3Q0FA

Crystal structure of suvh5 sra- methylated chh dna complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
163
structure length
146
Chain Sequence
b'QIIGTVPGVEVGDEFQYRMELNLLGIHRPSQSGIDYMKDDGGELVATSIVSSGGYNDVLDNSDVLIYTGQGGNEPPKDQQLVTGNLALKNSINKKNPVRVIRGIKKNYVYDGLYLVEEYWEETGSHGKLVFKFKLRRIPGQPELPW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
publication title A dual flip-out mechanism for 5mC recognition by the Arabidopsis SUVH5 SRA domain and its impact on DNA methylation and H3K9 dimethylation in vivo.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase/dna
total genus 37
structure length 146
sequence length 163
chains with identical sequence X
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02182 SAD_SRA SAD/SRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.280.30 Mainly Beta Roll PUA domain-like PUA domain-like 3q0fA00
4YGIA 3Q0CA 3Q0BX 3Q0DA 3Q0FA
chains in the Genus database with same CATH superfamily
4PW6A 3Q0CA 4R28A 4RZLA 3OLNA 3Q0BX 2PB7A 2ZKFA 2ZO1B 3DWHA 3Q0DA 4F0QA 3F8JB 2ZKDA 3Q0FA 2ZKEA 2ZO0B 3F8IA 4PW7A 4F0PA 3BI7A 3FDEA 2ZKGA 3CLZA 4YGIA 2ZO2B 4PW5A 4NJ5A 4OC8A
chains in the Genus database with same CATH topology
4RZLA 4YGIA 3Q0BX 3Q0CA 4F0PA 3Q0DA 4F0QA 3Q0FA 4OC8A 4R28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGI A;  3Q0C A;  3Q0B X;  3Q0D A;  3Q0F A; 
#chains in the Genus database with same CATH topology
 4PW6 A;  3Q0C A;  4R28 A;  4RZL A;  3OLN A;  3Q0B X;  2PB7 A;  2ZKF A;  2ZO1 B;  3DWH A;  3Q0D A;  4F0Q A;  3F8J B;  2ZKD A;  3Q0F A;  2ZKE A;  2ZO0 B;  3F8I A;  4PW7 A;  4F0P A;  3BI7 A;  3FDE A;  2ZKG A;  3CLZ A;  4YGI A;  2ZO2 B;  4PW5 A;  4NJ5 A;  4OC8 A; 
#chains in the Genus database with same CATH homology
 4RZL A;  4YGI A;  3Q0B X;  3Q0C A;  4F0P A;  3Q0D A;  4F0Q A;  3Q0F A;  4OC8 A;  4R28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...