3Q10A

Pantoate-beta-alanine ligase from yersinia pestis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
285
structure length
285
Chain Sequence
AMLIIETLPLLRQQIRRWRQEGKRIALVPTMGNLHEGHMTLVDEAKTRADVVVVTIFVNPLQFERPDDLAHYPRTLQEDCEKLTRHGADLVFAPAAADIYPAGLEKQTYVDVPALSTILEGASRPGHFRGVSTIVSKLFNLIQPDVACFGEKDYQQLALIRKMVADMGYDINIVGVPTVRAKDGLALSSRNGYLTEEERQIAPQLSKIMWALAEKMALGERQIDALLEEAAAQLLRVGFTPDELFIRDAETLQPLTVDSQQAVILMAAWLGKARLIDNQLVDLRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantoate--beta-alanine ligase
publication title Pantoate-beta-alanine ligase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 97
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3q10A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3q10A01
1EXDA 4MLPA 5IJXA 1TYBE 1T6XA 1YI8A 5AHWA 1JMVA 1I6MA 1N2IA 4ARCA 1U7DA 1QTQA 1N2BA 1PG2A 2X1MA 1LW7A 2EL7A 1O94C 5DK4A 4YP7A 2JANA 2QTRA 1K4MA 1N2EA 3A4IA 4R2MA 3VU8A 5HUHA 1TEZA 2IELA 4DLPA 1ULHA 2AG6A 2J08A 3A04A 5KCMA 5DEOA 1J70A 1T6YA 4MUIA 3NBKA 3QE4A 2QUHA 4MWDA 3COWA 4U7JA 1Y42X 1PFUA 2A1TS 1OWPA 3UMVA 3Q12A 5HG0A 3CLRD 3A05A 2BYTA 4HPWA 1KQOA 2AKEA 2Z08A 1K92A 1HYBA 4XFJA 1IVSA 4PBRA 3I05A 4HJXA 5TS2A 2PIDA 4FZJA 1CT9A 4BWVA 2DPLA 2CV0A 2E21A 1MBZA 3IOBA 3ELBA 3RHSA 1IQRA 5J5AA 4EG6A 3FETA 3MLBA 4CQNA 4XSVA 2CYAA 3CVVA 4EGAA 2QTMA 2E89A 1KH3A 3FG9A 4JXXA 1N2GA 4I6EA 1WOYA 3E27A 3X1MA 4MAFA 3RK0A 3TQOA 2J09A 3ZIUA 5KHAA 5BNZA 2PXHA 3LOQA 1ZJWA 1QRUA 4U63A 2I1LA 4NAUA 1KAQA 1MC1A 2XRYA 4EG3A 4PBSA 3GUZA 2J07A 4ZT5A 2ZP1A 1QU3A 3ZJUA 1OBHA 1K4KA 2CYBA 1H3FA 2A7XA 2E0IA 3PNYA 1KAMA 3HL4A 3AG6A 4I6JA 4MW5A 4MVCA 3OP1A 1TQ8A 1DNPA 4K0RA 4ND6A 2JAXA 1KH2A 1U0BB 1NYLA 4EF6A 1NZJA 2D54A 1NUUA 3F3MA 4NZPA 2C5SA 4XFDA 4KR6A 1N2HA 1H1TA 1H3EA 1OD6A 3CLSD 4UZEA 1S4MA 3SP1A 1GZUA 1KQPA 2CV2A 1EUQA 3FNRA 1QQTA 4DDHA 3DLAA 3JXEA 1R6TA 1KKUA 1B6TA 1U3DA 4MUEA 1ZH6A 1JZSA 3C8ZA 1O97C 3HZRA 1FFYA 1M8JA 1MJHA 4MUJA 2IP1A 3RJZA 1YUMA 1WY5A 2QJOA 4GU5A 1H3NA 3N05A 3ND6A 4AS1A 1ILEA 4RUKA 5DB4A 1ZH0A 1WZ2A 1G8GA 3DO8A 1OWLA 3AG5A 1O96A 1JEEA 1PG0A 1T9GR 3AL0C 3AKZA 1XNJA 1I6KA 1TYDE 1M83A 4EG4A 3N2YA 1JGTA 3FHJA 1F7VA 3UC5A 4DJAA 4J75A 3FWKA 1NSYA 3CR8A 4A91A 2PZ8A 1WXHA 3LCJA 1F7UA 5FO1A 3DPIA 2QUJA 1X6VA 1VL2A 3L92A 3MUEA 1KR2A 2O8VA 4JXZA 1O95D 3H9BA 1LI5A 1M8GA 4ZT6A 2ZUEA 1G59A 2A88A 5LFAA 3LE8A 3P0JA 1GTSA 4OJMX 2O5RA 3AIIA 1YULA 2QUIA 3IOEA 1T9GS 3U1VA 3D6VA 4ND7A 3RFFA 3X1JA 1O94D 4MUHA 1M8FA 2IJGX 4ZT7A 1WXEA 4MW7A 3H05A 2HMAA 3IH5A 2WB2A 3ZUGA 2A84A 2YWCA 1MRZA 1M1ZA 3N9IA 1WQ4A 1GTRA 1JZQA 4MVYA 3KFLA 4OUDA 4PY2A 4Q16A 2H2AA 1GLNA 3IVXA 5KWVA 3OTWA 1O96B 1OWNA 3UY4A 2DETA 4CDMA 3A2KA 1IH8A 5K0TA 2WQ7A 4DNXA 3ZXSA 3CLTC 1N2JA 1V47A 3AFHA 4L2IA 2B7LA 5DASA 3QTBA 1O0CA 3L93A 2RE8A 4RPIA 4EG8A 3ZXIA 4QBTA 3X1KA 5TEWA 3ND7A 1QU2A 4MW6A 4P2BA 4QREA 5FNZA 2VTBA 3ZGZA 3FOCA 1EFVA 1QRSA 4E1AA 3FY4A 1U7XA 2HGZA 1MAUA 4TS1A 2GM3A 4ARIA 1EJ2A 4YMIA 4ZCQA 3PXUA 2JA2A 1WXFA 4MVWA 3IMEA 3TQIA 3IODA 4MUKA 1JIIA 4G5YA 1IQUA 3P0IA 3ZJTA 2NZ2A 3CA8A 4NAHA 4KR9A 3ISJA 1JEDA 1P7PA 1IRXA 3NBAA 4MW9A 3DV2A 1N75A 5K0SA 1O0BA 2X1LA 2DLCX 1PFWA 1UFVA 1WXGA 4JZYA 4GRIA 5J59A 3P0HA 3KT8A 4KKVA 1PFVA 2OQ2A 1OBCA 1A8HA 4KPUA 2HZ7A 4OUDB 5LM3A 1BS2A 1IFXA 4MWCA 2CT8A 3TZEA 3TZLA 2A4MA 4MVXA 1WKBA 4JFAA 1NP7A 3PNBA 5TEVA 5IHXA 1JIJA 1KP3A 4PBTA 4L2IB 3COZA 2DEUA 1NUPA 4ZCTA 3CVXA 4X0EA 4ZCPA 4HK4A 4KR7A 3G6KA 2CFOA 1G8FA 3P52A 3KT3A 2PG3A 5FO0A 5JBNA 1EFVB 3CVUA 1OWMA 3GLVA 3MMXA 1MAWA 4K03A 1O97D 4EG5A 1J1ZA 1KORA 3COVA 2CYCA 1LI7A 1IHOA 2TS1A 5H16A 2EJCA 4DDKA 3KT0A 1VBMA 3H9CA 3RK1A 2CV1A 4MW1A 1F9AA 2D13A 5F23A 1COZA 1M8KA 4NDAA 3Q4GA 1N3LA 4NATA 1FYDA 5J58A 1N77A 2PZBA 3TS1A 5EKDA 2DXIA 4F3RA 2PZAA 1MB2A 2J4DA 1PFYA 4KPUB 3IUEA 1IQ0A 1GPMA 1T6ZA 1WJGA 2WSIA 4S1OA 3NV7A 3COYA 1N2OA 1VLHA 4HJRA 2OV4A 2V0GA 1NURA 3FI0A 1N78A 4MW2A 1WQ3A 2A1UA 3PRHA 3ILVA 2XRZA 2Z09A 1J21A 1J1UA 1ZUNA 3ND5A 4UZFA 4YBRA 3HGMA 1K97A 1D2RA 3FIUA 4CDNA 4CT0A 2VXOA 5LLTA 2V0CA 1I2DA 1Q77A 2QJFA 4R0NA 3TNJA 1X8XA 4ZT4A 3MLAA 3CLRC 2J5BA 3KT6A 1JHDA 3IVCA 2WQ6A 1QJCA 2PFSA 2R5WA 1V8FA 3CLTD 3INNA 1QNFA 4ZCSA 4NX2A 4ZT2A 1G8HA 1KH1A 3PNVA 1F4LA 1XNGA 5H7XA 2GOYA 5TGTA 3IVGA 3SDBA 3MXTA 3G59A 1Q19A 3H99A 1NI5A 1I6LA 3K32A 3FDXA 4DDMA 1Q15A 4YP6A 1J09A 1MOPA 1MB9A 3D6UA 1QRTA 2A1UB 2X0KA 1GN8A 2CUZA 2BTEA 2A86A 3CLUC 3N8HA 3IUBA 3IOCA 1YUNA 3H97A 1KP2A 1R6UA 1NUSA 2YXNA 2AZXA 4YP5A 2G36A 3S3TA 1KQNA 1U3CA 2X3FA 1O5TA 2QTNA 3CLUD 4ZCRA 3SZGA 4G5FA 2YWBA 3HFJA 1EUYA 4EG7A 2RD2A 3IMGA 3ZJVA 4WNYA 1SURA 1XJQA 3K9WA 2H29A 4I6GA 3UOWA 1EFPA 4MUNA 1EE1A 1WXIA 3BL5A 3RBAA 3SEQA 1NUQA 3CLSC 3UK2A 4J76A 3GMIA 2QUKA 3G5AA 1TFUA 3VRHA 2VTBB 4DE5A 4EFKA 4MULA 1VBNA 3VGJA 1YIAA 4JYZA 1RQGA 1VBKA 4F4HA 3IDFA 2Z3VA 4MW4A 1JILA 1GAXA 1M8PA 4EG1A 4MQ6A 1N1DA 3HV0A 1R6XA 2GKSA 3FH0A 2DERA 4AQ7A 4WSOA 2ZUFA 3Q10A 2QJTA 4MWBA 4ZT3A 1TYAE 3CVWA 3SZ3A 1TYCA 1OWOA 1XNHA 2DUMA 4G6ZA 1J20A 3M5WA 1JIKA 3SYTA 4MWEA 1NUTA 2DR2A 3QTTA 2CSXA 4R2LA 2D5BA 4QRDA 3HMQA 3SEZA 2NSYA 4Q93A 4MW0A 2YY5A 4MUFA 4H3SA 1Q11A 1O95C 5HUJA 1EFPB 1O6BA 2E18A 2A1TR 3CVYA 1YIDA 4MUGA 1JECA 4U8HA 3IMCA
chains in the Genus database with same CATH superfamily
4C4AA 4FGKA 2FUCA 2CJXA 4HQLA 2WMOB 2WRZA 1NLMA 3G2KA 4I9GA 1I0LA 4LMAA 2QM3A 1U7DA 2W6MA 1CUXA 4CETA 1GDHA 2C7OA 4LV5B 1KYYA 4YUWA 5AVVA 4EY3A 5AVOA 1JFSA 3MT7A 1D6JA 4C2AA 5C8VA 2BKEA 3FWNA 2FZEA 2BBTA 4AW9A 5CCEA 4X65B 2VK1A 5ALXA 2CUTA 1E1KA 1IG0A 4CYMA 2HRCA 3GJ7A 1C0PA 5IK2A 2GGSA 4BO5A 1Y0BA 3G0OA 1QCDA 1LWOA 1TUEA 4LECA 4POOA 4F46A 1QQ6A 5HJ7A 4W5OA 2WK1A 1A8SA 3KDPA 3DULA 2SICE 4KFTA 2IOFA 4MQFA 1PFUA 3CO5A 5UKDA 1ZRMA 3O31A 1YR9A 3VR5A 2PKQP 2V45A 4X1YB 4ZMSA 3H0EA 4J0JA 4OHRA 4RVCA 4EKNB 3UGQA 1UFRA 2MTBA 1A9QA 1T2UA 2Z9BA 5CIWA 1F0NA 3Q3JB 1COWD 1JQBA 4MRSA 3KQOA 1GPWB 2FP4A 1RI5A 4CI9A 2ES4A 3P96A 2D8AA 2PLAA 4PS0A 4I9UA 1KJQA 3GELA 1VKRA 3OEHA 3TQQA 2EKBA 4RBNA 4CUZA 4KCGA 2ZTUA 3CI0K 2ASVA 2B3TA 3H2JA 3QX8A 5I01A 4W5QA 4J3JA 5A5GA 4W1SA 1YRBA 5B1EA 2RHOA 3O91A 4JC0A 3V97A 1Z22A 4LPKA 3RK0A 5JJ5A 1PVVA 1JWAB 1OV6A 5KHAA 4YCAA 3AWDA 4ER0A 3BWXA 4IDCA 2W2QA 1QKJA 1OHHA 2C9CA 3HB7A 4IWNA 2DB3A 3CNQS 2XRYA 3M6IA 5IC6A 4IJVA 1RFLA 1C30A 2AI2A 5EKXA 3LXUX 1ISFA 3IAEA 1SBNE 1SUFA 2PEZA 2GAFA 3C7TA 3LTNC 4MS1B 1H3FA 2DG2A 2F62A 1WF3A 4C9BA 1R0SA 1GGFA 2H5JA 2QAGB 4TTPA 3N5CA 1O89A 1ZM2A 3I5UA 3AYZB 3NHBA 3UCFA 1BKDR 4ZAFA 4HNHA 5BN1A 2H1VA 3MJHA 4YLEA 1RYMA 3L1JA 3ZOKA 3CE9A 3BILA 3IEUA 4M1YA 2HYDA 3HCDA 4EGSA 1WKVA 1VFNA 2EFGA 3JWIA 1H5UA 3WRXA 1D09A 2CFSA 1SXJE 5REQA 3IV7A 3KKOA 4KR6A 3O93A 1W7AA 1O5IA 3ANSA 1RHJA 1B0PA 3A9CA 4L0QA 5SZIA 3WK6A 3FGPA 4EO4A 3ORQA 1U8AA 2OCDA 3GFVA 3IHLA 4YQYA 3MXOA 3IDZA 3O5AA 3SP1A 2IXBA 3T5BA 2HXGA 4ONEA 5HIIA 2LDBA 3QU4A 5K0BA 3U7HB 1FU8A 1NKTA 1Y8QB 3DF7A 1N0IA 4ALKA 2NXJA 3A1DA 2NYAA 4IJKA 4A0QA 2P77A 3MF4A 5IJ9B 2IIQA 1E0DA 2H57A 4R8VA 4R9SA 3WICA 3WJAA 4XVUA 3FYDA 4ENRA 1XG5A 1XLUA 1WABA 1V48A 1LJ8A 3AESA 1ODKA 3EIEA 3EH1A 2EERA 1FPQA 3CR7A 1R6AA 3FXAA 4TL8A 5IM4F 1K5HA 1NHGA 4GKBA 4D6XA 2VJQA 5IS2A 1Q74A 3DV0B 3TSAA 4BB0A 2R44A 3G8DA 4PWYA 3VC2A 4EUEA 1WZ2A 4P5PA 3R3XA 5EUMA 1ZBDA 1XNQB 4ZREA 3HJAA 1WETA 3E22A 1YA8A 3W5AA 2I91A 1ACJA 2RG1A 3HC7A 2IS6A 3BSFA 4P0PB 4U1RA 4G84A 3PCRB 2Q0XA 3KPWA 1RWBA 2ZRMA 1YH3A 2XQGA 4EG4A 1J2EA 2E7ZA 1WZNA 4ZVKA 2HCJB 2AN9A 2OFXA 1I33A 3LBFA 2NXNA 2V6GA 4I8IA 2W4QA 4DC0A 3TIVA 1QYIA 2I3AA 5JY6A 3R6WA 1TA0A 4PVDA 4Y6OA 2CUKA 4YMUA 1JYFA 4YDHB 1F7UA 2GTIA 3N2EA 4UATA 4U2BA 2ZCVA 1CUIA 1NVEA 1VL2A 3FBWA 5EY5B 2MMCA 1H65A 1TPZA 3DCNA 3FFXA 4PC3A 4QTUB 3ZLTA 2HHHB 4J1NA 4Q9DA 4IBOA 2FYTA 1GQ2A 4XWTA 5F5XA 1ZEMA 2YMQA 2H48A 4HS4A 4K3VA 4M4SA 3ZBQA 1KVUA 5T57A 3U61B 1L3CA 4QPCA 5TPWA 3FM9A 1EM6A 1THTA 1TKBA 5LA6A 1W96A 3ZGOA 2ET6A 1Y3CE 4MV7A 1BCRB 1JLLA 1JLKA 4ZV7A 5BSTA 3LC2O 1MHTA 2ZJ8A 2JLZA 4LKOA 5LYJB 2ORIA 1D8TA 3DUWA 4ZT7A 5IYZB 1XDBA 3EH2A 3NPAA 4EYOA 4G1UC 4OYYA 4WH0A 3W34A 4W5NA 3SLKA 4M9CA 1I4LD 2CEKA 3KAPA 4PSDA 3VJLA 2ST1A 4P58A 4Q00A 5HBGA 4BEBA 4AKIA 4XD7A 1U04A 3N9IA 3P9ZA 2W6JA 4ZHQB 2CFRA 1THGA 2B34A 2Y6UA 1QPBA 4MVJG 2FFBA 1RQ7A 1M6NA 2WWHA 3KFLA 4TTRA 3DMPA 3ZG6A 4CNBA 4E13A 3OD5A 5KJ1A 1K2VN 2XB6A 1O96B 4D3XA 1JFFB 1R8XA 2IY9A 2VAPA 4OA8A 5JQGF 5KDOA 3HI6A 3IKLA 1HEUA 1DKRA 5EPEA 4CODB 4N0DA 4IO0A 4R51A 3PNLA 1N2JA 4DWJA 3C74A 3NMUF 4YTEA 2B7LA 2OYRA 4AMVA 1ID8A 3HKEB 3TXXA 4ZVPA 3SS9X 1H6AA 5EJMA 4IIJA 4B4KA 2HSEA 3BTOA 5DNYB 4Q1BA 4WFJA 2FPMA 1ATZA 3RRJA 1UOOA 1YI1A 1YU9A 3ETDA 4BNIA 2EDAA 2PU7A 4AZTA 2HO5A 3L05A 3V1NA 1QRSA 1S2LA 2I55A 1E1MA 3ENVA 2DQSA 3K0AA 3FAKA 1CZNA 3AQIA 4F04A 2YZGA 4AN1A 3O8QB 1PWXA 1Z4KA 1NR5A 5U4QA 4J7XA 4R4JA 4RZ3A 1UIMA 1JAYA 3JQQA 4DLYA 3KLOA 1G1MA 3IMEA 2IZ1A 3JQPA 5FH9A 3HFSA 4Y2PA 5D5PA 3ZWXA 5JPDA 2VCHA 2YUIA 5EP2A 1RQPA 3GJ6A 2Z1DA 3E5MA 3CG0A 3STTA 3WDSA 4ABYA 1B41A 4EHJA 1U3UA 5A5FA 3ER6A 3OUTA 4NBWA 4F3NA 4HG2A 5A1TA 2VZEA 1RWQA 5D8DA 2OHIA 3M3PA 1GA4A 3HR7A 3AB8A 4BV3A 5M2QA 4RTQA 2XZDA 2AG5A 2VUTA 3H87A 2VSXA 4RY8A 3R7AA 1HZZA 3P4UA 2HQOA 1JQAA 3UHJA 5A5DA 5KTPA 1B1AA 3HUUA 4UUBA 3U4QB 4TLDA 3RS7A 1DC5A 4J03A 1UC4B 3KFVA 2O1XA 3WLRA 4DYDA 2DYKA 2NU6B 2X7XA 3KQYA 1LC0A 2VDMB 3U0VA 5IN4A 2G80A 1EDDA 4OUDB 4YBZA 1BS2A 2H7YA 1A77A 3IR7A 1JDNA 2NO6A 3OOSA 3BM5A 2ZQ5A 4QTZA 5KZMB 3ECCA 3HN7A 3A4YA 3M70A 4PNEA 4YUYA 5LD2B 2I99A 3KJHA 3K9FC 1IY2A 5DGTA 3DZGA 5EE1A 3A9SA 3NJ8A 4DAOA 4FZ3A 1D8AA 2AOTA 2RDMA 1CR2A 3QSGA 4ANFA 2JNWA 4KK3A 4G23A 2GHIA 3OE1A 1DAGA 4OHBA 3Q3VA 3WDLA 2WM9B 1S8FA 3KYBA 1Z3IX 2EFEB 3A9RA 3E9EA 1YZUA 1XCOA 3TDMA 4EUFA 1QMGA 1L7DA 1CJCA 2CW5A 3L77A 4UHJA 2PGOA 1SC9A 2V7PA 4Y30A 4GRAA 3R7DA 4L51A 4TUYF 3QKRA 1TVKB 3AONB 1ORIA 2YWXA 1RTTA 5ALJA 1AZWA 5CXUA 3TFOA 4LXYA 3SM3A 1N2CA 4PXYA 3DZKA 4CKCA 1UKBA 3VKGA 3EQZA 3QUSA 3KAKA 2XE4A 2PO5A 2GAIA 2VUIB 3Q7RA 1ST2A 1UANA 4GE3A 1CY2A 4U6NA 4QVGA 5HFAA 3RHTA 3TX6A 4DDKA 1WO8A 2WJGA 3B7GA 2I4IA 4FVTA 5DRYA 4CFZA 2BEJA 5G4KA 2VWHA 3TLGB 1ISHA 4D57A 3D43A 1N3LA 3QSYA 3F67A 3K6SB 1IWPB 1S1CA 1TEXA 3PDHA 4HXYA 3PSHA 1JEYB 5DNVA 5I9TA 5KWSA 1UM8A 3CJQA 3LBHA 5AVJA 1KK1A 2VYCA 1G291 2C54A 2ZYUX 3I04A 1PFYA 2GN0A 4FWBA 3V1YA 2I2CA 2I3DA 1BD3A 4A8JA 3V34A 3IUEA 1IQ0A 5JOQA 5INTA 2CK3D 2CMKA 2H8KA 3BIWA 2OY0A 4AP6A 5JLJA 2B9VA 5K3OA 3LUDA 1QF7A 4U39A 4O4JB 4GIBA 1NRIA 4E0BA 1Z6GA 4Z54A 3NV7A 3HRIA 2EJUA 4DF3A 1SPXA 3P4YA 2WFAA 5C7IO 3ZQUA 3L9XA 3EVEA 1VE6A 4RKRA 2D5CA 3C15C 3EVDA 3KZKA 4NOLA 4ID9A 4O4IA 3MCTA 4G2NA 5CCXA 3R7SA 4CG1A 1NF9A 3GVCA 5KOJB 3IJ5A 4CEIB 4QGBA 1Q0ZA 2WJ6A 1FFHA 3PZRA 5FBZA 2M1ZA 4F4UA 3KEOA 4NENB 4DWVA 3E7WA 1B4DA 1T2VA 3JW8A 5IKPA 4OJKA 3UAGA 1E8NA 4RVUA 1G60A 1JHZA 3DOJA 3MTIA 5EMKA 4Z1MD 4BEJA 4F97A 5LKRA 3NU1A 1WW3A 2P5UA 3RTAA 4D81A 2X0RA 3JD1A 1OYOA 4IDAA 5LN1A 2C04A 5DKFA 1R4NB 2R8PA 3E23A 5KSWB 2PXXA 5EUCA 4KWHA 3AIKA 3LIIA 2HIAA 3MG9A 4FOSA 1Q95A 4FI3F 5HM8A 2FPKA 2W2LA 2DU8A 1XTVA 3HUTA 3RYTC 4F9FA 4LI3X 4B6SA 4DA8A 2FPSA 5JWOA 1KARA 1XX6A 2WHQA 4M9XA 4MI1A 2FMTA 2HR1A 3SYRA 1HGXA 1IN6A 4JBHA 1V1MB 3DPSA 1WTCA 3OCVA 3ZV5A 3DB1A 4MVJD 4MAAA 1XFDA 2JLQA 4WNAB 2JBHA 4JB3A 5ALEA 3ZV4A 5FOUA 2Y2UA 1EA7A 3LH5A 3FTNA 3DUFA 4E4RA 1WAMA 3HCEA 3QV1A 1KJNA 2J6CA 1W2GA 3D81A 2OENG 4L73A 3DE2X 5E0OA 4R6XA 2CN1A 3NKLA 5F76A 1M66A 5BWCA 1L7OA 2ZZKA 3T3EA 4MQUA 3RFUA 3LX8A 4YJDA 3PR2B 3IEIA 1CBUA 4PFJA 4UAGA 3UFXA 3ZCVA 1BWPA 3L41A 1R6UA 3LXMA 1JG3A 2BFEA 3PI7A 3IKJA 4MIYA 3N76A 3PXEA 1OLXA 1NR7A 1V3VA 1ZI9A 5AXAA 4AYTA 3K0SA 2GF9A 1FRVA 1U3CA 4GQBA 1ZI8A 1VCOA 1LKZA 4GBJA 3ETNA 1X77A 3PPYA 4PXAA 1OFVA 4XGQA 4PXSA 5LC1A 2ZPAA 5TIIA 3UAYA 1XT6A 3MOGA 2ID9A 2ZTLA 5HILA 1XO1A 3FHOA 1R8SA 3OT1A 4PHHA 2UVDA 3W6UA 3ZJYA 2FWNA 3M9LA 4BMYA 3U09A 3C6BA 2C4NA 1J25A 1FFBA 3PLRA 3WGQA 4Z9YA 1B6RA 5L4NA 2EBUA 1EVYA 1PTJC 2GSWA 2ECFA 3AR8A 3PXDA 5DDIP 3G5AA 3L4KA 1T3SA 3ZJ4A 1Z33A 3IEVA 4KO2S 5YASA 3U6BA 2G2SA 2A59A 3K8YA 4FK8A 4LZOA 5B36A 3PA8A 3ZQJA 4ICIA 4DRXB 3FRHA 3ZZTA 3CM0A 1HDRA 3TO5A 2DECA 1QWOA 4HZIA 1EQ2A 4HAUA 1JJVA 2GS9A 2YVQA 3K09A 4L28A 4F4HA 4FKZA 2BUAA 4LYGA 4QNNA 5CB4B 4RULA 1EFDN 1LSSA 1QPGA 1TVMA 2C7BA 2DFDA 2Z3VA 3GRPA 2IEIA 1FQKA 2A2ZA 2C84A 4TQAA 1HEIA 3TMKA 3ELYA 4IFTA 2CB9A 4KYVA 1J2UA 4L5YA 5DRTA 1UBUS 1VC2A 5D3MA 3HR4A 4BMSA 1NBEA 1P4JA 2ONKA 5DTRA 4DLTA 4W63A 1D04A 1U5AA 1RQXA 5KNBD 3AF4A 1FMCA 1R15A 2LCIA 3UJAA 4NBLA 1RAGA 4MHTA 5LIRA 4UUMA 1TO2E 1Y7LA 3IA7A 4I5EA 4GFDA 2Z8XA 4OGFA 5ARCA 4NMHA 3WAGA 3WJ7A 2ON6A 1RWXA 1Z73A 1CUWA 2QRZA 1VPWA 2XBMA 3AIOA 2D5BA 2OP1A 2QYSA 1LEHA 1MX5A 1FX1A 3PEUA 1PNQA 1K8YB 3QX9A 3AVWA 3AFNA 1NL3A 4GPD1 1P4HA 1NBMA 4HC4A 1MD9A 4HYTA 5H68A 4DGSA 3L04A 2Q5FA 3A3NA 2R1TA 2E4ZA 1C3VA 1H1LB 3HEAA 5AOBA 1VDMA 1EFPB 5EEHA 3QBJA 4G85A 1W0JD 3T3PB 4DG9A 4QA9A 5CVJA 1X3LA 1WU8A 2XGMA 1J0DA 5EZ6B 4D43A 5F1KA 3SYNA 4MV9A 1MX9A 3ROKA 4HWTA 1A76A 1OB2A 2P90A 2I2DA 2ROQA 1EG7A 4QFDA 1L5ZA 3HLYA 3SYMA 1PX0A 2W0MA 4H7HA 2WF6A 3I28A 3BJMA 3RIHA 3B6KA 2EJVA 3OU2A 3WJ2A 3L6RA 2VN8A 4XR9A 3I9JA 2ZJFA 1ZN2A 1K4MA 2YFQA 3CNEA 4H18A 1G2IA 3TRDA 4ALNA 2J9FB 1TCAA 1IN4A 4G5XA 4BZZA 3G0BA 4O2BF 3TFQA 2DRIA 1ISRA 2O2XA 5CK4A 5BVGB 3ROMA 4MKIA 3NC1C 4OOFA 2H3HA 5JSKA 4HQ0A 5MGBA 3GY0A 1IY0A 1X1SA 1Z47A 3C3EA 3A4TA 2Q4TA 1DAPA 3MJFA 3AM5A 4NFYA 1T8WA 4IOLA 2IUFA 3Q12A 1YJ5A 4JU8A 4XI9A 2ERCA 3VZPA 1XMXA 2IZ7A 1W1WA 1EFAA 4QQNA 5TB5A 4YJ2A 1KI7A 3ZH2A 4DM3A 5C8YF 2C61A 5B2ZA 3PUIA 4YMTA 4Y7CA 3ETLA 4ZJZA 4B3DA 4WVLA 5I9NA 4AKGA 3AEQB 2C2HA 1W30A 3VZCA 1IUPA 2BKVA 4V1CB 4EA7A 2BWJA 2RHBA 3SQDA 2XE6A 3IOMA 3SC2B 2WPDD 1SQSA 3C3WA 4JBGA 1HE8B 4B32A 4CE6A 4D8UA 2ZAOA 4EFDA 2AN1A 3TWOA 5IZCC 3V4PB 1XUOA 1IBCA 1BIFA 1ODCA 1KH3A 3VAZA 1XVIA 1HE4A 1G4HA 4P7FA 3GD7A 3WKAA 3X1MA 4I2VA 4IMRA 4CG2A 5EIHA 5KOHB 1BVRA 3JZAA 4RF3A 2PFGA 2D1YA 4C88A 2O8EB 1KU0A 4HHEA 1DC4A 2R48A 1QRUA 4J07A 3ZCXA 3H42B 2CSUA 3MGGA 3PB3A 3HU1A 1Z6QA 1N0HA 3H2ZA 1DBIA 1T9DA 2HDOA 3DBRB 4HB4A 1YQTA 1ZGAA 2IYPA 2EX1A 2KM1A 4B80A 3BAZA 1MJ5A 4IHJB 2WKSA 3SVLA 3LLVA 4GKAA 3NC0C 2X1HA 2B5WA 3WLFA 1KFKB 4O25A 5C0OE 1U6IA 2A7XA 2H1OA 5ALGA 5DX0A 3WLAA 1BOOA 3GCDA 2OO3A 2VSFA 4MW5A 3EOZA 4B3BA 1Z5PA 4QDJA 4ZDJA 3FCUB 4MRMB 1AO3A 2A0FA 2E48A 2YNMA 1CDDA 1L4HA 1KH2A 2AFHA 2HMWA 2YOGA 4HWKA 4S1NA 4TMKA 3DOOA 1R50A 3D3KA 4L3OA 2QN7A 5KKCA 1XP8A 5CLIA 3F1KA 5FNVB 4CWAA 1H3EA 1ESEA 1GT91 3AH8A 1L5KA 3QVGB 1RKBA 2B8JA 4JX9A 4N54A 1K4YA 1UT8A 4Z7JA 2OFFA 2HA3A 4EHHA 2J3IA 2PKQO 2R7AA 1DBWA 2RBEA 1IG3A 1NVGA 1U8YA 3KL4A 4OXIA 9LDBA 4MUEA 1ZH6A 5AKEA 5FYDA 3IJRA 2VT6A 3KAJA 1NQVA 3EXHB 2XUIA 3D31A 3Q88A 3AUSA 4JB0A 4CEJB 1MT3A 1Q44A 2CD7A 2I7TA 3PC7A 2VF8A 2MDTA 5CH8A 4GL2A 4N0PA 5DZSA 2WJYA 4RF4A 3RJZA 3S7ZA 3Q6MA 5ALOA 4CQJA 3TECE 1SBTA 2XMZA 1SD1A 2J3EA 2LDXA 3M3HA 3P2EA 4Q9LA 1QOZA 5JAQA 2D1RA 2ZJ6A 3DMHA 5AW1A 1SULA 3RO7A 3FVRA 3FIJA 1JJFA 1QO7A 4BOYA 1WEHA 2XRFA 3IYLW 4GI2A 4TV9A 1G64A 3N59A 4S0XA 2BP7A 2QTVA 2Y1CA 1TPYA 2EJWA 4KFUA 1SK9A 2EZUA 3UC5A 3AW9A 4DBVO 3PGA1 1FMJA 2ZTVA 4J75A 4MKFA 4F1KA 1I3NA 2LKDA 3EZGA 5THQA 3IESA 3GFSA 4BMZA 5TLSA 1O08A 1TTQB 3HUEA 3BOSA 3G2MA 2WD7A 3FZNA 2ZRQA 3K5PA 3TD9A 1G20E 2G5PA 4FZRA 4YC7A 1DAEA 2R4QA 3PHJA 3PNPA 1Y4DE 1A9XB 2QL7A 3A28A 4IIEA 3AR4A 1IXKA 4WOKA 2OLKA 4KMRA 1N9ZA 3B1WA 3URMA 2A88A 4G0OA 1HY3A 3DBHB 4BIIA 4IZ6A 4IX1A 3LA6A 1DCMA 2XGGA 1BN6A 3AIIA 4EKIA 4PYJA 1B8VA 2W70A 1AQ6A 4RANA 1T9GS 4V24A 1Z6AA 3B9BA 3NEJA 1T15A 3ELWA 5KX5A 1J9ZA 1NW3A 3QHAA 4RFVA 1DAHA 4UNQA 1VMIA 2A67A 3T1TA 2A5YB 4S12A 4Q4DA 2VQDA 4QYIB 5JH7B 4DR6B 4BPRA 2RI1A 1GAWA 2FEAA 3A32A 3TRJA 1Q16A 1KJ9A 1XLVA 1H8EA 1KZ1A 4KZPA 3G23A 4TS4A 4WKNA 5EHGA 2IS4A 2I65A 4BZXA 2O5EA 4Q12A 1VRVA 4BRUA 1WQ4A 1I9CA 2FQQA 2L19A 3DNPA 4ZZ2A 2Q1XA 4PQRA 3AVVA 4RADA 4YA6A 4E4TA 2AFIE 4ZI7F 1BXGA 3F6YA 5KJEA 4AL4A 3D7MA 5B1SA 3NJ4A 4M6WA 2HSJA 3QXHA 1YR3A 1IJFA 2W7TA 2QV0A 1RNLA 3QBVA 4HB3A 1YBAA 2HL6A 4OI4A 5JW6A 5JUWA 1BKSB 1UBLS 1FTYA 1I2BA 1MC8A 4B71A 4M0CA 3T54A 3VC3A 5DASA 3BQ9A 4C4RA 1NPTO 3HACA 4F11A 4Q7LA 3NT4A 1IUNA 2HFKA 3OI7A 4IDEA 1GLGA 4J0CA 3CIFA 4XDYA 3ZXIA 4QKQA 1H2HA 4R31A 4BLUA 3WGYA 4DB4A 4KH0A 1MVNA 4NV3A 2YRWA 5AUPB 5ILQA 4BV8A 3ZHVA 4Q21A 4QWWA 4JL6A 3BL6A 4Y6QA 2GHQA 3NBMA 5ALYA 4NK5A 3T3MB 4LX8A 3T1VA 3DHEA 3ESQA 3ABSB 5I7AA 4ETMA 1T8RA 3SQXA 3MILA 1CQZA 2B4RO 2EG5A 2Q3EA 5T67A 3SBOA 5CX4A 5LP1A 1D3AA 1THZA 1CV2A 2XQJA 3G8BA 3EZFA 3NO4A 3OY2A 5E7JA 1IQUA 5E4YA 1AB5A 1HYQA 4B9EA 1I94B 1HSOA 2P68A 3HP1A 5FI1B 1Y6QA 1X0VA 3L1HA 2QHXA 2VATA 2EBWA 1WXDA 5KDLA 5BR8B 2O4UX 1UDRA 1IZZA 4H1HA 4IR7A 4LXQA 2BDEA 1QFZA 1R7RA 4BX2A 2QL6A 1DLIA 4MQFB 1KDVA 5JTTA 1AGYA 4YXFA 4RTSA 3Q7TA 4RJLA 1RXWA 2H7XA 3AF3A 3GR6A 4JYBA 2W43A 4BKUA 4EJSB 5DYIA 3E6AA 1H2ZA 3GCXA 5A2GA 3AVPA 3BB1A 3BIOA 2BE7A 3AO0B 1N9KA 3PPXA 1SVSA 3A1UA 3H5LA 4RNCA 3R0IA 1T1IA 3L0IB 4HDKA 5P21A 3CSUA 3P9CA 2IYVA 4D8XA 5E7IA 3K9QO 2ZR0A 3EDMA 1GAEO 3HB5X 2CWDA 3A3YA 3IUYA 1RP7A 3GYBA 1U2EA 4HGYA 4NOKA 3DZJA 1RLIA 2WNHA 2QT0A 4OMUA 4Y2JA 3DKPA 2QRPA 1DAFA 3F7TA 4YAJA 5JANA 5LZ4A 4AY6A 1NVFA 4DFDA 4KR3A 1DJQA 1SXGA 1YVPA 3FSGA 1XDWA 2IHTA 2JA1A 3OJ0A 4DLLA 4ZCTA 1XRPA 4GEKA 5FPTA 2O1EA 5FUBA 4IUBS 1GG5A 1ZDMA 4BHRA 3BDVA 3JQGB 4ND3A 5HKLA 1JV2B 4HK4A 5DM1A 3RTCA 2CFOA 5I7UA 4MYTA 3LDUA 3GLFE 1DOAA 1IMJA 3PTLA 4FILA 2BELA 3CVUA 4C14A 5HW0A 5FEMA 2D7DA 3MHPA 2B1IA 2W37A 1RVV1 5EJ7A 1L4BA 3AEKB 1EB9A 2WVGA 1AMUA 2O06A 3H83A 3QF7A 4K9KA 3FR8A 3JWHA 4G4SP 1HLGA 1URPA 4A8PA 3COJA 1NMSA 4P7KA 5CB4A 4HPWA 2WMYA 2WFMA 2OBBA 2PZMA 1IU9A 3FPKA 4HDRB 2QG4A 2YTZA 2X19A 2PT7A 4PC7A 4S3MA 4HB2A 5C1OA 5A1JA 5LR6A 3ACDA 1HC7A 1KO1A 1NMZA 3EGEA 4K9SA 1T1SA 3OU6A 5F2KA 2CV1A 4MW1A 4BFXA 1NWCA 3CKYA 2CFCA 3NZEA 2J3DA 5MFPA 4EZIA 1EK0A 1Z7BA 1X9HA 1QH1A 2PZBA 3IOYA 4FYKA 5FPYA 4YR7A 5HKOA 1H2EA 1TYZA 2YYAA 2ZIXB 4DUZB 2DXIA 4I5GA 3K16A 2CZGA 3D0OA 3NHZA 2I4TA 3O73A 3VO2A 1BW9B 1VA4A 1H2YA 3RG2A 1V26A 4H3VA 1QX4A 5JU6A 3MTGA 4JSYA 1AA9A 4K87A 1FXUA 1NAHA 3E8MA 1BRTA 4S1OA 3GQBB 1T5HX 5AJHA 5T4EA 3S70A 5DXJA 1XZEA 4TM7A 4Z1OA 2QBYA 4MYUA 1VPVA 1YE5A 4PO3X 1I2ZA 2QRMA 3GJ0A 4QNRA 3HDQA 2DBYA 1A9TA 2OBLA 2Q1TA 1MU0A 1CR4A 4BIMA 1HQCA 3FI0A 4TMFA 2A0KA 4RKYA 1DZIA 5JO9A 3KB8A 3IAUA 4FT4A 2IXTA 2GM5A 3CMCO 1X0XA 2JG3A 1SIWA 1FLDA 2UZ0A 2KQUA 4IDHA 1FYXA 2DR0A 4B4UA 5H3HA 3RVSA 1KAGA 1V11B 5TRTA 3RANA 2QMOA 2J67A 3LP8A 1JR6A 1Z0KA 2HIGA 1I30A 4FNGA 1INLA 2CE2X 5JYCA 2Y1KA 2VLBA 2I2AA 3LCVB 3CPJB 1I2DA 1P6XA 1NI3A 1V7PC 3N0RA 4NESA 4MKZA 4MINA 2YR0A 1PSZA 2X6QA 1R9JA 1ES9A 4YRCA 3ZXUB 4ARSA 3H0KA 5K3BA 1ZGBA 2WP0A 3I8XA 3MLAA 4WKBA 4N5NA 3KT6A 4GZ5A 2O3JA 4QOIA 3HWWA 2QRHA 3QG5A 4EHKA 2WT9A 1QH8A 1RZVA 4RGBA 5AOVA 4JLSA 3WRYC 1B0UA 4P38A 4LJAA 1Q0HA 1EIWA 2LVBA 4INZA 4OJTA 4B0OA 3HA3A 5LWQA 4B46A 5JFTA 2XD4A 1UODA 3PNVA 2QG6A 4BFCA 2R7NA 3LPDA 2C5LA 3PU6A 4H6XA 3FDZA 5H9WA 3MW8A 3V2GA 2HWXA 1DQPA 2VF7A 4BDSA 5BMVB 2OAEA 2O2YA 3A9VA 3PX3A 1IPHA 4OREX 3K32A 3WGIA 3CLKA 3U16A 3DM9B 2ZM6B 3SLGA 1DJPA 2YV2A 1C8VB 3DFMA 1QV6A 2ZJ2A 3UO8B 4RTOA 2VHZA 2QD5A 3GLSA 3MNFA 3UEOA 3IPAA 4P1ZA 2ZUSA 4BP9A 3V33A 4DARA 2QR3A 5T4HA 1TK2A 1FTWA 4AJ4A 3SHWA 4Q0MA 3NWJA 1JFVA 2E3JA 3AUJB 3IQZA 2GA9A 3KSMA 2CLLB 2X5NA 5K4GA 4I5FA 3SM9A 5E1MA 1D2GA 2XUOA 1LPAB 2Q7OE 1P9RA 1X13A 3PUKA 5H0IA 3S3TA 2EEZA 2NZ8A 3U40A 1NJGA 2X3FA 3IR5A 4QRHA 4COKA 4K8OA 1F8XA 3U7QB 4WKGA 5BMOA 1BDHA 2ZS8A 1SVOA 2B0JA 3AEZA 4JSRA 5M29A 3K5WA 1LPNA 2PMKA 2JFGA 1EFCA 4G1CA 3WV4A 4MDYA 1Y1PA 1G8JA 1FYFA 4OQFA 4BKMA 1I9GA 4UM9D 3SICE 3BFPA 3GFGA 4UCXA 4MUXA 4NFHA 2BAGA 4MUNA 5ABPA 2D0OB 1WV0A 1W87A 1ZN7A 2HIHA 2R87A 1WCIA 1EK2A 4UASA 3SEQA 2EZTA 5EE5B 1S2IA 3GK3A 3IPYA 3QENA 2O2CA 5ESRA 3MFYA 3VU9B 4K0KB 3KJEA 3GVHA 1RXUA 2ZBGA 1YCHA 1J99A 1Z2AA 1GTJ1 2AZDA 2IHUA 2Z58A 1XTUA 3EMBA 3C8DA 2X0DA 1C2TA 4FYWA 4DCTA 3TRIA 1P31A 3IPCA 1TZCA 4DJTA 3I9V1 4IRUB 1EDZA 3UG6A 2DJIA 2HPHA 3H8WA 4YGXB 1QIMA 3EPRA 4C0HA 5MN6A 2Z3ZA 4D9HA 1E59A 1BFKA 1KBOA 4J7CA 1M8PA 4QHYA 3NASA 3TAHA 1F3LA 1KO8A 1VPEA 3KPUA 4OXYA 1R6XA 5EVCA 2OL4A 4QOFA 5AVZA 2GN9A 3VR4D 5J4KA 1YKSA 4XUEA 3W2IA 3MAJA 3OCCA 2ZUFA 1SVUA 3WB0A 4JBNA 3FYUB 4EY6A 3D8UA 3DAPA 2HT6A 3GLQA 4OQNA 1FSGA 3UUGA 2O2GA 3IFSA 3MQ2A 4HUTA 5DBIA 1N4DA 4KXYA 3FWYA 4XH9B 1MABA 4MV5A 4WJKB 1LX6A 3FGZA 4D45A 3VSDA 5DGCA 1J20A 4L5IA 2Z4TA 5LXTA 1JIKA 3L0OA 4Q7EA 3EBPA 1TZ2A 2HA4A 1NUTA 3FMPB 2G7ZA 1RAFA 2KLHA 3ANNA 4QPZA 3OO0A 1H2WA 4V3CA 5FR1A 3RKSA 1SOVA 1T5SA 3R75A 5DHQA 2EDCA 1LNQA 2Z5LA 1CDOA 2OEPA 4JDPA 4M21A 1COWA 4RWZA 4KLZA 4XWYA 4URVR 2F3TA 1KZHA 4KRXA 3WA7A 4FOPA 1L1RA 4NCJA 2AA3A 1HQDA 3H86A 4NJOA 1SU6A 5C81A 2IODA 1AKMA 1T5DX 3WYEA 1CQPA 5U1PA 4A82A 2Q9UA 3IS3A 2Q3MA 3PD7A 4WLEA 1ZQ1A 3SZMA 1N32B 4F7WA 1N2IA 1Z06A 1W581 2IPMA 1ZVVA 1P33A 4TXLA 2XWQA 3CLHA 5IYZF 3UWPA 1QTQA 1W4AA 4RVDA 1PG2A 1JKIA 1LW7A 5SY4A 1QVAA 1R6BX 4W5JA 2VEDA 4PNZA 4TV8A 1UMCA 3KPYA 1N2CB 3X1YA 5D85A 1GP2A 5FQOA 1XZKA 2OHGA 2OPHA 2CBXA 4C0JA 4QXPA 1G4AE 4CIWA 4M9ZA 3ABZA 4R9RA 4ZHQF 3RI3A 3RWMB 2J4FA 4S35A 3RVKA 2IS1A 1GV1A 4TSKA 5DEOA 5FOXA 3DD5A 1X14A 3ZHZA 3E2PA 2V7GA 2OBMA 1SXPA 4BB5A 4EF4A 1VKJA 2H07A 3BRWD 4YMGA 2ZBRA 3SIPA 2AN5A 5D3QA 2NSHA 4EY4A 1V95A 4B7XA 3C8HA 5KHLB 4XTRA 1YNSA 1ZA1A 4M60A 3A05A 4WJZA 1KU6A 4A36A 3TF5A 1E2BA 4GF5A 4YLGA 2AKEA 2C8KA 3DO5A 2PX0A 4RXTA 1L5LA 1U7TA 8OHMA 4A8JB 1ND5A 2D1TA 2WM8A 3M9XA 5TS2A 4UMEA 1CT9A 1U7UA 2I2BA 1TAGA 3BIXA 2FE1A 3E1KA 2CV0A 3UJBA 1B6SA 2E21A 2GZSA 3OVMA 4LNUB 1QYCA 3FNIA 4BS9A 5CFMA 4LRWA 3QPAA 2H54A 4LAFA 5HHTA 1PTJA 3QHPA 4U7TB 2O3SA 3M4ZA 1VCNA 2E87A 3CVVA 2GZ2A 3L7JA 3M5DA 4DIMA 3OFNA 4U6SA 1Y3AA 5CLQA 2PWBA 5J1TB 1N4AA 4EX6A 3ITKA 3Q5EA 1VFPA 1E64A 1QE0A 1U0JA 1U99A 2CUNA 4XWAA 1XEWY 5BSEA 4LF9B 2VJYA 4RXMA 1L1EA 4LGVA 4FC6A 1UC8A 3CPEA 1ZJWA 1UZNA 2C5FA 2CZCA 5CDTA 1QB7A 5AVUA 2EW8A 2JL1A 2PS9A 3GEEA 3DFFA 3OHSX 4YONB 3UWDA 2NZYA 4IGEA 1EWRA 1U1CA 1U3WA 4K2AA 4EX7A 3GUZA 3AF0A 2JF0A 1QCZA 4GP6A 4GYYA 1YRLA 4TKLA 4ZHSA 4RMHA 2XSZD 4OQZA 1SVNA 3RKUA 3QW4B 3AGQA 1I01A 1UM9A 3VGPA 1S96A 2I71A 1JMYA 2PGDA 5HIAA 5DWVA 3WDKA 1WCXA 5BYJA 1U6JA 2BMEA 5SICE 4AD8A 3T94A 4B3IA 5GGXA 2YMLA 2HJGA 3NTXA 4QPNA 4ZVQA 1A9ZA 3Q9NA 1TQ8A 3T95A 1T8PA 4J4BA 4AWBA 1EQAA 2X9GA 3G17A 5ADVA 3H84A 4KE6A 2DHRA 3LY7A 4HGNA 2GZDA 3H9JA 2RGBA 2G17A 3QX7A 1K7XB 2E2WA 2XMPA 3D8SA 4RACA 3AHFA 1I3CA 2YHBA 3VXKA 4DY6A 2D5IA 3TMYA 5EIXA 4EHDA 1UDWA 1CNMA 1U8CB 2ACWA 4C7MA 3ADBA 2IOQA 2DH5A 3DT9A 1MHPA 4LF7B 3H1EA 1OC2A 4QOGA 4D0RA 3R0VA 3BK7A 3EFOA 4REQA 2DPHA 4AK9A 1O03A 3LP6A 4UPDA 1OKKD 3C8ZA 2R66A 1L5MA 5I51A 5CNKA 1KMQA 3IAXA 1RWMA 3BICA 3KEGA 4HPJB 1YQQA 4G0XA 2PO7A 2IYEA 1M1YB 1XTZA 2NWQA 5LU8A 1JFLA 2QGZA 2QA5A 4XE5A 3WAJA 4MDFA 3D2AA 1JDUA 2QTFA 2JK1A 1QHYA 4E6EA 1NX6A 2BVNA 4YRTA 2EG9A 4DCMA 4JOSA 2FPLA 4MS3A 1NMYA 1S0UA 4ZDWA 3UGKA 4GE0A 5BWOA 1T9GR 3F4BA 3PGXA 3QYPA 2W2XA 2AZ4A 4O1HA 2AMYA 4CL2A 3DEZA 4FHCA 2A92A 4LYHA 4B6OA 2E55A 1DADA 2ZI9A 2ZRLA 4HKTA 1XMSA 5G4LA 1NSYA 3T38A 5KUTA 5CB0A 5BQ3A 1F0PA 3LCJA 4IJMA 4OMFG 2FLKA 4TVKA 1I51A 4UE3S 4CUJA 3OZCA 4O4JF 1RZRD 4BJ6A 3G5MA 3X0DA 4YWJA 1F12A 1R10A 5ALHA 5E1OA 5JJKA 4A4DA 2RHGB 1YIOA 2Q5CA 2G5ZA 4S1TA 1L5FA 4LSZA 5CT6A 5IVDA 2NACA 1XZNA 2XQKA 3QMVA 4WMLA 3SKVA 4M0KA 3ZBPA 5ICEA 5IZCA 1C7EA 1JBKA 2G28A 2UXBB 2CDCA 3CT4A 3ST7A 4D5EA 1UPTA 5HYVA 5K8CA 5LU9A 2CVPA 4D6YA 1CY6A 1S8NA 4QEKA 2VUHB 3FKJA 4FP9A 4KNVA 4LPSA 4M46A 4G0ZA 3QFFA 2WYIA 4IS2A 1E6EA 4RHTA 1OVGA 3ESCA 2YIDA 4OQDA 3ZCTA 3HBNA 3IEMA 5FFMA 2W2MA 1DAOA 3H05A 2HMAA 4IF4A 4ID3A 5D3MB 3U9TA 3EZ7A 3L49A 2A84A 3P94A 2IU0A 1YD7A 4KR0A 1Y8RB 1RXYA 3TQHA 2YWFA 3IIEA 3KR0A 5A4JA 3KJGA 1GDDA 1KK2A 2ZULA 5J2UA 1TMOA 1MIOB 3GG2A 4MVYA 2JCVA 3RYIB 1VGRA 3MOIA 1W5FA 1EUCB 1YQ9A 2J7PD 4P8RA 4V2IA 4UTVA 4X3PA 3KOWA 1KSFX 5ESXA 5L4LA 2ONZA 3RT1A 5JI2E 3R6LA 1GU0A 1EZZA 3BT7A 4HDSB 1XDUA 1FLAA 2Z95A 3DE6X 1WP9A 5CHYA 4ROSA 3CZRA 2OQVA 1JKMA 2G8LA 1JE1A 5P8WA 4A16A 4B6EA 4B74A 3ETEA 3VJRA 3F5DA 4XJSA 3R24A 3AUFA 1XAIA 2H4WA 1NG9A 1EFTA 4V0QA 4B5KA 1VYTA 1EAYA 2AXQA 4LHEA 2Z2XA 2Q7DA 3Q8XB 4MHOA 3ZGZA 5LMZA 1WMBA 2GNPA 4L9WA 1XJ0A 2WYUA 1V5FA 1U7XA 1MAUA 1KXZA 5CK5A 3PITA 7MDHA 1WDWB 1WHSB 2VHEA 3S2ZA 5CA1B 4ARIA 3OZDA 1WMDA 4FHGA 4B40A 1M2WA 1I5OA 5K7SA 1MLDA 2BT4A 2C96A 2CB0A 2C9YA 1EPUA 4K7JA 1EGQA 4FU0A 1VLQA 4BZWA 3L7IA 1F20A 3BWMA 3NHRA 4EPXA 3GX1A 3AETA 1AURA 1P1HA 1T24A 3K31A 1P7PA 3MGCA 3NBAA 5EQFA 5C31A 1G4UR 1ZVJA 2OMEA 2R8ZA 2CD9A 5IW8A 3T9BA 4C6TA 1Q2UA 2GLTA 5FKJA 7REQA 1DG1G 2VZLA 3MWDB 4C4SA 3FNHA 1GUZA 1QLWA 3ADOA 3P0HA 4UXIA 5J40A 2F4VB 5ARDA 2OQ2A 4CL3A 2QLBA 5EFOA 3FOWA 4IWYA 1H0RA 3ZGLA 1Z0UA 3LC0A 4KQIA 1T2NA 4MLDA 1X94A 1UINA 2I1QA 2X5XA 4D79A 3DL4A 3L4JA 5JCOC 2BZGA 2R9VA 1YK1A 5ELLA 1HXHA 2ZUDA 5L6LB 2F8SA 4JL5A 1L4LA 2WA1A 3PFGA 1VOTA 4IFBA 3BDAA 5LPNA 3AVQA 4AO7A 1E69A 1PR6A 4H7EA 2F43A 4MR9A 3DF9A 3OM1A 1LWNA 4CUKA 4MROA 3LUJA 4JL8A 4MGZR 4PIVA 4E5KA 5LQCA 2ZSHA 1NUPA 5HJ5A 4CM4B 1JX6A 4LCEA 4UHHA 3TW0A 3ZCPA 4BLSA 3TDKA 4CM8A 2JEOA 3HL0A 1N0WA 4YUXA 5AVQA 3U3RA 4BLWA 4KE8A 3SCZA 1CJKC 1XTQA 2JFNA 1B16A 1AY0A 1P2TA 1ETHA 5K05A 3K53A 1MEOA 2JD2A 3DL2A 4NNJA 4HRYA 3TVDA 1BGVA 4QSHA 2ZI3A 3TIIA 2H0RA 2IQIA 2BFFA 4PAGA 4PX2A 1U1EA 2YOFA 5E6RB 2XI4A 1OLOA 3MTBA 5EP1A 1FSSA 3INYA 4REOA 3ZV3A 2ZRKA 4Z1MA 1XWFA 2OCYC 2WVJA 3IB3A 3DAHA 4JLMA 4E5MA 3ROQA 2B8WA 5FEUA 1T1EA 3Q4GA 1NXOA 3QBDA 5E9QA 3HDHA 3LY9A 4FYPA 4D99A 2J3KA 3VMFA 2GASA 4RYDA 4FYYA 3T15A 1DB3A 2VYFA 3GJ5A 1WDTA 2D2VA 5F3WB 3ORFA 4AI6A 3S5JA 4F3YA 2VHXA 4A10A 1IIBA 2ZWVA 3DE7X 3UA3A 5HJEA 4EGQA 3RSHA 1ZJYA 2O0HA 5B5SA 5LDGA 1EE9A 2KW5A 3OHPA 4L02A 1EM8B 3UCEA 3H2BA 2ISSD 5CPBA 3RJ9A 1QYDA 1T8UA 1SKYE 4AURA 1VLHA 1SWVA 4BLOA 3PDWA 1CLUA 4GYWA 4QFCA 2ZJ3A 5JRZA 2V0GA 3PGLA 2A9RA 3MB5A 3MWFA 5EZYB 1KBQA 2ZI4A 2B21A 1HKHA 3ENNA 4RELA 4LDNA 4AMZA 4C4TA 2B6HA 3FPFA 1HT3A 3JYOA 4IXMA 1A88A 4JBWA 4BP1A 2GPNA 4CF6A 1ZIOA 3N8NA 3OURA 4JLPA 3MJDA 4NULA 4ZAZA 4CKWB 1L4NA 2QL9A 4JJ4A 5TPZD 3RASA 4MA5A 5CDYA 5E1BA 1XAJA 2D0IA 4EFNA 2F1KA 2QMUA 5KWJA 3OEEA 4Y2RA 2ONCA 3BGIA 3BGWA 3IKVA 4HNTA 1NJ5A 2VK8A 4R8KA 5E6SB 1Q77A 4A8TA 1CUAA 1UT5A 1G9SA 4LTDA 1UWCA 1BH2A 4YAKA 1UWLA 1ZCAA 3TQTA 1JNXX 3Q11A 4GZ3A 4RK6A 5CR9A 1VHQA 3OZXA 4AYWA 5AVRA 4MWZA 5F3RA 4LHXA 1USIA 1BGXT 4G4SO 1A8PA 5C8XA 4KLAA 4Z0HO 2D2XA 1AUPA 1QNFA 2GILA 2O05A 4NCKA 4OU4A 1X7XA 3WE7A 4A5SA 1TUBB 3EQ7A 1M0EA 1QB8A 3AUYA 1F4LA 4H4DA 1SXJD 4M1ZA 4Z2YA 2Z2ZA 2BJHA 3SF0A 3ZK8A 1UMDA 2GOYA 1LU9A 1RZ3A 1Z4OA 1PFGA 4IG9A 5AKZA 2C7GA 5JRJA 3HEMA 3LLCA 2HIMA 5HRUA 2V7EA 2WYOA 1TUGA 3THOA 1KFJB 2QR5A 2QX4A 4PM4A 4K6MA 4XUDA 4XUCA 1E96A 1JIVA 1KMCA 2I3ZA 2OC9A 3X1XA 3IQXA 3SE0A 4CLRB 1XVAA 1KWGA 2NYVA 5BWLA 1QANA 3ZK9A 4BJ1A 2W6ID 2ZBDA 4I3HA 1S7CA 1E3WA 4HTFB 3HB4X 2PMFA 3FDFA 2ZYIA 4L7VA 3TTVA 5CA0F 2WT4A 4URYR 2FSUA 1FFCA 4OU5A 3L07A 1Z7GA 4FFLA 3WQHA 3TL2A 2V0NA 3O2NA 3P2KA 1XE3A 3VNAA 1LBTA 3FLBA 4E33A 2Q6KA 3WLOA 5JAIA 5KNBA 4UARA 1XTIA 4Q4CA 2YXNA 2AZXA 1K6EA 1V0JA 4EEXA 1C1XA 2PL5A 1KOLA 3KOYA 2XJ4A 3P26A 4I55F 3SSAA 4JFRA 2GN4A 4RGYA 4CMHA 1MPXA 5EC8A 1KK3A 1TE2A 3A7DA 1UJNA 4LXTA 3MMNA 3A6KA 2P79A 4IO1A 3SOPA 1D0VA 4YRZA 2X8BA 3KHSA 5FNVF 5L3SA 3EYWA 3D59A 4KUGA 1KZ9A 4KBFA 4CXMA 4B3GA 4B81A 3TX2A 5DMHA 1ZD1A 1ZO8A 2EAUA 2OD9A 3A2LA 3H8SA 3GA7A 3JWGA 2HNKA 1U0EA 1A8UA 1L5OA 3WGLA 5TQ2A 1SCDA 1UAGA 3OZBA 1W0JA 4HMQA 4DTCA 3NYRA 1WDLA 4MI6A 4RV5A 1AX9A 2Y99A 3ZIDA 3FNFA 5HQ3A 4TTJA 3CTPA 1I1OA 1NN5A 4MULA 4KB5A 5CW2A 3RFXA 3WNBA 4DC9A 1GU7A 3FWHA 1MKYA 2R7LA 3UW3A 1YBFA 4KOAA 4EYSA 1XU4A 4ENPA 5ALVA 2Q1UA 2H1CA 5AVXA 1ZWLA 1O2DA 2B82A 4HR7A 3MBIA 4BTLA 3AU8A 1DKUA 2XLBA 2BFPA 4AKEA 1ONOA 4MQ6A 2HSZA 1E7RA 2QX7A 4U2EA 1NUHA 5KYXB 3FH0A 3I12A 4JGBA 4AQ7A 4ALLA 4N7RA 2VLIA 2I3BA 1GSAA 2ZPTX 4XYGA 5BOVA 4E94A 1QP8A 3OUZA 5I4BA 1DIHA 3RH0A 2C31A 5IZ4A 5LZ7A 4ZZ0A 3WGMA 2FX3A 3TRHA 2HEGA 3PF9A 5JAPA 2ZR8A 3WFZA 1J97A 4KUHA 4GOKA 4O59O 3R9KA 4FW8A 2IHBA 4YYEA 4U7GA 2W6CX 2EIHA 4PX3A 4JHLA 1KI4A 3L02A 5AHXA 2ZITA 4PSKA 4RJJA 2B8NA 2Q6VA 2XUKA 3BK2A 5AM4A 5DN6D 3WRYA 5G0SA 3QXSA 2Q4RA 2RC5A 1I80A 1X7DA 3AHJA 3WYCA 3GJZA 2ASEA 4NPHA 4M0DA 2I1VB 1L9KA 1IYZA 5DNUA 2EGHA 4N5LA 1QF9A 5IVHA 3TR6A 2WPDA 5I7FA 2BSXA 4G5RA 4PSUA 2DCUA 3PVCA 1TYBE 1ZM3A 2VQ3A 3TW8A 2VYNA 3OQ1A 4YI5A 5JSYA 2PUAA 1AKVA 1AKWA 1IUOA 2BFBB 1JHYA 3GZJA 3S68A 2O8CB 1U1DA 4IHKA 4QBKA 3C24A 2GPSA 2P6NA 3FPAA 2FTKE 4P53A 2NQTA 1LS6A 4DPKA 2JANA 3MC1A 2YY7A 4DIUA 4OA5A 3CC8A 1E6WA 3A4IA 4J49A 1KE1A 3AEUA 4QC2A 1WB9A 3OECA 1TEZA 2IELA 2ZYDA 4TS3A 3O7WA 4OHFA 2PNJA 3G68A 3ZY4A 1PYDA 1X8KA 4RE6A 5BR4A 3V3TA 4MR7B 2ZW9A 1ZEJA 1QKIA 2QUHA 2VFAA 4L6AA 4OBBA 2Z6QA 3USCS 2PR2A 1TU4A 4EHNA 1E4EB 1TX4B 4D8TA 3RIEA 1B93A 4KL8S 5HG0A 1FDOA 2PRSA 3EGCA 2A9PA 1T4DA 3Q3EA 1D4AA 3V8NA 4BEVA 4OAOA 3SR0A 4KO1S 3T4XA 3HVRA 1UK8A 3GEDA 3IDOA 4P32A 3INRA 2IK8A 3ZLBA 4CCYB 2ZVDA 4YI3A 2QD3A 2ZCJA 1XXHB 2AQIA 1XNRB 5JPCA 3EUWA 4OLHA 3DS8A 3PNOA 1EU1A 4UVDA 3S2YA 5C4IA 1RE1A 3CRW1 3DWEX 1LJLA 4YAWA 2D2EA 1J8FA 3G8YA 1GL6A 3HEBA 3MOSA 3W5JA 4A2QA 1L7BA 1Q22A 5IN5A 4EG6A 1ORHA 5J5AA 5KNBH 1KJWA 3DDHA 3TD2A 3PIDA 4XSVA 1FZTA 1P80A 2OD7A 4EGAA 4ZARA 3OWXA 3ZU3A 4KQ2A 4JXXA 3HU3A 4MUAA 3E27A 2RH8A 3R0ZA 1FFWA 1A69A 4LJ5A 1J8VA 1CYDA 2JAOA 1Z5ZA 3CF6R 4LN1A 2UV8A 3SJCA 3ZIUA 2RGNC 1C7FA 1LDEA 1TF7A 2AG1A 2CXTA 2HV8A 2V96A 2X2PA 2ZVPX 4UUQA 1BROA 1KHHA 4YUZA 3UWOA 5H82A 3BZBA 2Y1FA 3OMWA 2JFYA 1HG0A 5K3CA 3KAQA 4HFRA 4S1PA 1BVYF 3QUCA 2VAXA 2Y1WA 1U9ZA 3PHIA 2AMVA 3ESRA 1B3BA 3N2IA 4R9VA 1SIBE 4Q1EA 3O74A 3E4DA 1QZ3A 3OHMA 4KQ6A 2GPTA 4BKRA 4YRSA 3LQFA 3RWOA 2BFCB 2PH1A 1YB6A 1TO6A 3K8ZA 5K8VA 4I6JA 3MJVA 3OLZA 4R1LA 1ZR4A 4UBNA 2DY1A 1VIYA 3Q40A 1Q92A 4U3JB 5B58C 2JAXA 3T5TA 2P65A 2QV7A 3C3JA 4DJJA 1U0BB 3MINB 3WVNA 3JY6A 4L27A 3I1IA 2ZSKA 1JT9A 1TJ4A 5FI3A 2IHJA 4EKYA 2C5SA 3KPVA 4YGYA 4N8SA 2G76A 1H1TA 2Q2VA 4YVFA 3WQQA 4D2IA 3WTBA 3BMQB 4RTJA 4KXUA 3FDZB 4Q39A 3VDMA 3HJGA 2IBTA 2WD8A 2ISQA 4BL5A 3H3XA 2Q5HA 4P5DA 1E9RA 3V6LA 3W8RA 3WL8A 4D1YA 5JXIA 3HL6A 3EGDA 1Y4SA 4Y2UA 1KETA 4FMPA 3GN2A 3SXUB 1B7GO 4HQKA 1Y63A 1OV4A 1VXRA 4C4ZA 4X95A 1T5BA 4LGMA 4MB0A 3LRXA 2R8EA 4ZTBA 1ZMXA 1XLTC 1SVKA 2BZ0A 2GA8A 2PPVA 2PVPA 2FZLA 5KKAA 4BQSA 1P91A 1M72A 4MUJA 4DIDA 3KQLA 4C4YA 4JI1B 3MMZA 1T3HA 5DYTA 4CMBA 1BE6A 2C9BA 1P1CA 1UMKA 3GPLA 4GW3A 1JNYA 1AS3A 4HFNA 2XCSB 3QXCA 3SK0A 4AS1A 4YP0A 1WW2A 1JBEA 3V4RA 5ALSA 5JSZB 5GV8A 2OV6A 2PN1A 2XB2A 2HU2A 2GW4A 2GJ4A 4EYKA 2CXOA 1BJRE 1SBQA 4Q1VA 2VNJA 2OESA 3TRFA 2X77A 1IBRA 4FEEA 3GNLA 1QR6A 3I01A 3CUYA 1ZC3A 2I4OA 3RROA 5THKA 4OHCA 1A7JA 1ZESA 1P72A 3HPQA 3R76A 4LCBA 4FONA 1WXHA 3THXB 1LPSA 1AXRA 2F48A 4H7PA 3Q7EA 4HDAA 4ZEMA 3S8EA 4X60A 1N6LA 3FA2A 4ZAYA 3D1VA 2GF0A 1DKQA 3O38A 3CX8A 5EE0A 2ZI5A 3H9BA 4EHFA 3Q2OA 1M8GA 3UJ3X 4YV7A 2NUAA 2ERYA 3IAM6 2AUTA 1WWKA 1PTKA 1PK9A 1ZJZA 1ULZA 2VSQA 1DRUA 1L9XA 3EW7A 2GRUA 4OHUA 4OJMX 5LP6B 4G9GA 1NOJA 4WZBA 3L8ZA 1FA9A 1EP2B 1ODLA 3FRJA 3ASYA 3UMSA 3DWFA 3SOZA 3L6EA 421PA 5TMDA 1T1GA 2BKAA 2QNRA 1ZJ6A 3DCYA 3RFFA 5C5DA 3N8KA 3E9MA 5DSZA 4RQTA 4DLZA 3SF8A 1HNZB 2MIIA 3WK9A 5AJUA 3ZYZA 3DW3X 4IH9A 4RXUA 3IDAA 4WFQA 3SVZA 3ZUGA 1ZVQA 1IQPA 3OZSA 3I61A 4E5SA 3PEVA 4ER3A 3JWPA 1T36B 1NMXA 4RA6A 4XPZA 4ITVA 4GGPA 2IYRA 2SCUA 2FEXA 4D0GA 5FUQA 3WOVA 4ER6A 4Q47A 1IBKB 3B1ZA 4WCFB 1ZD9A 4W82A 1EQUA 3E7PA 3IALA 4RSHA 1NPDA 3ERCA 2XY4A 1R6VA 4YAGA 4RDHA 3NHAA 2AFHE 5AW4A 3TSZA 3DE1X 2XOXA 3O8OB 1UOEA 2DHEA 4EMBA 5MN4A 3THYB 2UUAB 2HLDA 1VL8A 2BBSA 2ANCA 3Q3IA 1LQTA 2PUEA 3FPLA 3DLCA 2BY4A 3OE5A 1ESDA 2G0TA 4BO8A 2PX3A 2BFAA 5LA6F 4P2BA 1XVVA 1V43A 3TLKA 5BMVF 3NOXA 4HWGA 4UTZA 3UWKA 3RSFA 3VO9A 4D4KA 2PAFA 1KERA 4KAAA 5C7LO 4JYPA 1NXWA 4BCBA 3HFGA 2VT2A 2NQ8A 4H1WA 5IBRA 4G26A 1B43A 1K06A 4GPEA 4YMIA 5JD4A 2ZUWA 1XF1A 1UMCB 3LOUA 2AHOA 3C5VA 4YP1A 5ES3A 3IRVA 4M36A 1RYDA 3BSYA 2YZMA 4G97A 5JO0A 1IM8A 3K7EA 4TWAA 4DBLE 3G82C 4YK7A 3MWKA 1V96A 2V74B 4MGEA 2F6RA 2GJAA 5CBPA 5FIUA 1ODIA 1UJ6A 4WZZA 2CJWB 2FR1A 3P2IA 2DLCX 4QGAA 3LZDA 1UFVA 3FN4A 4PZ9A 4U5XA 5J59A 1NG1A 5AOCA 3UMBA 3V8BA 4CMAA 4E30A 1ZK2A 2HZ7A 5HTOA 4PONA 1ZSYA 2UZ3A 3IE0A 4F85A 2FLVA 1LTKA 4RGQA 4IIJF 3LD9A 3E05A 1G2PA 2GRAA 5D7NA 1LPPA 4NV0A 3ITEA 3KSZO 4NBKA 5BPHA 1W85B 4B85A 3BZUA 4XVQA 1F1JA 1OQAA 2CXUA 3EXFA 4G5QA 5DNEA 2O50A 3RRFA 5K8TA 4Q15A 1F6DA 1J90A 1M54A 2QQ0A 2G04A 1V4NA 3NATA 3TSCA 4CTKA 2IYYA 5D01A 4UDYX 1XRQA 1NF3A 4AUNA 2FPOA 2Q1SA 2FCRA 4P0TA 3K1YA 1U8TA 3I3SR 3K0FA 3KQHA 3ICPA 4DZRA 2ZSUA 3RQIA 3DONA 4UUAA 3U2QA 4HEA6 1ZAKA 5ECGC 3IELA 3AY7A 1FS6A 1G6HA 2W6OA 4V1CI 1IY8A 4FN5A 4KVZA 1FY2A 4OL9A 4PZAA 3NX4A 2VC2B 1OA0A 5GPBA 3TIGA 1J7JA 1W1UA 2I2XB 2WJAA 1MB4A 4U0JA 3HXOA 2C07A 3WL4A 4J0FA 3TAXA 3FLMA 1WXQA 3DNMA 3BA6A 1FUIA 1GWNA 3RFTA 4HZGA 2NV0A 2NO1A 1BC5A 1YCDA 2SKCA 3EWIA 3HXQA 5FUXA 3EXEA 3A2MA 4KAFA 1COZA 3QVJA 4K86A 3HU5A 4PFSA 4LV8B 3BORA 1LBSA 4JN6B 3DAOA 2VNIA 1IBMB 2JIMA 1RBQA 2XUFA 1ZN8A 4K9DA 4ZYWA 3JATA 1GN9A 1JSXA 2J4DA 4GDFA 3H4IA 3N70A 3IUSA 4J0DA 1Z4JA 4MK4A 5ITSA 1TQ4A 3M6WA 1VKHA 2G16A 3V4OA 4DADA 1L7QA 3PXXA 1C29B 2HEIA 1UXKA 4WXHA 1M75A 1GZ6A 1FMTA 2JZOA 2FWJA 5F3DA 3B1VA 4NCBA 2RJOA 4IAOA 4C4XA 1A71A 2YS7A 1NVTA 4U9HS 5C7OO 4UTXA 3CB4A 4HZUB 2OHFA 1Y5LA 1N0VC 4KV9A 4Q7QA 1OILA 3MAGA 3ZEIA 4BFYA 2LGJA 5J23A 5ILGA 4GI3A 2V9PA 4RJ2A 3UAXA 3RUEA 4UE6A 3DSRA 4FLEA 3I72A 4B17A 5CCDA 3W5SA 1NXSA 1BQ4A 3CX6A 4CNQA 3N6XA 5AI5A 5GVRA 2P4HX 2WWFA 4F3TA 5AFSA 3LPMA 4M0LA 3R8XA 5JMOA 1D4ZA 1MVLA 3EGXB 4I36A 1OX6A 2GPBA 3KTAA 1H2RS 5IEBA 3CWQA 2BEKA 2DPXA 4INOA 1KVSA 1RYYA 4QYTA 3NV9A 1DQRA 4PICA 2H4JA 2HPVA 5JCXA 1XDGA 1CDZA 5JYEA 2LIPA 1QUEA 5IJZA 3Q8KA 4EUSA 3ICOA 1ODTC 4DMRA 2QRUA 2M6SA 2AGVA 2PUWA 3JPYA 2O2ZA 4G25A 3CEJA 1MO2A 2QD4A 5BN4B 1SOUA 2LIVA 3BJEA 1J9GA 4UHCA 5E0KB 1JMKC 4M9RA 3ZDRA 4IUYA 2ZU0C 1O8CA 1H4SA 2ECOA 5EINA 5JCOA 2PUBA 2UZ4A 4O8CA 4AZWA 1Q1NA 2D2FA 3OZIA 3QMWA 4IDOA 4M88A 1KH1A 2AUMA 3BYZA 4LRYA 4NARA 4YIHA 1VKOA 4YO7A 4LF8B 1XNGA 3Q98A 1KR5A 2IW3A 3OJCA 2HD4A 3HA5A 5D3ZA 6REQA 4LNAA 5JAZA 3ORHA 5TGTA 2B4TO 4W6ZA 2ZWIA 3WYAA 4Z6KA 1X80A 3GZTB 4X7MA 4BO4A 2WYWA 4XD2A 4B6JA 3MXTA 1WLYA 2JI7A 1CUSA 1NAIA 1WVGA 2Z1MA 1YAHA 3PICA 5G3ZA 4GSLA 2ODEA 3HB0A 3WLIA 2FPRA 4JJZA 2ZUBA 1SU8A 2FMXA 4D3YA 2JI8A 4RJKA 2CMFA 4NJMA 4LWZA 2D6FA 2YHSA 4JQOA 3PEWA 4WFKA 1TKAA 1RMQA 1VIVA 2J46A 4AJLA 4I5IA 1ONNA 2A0WA 1YACA 3DJYA 4LX0A 2GVZC 2DHDA 3TI9A 4D9EA 4K6GA 4YRRA 4FFMA 3AI2A 3GQVA 3U4AA 3VR4A 4BB6A 1HTTA 3QXJA 1FTSA 1REQA 1XKLA 2W6PA 3H97A 3LDAA 1SVWA 3QKTA 1L7AA 1IB6A 2J1LA 5DLQC 2ZETA 4I1PA 3ILYA 1SU7A 5ALUA 1J00A 5EXCA 3U37A 5AHKA 2ZFUA 1KQNA 2FF7A 1BMDA 3HADA 2C97A 3PENA 2ZE7A 5B4UA 4M83A 1NV9A 2RD2A 3NM5A 1T5OA 1OH7A 1Z2CA 3KZOA 4MJXA 1T4CB 3K6JA 1GITA 2YJNA 3D4LA 3ENWA 5AKHA 2P91A 4WHMA 5CPFA 2XWJI 3JCZA 5M34A 3EARA 5EMNA 3EGWA 2IXGA 3KYDB 1QVZA 3KTDA 1A97A 3CRRA 3R3UA 4RHYA 5FOVA 2HTFA 3DT6A 4ZEWA 4O02B 2PY6A 1I24A 2Z5GA 4PPGA 2JH3A 1CQJA 5FTLA 2DFKB 2AE1A 3VTAA 4BZQA 4E09A 3OPYB 2NAFA 3R2JA 2QNBA 3I0MA 4TLEA 3R7WA 2AEJA 1M9NA 3L5KA 1GQFA 4PPNA 3IIIA 1NVMB 3FMOB 3MCZA 2YX1A 1JILA 3AR5A 3AHHA 5FBHA 4CR7A 1LTHR 3VKFA 4DUYB 1DC3A 4XKJA 4FYMA 1N33B 2REXB 2WFLB 1NTRA 5CM9C 4GC9A 2MT9A 1T9KA 1XQVA 1FFXA 5G40A 3WZMA 3ZE0B 2X0FA 4RQAA 3V2UA 4TZ6A 1BE8A 1SG9A 1ZH4A 1V4BA 2NO9A 3R77A 3TM5A 2O9JA 4AY3A 1F3OA 3NOVA 5I7EA 4QU9A 2FQWA 2XA9A 1XTJA 3BRWA 4X3CA 4PS1A 1XU9A 5JYDA 1TYCA 2JAWA 2QW8A 2REBA 5HKKD 1PV4A 3Q0EA 3ZD8A 1JG7A 5JBQA 1R64A 3UOAB 2G70A 4NS4A 3ZXYA 2YXPX 2DR2A 1MO5A 4PHCA 1UAYA 4C1NA 2WF9A 4MYHA 3ROZA 4IUDS 1YL5A 5G53C 4D26A 4A0RA 1MW9X 1C7IA 1KY2A 1MIHA 5HQTA 3OKCA 1MDBA 3IBSA 3UMCA 5K20A 4S05A 1Q11A 5A05A 1AUXA 2X58A 2JFZA 5AJTA 1GA1A 1HQKA 1SGWA 1UIRA 1ZVKA 2Y0EA 2XCTB 1HFWA 2QY9A 3NHKA 4F5ZA 4LWQA 2FPGA 5IAEA 4KJXA 2RC6A 5GY7A 4CM8B 3OF2A 3V5NA 5EJ8A 1QZUA 4B34A 3D3EA 4DZZA 3WK5A 4ZQCB 2RGAA 2X1MA 4QYWA 1GUFA 5K8LA 2VAWA 3KVNA 2OGWA 1I32A 1BAPA 3LI2A 3WBFA 4YCCA 1WU7A 1CR0A 1BXRB 2F9MA 2GZAA 5ERXA 3R09A 2W6QA 3CUUA 4NYMQ 4TMYA 2BFFB 2ZSJA 5SY6A 3UJ7A 5AW7A 3I92A 2Q6TA 5IARA 2O6LA 2WUFA 5B58T 3SKXA 1PD1A 2AZMA 3CY6A 3EVCA 1II8B 4IOKA 4N3NA 5EMMA 3WP1B 4ECEA 5JASA 2FFJA 3OZWA 2EFCB 2XSZA 3B38A 4OFBA 1PJTA 4GX5A 2QKYA 1SZCA 1IAVA 4D97A 1DO8A 3LBYA 4H6VA 2HA2A 4MPTA 2GD1O 4MWDA 3PXBA 1X9GA 4MI9A 2BKUA 2AW3A 3AZQA 1G98A 4WN3A 1NBAA 3CO0S 4O4HA 2Q50A 2EL9A 2BMDA 2I0FA 3VI4B 1P4AA 1VCHA 3FFWA 5FLEX 1V9SA 1X42A 2JI9A 4RK0A 1TL7C 2ZGVA 3O8LA 2PPLA 4L5JA 3LY5A 3EIOA 2I6SA 4L8WB 4NIMA 4QLBA 1ZKDA 2BSAA 5BT8A 3H5AA 4DMFA 4GGOA 1YI0A 4JROA 3VR4H 4JUBA 1H93A 3N2KB 2PGJA 2FAXA 4H1VA 1UKAA 2NVWA 3GLRA 2XGOA 4Q4HA 5DJ5A 4Z4EA 3OAAD 2IHNA 1UJBA 2C20A 2XNCA 3HN6A 4FEGA 3UPTA 3TKYA 2BV3A 1XPJA 1XBTA 4CQMA 4KYUA 4TRJA 3AQ4A 4IZIA 1OKKA 1D2AA 3A9WA 2QYOA 4QOHA 4MJLA 3GCWA 3DVRX 3CH6A 5LWHA 3QHQA 4TSFD 1I0ZA 4P4SA 2P9QA 3KRTA 3V4ZA 4GSKA 1D6SA 1U0HC 1YMQA 3V80A 3HU2A 5M7EA 3ZU4A 3T7AA 4XEHA 2E4WA 4P54A 4S0ZA 3QW2A 3OY7A 4UD2A 1E2EA 3W90A 1MO4A 1GU1A 3KHTA 4KIWA 5AJXA 1YOVB 3FNEA 4PZLA 3M1LA 4R1UA 1D1QA 1KF0A 4JUAA 2DGDA 2JLAA 1GSOA 1RIIA 5E6UB 5AT1A 3OIGA 4MR8A 4JD5A 3KWMA 3CZCA 2YQ5A 4WBNB 3OM0A 4X44A 1RLMA 4DV3B 2H08A 3GFTA 3WHLA 2V5AA 1EZ4A 1N25A 2VTEA 3P0EA 1BEEA 4FIZA 2VP6A 2FA9A 5DULA 4DV2B 1FX0A 5EZQA 1O6CA 2YFHA 3ZVNA 4NZPA 3HKDA 1RZRA 2A3NA 1GO2A 3RJTA 3PEYA 2PHZA 1ULBA 2D0PB 2VF4X 3EXG1 3GPBA 4UZEA 5HDQA 1W0KD 2B83A 1LPMA 4R7TA 4W1RA 5DYWA 2CV2A 4I50A 1KEEB 3I9NA 2XUZA 1KKUA 4B9AA 3OETA 1H9CA 2OUIA 1P29A 1L5WA 3RGWS 3Q8MA 3IV9A 3QUAA 2XODA 2Y71A 4IOJA 3PT9A 4TX1A 4ZQHA 4XB1A 2N3ZA 1IB0A 2PL9A 1R0KA 5BW0B 1U2ZA 5HMLA 3K0KA 3SAJA 2KMLA 2ZRJA 4BXOB 4OX9B 2FNAA 3WGNA 1K27A 1LVHA 2R2AA 3CWCA 3OD1A 3QELA 2PKWA 3WMXA 3HKCB 4BNYA 4DABA 5T64A 5KTSA 3KXIA 2WKQA 5DB4A 4TSRA 2JIZD 5EJFA 4DT1B 2PSEA 1KEPA 1Z0FA 2BFOA 3D02A 1GJRA 3D8TA 3B1KA 1XA4A 3C6YA 1SHKA 2UZIR 4XZ3A 1QE5A 2CDRA 4Z3KA 2AOUB 1JVBA 1JGTA 1ENZA 2CNNA 2J7PA 4LYJA 4MMYB 4D4HA 3I5YA 1TLLA 3R3HA 2PKXA 2RAFA 2BR5A 1ZW6A 2JZNA 4TQUS 3WO1A 2Z2YA 2P5YA 1FXWA 1VE9A 2H9AA 4L4ZA 4QUJA 3I2GA 3VX3A 2PRIA 3NUZA 5J43A 4MS4B 3DPIA 1U90A 1G6KA 1G7TA 3OT4A 3N6VA 1WCWA 3FLEA 3L92A 3SQWA 2Z0MA 1K8ZB 3HJHA 1M1NA 2YWDA 4XVHA 3EAGA 1O95D 1V8DA 4UW9A 2Y6VA 5TQ2B 5CCBA 2ZZNA 1XALA 3B6IA 1JG4A 3TQRA 4AAYA 4C7JA 1U8FO 1UBEA 4HNRA 1DEOA 1C9YA 5EZYF 2ZUEA 4L9RA 2RMKA 1SUDA 4C05A 4LOAA 1JA9A 1P1JA 9GPBA 2I29A 2O5RA 2X8WA 1J8DA 4FFBB 5JRDS 4CM5A 1XZFA 2QX9A 1XELA 2PAAA 3D6VA 1UWKA 3AJ9A 1Y4ZA 3U4IA 1JJAA 2RGNA 4ETIA 1QNLA 5K6TA 5KNLA 1AHHA 2H5EA 2AJBA 1G3RA 2BEVB 5CIYA 3EEOA 2F55A 5DX1A 1GVHA 1DJOA 2NO5A 1C9JA 2B7BA 4KXNA 4IQ4A 4TV9F 2XYGA 2W2KA 3VFDA 1G5TA 1USKA 1W9MA 3UC9A 1OC4A 1M1ZA 5TMPA 4DDUA 1K5PA 2YXEA 4JENA 4P08A 2Z6AA 1JZQA 4LYYA 1C4XA 2GT1A 1UXHA 1SN7A 3MAAC 2BSQA 4BDTA 1WTAA 1E1CA 1V71A 5F64A 3RCBA 1XQ1A 4EENA 3WNDA 5KWVA 2JRLA 3L7NA 4ZYUA 3AHCA 4CDMA 5B7GA 3H1TA 1IH8A 3PNQA 3E5HA 4JI0B 1TCVA 3MD9A 4Y0VA 4AULA 3ZXSA 1R1DA 1LI4A 3D3WA 3QF4B 1O0CA 1Y1TA 3DEKA 2G9RA 2CL7X 1PFQA 1OVMA 2RAUA 3E7XA 3L6DA 3HG7A 3LNCA 4R8LA 3C6QA 5BOSA 3GGCA 1YE8A 2FK8A 3FZQA 2WUDA 4QREA 5K0NA 3B6MA 3CF2A 5KVQA 4F6LA 5JNVA 3HDTA 5CD9A 3ZNPA 4QIHA 5KX5F 2ZJ1A 3M6VA 1UAAA 2Q8NA 3V32A 1PQWA 1QZXA 1XA3A 1RJDA 1XROA 5LZ8A 3WWZA 2P3LA 2Z8YA 2GYVA 3RBZA 3RKRA 3B2QA 5EJ6A 1WXFA 1S3FA 2YXDA 5CJ2A 4CGZA 3K4PA 3ZD7A 2W8BB 4GPIB 4M2LA 1XLTA 1Z7WA 3U80A 4C01A 3AEUB 1Y80A 3WGTA 3ZKWA 3KXLA 4GNRA 5B7QA 4QGSA 3VV3A 3BH7A 4ZDKA 1JVSA 4ZU6X 4OK6A 5BQOA 1A0OA 1MV5A 1IRXA 4OOEA 3WMGA 4DWOA 3OZVA 1C1DA 4IQGA 1ABEA 4QELA 5K0SA 2O2EA 3EB9A 3F3YA 4HP8A 2RAVA 1TCBA 4CKBA 3H9UA 1BRMA 3MELA 4JB2A 1GR0A 3HYCA 2QTGA 5SYNA 1SA0A 4YT2A 3O1JC 2YHIA 4KKVA 4RORA 5BN3A 3ISTA 1JQDA 2AR0A 5CT8A 1OBCA 3QVOA 1E9VA 2RGYA 5H80A 2X6RA 5FLYA 2QYHA 1KJ8A 3RTBA 5BUCA 1U4OA 2AXEA 3HCWA 4GO1A 3STUA 1Z83A 4DQKA 5KYKA 2CCJA 3W5BA 4F4JA 1T34A 3EXIB 1Q14A 2PBRA 4DEXA 2BFMA 3BWCA 1KE2A 3ESXA 4OO3A 3MUNA 2GESA 1M1XB 2NM0A 3EOBI 2IYAA 3OM9A 3Q6NA 1QZZA 3RS8A 2PLWA 1NDUA 3PNBA 5JAMA 4HATA 3V2IA 1JR3A 4PWZA 3G79A 2X3UA 5EQTA 3RAJA 4QYXA 2I9PA 5B64A 1G17A 1UQTA 3I0NA 3QVTA 4GR9A 4IZHA 2PX5A 3IVRA 1AS0A 4Q34A 1DARA 1WZIA 2Q5IA 1GRVA 1P6UA 2VHYA 3C4VA 2QR2A 3P52A 3PGVA 3T0IA 2RARA 5AM0A 2XMCA 3TK1A 1AK9A 1ZIXA 5JISA 3CH7A 1N5JA 1XZIA 1QVRA 2A0YA 1P74A 3G0DA 3N0TA 4K03A 4WZAB 5IH7A 5CT5A 3P9KA 1ZCJA 2OZVA 3HNOA 1OXBB 1DWUA 5ERYA 3E9RA 4UNRA 3JD3A 1L5GB 1G8SA 2IHYA 1EP9A 3AV3A 4GX2A 4OQXA 2GH1A 2V4MA 5FI5A 4K46A 2R1VB 4U2GA 1XCPA 2WOOA 3DKIA 1AK2A 3OU7A 2C78A 2J9GA 4H9GA 3EEQA 4JLWA 2XDQB 2C7PA 2QTBA 4Z0TA 1C41A 1JEQA 2CVHA 2MR5A 3S2SA 3PL5A 3KQQA 2QLTA 5K0EA 2PUFA 2JS7A 2HWYA 4GQAA 4Q9AA 3U3ZA 5G1NA 2ZIGA 1MB2A 3P9XA 4Z3DA 4IPTA 4Q9JA 4KPUB 3RS0A 4WVFA 5AVSA 3DKKA 5U9CA 2G1JA 3NGLA 2AQ8A 5AKLA 2XVZA 1PBNA 4CRWB 3EF0A 1T13A 3FCOA 4O2RA 3H4VA 4OATA 2FUG6 5GGYA 3GNQA 3F1LA 1P73A 4D3SA 1IZYA 1F8UA 1XA0A 1FFSA 5IJ0A 2EZ4A 1O9HA 3BHIA 2O7SA 2OV4A 4PYLA 5A62A 4EB0A 4CPDA 4YEDA 1FPMA 3QA3E 4GVXA 4J16C 3FTDA