3Q15C

Crystal structure of raph complexed with spo0f
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
116
structure length
116
Chain Sequence
EKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of response regulator dephosphorylation by Rap phosphatases.
pubmed doi rcsb
molecule keywords Response regulator aspartate phosphatase H
molecule tags Hydrolase/kinase
source organism Bacillus subtilis
total genus 35
structure length 116
sequence length 116
chains with identical sequence D
ec nomenclature ec 2.7.-.-:
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3q15C00
2FN9A 3QLUC 4RV5A 2WJWA 3F7NA 1JLKA 1NXOA 1CEYA 1ISSA 4NV3A 4IF4A 1JH9A 1YK1A 3HS3A 4F3TA 4KK4A 1AB6A 1XWWA 2PE5A 5DKFA 1DC7A 1PHRA 1MIHA 4LDZA 5TPZA 2PUDA 4RK0A 4HNRA 3QLTA 4G0MA 3FFWA 4E7OA 1PEAA 1ZESA 4RKRA 1VLZA 4QICA 3I45A 1PUXA 1AB5A 1YIOA 3M9WA 2NZUG 2WJAA 2ZWMA 4JASB 3RVLA 4CBVA 5FWXB 3OO0A 1DRJA 1QP7A 2QXYA 3QX9A 1E6MA 2L18A 1RPJA 1XHFA 1IIBA 1QNLA 3GBPA 1NTRA 4G0QA 1P6QA 4ZPJA 4RXUA 1H9CA 2MYTA 1GUDA 3JPWA 2E4UA 3JY6A 2QW1A 2GKGA 1VPWA 3QEMA 2F8SA 5KQGA 3OLXA 1P8AA 3GA5A 3HJFA 4H3KB 5FWYB 1Z13A 4EYGA 1U0SY 4TN5A 3EJWA 2M98A 5DTEA 4Z4GA 2HQBA 2MSKA 1USKA 4RK6A 5BQ3A 2LPMA 1ZGGA 3HZHA 4QYMA 3FGZA 4RK5A 5JS2A 3FFXA 1GLGA 4MAAA 3RVPA 2NT4A 3H1EA 4N03A 4YS6A 1KGSA 3UKJA 1NXTA 2RDMA 3CZCA 2PUCA 2FQXA 5IUNC 2W42A 4OLBA 4S04A 5E3JA 5F64A 2FMIA 4EUKA 9ABPA 4W5QA 2A9PA 3IP9A 1NXWA 1L5ZA 4OATA 3RVQA 3SNKA 1GUBA 1NXPA 3NBMA 1F4VA 4MS1B 5KQLA 1DRKA 5TQ0A 6ABPA 3LUAA 2CHEA 1ZH4A 4DQDA 2HQOA 2VYCA 3CFYA 4JB2A 4MLDA 5DGCA 2PUBA 4Q6WA 2JBAB 3E3MA 3FMVA 4MS4A 4Q7EA 3OLWA 1RZRD 3O75A 3MF4A 1DCMA 1E6LA 3P9YA 4IILA 2FTKE 2RGYA 1A0OA 4XLTA 1QP4A 1YVUA 1LJUA 4WXMA 5FWXA 3KHTA 4IGAA 3Q41A 3O21A 2GBPA 3NNNA 4QYWA 4MR9B 2IPNA 3HXMA 4G0ZA 4JA2A 1BDJA 1NXSA 4FE4A 3ILYA 4G97A 1JX6A 1U04A 1OXKB 3GBVA 1Z12A 3LKBA 3GYBA 3JS5A 3EAFA 3OM0A 3O1IC 3HK2A 5CNIA 3T6KA 5CNMA 2RJOA 4GNRA 3F6CA 2CD7A 5FBHA 4N76A 1ABFA 4W5TA 3LKVA 1BVHA 2IOYA 4Z4CA 2GWRA 3Q15C 3NNSA 3R0JA 1DBWA 5T3YA 2QVCA 2R48A 4OBBA 2GI4A 1LBIA 1QP0A 5KQMA 2LIVA 2E4XA 2KYRA 1E6KA 4O1IA 4F06A 3BRSA 2A9RA 5JNTA 3T8YA 4F11A 2R47A 3K9CA 3DGFC 2B4AA 3MYYA 3DGEC 3NHZA 3HV2A 2PUGA 2E4ZA 1MB0A 3N0RA 4MLCA 3SY8A 3JTEA 1P6UA 1Z18A 3O2SB 2L2QA 2CWDA 3QELA 1JDPA 4M88A 1WETA 2QU7A 3SG0A 3T95A 2FLWA 4N0PA 3H5OA 2E4VA 2P9HA 1MB3A 2JBAA 2FEPA 1W9HA 2GX6A 4MRMB 1ISRA 1FFWA 3LUHA 4LE1A 2FVYA 1USIA 2FXIA 5TPZD 5B3JC 4PZ0A 4W5NA 4MR8A 4G0YA 5EWMB 4MR7B 4D6XA 1W25A 1TM2A 1T34A 4RKQA 6CHYA 3L49A 3EGCA 3HSYA 2JVKA 4G86A 4KMRA 2WY2D 4ETIA 1DCFA 4MR9A 2FKAA 1DCKA 1QO0D 4N47A 3OQNA 1D5WA 2J48A 5TQ2A 3HUTA 1BAPA 1ABEA 2HQRA 3I42A 4N41A 3MM4A 5ABPA 1RXIA 1Z2EA 2QZJA 1JF8A 3QLVC 3TMYA 1QO0A 1C0EA 4MQFB 4XARA 5GQSA 3EDCA 1TVMA 3LUKA 5IULC 4Y9TA 4YLEA 2E4YA 1RXEA 2HJ9A 3RVNA 1M2FA 3M9XA 1YK0A 2JVIA 3G1WA 3QEKA 4JP1A 4E7PA 3H5WA 3QX8A 3LMKA 4YR7A 2MYPA 4TLLB 4MS3A 3C3WA 2CHFA 3DBIA 3GV0A 1PNTA 4MPTA 4ETNA 5EWJB 5TPWB 1L5YA 3H6GA 3CTPA 4RK7A 4IMJB 4RY0A 2VUIB 4RSMA 1B00A 2PAFA 3LUDA 3RVOA 2FEKA 4ZMSA 4KK3A 3KYIB 4WWHA 2FMFA 3CHYA 3QLUA 4HNSA 2Q5CA 2P4UA 4H60A 1DG9A 2LBPA 2PMCA 5IEBA 3RVKA 3H1GA 5BRJA 2QR3A 4KVFA 1KRXA 2X7XA 3EODA 4WZZA 4B09A 2FLKA 3KS9A 3N8IA 3OMXA 4XAQA 1YS6A 1K68A 8ABPA 2H0AA 2OENG 4ZJPA 4W5RA 4KNYA 1QMPA 4EGSA 1SD5A 3ROTA 2NUBA 1D4ZA 3GWGA 3CRNA 3S99A 1QPZA 2IPAB 3EQ2A 3Q7TA 3DZDA 5KQPA 2QSJA 2V0NA 3O2QB 4YGXB 1VKRA 4Z4HA 5JNRA 3EQZA 3OLZA 3HCWA 5KC8A 1ZVVA 1EWVA 1RNLA 4G0OA 4RK1A 4YCSA 3W9SA 1C4WA 4MQFA 3N6VA 1DP4A 3OMWA 4XFKA 5IUJC 4YRZA 4G0XA 5HKOA 1USGA 1JYFA 5IBQA 2JB9A 3I09A 1BA2A 5I4CA 3IP6A 1LBHA 1JFTA 1Z2DA 4YO7A 4EVQA 2IPLA 3MMNA 2PL9A 5FWYA 4OLAA 4DN6A 5EWJA 5TPWA 2VUHB 4KREA 2IKSA 3SQNA 3URMA 3D8UA 3CS3A 1M2EA 2ID9A 2MSLA 5T7BA 1SXHA 4NCAA 1MVOA 4L4UA 1EAYA 4PEVA 1TMYA 1D1PA 3OQMA 3F73A 2FSPA 4IRXA 2L17A 3BILA 5BRAA 1P2FA 5HM6A 5FBKA 2NZVG 5JNVA 1CYEA 2FQWA 3M6MD 3G85A 4WT7A 2AYXA 3HVRA 4Z99A 3CU5A 4MS1A 1JFVA 1ZH2A 2HSGA 4EVSA 4LDAA 4NCBA 3OM1A 1QQAA 3F6PA 3O2JA 1ZITA 3HUUA 1K66A 3CG4A 2PLNA 3B2NA 3LUCA 3C97A 2PUAA 5IX8A 1MAVA 2LP4Y 1JDNA 3N0WA 3N53A 4S05A 3KTOA 3H75A 3A0UA 3HDGA 1LK0A 3KLOA 3QEMB 4KPYA 1YTUA 3H1FA 3JVIA 4RK4A 5CNKA 1DBQA 3SM9A 4L85A 3LOPA 5TE9A 2DRIA 2JCGA 2AYZA 1A04A 3UUGA 2JK1A 1NATA 2L19A 4OG2A 3OQOA 2F8TA 4TLMB 4RY9A 2N9UA 3HO1A 3A10A 1FSPA 3H5VA 5KWSA 2LUOA 3KJXA 1ZHHA 1URPA 2R25B 4KQCA 2PJUA 3LUFA 3I5AA 1BDHA 3IDOA 5PNTA 4EVRA 4ZYLA 4XASA 1F51E 3N0XA 4XXHA 3GRCA 4ML3A 1R8JA 4O1HA 1KMIY 2WRZA 4EY3A 3LUGA 4N0QA 3MIZA 4RU1A 3NNDA 3MQ4A 3IPAA 1PEYA 4UHKA 4RDCA 5TQ0B 4Z4FA 2HPHA 4RWEA 2IYNA 1EWKA 2YHAA 3RVRA 2O20A 3CLKA 3CZ5A 4EYQA 1D2AA 4MS4B 4JAVC 3HM9A 1GCGA 3EULA 2IDMA 4IMIB 2YHBA 2JVJA 5C5CA 2ID7A 7ABPA 1ZN2A 1Z15A 4RZSA 2R4QA 1M5TA 3KLNA 4YP9A 3ROFA 4ZMRA 3O74A 1SXGA 4D74A 2FEWB 1DZ3A 2BGGA 1QKKA 3Q9SA 3FDFA 4MQEB 3BREA 1Y1LA 2MYNA 3BBLA 4LZLA 4OTZA 1U2PA 2H3HA 3H5IA 4DADA 5JNUA 5B3JA 1PNRA 2QV0A 1U8TA 5CHYA 4HYEA 1I3CA 3E61A 4LX8A 5IUKC 3JPYA 4Z9AA 4KZKA 2VK2A 5EWLB 4FB4A 5DLEA 4YWHA 4MRMA 1ZAYA 3VNBA 1CHNA 2I6FA 3K4HA 5IC5A 3LFTA 4MYRA 3SAJA 4EYOA 1ZDMA 3O1HB 1EHCA 1GCAA 1Z17A 4MR7A 5EWMA 1D1QA 4Z9BA 3OO1A 4RXTA 2JRLA 1U2QA 3A0RB 1SRRA 1JBEA 3QLVA 2A9QA 3LUJA 4KV7A 2WMYA 2IPMA 1APBA 5D2CA 4PICA 4WUTA 3HEBA 5C5EA 1QQBA 5JS1A 1Z16A 1YMUA 1YS7A 2FMKA 1ZGZA 3OLVA 1EWTA 4JB0A 5CNJA 3O1JC 3BRQA 3KKEA 3LTEA 5TQJA 1M5UA 5KC9A 2OQRA 3NHMA 4KQ9A 4LE0A 4RXMA 4TMYA 2MYUA 1DJMA 3QELB 1S8NA 3UK0A 4F12A 3H6HA 1BDIA 4RY8A 1LJLA 4EYKA 2B1JA 1TJYA 3CKMA 4H3HB 4FE7A 5HSGA 3C6QA 2M1ZA 3RH0A 3IPCA 2RJNA 3D02A 3DLBA 2WB4A 3JVDA 4G0PA 3Q7RA 4JOQA 1JWLA 4HNQA 4P1ZA 4QPJC 3T38A 4MR8B 5JNSA 4UHJA 1KRWA 3KSMA 1RZRA 1JL3A 5KI6A 3GT7A 1JFSA 3IP5A 3L6UA 4MQEA 1XHEA 4WXEA 5ED4A 3N75A 3C3MA 3TB6A 3DLHA 2E4WA 1JHZA 1JYEA 3QK7A 3RVJA 3TD9A 5TQ2B 3VNAA 4W5OA 5GOTA 1EFAA 1SXIA 3H5LA 2FMHA 3RQIA 4LRQA 2TMYA 2NT3A 4Z0NA 2PKXA 5DCLA 1DC8A 1Z26A 4RS3A 1TLFA 2A9OA 5EWLA 3FFTA 3KCNA 3KG2A 2XDYA 3RVMA 1DBPA 3TO5A 5BR1A 4PYRA 3A3KA 3KYJB 2WWVD 2QVGA 4YV7A 3IP7A 1FFGA 4NQRA 5JNWA 4Z4IA 1FQWA 3GL9A 2PUFA 2PUEA 2FQYA 3OLYA 4F8JA 1HEYA 2PL1A 4LE2A 3ILHA 4MGEA 4Q6BA 4KRFA 4PE5B 5IEJA 2ZAYA 1A2OA 1OXBB 1UDRA 4O5AA 1ZY2A 3HDVA 4MS3B 4GPAA 5HQJA 3TX6A 2FN8A 3RVSA 4Z4EA 4KFCA 4NICA 3C3KA 4D6YA 1VRVA 2MSWA 1FFSA 1YMVA 1NY5A 3Q7SA 1NXXA 3H5TA 4ETMA 1E2BA 1J56A 4P98A 3CG0A 1Z25A 2FW0A 1NXVA 3CNBA 3MA0A
chains in the Genus database with same CATH superfamily
1QZZA 4TOIA 1IUPA 3EGDA 5IP5A 2A86A 2PTGA 1TXGA 3IV6A 4X54A 5CX1B 4E1BA 1JLKA 3ICQB 2Q1TA 4FJ1A 3AUSA 4L8GA 3K0EA 4NV3A 2ZIFA 3R1IA 1KFKB 1C3OA 1RQ7A 2IX9A 1P2GA 2PYIA 4J2HA 1AN0A 2F4NA 5E9JA 3TJMA 5KX5A 1Y7LA 2ZJ4A 3EC2A 2WOJA 3DB1A 3WKDA 4EJ0A 5IBRA 2JZNA 4N01A 5TPZA 2A1TR 4HH0A 2HF2A 4L0CA 2D1QA 1XLUA 3WJ1A 1HDOA 5K8IA 1LPOA 4IIGA 1AHNA 3IODA 3AXTA 2ZYTX 4FGKA 3RBXA 3KKOA 3FB4A 3MT8A 3UM9A 4MVJD 4NULA 4U00A 3ZBQA 2XSZA 1R6XA 1F2TA 5DTJA 1NZDA 2CUZA 2PUJA 4NL4H 1JH9A 1T6ZA 4Q4DA 1CJMA 1KYXA 3EPRA 3QYJA 4LV8B 1N6NA 4F1WA 1AKTA 1IY9A 1KYIA 3BK1A 4MV0A 3X2SA 3FI9A 4ARSA 1O9BA 2OY0A 3E3LA 5JMTA 1N92A 2HWUA 2TYSB 3OPMA 2X2PA 3T3DA 3QU7A 4HXEB 5IZ4A 1LB1B 4UXIA 2ZSEA 3SZGA 1FMJA 1CBUA 1NNEA 2VNJA 3AUKA 2GAFA 4XLLA 4AMVA 4HXFB 1RHJA 3FTFA 2JEYA 4TL9A 1L4YA 3WNBA 1JLHA 1MAAA 1SQGA 2JFZA 1BCSA 3C8UA 3QNUA 1N9ZA 3TAHA 5C0OE 2VH1A 5HHTA 2OLEA 4P0PB 2V6MA 1JKXA 3H9GA 5E2AA 1TYEB 4U0JA 2A2ZA 3TTVA 3X2EA 3T9FA 4AVYA 1E3WB 5TMPA 1AIPA 4RABA 5FBZA 4MWZA 1T13A 1GN9A 4NFSA 5EZYF 2J9RA 2W4QA 4YMTA 1Z06A 2GZHA 3OWOA 4QODA 3OE5A 1E3TA 1E2DA 1KZHA 2HF9A 4NBLA 4DLVA 2ZSIA 1XMQB 5G0SA 1BMFD 2J3EA 4IINA 1TQDA 3ZYCA 2TSYB 3T3GA 4N54A 3COPA 1SKBA 3MT9A 1KZ1A 1HTBA 2V54A 4A16A 1E79A 3LQRA 4HD8A 1DTWB 1GVHA 1Y7TA 2F00A 3K0AB 4OJNA 4P84A 3V33A 4HTAA 3L01A 2J0VA 3ESAA 2VF7A 3OTHA 4MIKA 3Q8LA 1NBEA 3O3CA 2I6GA 2ZIUB 3HJTA 5F98A 1Y1QA 1Z22A 1KTVA 3AL2A 3Q41A 1YS2X 4ER6A 3CLTD 1ZUWA 2F9MA 3GVXA 1WUJS 5AHOA 4Q3AA 3AGPA 5GM1A 1RYEA 4A5OA 3JASB 3WICA 2K7ZA 3NIGB 4JA2A 2ZBPA 3OT1B 1HPLA 3N3BC 2NG1A 1MJFA 3AI2A 3IHLA 1R0XA 1KY4A 2HRBA 1DAKA 4UHBA 1C3JA 3I2FA 3OM0A 4RIFA 3LHKA 3V8PA 3LTNC 4M7PA 1PE0A 2AN3A 2Q3LA 2WF7A 2JGAA 1PQWA 1U2TA 4S1TA 2NTYC 4KYTA 5EE1A 3H5NA 3V2HA 3UT0A 1E8DA 4C30A 4HPJB 1W19A 4B0PA 1CUFA 1KAOA 4F9EA 2OFFA 4KN6A 4GOKA 3Q15C 4EG8A 1UXKA 3QVMA 5I7FA 1PWZA 1WPRA 1KAGA 3STHA 5IM4F 4QBHA 2Q6LA 3C1OA 4JT9A 4MW6A 5KTSA 4JBIA 1U8CB 2FDCA 5LN1A 3DPIA 2LCIA 4YAIA 5LP6B 4M1EA 1YI8A 1M8FA 1RAFA 3ND7A 1E3WA 4H1TA 5K4GA 1N34B 3W5CA 2PUGA 1KSFX 1DMSA 3NO4A 4NKRA 1TRKA 3RSGA 3D0OA 4OHWA 1FVXA 4FR2A 4OD0A 4M1KA 3DZKA 5GPBA 3ZXIA 2PGDA 4L2IB 3D6VA 4HFRA 4FZRA 3UOGA 4DDVA 4TV8B 3KSBC 3GRZA 5DM1A 4LKOA 2DR3A 4YAGA 4EF4A 4N0PA 4UTPA 1GGHA 3JQGB 3KQKA 5AQEA 5I9BA 1KZ4A 3DUFA 3Q1LA 4G4SP 3L8ZA 5AYVA 2ZIVB 3D0QA 4Q4HB 1XRMA 3A6DA 3K0AA 4ZO4A 3RAPR 4E5MA 1FFWA 3VU3A 3OIGA 1USIA 3EIQA 3SXUA 2OPHA 1QYWA 4FFSA 4GICA 2OWEA 2ATVA 4ALMA 4RKQA 1OILA 2ZWIA 1CJCA 3SX2A 2AFHB 2J8ZA 3EGCA 4IJWA 3GUVA 3FH0A 3G5MA 4RQUA 4RLFA 2UUOA 1GUZA 3JASA 5CDFA 3GPLA 2VLBA 3OT5A 4P4SA 5EIHA 1BS9A 4DMHA 5G4LA 1LVGA 2VA8A 3ADOA 1G8GA 1C14A 2E5WA 1I6LA 2NXEA 2X4IA 1GARA 1V11A 3LF2A 2ZSUA 5BO5A 5FOTA 2F3UA 1WE2A 3KEOA 4ND7A 1IWPB 2PBRA 4NJEB 3FCSB 3LA6A 5JYCA 2GAOA 3V1YA 2ZVPX 3H8WA 3ZHOA 4A23A 1GPH1 4BC0A 3BYZA 3HU1A 3LUKA 3WL5A 4DBLE 1ULBA 5IULC 5G3ZA 4COKA 3CZ9A 1UAYA 4NBRA 1QRTA 1GSIA 1RXYA 4F5DA 1Q5PA 5AOCA 3B70A 3CO0S 4BQSA 2WKPA 5CDYA 4Y2QA 1Z33A 3ND8A 1PI3A 1Z4OA 1E2KA 3QX8A 1RCUA 4DNOA 4KPEC 2Z5GA 2ZRQA 5LYJB 1IQRA 4RLSA 4A92A 2H5JA 5DN9A 4BTEA 5A5GA 1T1JA 2LNDA 2AUTA 4PSVA 4MUEA 1G3QA 1OPRA 1HTWA 1U7ZA 1YI1A 1FNBA 2VC2B 1LBQA 5IANA 1Q7RA 1X2EA 2PX4A 4JUDX 2OCDA 4TT8A 5KSOA 3M3PA 5ALDA 2QK4A 4C7OA 1UC5B 1UK8A 5A0TA 3LUDA 3MILA 2QLTA 1IXKA 1JUDA 1NSYA 4M9RA 3WS7A 4AURA 4QSHA 5CG2A 1VLMA 4F4CA 4EF5A 1KF0A 1RYNA 4L2IA 1II8A 1R12A 4HDOB 4XYGA 5DGHA 1TZJA 1T2NA 4KNVA 2Q6OA 5BNWA 4UEKA 3ZV5A 3ERCA 3EVTA 1XZBA 5AVUA 1G20B 4L6CA 1WDWB 5FTNA 4JJZA 2W2TA 1TZ2A 3GJ4A 3IELA 2QR3A 4BB6A 2XYQA 4B31A 4X44A 4KR7A 1O5OA 4PSAA 5EEHA 1V5WA 1QRDA 2QG9A 2FSFA 4HJRA 4JJGA 2V0CA 4TTJA 5E38A 1PBTA 3CEMA 3SVZA 1VE1A 3HBAA 2H0AA 2P4EA 2PCLA 3DHWC 2O4CA 4V02A 5A3SA 1T4CA 4A0GA 1JW9B 2JPDA 4MLZA 2GPBA 1VCHA 2HFJA 1OY1A 2NZYA 3N0TA 3WNZA 3D8NA 4FHEA 3ZXUB 3L8FA 4PG4A 2F3PA 4K6GA 4LVUA 3DTVB 5L3QA 2XNCA 1P7YA 5L7WA 1YSCA 3FCYA 4L74A 3O4FA 4PC7A 4ZJUA 1XCBA 2W48A 4WFIA 2JLXA 2NACA 1F48A 3SJAA 1XI2A 1DRUA 2AJLI 2ZT7A 1O94C 3O8BA 4O2AF 4B48A 4L4YA 4YRZA 1V95A 1USGA 1JWAB 5IBQA 1HRDA 3E9NA 1E94E 1VHDA 2BKVA 3B85A 3ET4A 3HCOA 4NNPA 2GF0A 1YE5A 1HORA 2W6IA 3H2IA 1NSTA 3KR2A 4XJVA 2OV3A 3C74A 4GGPA 2RONA 2FOXA 4QULA 3M6UA 4CKEB 5IARA 4Y67A 2HAEA 4QBTA 3VBEA 1SG9A 1CW2B 4JLPA 4L5BA 4V24A 4A9AA 3KYCA 3MGKA 3RR2A 2C78A 3SLRA 3UMBA 4EFDA 2WMOB 3L3BA 3TJRA 2WZBA 2MSLA 5J2TB 3T5BA 2B2CA 1JE1A 3PL5A 2NSLA 1TF2A 1T1RA 3IIEA 3V46A 5BSKA 2RB5A 2H7YA 2BR5A 1ECPA 3W2EA 5G3YA 2OD7A 3DBRA 1L9XA 3I9JA 2B37A 1HDIA 4JP2A 4NV0A 2AFIB 1CNEA 3IOEA 2QUKA 1RR6A 4P86A 5EZSA 3W8DA 3KEQA 2BMAA 2O8VA 3UXYA 4MVJE 3L6CA 4HGPA 4QHYA 5A3JA 2QY9A 1JFVA 2Q0HA 2OHGA 2PX2A 2VRNA 3OM1A 4DDHA 4KE6A 2QMYA 5JVDA 2JD1A 4FJ2A 3RG2A 3DT8A 1GGKA 1FTWA 1P7WA 4HN2A 4HNAA 4JN6B 3UKDA 1V8BA 2WWHA 1GADO 3QEMB 1NLUA 3CEHA 3QPWA 4J76A 2J45A 1FP4B 2NYUA 1SC6A 3C3AA 3MJTA 4P3NA 4OHMA 5EP4A 4PONA 4L85A 3ABOB 3SM9A 2ZXFA 3ZJ4A 1XNQB 3ZHCA 2OBMA 5KTKA 2CV0A 2HBQA 3H84A 3DH0A 1JDTA 4CE6A 1L8LA 1PT8A 3UGJA 3FTPA 3TEJA 3W06A 4NJOA 1T3ZA 5AH0A 4BLWA 4QG3A 1QYCA 3AR9A 2DETA 1FC0A 4V0OA 3SOPA 5PNTA 4ZCLA 4BWGA 4K40A 1ILWA 2H1OA 3EASA 1FXUA 3OECA 2V4MA 5LUAA 1U7DA 4FFLA 1CVIA 4TMFA 3DBHB 1SK8A 4HGQA 3DDCA 2ZULA 3MWDB 4Z86A 5HW0A 1CD5A 2W6JD 3T5AA 2P9ZA 1VIVA 2H2WA 5SYMA 1IN1A 2QU8A 2JF0A 3VC7A 2P2NA 3O4GA 4HUQA 3TM5A 5HUJA 3IE0A 3K5HA 3WP1B 1G3MA 4EW6A 4F3NA 4MS4B 5FL7D 1MHPA 3OUUA 3THXB 1KO1A 1V8OA 2BEVA 2GTPA 3HUDA 4PHTA 2IOQA 1UP7A 1ZM7A 1IM8A 3D8HA 4F5ZA 2BFBA 4RVFA 5DXFA 4NS1A 2AOUA 2VOEA 5JSZB 1YBHA 2XZPA 2AFIA 2Q3DA 5TT0A 2GAAA 2XW6A 4DB2A 1FNNA 1QKKA 2XUAA 3KJIA 1RWMA 3ULKA 1N3LA 3FDFA 3JSXA 4R1NA 3A9UA 2ZW9A 1CEXA 1CZKA 2D1SA 5AXAA 1XVVA 5F7OA 1EWQA 2VHVA 2GERA 1SOAA 1WPQA 2QWXA 4KBYA 1YC5A 2C42A 4QATA 4I55B 3RAJA 5AXCA 3D8RA 2CLMB 4HYEA 4MWDA 1N5MA 1VI2A 2GS9A 3WK5A 4Z9AA 3OZVA 4YLGA 2QXUA 3D3NA 2K4MA 5JZOA 1TRHA 2JLRA 4QOEA 2H0QA 4A8JC 4UMDA 5DCUA 4E30A 4OI0A 1QO7A 1UPBA 3BIOA 4PZYA 4MPRA 2Y2UA 5E1OA 1QYDA 2GPWA 4DUGA 4BNUA 1RIIA 5JQGB 1ZXXA 3IEXA 1BU5A 1JLSA 1U2QA 2DPGA 3X1YA 1C9YA 2UZ3A 2ZS7A 2D54A 3N1UA 2K2QB 3PC3A 5BUCA 2E5FA 2JGLA 2X19A 2X3YA 1LRJA 3ADKA 3M5PA 3ZNPA 1W29A 2WMYA 1HNNA 1H22A 1KJYA 1JIXA 1NNI1 2ZCVA 3L41A 3PK0A 4HJXA 4IDHA 5KYWB 4UQPA 3ZHVA 1T29A 1ADYA 4CMEC 2WJ3A 1WV1A 4AMBA 5FOWA 3O1JC 4GQIA 2RI0A 2M1XA 4W9MC 3DAPA 1IBKB 5K99A 1M5UA 1L7QA 3FNBA 4V2UA 3LGXA 3P52A 1Q7EA 1F38A 3TR5A 3PEYA 2XA9A 4Y2JA 4X63A 1U3UA 2J5KA 3UOAB 3T61A 2IIPA 5JLJA 3PWKA 2IGBA 4V38A 2AUMA 5IK2A 3I39X 2H1IA 4J75A 2HEGA 2EFJA 2HQ1A 2Y0CA 5JSZA 4M1OA 2DE0X 4RYLA 5HIJA 4DYHA 4MJ7A 2GK7A 3ABIA 2JFUA 3F98A 1RWOA 1XNRB 2GEUA 5I01A 1RZRA 5T57A 4PZAA 3E4CA 4UPEA 1FDOA 1E3SA 5AIAA 2OD2A 2RGNC 4K9MA 4TRJA 2JLWA 3M1AA 1JHZA 2BDTA 1U2DC 3HU2A 3CWQA 2XB9A 2OZKA 4GL4A 5JY1A 1GGJA 2IHTA 4LRSB 2ORIA 4LRQA 3VTKA 4OXQA 2M6LA 2D13A 2X5KO 1VFPA 2FB9A 4PSUA 3GYGA 1MO2A 1B6TA 1WB6A 5ALOA 2II6A 1MJGM 3D7NA 3I8OA 4XWWA 5KKNB 1L8OA 3CF6R 1W73A 3DOCA 1BSVA 4IYRA 2DQ4A 3A3KA 5BN5A 5JQGA 1RRPA 4NBKA 3OLCX 4Z4IA 3UENA 2QQ5A 4PNHA 3G23A 1VRWA 3RC9A 1VSVA 3ZCUA 7REQB 2B8JA 4OU5A 1QVAA 3I3SR 2FQYA 4HB0A 4ONEA 1K7CA 5IW8A 3SHTA 5CLHA 5JUWA 3FOFC 4MW5A 1Z2NX 2D1TA 1YCHA 3PR2B 4O4LA 3SLGA 3PL1A 3TCXB 1EZZA 4OXXA 3QG1A 4IICA 1KU6A 3WIBA 1NZJA 3NJRA 1UFRA 2DHEA 3G82C 3OU6A 4L0DA 3R9IA 3UK6A 4B75A 2CFCA 4KO1S 1HY3A 1C8VB 4E33A 4UUPA 2GARA 4R6XA 3W5AA 3IUEA 4F5YA 2QVYX 2B4YA 1O97C 4MJLA 1Q22A 2REXB 4WZBE 5EL0A 5IYZB 3LY5A 3J7AC 1A9ZA 3PDCA 1HT0A 3D5QA 2NPOA 2IJGX 4E12A 2CLFB 2ZAMA 3CG0A 121PA 2G9VA 2W0SA 5DGTA 2ES4A 1TZKA 2QGZA 1FY2A 4LCJA 3TZ6A 1E9CA 4YALA 2A1TS 3DAFA 3IBTA 3VH2A 4R2HA 3L4JA 3KB8A 4FKBA 1G8HA 1TO2E 3QFCA 5LBTA 1T2UA 4V1CI 1MORA 1JVBA 2QRGA 2XI4A 3OHPA 4ZD6A 3A6ZA 2ZI3A 2WV7A 1YULA 4IXNA 1D4AA 1GG9A 3AM4A 3CVUA 3ND5A 1CUCA 2IYPA 2J5RA 4LDZA 1I6MA 1EE2A 4F6LA 1JIQA 3ED1A 4IZHA 1NDUA 3FAZA 2JKZA 2WU0A 3OX2A 3TOSA 4M83A 4ABTA 3FFWA 5EHNA 4RKEA 4RKRA 5AUPB 1UM8A 1Z0AA 3K92A 4K9KA 3QXSA 1X86B 3WWPA 5DNYB 1E7QA 4YUXA 3JAMA 4UD6A 1XMVA 3FETA 4IFIA 4XSGA 2VJKA 3D6HA 1O89A 3JQQA 1GGNA 5H5JA 1QLJA 1SU4A 3I8XA 2QE6A 2HZBA 4GMFA 1HC7A 1DB3A 1Z5VA 3NBKA 3WNCA 1J0CA 4F6RB 1VKJA 2R5NA 4RBNA 4LWZA 3WX0A 3FOWA 5BN1A 4Q7QA 4C3UA 1C3VA 1GUDA 2PR2A 1M6EX 1WXHA 1UWCA 3WV4A 1A98A 2RHMA 3MXOA 4MKHA 4LWPA 2BV3A 2E89A 4HDSA 2GZ3A 4D9KA 4QVIA 4D1YA 4YASA 2HXSA 1PGOA 1Q7GA 5AKIA 5E2BA 4GSLA 1UUFA 1OVGA 2EKDA 3EC1A 4MB6A 4MMXB 2A84A 1O77A 2BCEA 1UMBB 3ABZA 3KP1A 3O93A 3IRUA 3QG5A 2IBSA 1T8SA 4KX5A 1USKA 5HS6A 3V4OA 2LPMA 2ZG6A 3D3JA 3VQTA 5JS2A 3NT2A 4UNRA 1V8ZA 4NCXA 2QTVA 3IHTA 1MGOA 2OZLA 1JDVA 2PUCA 4C43A 2H59A 3SNHA 2ZWVA 4TVBA 3UVEA 2DEUA 2ZQ5A 1GAXA 2CBGA 4M9XA 5B3AA 4C0JA 5FYQA 1IG0A 3MINA 1JILA 2QM8A 4CLRA 4OLBA 4LSWA 4N8DA 4NAUA 2CW5A 2HHJA 4U5XA 2R1UA 1TW3A 4UMVA 2G70A 4D44A 5HJ5A 5LBUA 5I5EA 4ZCPA 3U40A 4HADA 3FMPB 3Q3VA 2GVNA 3GFQA 1G16A 4Z1MA 5HDQA 4JI8B 4WN9B 4AMGA 2VP3A 4YUAA 1S5PA 2E55A 2ZRPA 2IQ5A 2GM4A 3E3MA 1DAFA 1E7WA 3BMOB 2PEYA 3MUNA 2C5BA 3E9DA 3OCJA 4D9NA 8AT1A 3ABQB 4RF4A 3ZDEA 2ZTHA 2SCUA 2H8GA 2YXBA 5JZ9A 4YMVA 4Q9LA 4XQEA 4YAOA 1Z36A 1NBIA 5ES4B 1J1ZA 3MLBA 5F2NA 2F1OA 1Z6QA 1NASA 4DTCA 3I01A 1N8SA 2X1VA 4TYWA 1ANKA 2CNDA 2VQ6A 3JQ6A 3KAQA 2IPNA 2YHIA 3IP3A 4MVJM 4QFDA 4GDMA 5DE3A 3X1JA 5BVHB 2A6PA 2YIJA 4WJKB 4F6RA 2TECE 4MVJH 1QYIA 3GBVA 4C03A 1YZFA 3NW9A 1DI0A 1K06A 2VQSA 3PNLA 4O8ZA 3KXKA 1GGFA 1SUEA 3HA3A 1XQ6A 1E7RA 4E5NA 1UMCB 2UUCB 1LCIA 1S6YA 1PYOA 2A9KA 3KPWA 1CR6A 1Z45A 2OL4A 3EAGA 5EXEA 4KP7A 1PS9A 1PZNA 3Q6MA 3VPFA 5KJ6A 1RRMA 4BP9A 1KVQA 1NAIA 1GKLA 1KI7A 3X3HA 1T1SA 4D92A 2ZBGA 2HBYA 4AJ9A 1UMBA 1E4EB 1TF7A 4FKMA 4PAOA 4W8OA 5IG2A 1XNHA 2J9FB 2LIVA 2CJYA 2VAPA 9GPBA 1SR8A 2AEMA 1U7WA 4ZHQF 2I3BA 4GOJA 5LL6P 3CPSA 3OFKA 1M2OA 1PT5A 1GVNB 1ZMTA 2A59A 2P7HA 3DGFC 3MYYA 2ZPAA 3VR6A 1F7VA 4URYR 2Z5VA 5K2MA 1ZI8A 3EQ8A 4IXTA 3PE6A 4UVEA 4WSOA 5AJVB 5TEWA 1Z18A 1UXJA 3ZDFA 3WWZA 1RLUA 1ATZA 4EPTA 1PNVA 3G1TA 1H93A 1F3OA 1NF2A 5LP6C 1IE3A 2ILVA 2JIPA 3RTCA 1EVZA 1V9CA 1H4QA 2JGRA 1VLJA 2QYOA 4WN9A 3HZOA 4TZKA 2QM3A 3I76A 3T95A 1UJ5A 1SVLA 3IEPA 5KPDA 1GM5A 1MB3A 1YKGA 3F6RA 2BGKA 3FYDA 3KT8A 3BMOA 3BRCA 4JNCA 4R9VA 3PHGA 4MRMB 4Y2PA 4ZT4A 3ROQA 3UT5B 2NU6B 4TRNA 3GAAA 4I8DA 1FFCA 1UXGA 4LE1A 4ZVPA 4XDZA 3NDIA 4MUIA 4U7JA 5SZJA 2V03A 3V4VB 2JDID 4Q03A 4W5NA 3AP3A 1XDZA 2AL7A 2VXYA 3EVCA 2GTHA 4QDJA 2CVQA 3BB1A 1QBKC 4I1OA 2J41A 3K1YA 3QNMA 4TT3D 4JI1B 1ID1A 3I9OA 3NC4A 1DE0A 4NPHA 3L5KA 3RBVA 4CEHA 4ZVUA 4OHPA 1M2WA 1BAPA 1ABEA 2Q3CA 4UBJA 4UPVA 4EY5A 1FTSA 3PDWA 2IODA 1TCBA 1UMKA 3EWSA 2FZ4A 4LZOA 4MQLA 4P2BA 4Q93A 4GYWA 4Q4JA 1L4GA 3OZSA 4H08A 3VGJA 1E63A 2DPXA 3T3HA 1G5QA 3JX9A 2CLKB 4UVDA 5K3CA 4JJ8A 3HTXA 4OMCA 4GDFA 1PT7A 2IYSA 3QPBA 1T36B 1ZU5A 3AFIA 1M2FA 4RGBA 1E4EA 2JVIA 4EHHA 4URXR 3DD5A 5DULA 4R01A 4GI2A 3WLJA 3U37A 4D0NA 4F93B 1EM6A 2GFQA 4UFNA 3ZD8A 1GKKA 3NTOA 4M0DA 1U0HC 2DFDA 4O4IF 4Q7JB 2X9GA 2IH5A 4J16A 3TLCA 4W8GA 1OZGA 1FYVA 1N5RA 3KQYA 4BJHB 2Y1FA 5BURA 4RK7A 4FR0A 2E1PA 4LI0A 3IT1A 4G1BA 4XDGA 3OA2A 2C94A 1NV9A 4KITB 1EVLA 2G76A 1PTJA 2ZJYA 1G5TA 3QU4A 3L1KA 1UODA 3ER6A 4HGNA 3WMEA 4G25A 1QIGA 3QLUA 3AFOA 3TSAA 3GLFA 5TQVA 3OZRA 4Y6SA 4B45A 1BWRA 2QAGC 4X1OA 1YCGA 2NGRA 4JB8A 1XTJA 4I14A 4CDNA 5AVWA 1R4NA 1ODTC 1WXFA 5HTOA 3UWPA 2NU6A 3GJQA 1B15A 1BA3A 1EFLA 1EP2B 1GXSB 2EQAA 2IIVA 1ODJA 2VBIA 3IX7A 4G4SO 3UAVA 5BQXA 5SYAA 4E3WA 5JSHA 3GUZA 2CMHA 4TM8A 1QMPA 1RKXA 5IABA 2BFFB 1P6XA 3OKAA 1MOPA 1QHIA 4IX1A 2PA0A 4HQRA 4X24A 2D59A 1TW2A 4CW7A 3M33A 3I0MA 1QC5A 2Y67A 4FFMA 1KXJA 4N40A 3DVSX 2FPPB 4NPCA 5KQPA 1R4MB 2GEVA 5COQA 4CV3A 3FYUC 2V65A 1S3GA 5IJ0A 5EJ4A 1GCUA 1R3DA 1RM3A 3U61B 3I9LA 2PO5A 2VT7A 1RC8A 3L77A 5FOUA 2PKRA 2QVLA 3NRBA 1UEJA 3MD0A 1C80A 3ANLA 5NLLA 3JYLA 2F55A 1EJBA 2JFGA 1W581 3HADA 5E7IA 4P32A 1U02A 1UKEA 1NG9A 4XWGA 2X2OA 4O3FA 4G0XA 2QBYB 2NX2A 2YN2A 3JQAD 1YTLA 4GLBA 4K46A 2ARKA 2BGRA 2PR7A 4R2XA 1B93A 5ADUS 5K8JB 1LBHA 2R6AA 3PE3A 3Q8XB 5D7NA 1G8FA 1PR4A 1ZWKA 2YMQA 2PIAA 4QEZA 3WGVA 1W7AA 1VCOA 2EKBA 2OLKA 2VNHA 3H8VA 4M0EA 3VR3A 1HNWB 2VUHB 2ZI6A 3DEHA 4KREA 3TUJC 1UKVY 2G25A 3N5KA 3IOMA 3KU4A 1RYZA 4IIEA 2IIBA 1NJGA 4TS9A 4D3ZA 3KD3A 3C15C 4OX9Y 1QDUA 1X9GA 1ZKDA 2Z6VA 1HZZA 2APJA 4CEJB 2ZUFA 1TM7E 4KWEA 1TMYA 3D6MA 4RTNA 1O1YA 4PPFA 2AV6A 3BILA 4YJHB 4GZLA 1O58A 2V7GA 3V4ZA 5FBKA 3AMVA 4DMMA 3P9PA 5EJ9A 4AQ7A 5EXSA 3M9LA 1OH8A 2Z56A 4A27A 4WT7A 4PPYA 1Z8HA 5GVRA 4YRIA 4MPDA 3U3DA 1S2MA 3HVRA 2ZU6A 4Z99A 1XK7A 2HWYA 2PFSA 2XQKA 5HXAA 3IKMB 4OLFA 4XOIA 4F2HA 1NP6A 1ZH2A 3MCZA 4HKTA 2NZJA 3F46A 4IIVA 4G9GA 1SMKA 3BD9A 4UQLA 3EVEA 5ILGA 1XQ1A 3CG4A 5FPQA 4BPBA 5IX8A 4C4AA 4U4AA 3PPYA 2FPPA 4Z54A 3PC7A 1KY5A 1P61B 1ZL0A 1SURA 2ZTSA 4F9TA 1OYWA 4I08A 4MW2A 2L19A 1IWBB 2WPDD 1NVBA 4UUNA 1YJ8A 2RMKA 5EG5A 3OPVA 1JSRA 2VKTA 3OMLA 3ZE8A 3B3QA 3EOAI 2ZAIA 2NWQA 4CHTA 3T5MA 4B6RA 5JI2E 4YRKA 4RD6A 2AXNA 4A6XA 4M1SA 4DPMA 4P4GA 1BS1A 3N39C 3WLAA 4LGMA 5TS2A 5KHOC 2DGDA 1EFRD 3PXDA 4Y0VA 3NJ4A 4ZYZA 4HYQA 4MRSA 1DAMA 3L0IB 3QIAA 2A4MA 3GEIA 2J9ZB 4ML3A 4PVCA 1E6WA 4O1HA 2WRZA 4DJTA 4JP5A 4EGCB 4N0QA 5G41A 3PFCA 3RRMA 1AO0A 1WHSA 3NNDA 3ROEA 4B3CA 3KWJA 2NXNA 4IW3B 1FK8A 1GL6A 2IYNA 2PRZA 1G8PA 3NCTA 1WSBA 3E3OA 2Q50A 3UJCA 3VR4D 3CZ5A 1CUVA 1SCJA 4B84A 4EDFA 1A2KC 1TU4A 1OAKA 1UBUS 2REBA 2O2SA 3WKEA 4FYIA 5TMDA 2CXQA 2GYYA 4ALNA 1A5TA 2ISQA 4IMIB 3RFVA 3KSRA 2RGDA 4JBYA 2VWQA 2K6GA 4YJHA 5FLYA 1QG0A 2ID7A 2P5UA 4AN0A 4B5KA 4C6TA 7ABPA 2H1FA 3RT9A 4OOEA 1I3NA 3EEBA 4KEAA 1KI3A 5IT4A 4ANFA 3W2TA 1ORWA 3AU9A 4FWBA 1WVMA 1L4FA 2DBZA 2A78A 4QHSA 3RUIA 2AZXA 2H3HA 3CR8A 3G8DA 2R7LA 1U0NA 4X1IA 4LVNA 2XYRA 3DXFA 5E1MA 4G01B 2GPYA 1GYPA 1NJFA 2QUAA 3EG9B 3GD7A 3EVZA 3KBBA 1KQOA 4XR4A 5CHYA 3FOCA 5BN4B 5LCXA 1JQEA 5JYBA 4CLOB 3LQQA 4FLMA 3QYAA 1H5QA 1MVLA 5JTUA 1P62B 2WUGA 2CMGA 4KVAA 3VPCA 4Z9BA 1X1QA 2HNKA 1Y98A 5AW5A 4UEJA 5CB4F 5EPUA 4XR9A 3ZI0A 5JU6A 2YC2C 1KNXA 1SRRA 2J7PD 2QRZA 1LDEA 2DJIA 2XAUA 3S2UA 2GXAA 4BYMA 1GZ4A 2QD4A 2V74B 4ZFNA 1LH0A 1PJTA 4Z0PA 1GGVA 1K8ZB 1XVLA 4B87A 4RH1A 4EBBA 3MWFA 1YS7A 5ALVA 2FMKA 2AQ8A 4KJXA 3Q6IA 1K7EB 2VNSA 4TPKA 4YRBA 3KETA 4J0CA 1NAHA 1XN1A 1MFPA 3S2FA 1T9HA 3WMGA 5KC9A 4TMYA 3L8GA 4LE0A 2P1DA 2JFNA 3FUCA 4F12A 4YV2A 2QGNA 4MEBA 1Z62A 3FY4A 3UC9A 4LDJA 5DHPA 2JGJA 4M86A 3M3HA 5IDXA 1J24A 2RHOA 3I64A 3WGJA 4BQNA 4L8FA 3NWBA 4DFDA 2VTVA 1ESDA 4LW8A 4XX0B 1YA6A 2BHSA 2CVOA 3DLBA 1R74A 1V1JA 1EK1A 1AQLA 2WYHA 1F3LA 3IBFA 5B57C 2AW3A 1AGPA 2VHTA 3L1VA 4HTFB 1Z7EA 2PKEA 5FJIA 4YPVA 1ZD3A 3AL0C 3QEOA 1E18A 3K70B 3CPEA 1B8VA 1LEHA 4X6UA 5HCNA 5FUQA 5J2UA 1JYEA 4CIBA 3RVJA 2WNSA 4ESHA 5JY6A 1TM4E 3DBVO 4WDQA 1NBOA 3A9CA 1W46A 2ZJ8A 4LZAA 4EAAA 1XZ8A 2KQUA 4J91A 4C0HA 1UKAA 3JYNA 4D0RA 5BN4A 4CLOA 1KYYA 5MGNA 3BSWA 3EXAA 4NF2A 4RCVA 1YRLA 2ASEA 2J7KA 5F21A 3VVBA 4EO9A 1QQTA 1RLIA 1JHUA 3PXXA 4BMSA 2JAUA 2WVAA 1PX2A 2TS1A 4PLZA 4GOLD 3LDHA 3OQHA 4AT1A 2PUFA 1FPQA 1E99A 1LPNA 3ZCQA 2EF0A 4LE2A 4BLUA 4DIBA 4RTMA 1FYWA 3ZW8A 4R0MA 3JQ7B 3N8DA 3ANNA 1H1TA 5CDGA 3R5TA 1OXBB 1U0GA 2YQ4A 4NIMA 4N49A 5GGXA 4JFAA 1WSAA 4IZOA 3LI2A 4LMPA 4MUBA 2H3EA 4A6DA 2UZAA 1NP3A 5EHXA 3H7IA 4K81B 1AQNA 2J3IA 4JLKA 2FPGA 4K9SA 3DQQA 5D3QA 5BORA 3FNRA 5DU2A 5THKA 3RFCA 3CWCA 4W7IA 1L4UA 3ZC3A 2GILA 1ZJYA 2MSWA 3BGOS 3I05A 1VYVA 3MJCA 4V0KA 3W1VA 2CXOA 2HU5A 5DM2A 3HC7A 4YDRA 3GPDG 4RKFA 1HYEA 1UINA 3BIWA 1YHZA 2IY8A 4REMA 1ZA1A 4M89A 4H7FA 3M9WA 3O8OB 3HJAA 3RRXA 1H8HD 3I04M 2FN9A 1M2VB 1MX9A 3OIWA 4AQYB 4R2MA 4RHEA 3M6WA 3WLHA 3ZGOA 3MWYW 4PVDA 2Z09A 4BCBA 1GEGA 3RAGA 5AKLA 1QWSA 2GRAA 3A05A 3UK2A 4B2LA 1M83A 3IUJA 4OQZA 1D07A 2V7BA 1H8HA 5FOSA 1NKVA 5JARA 2BOVA 2PE5A 5C18A 4NBWA 3GGCA 3PGMA 2XMSA 3GRVA 2Z30A 4K8OA 4B7UA 2DTDA 4BV9A 2FPSA 2BCGY 4WEOA 3W7BA 2VF2A 4XIFA 4BRWA 1GA4A 4QPPA 3NVDA 3Q1KA 1YONA 3M8KA 2QLFA 4KTTE 3IJEB 5TLSA 1ECCA 1UBJS 3GEPA 3W8RA 4BN5A 4BBJA 1BH2A 3V3TA 2PZKA 2ZUDA 5H81A 2H2HA 5LM3A 2NXJA 1NA5A 2JFYA 4AUEA 4TYPA 1I0IA 4EG3A 2HT1A 1I3LA 3K9GA 1MR3F 2B4RO 1JT2A 3B6IA 4HDRB 1ZJ5A 2OEPA 3G9QA 4TLEA 4DZTA 2BFDB 1T9KA 3AF2A 2D8AA 4DA0A 4F92B 1W85A 1SHLA 2JAWA 3GFBA 1ZIDA 3OZFA 4F7WA 1BXGA 2VNKA 2XZTA 2NQ8A 4XVUA 1U6JA 3AF0A 5K0CA 1CFZA 2RHWA 5FORA 4A36A 3Q2KA 4GR9A 1X8LA 1I80A 2NTNA 2VJMA 3KL4A 3M83A 5TC4A 4UE3S 2JEZA 3PLAE 2F4VB 4RVNA 3CR3C 1W5AA 3ZNQA 2AYYA 2C8KA 2B78A 1GITA 1TF5A 2CZGA 2BEUB 3HCPA 4FSDA 2Z8YM 4ROTA 3MFQA 5A05A 1VECA 3RVPA 2IITA 1A9YA 1QFSA 3H1EA 4K7JA 4N03A 5DOVA 3RM3A 1G5HA 2BY4A 3P2MA 5DHUA 4TX1A 1Q1BA 4YJ2B 5AP9A 2A9VA 2G1UA 1FP1D 4IIJB 1J8DA 5B6IA 2FMIA 2OFXA 2I55A 1HQDA 2B4QA 4IXDA 2B6HA 1G8KA 1GTL1 3O9MA 1T9GR 3PDUA 1CUAA 1C30A 3CSUA 3B1FA 3DZJA 1DRKA 5HJ2A 1GSHA 2C82A 1DELA 1EXNA 1UPXA 2HHLA 4HO1X 4N3AA 5T4BA 4EITA 5I45A 2HQOA 1NG1A 2ZJ7A 5DGCA 1XHLA 3BA6A 1WULS 2OZVA 1FFXB 1K6EA 4C5AA 3U3XA 1B74A 2I99A 3GUUA 5TX7A 3EIXA 1EXDA 1P8JA 3FWKA 2OHXA 4HLUC 2FHSA 2VSOA 4YV1A 4B43A 1YJQA 1E2EA 1JHRA 3WGIA 3OT4A 5F76A 2CK3D 4O4HF 4F4IA 5CT6A 2B9EA 4YUWA 3UCXA 4TL6A 3LC0A 3VU0A 3IR5A 4FYJA 3C3BA 2IF2A 1YRHA 4QU8A 4XSVA 4YT2A 2HJRA 3T1QA 4LBWA 1EA5A 1GQOA 1JX6A 1Z12A 3OFVA 3EYWA 3T7SA 5K51A 1D7AA 4QGSA 3R40A 2BFDA 5FFNA 4UM8B 5CNMA 1ND5A 1NPDA 4OSEA 3WY9A 4ESVA 3GQBA 3LGSA 3KHUA 1TEHA 1I33A 2X13A 3B7WA 3K32A 2UU9B 3C5HA 3ZDDA 3ESYA 1O94D 2XNDA 4HWRA 3EPKA 5HJEA 2QVCA 5KKCA 3KT6A 4B3SB 3AONB 3O8CA 1Z2PX 1IBLB 2I9KA 5EMHA 5G0WA 2BYTA 4K9QA 4QJBA 1THTA 3BD7A 2QMHA 3NB0A 5LMUB 2W2KA 4U1RA 4WJLA 4G0NA 4BFYA 3SQLA 1X1RA 4PQGA 3HV2A 3AM1A 1JYSA 2JHAA 2X8LA 4JP8A 4MLCA 2ZT5A 3N0RA 3R75A 3UV7A 1ZU4A 2F3SA 2AG5A 1P17A 1MA0A 3S8MA 3U1BA 1JTFA 4M88A 1OR8A 4TMVA 5HF8A 1WQ4A 2C61A 2NZWA 2OUKA 1FQKA 2QQFA 1KVTA 4I2NA 5A02A 4CVNA 3BK2A 1Q0SA 4ATNA 1X7HA 2F67A 5CEJA 2ZR9A 4M0LA 5DHAA 3R3SA 1JIUA 1K6IA 1RHKA 2JD2A 3TQCA 4DNQA 4DCNA 3D7KA 2FVYA 3BWMA 2FXIA 4MTLA 3VXKA 3S27A 4BNJA 5JO0A 1V1MA 3PJEA 4GI7A 3NUZA 1P74A 3S44A 3T5PA 4UC0A 1EDOA 5KTPA 1LC0A 1D2NA 1M8KA 1MENA 3EW7A 1N8TA 1KBQA 3OTWA 4Q4LA 1GNQA 1AKEA 4S2UA 4AICA 3UJNA 3ZI7A 4YCAA 3CC8A 2BM9A 1D5WA 5BOSB 4HQNA 3PVZA 2WOOA 3GD5A 1BJTA 1V7PC 4ENTA 5SY6A 2PD6A 5EJ8A 2P41A 4C7JA 2QE7D 3KPUA 2V58A 3ZQ4A 5DYWA 4YJDA 2FGKA 1QOPB 1OWLA 3K1TA 3Q0TA 1BHSA 5IAEA 3RKUA 3T1TA 2WQ7A 4ER0A 3EDCA 3U56A 2BMJA 3D4OA 1F4LA 2WLTA 3KV1A 4JUAA 3IKLA 4WOKA 4BNNA 5BWMA 1B6RA 2PTHA 4DCJA 5JLAA 4IDBA 4MVJF 3AR4A 1J2TA 2O2CA 3H5WA 3Q3CA 1LSOA 1P72A 1BQEA 1Y34E 3V97A 1CB7A 4ENUA 2MYPA 2PT6A 3EX7C 2C7RA 3BM5A 4WFQA 1QYVA 2NNWB 4GP6A 3QTLA 3VR6H 3EXEB 4IIYA 1T10A 4W82A 4FCTA 4TV9A 4C88A 5FO0A 5B7NA 2X15A 2QP4A 1MD9A 3IFSA 3MWKA 1YFZA 3KZMA 4HG2A 1GSOA 4J0DA 3OEHA 1P1KA 4TWAA 2NU8B 3TUZC 1X92A 2PS1A 3HP1A 4HNSA 2GCGA 2IXBA 2Y6VA 1E4OA 4WK6A 4MI3A 1Z0JA 3CT6A 1QQ5A 4JJ6A 4JL8A 3PNBA 3WGYA 4XDHA 1SQFA 2VDJA 1NI5A 1E61A 5BQ5A 5KYXB 3C2QA 3T1VA 4AXXA 1UWVA 1G8AA 4RMNA 4YRNA 3PTAA 1Y5MA 1XRQA 4F1KA 3IAM6 2NVWA 1T5IA 4BX0A 4YT8A 5C4MA 1AS0A 5A1JA 2DKFA 1T91A 2IX3A 3D6NB 2BTQB 1I8TA 1RM0A 1V26A 1IM5A 4Q7KA 3GAMA 4FGJA 4KBFA 1NI3A 2CNWA 1UQRA 1YB4A 2IPAB 3CZQA 3N6XA 4WXHA 1CQIB 5FKJA 3K1AB 3UHJA 5LZ9A 3WIEA 1HDZA 1X3LA 1NOKA 1PR2A 1V4NA 5AWFC 1VB3A 4YGXB 2H63A 1T43A 2Q8QA 2GLTA 1UBFA 2AMVA 2AXQA 3RREA 3SF8A 1QVRA 4G0OA 1KDRA 4OHYA 3FD8A 1U9JA 3JWIA 1PV2A 1M75A 2XOEA 1BWQA 3OG9A 4B79A 4WH0A 4G89A 4DRZA 5JHHB 4DV4B 3NYQA 1KQNA 1HA3A 1XKLA 1U11A 2H00A 5KOIA 1E7MA 3ZLVA 4TZ6A 4W7HA 1L4EA 2EYQA 2IPLA 4NYJQ 3FGNA 4E3ZA 2ZB2A 3C3XA 3IQGX 4FS3A 4JYMA 3MMNA 4FI3C 4MA0A 4LZPA 5F3DA 1DIRA 3EJ6A 3ESDA 2EQBA 1SOMA 1ICIA 5A4IS 1C2YA 1M72A 4RH3A 3UK1A 4AJ1A 2WVJA 3G13A 5L6MB 4FM9A 4WNYA 2I7XA 1WAMA 5JSKA 1VBMA 1ODSA 3R8FA 1USVA 3A6KA 4B3XA 3GRKA 2JFXA 1CJBA 3IVRA 3BDAA 3IR6A 4L4UA 3ACDA 3FNFA 1IM2A 1CRWG 1N2CA 1D1PA 4QQ8A 4DLTA 2OHOA 1KWGA 4PCAA 1N25A 4WUVA 2YFHA 1YCDA 3E8XA 4KYUA 5TGZA 4B3TB 4GT1A 1IOZA 1UADA 1B0AA 4MXDA 3AOGA 2PWBA 3OBBA 4YJFA 1IY1A 4AWBA 2HSGA 3IEMA 1SBTA 3R24A 1AUVA 4ZTZB 2XXAA 5L3ZA 3T3IA 1NMXA 4HQ6A 3K0BA 1MC5A 5FTWA 3TZHA 3E0QA 2P3QA 3KJFA 3O8LA 4ZRMA 1UM9B 1CFJA 1F0YA 1P7VA 1AY0A 3I28A 3A0UA 1LK0A 4TSFD 1QLHA 4KPYA 4UXHA 1TMKA 3S2GA 2I54A 4JEHA 1PLLA 1Z4NA 3KO8A 3UUGA 3OZ7A 3EDOA 3U17A 1VKNA 3LBAA 1EWRA 2XRFA 3LW7A 1OZAA 3SVTA 1Y4UA 3KJXA 1KQ3A 1SZCA 1ZHHA 2GD0A 4EABA 4CM7A 4GSKA 4XGRA 5GV8A 1TK3A 3NHRA 2VZ8A 3ZW7A 2ZAGA 4KQGA 2IEAA 2YDYA 5DGXA 1X80A 3N0XA 3RIXA 4QG7A 4P8RA 1EBFA 1J0BA 1XZFA 2UZ0A 3W04A 4ZI7B 4EY3A 4FE3A 5ALRA 3TXAA 2WJVA 2RHTA 3C4VA 3QXGA 3MQ4A 1XTQA 5DBGA 4AJOA 2QN9A 4UHKA 3CPJB 1D6NA 1O97D 1ZXLA 4RWEA 1L0BA 1T5LA 2F1HA 2QM0A 3AVQA 4YRRA 4OL9A 4P9NA 5BT8A 2OORC 2OXIA 2IHYA 4HBGA 3TQHA 1U8FO 2A4KA 2C2WA 3WBFA 3PB3A 4C29A 1GCGA 1OGYA 2Q9CA 1W49A 4ZJYA 5JR3A 1W0KD 4HZUB 2YWXA 4XYBA 1RPTA 1OLOA 2ECOA 4ZT2A 2JH9A 2WT8A 2AG0A 3TE7A 2XB6A 2O4UX 5JNVA 2ODBA 2Y1EA 3PGJA 1AE1A 3AX6A 4I9UA 4TVOA 5F4BA 2WG2A 2EAUA 4IFBA 4G0UA 2PVCA 3ILSA 3I92A 5AT1A 1MP0A 1ULZA 3KJNA 4Y2SA 3GUHA 2YCBA 2AWNA 4MVCA 1BKYA 2P90A 4OAPA 2ID4A 4UTXA 2WZDA 5E2IA 5FQOA 5B3JA 1QYXA 4E07A 4EI9A 4RQBA 2VK2A 1J9EA 3QI2A 4YWHA 1ADBA 1CHNA 2I3GA 1TJ4A 4ZAZA 4BDTA 3CUSA 1OMOA 1PFWA 1PVDA 3B60A 3D2BA 3SEQA 4U7DA 3FRJA 3JALB 2I29A 1L8QA 3SIWA 5C8YB 5EWMA 5BMVB 1H3EA 4W1SA 2Q3MA 3E9RA 4MUXA 5HF6A 5KAMA 5LQAA 5K3AA 5I7OA 1JBEA 2B82A 5LZ8A 4BWFB 1DX9A 2OO7A 3JQCA 1OLXA 5KNCA 1APBA 5D2CA 1LY1A 1KEUA 2VK8A 2XVMA 3Q9LA 5ERGB 1LRLA 1O87A 1OBHA 2DBQA 4KH1A 2BMWA 3LTEA 5EPOA 2FSGA 2HBZA 3AKCA 1JDSA 5ARBA 2FPIA 5BY2A 4Y6RA 1CUWA 4RDXA 4RXMA 1RFGE 4B33A 3W5VA 3MGGA 3DEJA 2JFVA 4PC2A 4V0MA 1NDQA 1LJLA 4IWXA 2FG7C 2PD3A 3BE5A 4WXPA 3WXMA 1G7RA 2G0AA 1BH6A 3WLLA 1FJHA 2B2XA 1SM4A 2X9NA 4CG0A 3Q87B 4EG6A 2NUAB 3RH0A 1JQLB 3VR5A 2AW5A 2P78A 2KE5A 1W1WA 1PT9A 2V7WA 1R0YA 2I71A 3VR4H 4CIDA 3IVMA 4A0QA 1EXWA 2G83A 4FOOA 2V6BA 1ZGBA 2OCLA 4TTVA 5FA5A 5AICA 1UK7A 4HC4A 4UNPA 2GRUA 3ORSA 5BYJA 2QN7A 3KYDB 1XHEA 2J85A 4HDMB 4DCUA 1EGVB 3N75A 3S7ZA 3KNZA 1SK9A 3ME5A 1G6OA 3BJEA 2FHPA 1P4RA 2XWSA 3QJGA 3K70C 4JL5A 4H1UA 4GBGA 3PZBA 1DC8A 4R0NA 4ZALA 5IXSA 1TD1A 1WXDA 1ZL2A 2QMOA 5KSWB 1ONNA 4MKRA 5G53C 3LUBA 2YVQA 2FUCA 3NASA 5BR1A 2PD4A 4OJQA 3ETNA 5C8YA 3V1TC 4NXMB 1DWOA 3CRW1 5BMVA 1MOZA 5KJ1A 4EO4A 1IEWA 5JVDF 2GBCA 1XR3A 5CFZA 3NUQA 1BX0A 4HGOA 4BC1A 2BJWA 1G41A 4KSYA 2E18A 3D81A 3MK31 3QV1A 1CDOA 4FR5A 4WKGA 1A2OA 3KJZA 4O5AA 1J25A 4EY6A 3CVVA 1XEXA 1C4OA 2O6LA 1QVWA 3N2KA 4L5CA 2DX7A 1OH6A 4UULA 5GADl 2VDRB 4PX2A 3FNGA 1SZPA 4Q1DA 2Q4RA 3H2SA 3SHQA 2EU8A 3PLRA 1UZUA 5T8KA 4LYYA 4M6WB 1MJHA 3O90A 3IUPA 2HLDA 1IY0A 1SBCA 1FTYA 1NXQA 1WV0A 3KLPX 5LLSA 1NW6A 3QE9Y 3KQWA 3TBKA 1C7FA 3DEIA 4AS3A 4BVEA 4E5UA 3H65A 1KJJA 2ZK7A 1T4BA 4G9EA 4HQLA 1V3UA 1P2VA 3BXGA 3EDMA 4MYSA 2JJ2D 4OFZA 3WG9A 3MOIA 4M7RA 4AW9A 2XEDA 4MHTA 2D5LA 4OB7A 2J9XB 3MC1A 4IQ0A 1B2LA 3W2IA 2MU1A 3TRIA 4ND8B 4RD1A 1Q2XA 4YCMA 4CL2A 1KY3A 2ZR7A 3LYLA 2XCTB 1CEYA 4EYEA 4YLYA 1GCOA 4TXNA 4RTPA 1HE4A 1GRCA 2WSLA 2FZKA 1Y6GA 5HK9A 1G5RA 1ZC4A 1NUHA 1GFZA 3CNNA 3AT1A 5JD5A 1N5DA 1P31A 4RTRA 3EDRA 3PENA 1NPTO 2XUHA 1JHYA 1NUSA 5AUQA 1K1EA 3BE4A 4X7MA 1JPJA 2GTIA 1JAZA 1KKUA 4ZC1A 2G77B 5KMGA 2FSSA 3CN7A 3CH4B 1U1FA 2BTOA 1QAOA 3DMGA 2HA0A 3E4DA 1TK9A 3OAAA 1EQUA 3UOWA 2HIMA 1XAIA 1H9BA 3F4BA 8GPBA 1Z7WA 2CLSA 1HDRA 3KXDA 3K0KA 4G0QA 4GGOA 4C01A 1T5HX 5A4FS 5DTRA 2GHIA 3H19A 3VPXA 2V96A 1T9CA 4H7JA 3JPWA 3ZOKA 5K6RA 4RL4A 1M0TA 3WBJA 1N7JA 2WAMA 1AHHA 1P8AA 1YASA 2ZSJA 3MUEA 5GGYA 2W6CX 3P9IA 2IU3A 5KTYA 3U7GA 3FWHA 1V6AA 1RKQA 2V6GA 2WW8A 4LJLA 1F06A 5CJJA 3ZIDA 1MGPA 1Q91A 4PZPA 5DTEA 1E1KA 3MCTA 4LECA 1PJRA 2P1ZA 4B3HA 1I24A 4RF3A 2NO1A 1ZGGA 1RAIA 4J9VA 2YCLA 2JGFA 4OL0A 2EVWX 4RK5A 5ULLA 2P65A 4G4GA 2X4LA 4BO5A 4ZZ0A 3H3XA 3UYKA 7AT1A 4RD2A 4EOGA 2FZVA 2VHZA 5MF6A 3E7WA 2VH5R 2HK8A 3Q0EA 4ZHSA 2EFCB 1F8YA 2VBCA 1RJ9B 5ELMA 5BWCA 1JKJA 4DC9A 3OJFA 5LOVA 5BXQC 2RI6A 5T5QA 3BD8A 1XJWA 5E6RB 3RTDA 4KN8A 1B73A 1MEOA 1PG0A 2HK6A 4PLWA 2PUTA 4Z49A 5JASA 1XRRA 4CFYA 4BVAA 2I33A 4C3VA 4MS1B 3FGPA 3SEAA 3VH1A 3LUAA 1ZH4A 3S8YA 1OFUA 4QFCA 1Y8RB 3NFYA 1JHVA 2WAXA 2JBAB 3FMVA 3GLHB 5JFGA 5JMPA 1T4MA 4DJEC 4MARA 2GM9A 3O4HA 4RDHA 5JCZA 1A8IA 4BP3A 1E32A 1VMDA 1XCLA 4XD7D 4DV0B 1C7RA 2Q0SA 1JHMA 2BEKA 2Z6QA 1G2QA 1LV7A 1CQZA 2I1WA 3EEYA 3HRKA 2JAHA 4L3VA 3NM5A 4RWZA 1JKIA 5DLDA 4AYXA 3SD7A 3URKA 3KHTA 3H4IA 5AJWA 2WKSA 2HHCA 5T4FA 1I5OA 1SC9A 3L0OA 5A5VA 2CMFA 4DKXA 1OXTA 4UUOA 1H2YA 4L3OA 2WUVA 3M1LA 5JAZA 2WWFA 1N1MA 1H8ED 4RL6A 3C1UA 5KZMB 5IU6A 4KUEA 1RJEA 2ORVA 2JLZA 1OAOA 1M33A 3ZZMA 1B0ZA 1SQSA 5EGNA 2UYGA 3NHLA 5KREA 3KB1A 5E6UB 3WRXC 1A9XA 3H99A 3R4CA 2LVBA 2Q07A 1XTPA 5LSAA 3QH4A 1YGYA 3DTVD 2EW1A 1T8UA 3BRWD 4Y2VA 1S9DA 4Y3UA 3A1SA 2NIPA 2WFLB 4Z4CA 2XZLA 1ZJJA 3UG7A 5EE0A 1A1SA 3GB9A 4F5WA 4H1WA 2WQ6A 1M34E 3BGIA 1QZXA 1SPXA 2H9YA 3MEQA 1Y3FE 2BF4A 2Q46A 4MYUA 4F91B 4AD8A 4YT4A 5JXJA 1QGOA 1E69A 2CNOA 4ZGWA 2XMQA 1CEEA 3PPWA 4MUFA 3UB4A 3II6X 1CRPA 1RJ9A 2BGMA 4BVGA 3D6UA 2XHZA 3U9TA 5E6RA 1KORA 2ZJFA 3MJDA 4GC9A 3S7TA 3QUCA 1AXGA 2VZ9A 3PRYA 3PXAA 1CJSA 2CVFA 2L2QA 3TIVA 4DEXA 2XF8A 1JB1A 2J0UB 1YQTA 1EQ2A 2XUFA 4MP6A 1U65A 3AV3A 4P83A 1Y8RA 3FBGA 1QCYA 2P5TB 2P9HA 4U02A 2PSHA 2JBAA 5U9CA 2WG1A 1XLTC 4YHBA 3CH7A 5ESDA 2PS3A 1TQHA 1YBAA 1H6CA 2AA3A 1P4GA 2H1LA 2IEGA 1WXQA 3ONFA 4WVLA 3ZD9A 3DE1X 3AB3A 4Q21A 3KVNA 4YRMA 5B12A 4JI0B 1MX3A 4MR8A 1ZMXA 5I7UA 5KTTA 2RG1A 4C6HA 2JVKA 4PCLA 4OIFA 3KPVA 5HTKA 4R51A 3BX1A 4BLTA 621PA 2RD2A 4IDDA 4GI5A 1M2NA 4OBWA 4U7TB 4F46A 5JBNA 2NP6A 2H4ZA 1NI4A 4KXVA 2X41A 4UPDA 3DP7A 3O4IA 2IRWA 1JE0A 5LIPA 1SUCA 3HCEA 2FQ1A 3PC6A 4TKUB 2I2DA 3GT4A 5DLYA 1JQBA 1GDTA 4IKPA 4G3XA 2EYUA 3CNLA 4YCDA 2OXTA 2HCJB 1QCCA 4V0ME 1Y6JA 1YB2A 5AJUA 2C57A 1IVYA 3TW6A 3JRNA 3LCUA 1YZNA 5CA0B 3DKIA 1HE8B 1R10A 3NS7A 4KH0A 3U60B 5D5HA 1NULA 5J59A 3VR2A 5CYOA 4HLQB 4OP1A 5CURA 5D6NA 1BJKA 3NWOA 4JUCA 1KO4A 1YBFA 1C7EA 2PSSA 4BNDB 2WR8A 3Q2IA 5HVNA 4C1NA 4D3XA 4LXYA 2Q21A 4AJ4A 3FHJA 5DNDA 5K7SA 2H2FA 5FBLB 2NADA 1HE1C 3GV0A 4F45A 5HKAA 1ST3A 1TO1E 2DZDA 1XU4A 3CTPA 2UVPB 1JB9A 2VUIB 2AF4C 3O2NA 3WVNA 1KMHB 2AD1A 4AX4A 4ARIA 2JGDB 1PLKA 2PAFA 3QRWA 4AROA 2FEKA 3KLBA 2AX4A 2HLHA 4WNAA 2BFEA 3KUCA 4BASA 2DFNA 1O6GA 1MABB 1U0FA 3CHYA 4FD2A 4BQPA 4FGZA 1KK3A 3VU8A 1Y7PA 1E5LA 4DLLA 3HGTA 3ZJTA 4B3DA 3NGXA 5K3SA 1FFDA 4TMTA 4LSGA 721PA 1BWSA 3TW4A 3N8IA 1XZLA 5B2ZA 3VJRA 4WCDA 3REOA 4EARA 8ABPA 1K63A 1RKUA 3F96A 4W1PA 3RS4A 5C31A 1EIZA 1RBMA 1VHQA 4FGUA 4GE3A 3DDSA 1H0RA 1WOYA 3NHUA 4OQDA 5CIWA 5BUZA 5C5DA 3W6OA 1T0PA 2I34A 1D4ZA 3T0FA 1EZ4A 1I30A 3IOCA 3F8SA 2AR7A 2WSIA 2Y1LA 3DZDA 3ETEA 4G8CA 4P5PA 4JI6B 1PG2A 1EVEA 2OYCA 5LLDA 2R1TA 1K89A 2WUFA 4BUJA 1IOVA 2VQDA 3IXLA 1XXHE 3KEMA 3R5XA 5FLKA 4E6EA 2IBTA 2C31A 3G6WA 3P5SA 3KHKA 1ZOOA 1U9ZA 3GZTB 5H83A 4ZPXA 5IBPA 3ZBUA 1V3TA 3H7AA 4XFKA 4QAQA 4AF8A 1N6OA 2VJDA 3R3HA 5KVQA 3GEMA 5IUJC 1ZR4A 1EUYA 1VDZA 2PZFA 1JQ3A 3M2PA 4UATA 1UJ2A 2ECQA 3UV3A 3A4YA 4ZOLA 5BYAA 3EA0A 4MQ6A 2VYQA 4TTQA 1ZJ4A 4P22A 3NTLA 4UNNA 5IJXA 3UW3A 4CQMA 2XDAA 5D87A 1JFTA 2VQ3A 1TYZA 3B6JA 1U7UA 1WMDA 3QBEA 1SQ0A 1B1AA 3TINA 4EVQA 5H02A 3WLEA 3KZXA 1E4VA 3VX4A 3COJA 3UMCA 3OEEA 1DBRA 4R7GA 3TFWA 1L4MA 2DBRA 2RAUA 1Z8FA 2YC4C 3L7MA 1SQ5A 4RZUA 1RQ2A 3SQNA 1I94B 1VJ1A 1LLQA 1ZW6A 1JR3D 4OAQA 4NCAA 1J8YF 2JZCA 1K6JA 5TIIA 1DV2A 3ASVA 5HOQA 1MABA 5K8VA 1M3SA 2NVBA 4EA7A 4HVCA 3IQWA 4HB4A 5D00A 5HS4A 1VE3A 1XIVA 2H16A 2QPAA 1M66A 4WZ6A 4BE9A 1GUAA 1GTG1 2C0PA 1ZI9A 3QV2A 3V34A 4BFZA 2YDXA 2ZR8A 3H9EO 3ONVA 3PIDA 5LUBA 3CU5A 4IMRA 3DMPA 4YJ3A 4E0BA 3X1KA 4F9GA 1QE3A 2UVQA 3GHHA 5DP2A 3RO7A 1MX1A 1J2RA 2ATIA 2W2MA 2XQGA 2YNMA 3G6KA 3HRHA 2WINI 3ORHA 1QQAA 1B14A 3C97A 2OV8A 3ZWVA 5BN3A 4DLRA 1RPZA 2GJAA 3LX5A 3PSAA 4NZZA 1AM4D 1DS6A 1WDMA 2FFJA 2D2EA 2G4CA 3JQBC 3EGXB 4BVKA 4B3GA 4RQTA 5JAPA 2AFHE 1JMYA 1KJQA 2BMVA 4OJTA 1XZCA 5B4VA 1TNDA 2OO3A 1QF6A 1LGYA 4FP9A 1L9KA 2JI6A 3FTNA 3HU3A 2JGIA 1Y37A 4LJAA 3SYTA 2H92A 4GRAA 1Z2AA 2R25B 2ZYHA 3TXYA 1UMDA 1I6KA 3AI1A 3JZAA 4M8LA 4JLDA 5TT1A 1WB9A 3HA5A 3VKFA 5EMNA 1OXUA 2H1VA 4XASA 1NGSA 3IVGA 4P7FA 2WHEA 4N9WA 1UJ4A 4PW0A 2VDUE 3SEFA 1CF4A 1K9SA 5BR7A 3FXAA 1R18A 3SICE 3WISA 1P0IA 4BKOA 3T35A 3UQYS 3BDIA 3E7XA 3M6IA 4Z7NB 4Q3BA 4QPNA 4TXMA 4NR0A 2XH8A 4WZAA 1JSCA 2ZOSA 1DC6A 3GMIA 2H7XA 2I3DA 3HZZA 2IT1A 3OKPA 1R3UA 3O03A 3WV5A 2A0WA 2W83A 3TDMA 5FA6A 2PMKA 3GGPA 3KDSE 4W9RA 4Y9UA 4HAIA 3TKLA 5B1EA 2FW9A 1MFZA 4MWSA 4HGRA 4BL5A 3AB7A 1JFFB 3EULA 4ZYUA 4Q19A 4L4ZA 1VBKA 3RU3A 4OQFA 2JASA 2P0YA 2GFHA 3HR7A 2R4QA 4R54A 5F5LA 3STVA 4WK0B 3ZWNA 1SXGA 3SSMA 4QE3A 1JNYA 2X0EA 4L4SA 2Z9DA 3WGHA 3T41A 4JS0A 3GNQA 3ZN2A 3TGPA 1Y1LA 3MBIA 1JAYA 1QK3A 4N82A 1G20E 1T3LA 1SA0A 3ROPA 3IAUA 3LU1A 1GILA 4YAFA 3U7RA 1QH8B 1EP1B 2CNLA 4GS5A 4DJAA 1BW9A 3TOXA 1ZPDA 3HVHA 3AUFA 1Z4PX 2W6MA 3R3VA 1V5GA 5DZSA 1ZAYA 1Y42X 2OGUA 3NWJA 3QE4A 3EGXA 3N05A 3I6IA 2HDHA 3CO5A 5A6VA 4W7SA 4UHFA 5CFRA 2JIZD 3TR6A 2REQA 2JI8A 3COYA 3MTIA 2QRVB 4U6QA 4GOXA 1U7PA 2O2GA 3OO1A 2G5GX 3ACCA 4PLFA 1PFQA 5FP0A 4LY3A 1F2DA 1P5FA 5AW8A 2I8AA 3QLVA 1GPUA 5J9FA 4R6WA 2F62A 1JTVA 1Z39A 1L5LA 1OFUX 1KQFA 4PICA 4KO3S 3PYXA 2V4UA 1RC1A 4F5EA 1Y1PA 1Z16A 3DBLA 3NX4A 3PHHA 4IL5A 1REQA 2GXQA 5CNJA 5BV1A 2J3KA 2CXTA 1UBNA 3WDLA 4R0VA 3G9TA 2Q5OA 2P68A 2HMTA 3KTAB 4KQ9A 2MYUA 4LHVA 5JYDA 5KJFA 4MO9A 1C9MA 5J43A 4TMXA 3GFSA 2DWPA 2B1JA 3MBOA 2LGJA 4P7BA 4RPHA 3SLKA 4ZOBA 1P5HA 1CZUA 2D4HA 1ULUA 5EJFA 2HK9A 4R68A 3G2OA 1VP3A 3IULA 3VZPA 3TIIA 2NUTA 4R9RA 2NZ2A 2V7UA 1BHQ1 2H1RA 3SX4A 3T38A 1F0NA 5I4IA 5EZ5A 4KXFB 4DJ5X 3LWDA 2PKQP 5E9WA 4PLVA 2WIFA 4GFDA 4QRHA 1T15A 5EQDA 4EVIA 1EUDB 1Y8QA 3GT7A 3G79A 4FMDF 4IRUB 5EP2A 3TEFA 2XNSA 2RHCA 5EXPA 3RI3A 4F04A 3TB6A 5DNCA 2I65A 3GVCA 4B7ZA 3MJRA 1CRLA 1SXIA 3U7QA 2EEZA 1NIJA 2EIHA 3Q8KA 1C9EA 1G38A 3B3AA 1SUPA 1VMIA 2YYAA 1DT3A 1KJNA 2HXGA 1Q7CA 2Z5LA 3AOEC 4XVQA 5DMHA 3I5XA 1VG0B 5CAEB 3KCNA 3BF8A 1GRNA 2QTRA 3CR7A 3LK6A 3HKBA 4MPPA 4XUEA 3W78A 1T9AA 3LYAA 4N3BA 5AI6A 3ZDYB 1F9AA 4NQRA 3BQNB 5LIRA 5HR5A 3OPNA 2HM7A 2G1JA 2X40A 3P0RA 1W4ZA 5E7JA 3WSWA 3NHKA 3KKNA 4PS0A 4TRMA 1SKUA 3E35A 2G1AA 2WP8J 4J0QA 3LOUA 4ZEOA 1E2MA 2O6HA 5AVZA 2XB8A 2QW0X 4JT4A 2WABA 1H0KA 3P9RA 3INGA 3C85A 2IHKA 4ZAGA 3PFIA 2AFVA 4G2TA 4DJDC 4QBKA 1GG2A 2XMDA 2B8NA 1FMCA 1GKYA 4PG7A 1TIBA 5D86A 1V0JA 1UQTA 4CUZA 2JJYA 5F1KA 1HL3A 1JPUA 1SZJG 5C9ZA 4D8YA 2GJ4A 3QKIA 4EKDA 1DUIA 5L4LA 4V0LA 3G2PA 3WMRA 4LUCA 4P98A 4EYSA 1NXVA 1G21A 2OAP1 3GC6A 3VR5H 3QYPA 4MGHA 2PAAA 4QUJA 5D1HA 3CVWA 2M6KA 2DLCX 2JGKA 1DKPA 3A7DA 3HFSA 2C9CA 3LXXA 4W99A 5HBGA 4DARA 3RGWS 1FRNA 4UDYX 1AZLA 1XWWA 2COUA 1YGPA 5K4HA 1TM3E 4IUBS 1JSXA 1M2KA 3PXUA 2PHZA 4DBVO 3GO4A 2ALJA 3A25A 4QIHA 5CA1B 1A7KA 1OI4A 1J09A 1JG1A 2GB4A 4LG1A 2GJSA 4RAOA 5EIFA 2GDZA 3G49A 3OHSX 4U63A 1C8BA 2RIPA 1VSQA 3FNIA 4Y30A 3HB4X 4MKFA 4IGEA 1AQIA 3D0RA 1QH1A 4BGIA 5CAEA 4J7CA 2YWRA 3GT3A 4N3GA 4K3VA 5SYNA 5FPTA 2UUBB 1KK0A 1X39A 4N7RA 1IZ9A 1NTRA 1RVDA 1UT5A 2QNIA 1SD1A 3AHHA 5KSPA 1GV0A 3LCVB 2PL5A 2GBLA 3UWOA 1P9LA 4DOMA 3KYBA 4FKZA 4PFSA 1XNGA 2GVDC 5B7QA 4IF6A 4XIIA 1B43A 2BKXA 2PYDA 1BGXT 3FA2A 1N7HA 3LSYA 1QG2A 4IUYA 2PSJA 2R7AA 3DF7A 4WESA 3QVXA 3KC2A 5KWEA 4RFLA 5DB4A 2VRCA 2G5CA 4FINA 2Z2YA 3SN6A 4B1FA 1PL8A 1RRFA 1RWVA 1HKUA 2WE8A 2W6NA 2XKAA 2Z8ZA 3ZXYA 4BZZA 2R85A 3EUEA 4EGFA 4Z4QA 1DPGA 4MAAA 2X4DA 3KHSA 4UCFA 2PEZA 4QA9A 4YI5A 3H8JA 1JR3E 2BSXA 1W34A 2GJ9A 1M1NA 1BYIA 3BMQB 3IQEA 1OIXA 3HB9A 3X1DA 4AP5A 1IPHA 2HMUA 4TXHA 3WNVA 4HYYA 3MQ2A 4CM4B 2ZBVA 3ZU2A 4GLOA 1QV6A 3UGKA 1W4CA 1ZOSA 2Y2VA 4S24A 1KEVA 3ZVRA 1XQ9A 3WLSA 2JLCA 2R97A 5DNUA 4LYEA 1DTSA 4U2DA 2HRRA 2YZNA 5D3ZA 1RE1A 3HJCA 1Z2OX 3HN7A 3T7AA 1PJSA 2CUTA 2PBLA 4EMBA 2JIRA 2V3WA 4YMSA 1BEZA 1SCDA 2OGTA 3ELWA 5DYIA 1OKKA 3NHAA 4CR6A 4FLEA 5CA1A 4Q48A 1CZHA 2CFOA 3GLQA 4TQ9A 1B8OA 2MINB 3P32A 3L93A 1GPWB 2VHCA 1Z29A 4CF6A 1P3DA 1XVAA 2X8JA 4XLTA 5C7IO 2I7CA 1HL7A 4NEQA 4RACA 1EYZA 3OFNA 2V5VA 1FVHA 1D0SA 1M6NA 2FWBA 5CHEA 2PBFA 3OE4A 1R0WA 2C1ZA 3OU2A 2IHNA 1NXSA 1UP4A 4Y6OA 2YTZA 3A4MA 4K1LA 4UBNA 3GDHA 4FONA 4WIAA 1OXMA 1OHHD 1FXWA 1HR0B 5BVGB 3RAFC 1RI3A 2DBYA 3O1IC 4CWAA 2FRDA 1HOXA 2O14A 2PUWA 1XJ5A 1D2CA 1T1IA 2NZ8A 3K1JA 4KMMA 4WZAE 4BFXA 4EX7A 3OI7A 4W5TA 1PWYE 2WKRA 1B6GA 3PVCA 1KIMA 1MAHA 2ZZKA 4FSXA 5A5FA 4OBBA 4QLOA 3TZKA 1EUQA 5SZKB 5CCBA 1QHYA 4G5RA 3VC1A 2QD5A 2Q7XA 3AKZA 3NDJA 4LFBB 1OV6A 1UAGA 3EBPA 5ALUA 3Q3HA 3G2QA 4Q1CA 5D5QA 5HP4A 5JI3E 5DYYA 1CQWA 1OV4A 2QORA 1PQYA 1K5DA 4J2TA 3F1KA 3SIPA 1OX4B 1IVSA 4OXYA 5LA6F 3JWPA 1FNMA 1VRCA 3LL4A 3C3JA 4RE5A 4OEHA 1UK6A 1TVKB 1FVFA 3AZQA 1Z08A 3G1UA 1MG0A 3HPRA 4D3SA 4FQ7A 4ZYWA 3BKWA 1U3VA 2E4VA 2R87A 3VKWA 2ZCJA 2Q4TA 2AQHA 2GHRA 4LYDA 3DL7A 2P3SA 5LB4A 1BRTA 4JC0A 3ZK7A 2FX3A 5LWQA 3HA7A 2QQ0A 3FF4A 3SYMA 1YZVA 3NV9A 2O0LA 4PPNA 1TB4A 2A14A 1N2HA 3BPSA 3TZLA 4KOAA 4I36A 5FOVA 1AZWA 1FTNA 4E03A 3AHEA 4KQHA 3VPDA 1UDWA 5GMOA 3ZWKA 6YASA 3ZBPA 5K3DA 3GZNA 4DVGA 1G5PA 4GQAA 4N47A 3OQNA 4LYHA 2VPTA 1G291 2WC1A 1M8PA 2X6TA 2GK3A 1G3UA 4KHZA 1E2JA 4LAFA 2VTBB 2H57A 3GEGA 4QECA 4G8BA 4AULA 2H4HA 1I10A 4HH1A 4RFSB 1Q0TA 2JZOA 4UU0A 5EZYB 3N87A 4DHEA 3E22A 3MN1A 5IKPA 4RNDB 1P3Y1 3JQEA 3S5UA 5FBVB 4IJQA 1D0VA 4A0FA 1EUZA 1HH4A 3CCBA 2R8YA 3DPSA 3QSGA 1SCUB 3IKVA 1R6UA 4DF3A 2GNAA 3RF7A 3V5NA 3QWFA 5DRTA 4B4UA 1J70A 2R7NA 1GV1A 3KXLA 3L05A 3LJKA 4EATA 3IBYA 5A3VA 1T0HB 4LC0A 4ZXFA 4PO1A 1JA1A 3LHFA 3C4JA 2WA1A 4ZEWA 3E6AA 1G8MA 2YL2A 4CNBA 1LTQA 4S12A 4ETNA 2W2LD 1G0OA 1A8SA 2DFKB 4HRYA 2IXEA 4RY0A 3S5JA 5LP1A 5C3UA 1E20A 1YBMA 2CNBA 5LMCA 4HMQA 3HHPA 3RVBA 2ANCA 3RC1A 4DDWA 1O4WA 2V5UA 4C2UA 3VO2A 2VH2A 3H13A 3RUAA 2IXTA 2PRSA 3F78A 2CNNA 3WJAA 1XZIA 4R83A 4UFPA 2P4UA 3HCBA 2Z2ZA 2CKDA 4O8CA 4AG5A 2X0RA 2GVZC 4MAMA 4K2AA 4EHBA 3RVKA 3WYBA 3PUKA 3HCNA 1IQ0A 4G1UC 3R9KA 2GPSA 3H11B 5CXUA 5BNIA 3MMPA 3KQUA 5H4GA 2BI7A 1UBEA 3WIDA 1C9NA 3IPYA 4DA4A 1JAXA 3DA8A 1AUXA 1X7ZB 3NLLA 4KNYA 4YRGA 4L4XA 3RFTA 1QU2A 4M49A 3X43A 3ZIAA 2C9DA 2G67A 2XCOA 4FYPA 4NC9A 1E89A 2M9MA 4ZXPA 3V4RA 3NHBA 3JWHA 3GI1A 3DD1A 1T4DA 4JELA 1QVVA 2YUTA 1X6VA 2VTBA 3EQZA 1TCUA 5MN4A 1EGHA 2X8BA 3EIEA 1XQWA 4IPTA 1C4WA 5EZYA 4B6QA 2EJCA 5FI5A 4IWYA 3TQSA 4HY3A 1XRLA 4TKVA 1W88A 1NQXA 3LA8A 1JYFA 3TLMA 4GZMA 2BHTA 1G21E 3A4VA 3CY6A 3G8YA 1E8NA 1T2FA 1QK4A 1ZGCA 1LX6A 1OBVA 2D5BA 1WUHS 2O5RA