3Q15C

Crystal structure of raph complexed with spo0f
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
116
structure length
116
Chain Sequence
EKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of response regulator dephosphorylation by Rap phosphatases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/kinase
molecule keywords Response regulator aspartate phosphatase H
total genus 35
structure length 116
sequence length 116
chains with identical sequence D
ec nomenclature ec 2.7.-.-:
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3q15C00
5KQMA 4MLDA 4MQFB 2FW0A 2ID7A 4RY8A 2MSLA 3ROFA 4XLTA 4EYKA 3LUJA 4W5RA 1Z2EA 1MVOA 2HQBA 2HPHA 2LP4Y 3A0UA 3UK0A 4N41A 4Z9BA 1ZAYA 5F64A 2JVIA 3CG4A 2H0AA 1MAVA 1A2OA 1SXHA 1Z16A 4Z4IA 3OLWA 1M5TA 2JVJA 1L5ZA 4OATA 3EODA 3KJXA 4G0QA 1P2FA 2AYXA 5FWYA 1JFSA 1CEYA 3OLZA 3OMWA 3DBIA 3I09A 3S99A 3NBMA 2QZJA 1XHEA 1DCFA 3FGZA 4MR9A 1SXIA 1JDNA 1Z2DA 2LIVA 1TLFA 1WETA 1E2BA 4YCSA 4RV5A 5TQ2A 1VKRA 1ZH4A 1Z26A 4FE4A 1E6LA 1JLKA 3DLHA 3QEKA 2PJUA 5DGCA 1YK0A 2HQRA 1PUXA 1Z18A 2GWRA 1TJYA 2GBPA 3JTEA 3D02A 3HSYA 2ZWMA 2PL9A 3RVKA 2FLWA 5KI6A 2FN9A 3CZ5A 2VK2A 4EVQA 3TB6A 4MLCA 1GCAA 2L18A 2NUBA 3HUUA 1R8JA 4PZ0A 4RWEA 4ZMSA 1KMIY 1D1QA 1EAYA 2P9HA 2IPMA 4RS3A 5TQ0A 3W9SA 1QPZA 5JNUA 4L85A 4MPTA 5EWMB 5IBQA 3KLOA 4D6XA 5KQGA 2HJ9A 1L5YA 3F7NA 1DCMA 3HDVA 3LUFA 4YGXB 4DQDA 4ZJPA 1YS6A 3OQOA 3T8YA 1YTUA 1XWWA 1DBWA 1BDJA 1W25A 3KYIB 5C5EA 4LE1A 4IMJB 2L19A 1MB3A 2IKSA 4RK6A 3SQNA 5PNTA 1NXVA 2FMKA 3GV0A 4JAVC 2FN8A 3OM1A 3MIZA 2RJOA 4RSMA 1JYFA 4Z4CA 1VPWA 4RK7A 1NTRA 3Q15C 3FDFA 2FKAA 4JB2A 4FB4A 5KQPA 1LJUA 2R47A 3HEBA 4Z4GA 4LX8A 1T34A 2MYUA 2A9QA 2CWDA 2LBPA 3HS3A 5TQ0B 4G0YA 5JNWA 3IPAA 5DTEA 2BGGA 2PUAA 5EWMA 4LE0A 2GI4A 3VNAA 1DRJA 1I3CA 4OLBA 3O1IC 2IPAB 4MYRA 4KREA 3HVRA 1P6UA 3GYBA 2QV0A 3IDOA 4KK4A 4TLMB 3QX9A 5TPWA 4LE2A 5DCLA 3K9CA 1LK0A 3T6KA 1TMYA 2MSWA 1Z25A 1JWLA 3OM0A 3CG0A 4PEVA 2PUDA 3BRSA 1J56A 4EY3A 5BQ3A 1NXXA 3HM9A 2GX6A 1DP4A 4RY9A 2NT3A 3NNDA 3KS9A 4JASB 1JDPA 3HCWA 2IPLA 4IGAA 1URPA 5EWJA 5FBKA 3RH0A 3TMYA 6CHYA 3SAJA 4Q6BA 3O75A 5HSGA 3MYYA 3LUAA 4ETNA 1QP0A 3O74A 4G0MA 3CRNA 4O1IA 4NCBA 3GRCA 4RXMA 1QP4A 4QYMA 1CHNA 3I5AA 1UDRA 2IDMA 2Q5CA 3F6PA 3LFTA 4G86A 4RKQA 3SNKA 1YVUA 1LBHA 5IEBA 1DC7A 3M6MD 5JNVA 2JVKA 3Q41A 3KHTA 4YS6A 3CLKA 4RK0A 4YWHA 2PUGA 1JFTA 2IOYA 3UUGA 3LKVA 4W5OA 2KYRA 5TE9A 4H3KB 4CBVA 3C97A 2YHBA 4ETMA 5TPWB 3HO1A 4XAQA 2I6FA 4EVSA 4KNYA 2QR3A 1BDIA 4D74A 3O2QB 2H3HA 4NCAA 3JPYA 1USKA 1OXBB 2J48A 4ZYLA 2RGYA 1A04A 1BAPA 1HEYA 1K66A 3IP7A 4Q7EA 1VLZA 3GWGA 2JBAB 2JCGA 4F11A 4YP9A 3SG0A 3CKMA 2PMCA 3N6VA 5CNJA 4PE5B 4EYQA 5KC9A 4KRFA 1SRRA 4B09A 2V0NA 1DC8A 3KLNA 4DADA 1W9HA 3Q7RA 4KFCA 1QO0D 4Q6WA 2CHEA 4W5QA 4P98A 4DN6A 1YMUA 3IP9A 4F12A 1A0OA 1NY5A 1XHFA 4IMIB 4MQFA 3SM9A 1LBIA 2R48A 3MA0A 4RU1A 3RVQA 1KRWA 1Z13A 3A0RB 2RDMA 3H75A 2LUOA 3R0JA 4MS4B 1BDHA 1E6MA 1U2QA 3O21A 4EYGA 3H5VA 1ZGZA 4OTZA 5TQJA 3N8IA 3OQNA 4ETIA 1U8TA 3JY6A 3T95A 3P9YA 3H5LA 3MM4A 3H6HA 3QLUC 8ABPA 5FWXB 4IILA 1FQWA 1YIOA 1M2FA 3KTOA 3QK7A 3QLTA 1RZRD 4HYEA 5T7BA 5CNKA 3QLVA 3E3MA 5TPZA 1NATA 2E4UA 2FVYA 3K4HA 3NHZA 3RVSA 3HJFA 5EWJB 4YLEA 7ABPA 2M98A 1NXPA 3FFXA 3O1JC 4PICA 2FQXA 4EUKA 1BVHA 3OO0A 1PNRA 5TQ2B 4MQEA 2F8TA 3SY8A 1NXSA 3CZCA 1TM2A 3RQIA 2QXYA 3KCNA 3QX8A 4IRXA 2JB9A 4GNRA 3TO5A 1QNLA 3LUGA 1Z12A 2E4VA 4E7OA 4JOQA 2HSGA 2MYNA 1RPJA 3LOPA 1JFVA 2IYNA 4MR7A 3I45A 2YHAA 3HZHA 4JP1A 1P6QA 4OG2A 2FEKA 4RKRA 3L49A 1EWKA 3H1GA 5DKFA 3OQMA 1EWVA 3QELA 3TD9A 4N03A 4Z4FA 4WWHA 1FFWA 2IPNA 1D1PA 1ABFA 2WB4A 1PEYA 2OENG 6ABPA 3IP6A 3DZDA 4G0XA 5BR1A 3A3KA 3MMNA 5JNTA 4H60A 1FFSA 2VUHB 4HNSA 5CHYA 1AB5A 1SD5A 2WWVD 2W42A 3RVLA 2WJWA 3G1WA 1ZESA 4LDAA 5IEJA 1YS7A 3CHYA 3HV2A 3C6QA 3ILYA 1DG9A 5GOTA 3G85A 3ROTA 1FFGA 3KYJB 3LKBA 2X7XA 3JVDA 1U0SY 1VRVA 5DLEA 4NICA 4F8JA 1MIHA 2E4XA 3LUKA 4WXMA 5JNSA 2ZAYA 3N0WA 5HKOA 1JH9A 3FFWA 3A10A 3CNBA 1C0EA 1USIA 3JPWA 4MGEA 3DLBA 1K68A 3L6UA 4N0PA 3RVOA 1QP7A 3C3KA 4F3TA 2FLKA 5ED4A 4MR8A 1IIBA 3GT7A 2R25B 1C4WA 1DZ3A 5CNMA 3LUDA 3RVNA 4MS3B 2MYTA 1CYEA 4HNRA 2A9PA 3HK2A 3ILHA 1ZVVA 1F51E 1JL3A 1JF8A 4S04A 4O5AA 4EGSA 4ZPJA 3N75A 5JS2A 4XARA 3HDGA 4QPJC 2NT4A 3H5IA 1E6KA 3O2SB 2QSJA 1QO0A 2QU7A 3LMKA 2L17A 4YRZA 3QEMA 5IULC 3OLYA 3EQ2A 2E4YA 2FQYA 3MF4A 1OXKB 4LZLA 1KRXA 1P8AA 2B4AA 3QLUA 2HQOA 4XFKA 3JS5A 4QYWA 1QMPA 3FFTA 4RK5A 1FSPA 5B3JC 5HM6A 3RVRA 2TMYA 2OQRA 3OLVA 3QLVC 2CHFA 3H1EA 4N47A 2FXIA 2AYZA 2GKGA 1ZHHA 2WY2D 3H5OA 5I4CA 4MRMB 4WZZA 1RNLA 3JVIA 4KMRA 4JB0A 5IX8A 4RY0A 1U2PA 1Y1LA 3C3WA 4P1ZA 4WUTA 2E4ZA 5JS1A 3GBVA 4KZKA 4MS3A 3BILA 3KSMA 4M88A 4XASA 1QQAA 1ZN2A 2FMFA 2ID9A 5GQSA 4ZMRA 3M9WA 3KG2A 1ZGGA 2PUEA 4RXUA 4UHKA 1ISRA 3Q9SA 5BRAA 3C3MA 3GL9A 4KPYA 1KGSA 1GCGA 4MS4A 1PNTA 3BBLA 4H3HB 3Q7TA 1NXTA 1QKKA 3IP5A 3RVMA 3BRQA 2E4WA 4XXHA 5FWXA 5IUNC 4KQCA 3LTEA 5E3JA 3NNNA 2L2QA 4YO7A 3N0RA 1PEAA 3F6CA 3HUTA 1Z15A 2RJNA 3EULA 3NHMA 4Z0NA 5IUKC 5KC8A 4GPAA 1F4VA 4MRMA 1M2EA 5IC5A 3BREA 4MS1B 5BRJA 3H5TA 1ISSA 3EGCA 3T38A 4WXEA 4PYRA 3NNSA 2A9OA 3F73A 9ABPA 4MQEB 4ML3A 2PKXA 2WMYA 5D2CA 2JRLA 1D4ZA 3H5WA 1EHCA 5CNIA 3CFYA 2F8SA 4FE7A 4HNQA 2M1ZA 1YK1A 2PUBA 4UHJA 3CS3A 1ZH2A 4G0PA 4YV7A 2MSKA 1ZDMA 3OMXA 2PE5A 4D6YA 2PUCA 4EYOA 2FSPA 2CD7A 2FQWA 4L4UA 4Y9TA 3VNBA 4W5NA 1QQBA 1GLGA 3QEMB 1U04A 4Z99A 2LPMA 3Q7SA 2FMHA 2FTKE 3DGFC 1NXOA 3OLXA 5T3YA 4EVRA 5IUJC 3QELB 2PUFA 4E7PA 3OO1A 4TMYA 2QVCA 2VYCA 4G0ZA 2P4UA 3CU5A 3EDCA 1D2AA 1RZRA 1DBQA 3IPCA 3MQ4A 3N53A 4TLLB 5FBHA 2N9UA 1LJLA 5FWYB 5TPZD 1ZY2A 3H6GA 4Z4HA 1JBEA 2QVGA 5HQJA 1SXGA 2O20A 4KVFA 3TX6A 1H9CA 1B00A 1TVMA 2XDYA 3URMA 4F06A 4OLAA 2A9RA 3N0XA 3HXMA 4JA2A 3EJWA 3UKJA 2NZUG 1DRKA 5EWLB 3E61A 4QICA 2PLNA 1ZITA 3O1HB 4WT7A 3H1FA 2FEPA 5B3JA 5KWSA 4N76A 1EWTA 2VUIB 4IF4A 4RDCA 2PL1A 1GUDA 4LDZA 2JK1A 1D5WA 1MB0A 1JHZA 1M5UA 1NXWA 3KKEA 4RXTA 4RZSA 4Z9AA 3GBPA 4MR7B 4KV7A 4KK3A 1EFAA 1GUBA 1USGA 2PAFA 5C5CA 4S05A 2WRZA 4N0QA 4MR8B 4NV3A 4NQRA 1RXEA 3DGEC 3FMVA 5KQLA 4Z4EA 4O1HA 1ABEA 3M9XA 3LUHA 1DBPA 3B2NA 2FMIA 3D8UA 1BA2A 3LUCA 1YMVA 4KQ9A 4TN5A 3RVJA 1JYEA 4OBBA 2NZVG 3EAFA 5JNRA 3I42A 1JX6A 3GA5A 4LRQA 2R4QA 4MR9B 2JBAA 4RK4A 4W5TA 4MS1A 1DCKA 3RVPA 2DRIA 3CTPA 4RK1A 1AB6A 1S8NA 3EQZA 2QW1A 1DJMA 3O2JA 5EWLA 1RXIA 1PHRA 4MAAA 1APBA 4G0OA 1Z17A 5ABPA 2MYPA 2WJAA 2FEWB 4YR7A 4G97A 2B1JA
chains in the Genus database with same CATH superfamily
5JQGA 5I45A 2VJPA 4CR8A 4OL9A 4ZCTA 1NMZA 4ZAVA 3TSYA 2IEAA 4C08A 1U0HC 1XL1A 1M0SA 2ZJ6A 3ESYA 4PQGA 1EZ4A 1KMHB 1CQJA 1U7TA 2RI0A 3WB2A 4CYMA 1JLSA 1MVOA 3BRWA 4LVNA 3ZEIA 2JKZA 4UNRA 3GZNB 4ZO9A 3T7CA 4XGQA 1ZRMA 4L3OA 3KJZA 4DR6B 2IZZA 2QYOA 1O2DA 5KBYA 1JXQA 4D9CA 4Q12A 3V1NA 1PZFA 3OLWA 1XZMA 5JMOA 2FPMA 2BMFA 1TK3A 2VO1A 1FUIA 4FSXA 5EEHA 1NFQA 1WLSA 1XQVA 4CN8A 1MZPA 1RZVA 1Y37A 4WKOA 3I09A 5U4QA 3AEQB 1MW9X 3HCFA 2J5XA 2W0MA 3N7TA 4QSHA 3S2SA 4BUCA 1GIAA 3LS2A 4B2YA 1VL0A 3A7EA 3DFZA 4V03A 2JZCA 5FTJA 5LMZA 5LYJB 2WJ6A 4YECA 2H54A 2JNWA 4CMGA 5IMBA 4RV5A 5F52A 1NNLA 2FOLA 3R6GA 2W22A 3EW7A 4JC5A 1L5MA 3M4JA 2W4IA 3QUBA 3LLCA 4P22A 1HNXB 3KT3A 4PXSA 4PVCA 3JQPA 2WM9B 3BE4A 3OOHA 3TOZA 3UT0A 1GZ3A 4XYMA 2R00C 4D81A 3WJ2A 4KLNA 4QUAA 4KDEA 2C0PA 4Q1VA 1T8PA 3WK5A 4OLFA 5E8JA 1MAAA 1VTKA 4XJSA 3DWFA 2GD1O 4BVFA 3SE7A 3EEOA 1GQFA 3NCTA 1U2GA 1O89A 2VR1A 1BU8A 1XLTA 2VDMB 2ZTHA 2Z4TA 3PXBA 5A2QA 5ESXA 2QRMA 2RCYA 1BO6A 3NIDB 4PZCA 4LF6B 3UHAA 2MSCB 4IDNA 5GINE 1JIXA 3IDQA 1KQOA 4AX4A 3O8NA 1EUCB 3DZBA 3CNHA 3HB9A 1NNUA 1T9GS 2VUTA 2XA9A 2Z1MA 2ZVDA 1YQXA 4OI4A 1E62A 2A78A 4ZT7A 5IBQA 4AG5A 5CBPA 2VA9A 2GEFA 3FTQA 4N3BA 2ZIGA 3DE1X 1S7CA 1L8AA 1JKXA 1V45E 3LUFA 2OGTA 3PC6A 4RVFA 4F6CA 2HXYA 2XEXA 1JIVA 2G1PA 1N1GA 1O95A 2C2MA 3HWRA 1K7XB 4ED9A 4FEYA 7AT1A 3L1VA 5LB4A 1U7HA 3M4YA 1HLPA 1KJJA 4HUJA 4GI5A 4KI7A 4PQRA 5DM60 5CEFA 1ATZA 3WLKX 3ZE1B 1V16B 4OY3A 4F8EA 2A30A 4AP9A 2FOXA 3A4VA 4JEIA 3MTBA 1G8SA 3D2CA 1LLFA 2IELA 1AV6A 1PYGA 1FSSA 2QRPA 4KIJA 4LGCA 4LJ4A 3TDMA 1TO1E 4CM7A 2G1KA 5JMWA 3NONA 1HE4A 1VI5A 4TZ0A 2JGKA 3G5MA 2CT8A 1CS0A 1NTRA 1E3QA 1XDBA 2J33A 3NTRA 1Y1KE 2ZYAA 4CMEA 4AY6A 1PVOA 1H6BA 5DNDA 2P77A 4BEVA 4NS1A 5H3CA 1L6IA 2CWDA 1SCQA 3VPCA 3P9RA 4G0YA 1Q14A 4HADA 5CVCA 3IERA 2F00A 2IUSA 3BGOS 1ZUWA 4QRHA 3CKKA 5IFKA 1YRWA 2IPAB 4EMSA 2J30A 2ZBUA 1QG6A 1QF7A 4OHMA 3ZLUA 3MINA 5I9NA 4HEQA 3WDSA 1H4QA 1IG0A 3TXXA 4JIGA 1A88A 4WCVA 1PQWA 3FMIA 2Q8QA 5EINA 4GI3A 1PDVA 4OHUA 4C22A 5JD5A 3CSSA 4M8NE 1JHRA 1P0MA 3DMGA 1E9SA 3OC6A 2P6NA 2IEZA 2UZ3A 1C8BA 1LW6E 2ZUVA 3RK4A 3K0KA 3VR3D 4IIGA 3D0QA 2ZATA 1R8QA 3IR7A 3JWJA 4ISCA 2X3FA 1QFSA 3MWEB 5L51A 4MQBA 2J9YB 3W2TA 5FBKA 1GYRA 3MYRA 1I1OA 3HY6A 1JHMA 2JI7A 2SBTA 4HNTA 3Q8KA 4BN4A 3QQ5A 4D9BA 1E8DA 2H7YA 3RSGA 1SUWA 3HCEA 1JPJA 4W4TA 2RGXA 4WCDA 1RIFA 2LR0A 1H3FA 4CLDA 3AGPA 4JBWA 2FV8A 4EF6A 5CBPB 2CXSA 2WIAA 3F6SA 3BB3A 3EXFA 3HCDA 3A6LA 1EAMA 1L4NA 1RFLA 2M6SA 1MEOA 3HKEA 3QOFA 3KHSA 4HX5A 1SB9A 2Y6UA 2WV9A 3CF4G 2ONJA 2BTOA 2QXTA 6REQB 4LMAA 2ETXA 3DDUA 1DJPA 2KYRA 4RIEA 2GK7A 4ETMA 1RHQA 4A23A 2Z09A 5JQWA 2P90A 2DH5A 1GITA 2FZEA 1WW3A 2XTMA 2XWSA 2XGGA 4QHTA 1OLUB 2QX4A 1OXBB 1U4SA 3KT0A 3A1FA 3BUSA 3R3JA 2W11A 3WXMA 1WU8A 2G7ZA 3K0SA 4DC9A 2HBRA 3TCNA 1HA3A 1CIPA 1P4SA 1UM9A 2CXOA 2I2AA 1FQOA 2QSYA 3OZBA 3EUFA 4I5DA 1Q0QA 2VYVA 3ZNPA 3KAJA 4JDPA 3TPCA 3X3HA 3KOMA 2VPPA 1Y63A 5DTQA 1ZMXA 3WV4A 4MRVA 1SXJB 1RJEA 3A6ZA 4TXNA 4E03A 2I8CA 2NU9B 2XGOA 4I19A 2EIHA 4D4LA 4ZTUB 4IJWA 4XFJA 3N0VA 4U2FA 1R64A 1UBUS 5DRYA 2G80A 3Q7RA 4HC4A 4WZAE 1CUVA 1QHHB 3AC0A 1YRBA 1RKXA 1OAKA 2XMRA 2ZWOA 3DMNA 3EVDA 2G82A 5TXGA 1V8FA 2GUWA 2DY0A 2QRZA 2QTNA 1C9DB 4LOHA 3OU6A 4LZOA 2B4RO 3IFSA 4KNWA 3G8YA 2WJHA 1JQLB 4P3NA 4R3UC 5DBFA 2FPOA 2R8BA 1SQ0A 4QNRA 2EBHX 3MWKA 4TXMA 3RT7A 5C8DA 3RG2A 4UMDA 2ZW9A 1Y6RA 3R0JA 1Y4SA 4PC1A 3FSRA 5IZCC 3H5VA 1RYNA 3PC2A 3DDHA 3GLRA 1OROA 1U3TA 4MI3A 3SR3A 1KYIA 5I7OA 1RRMA 1FQWA 3KTOA 3PPYA 1UPUA 1RZRD 1DTEA 1HX7A 1O9HA 2A0YA 5JALA 3W8RA 2ILTA 3SHFA 3E3MA 3UG6A 5BNZA 2XH8A 1DEKA 2BCJQ 3K4HA 3BKXA 3T5GA 3ZDEA 3DDOA 3MCZA 4O3MA 7ABPA 5AVVA 1NXPA 1S8OA 1YR8A 5LUBA 2R1VA 3C8MA 2IYQA 3QXXA 1K7FB 2WHQA 2B8NA 4MQEA 2VOJA 2WYWA 4DC1A 5KAPA 3FBWA 3QKWA 3M3PA 1B7GO 5HCIA 4EZIA 1R6UA 4FLMA 1DFIA 3EMDA 4GEKA 1AC5A 4UM7A 3TNDA 4YMWA 1UJMA 1W4BA 1FMJA 3BYZA 5FWDA 2BLLA 2QL7A 4A6EA 1EFRA 1FSFA 3CLSD 3L6EA 2PZBA 3JX9A 4HN4B 3O26A 2JRCA 4P32A 3EXAA 2IZOA 2YHAA 3HEMA 2P79A 1QV9A 4RFVA 2CFSA 1Y9DA 2A2ZA 5LYYA 1BSVA 2P5SA 5CLJA 3AEUA 3MWJA 3WLPA 3AK4A 1HTTA 5AW0A 1IWOA 1VG8A 2P9QA 1R0ZA 1B6TA 3EF0A 1YRYE 3QF4A 2E3JA 1I7DA 3MIIA 1ZL2A 1OLUA 4BJ3A 2O8BB 4FP9A 4DAOA 4QDUA 4PQEA 1PDOA 2CMDA 2I3BA 3TIIA 4RPCA 3ML1A 3D8BA 2D2IA 4J91A 1EMDA 5JANA 4JP3A 5DNAA 3MHTA 5K7SA 3DZDA 4JHXA 4D0GA 3O90A 1BD3A 4B6RA 4KIFA 4M1KA 4H60A 4J2TA 1CUWA 1SXJA 2NX2A 3VH3A 4MDHA 2XTNA 2ZJZA 5AK6A 4JSRA 5EE1A 1YZUA 4UASA 3W05A 2QA5A 3G85A 4R3WA 4A03A 3BDIA 4BGEA 5JU6A 4NYMQ 1NUAA 2O2IA 4O2BA 2QV7A 3UXHA 4ZOQI 1U0SY 3C39A 5DLEA 3EB9A 2QUHA 4F8JA 4PX9A 3HGQA 4NYMR 3ROXA 2F8LA 5C9ZA 3B3FA 4L5YA 4BAUA 4UKDA 2Z4SA 4WPGA 3CIOA 2QBYA 4PSVA 2QGFA 1MC4A 3DLBA 3Q9UA 1WMFA 1UBCA 4PZLA 3MBOA 1I4WA 3C3KA 1W35A 4B71A 1U4NA 1W30A 5ED4A 4B35A 4MR8A 4QX6A 3ZDZB 1Z33A 4JU8A 1UJNA 3JWEA 4IQGA 4LN1A 2DSTA 2VA8A 3OF2A 3OE7A 5I51A 3I64A 1J2YA 5K45A 4C89A 2XE7A 3GLIB 5AVTA 2WHRA 1Y5IA 5GJWC 4F0JA 3AJAA 2IOHA 2AUTA 5G02A 1WR8A 1FS5A 5I7RA 2ZJ1A 5K01A 2AHOA 2PMDA 4KAFA 1NULA 2FNAA 4MGZR 3K9LA 2R6FA 1E6KA 1ECPA 2QU7A 1Z4IA 2CHUA 3TOXA 3W6ZA 4CMAA 4E30A 4UAJA 3EQ2A 2EKPA 4HNGA 4PLVA 2FF7A 4RD2A 5A7FA 1CJUC 1GD1O 2UYGA 4YTEA 3IEIA 4GX2A 1ZM2A 4OIFA 4HB2A 1L5GB 4CLHA 3THYB 2IHTA 1Z56C 4IOLA 1DCTA 1B0AA 4QO8A 1I10A 3QLVC 3UMVA 1CF9A 2BVNA 5BMVF 3DW1X 2AUMA 4JHLA 2QTHA 1B2LA 2AYZA 3FPFA 3ON5A 4MVWA 4ZQIA 3RT1A 4AJNA 5JAIA 4UE3S 1IMJA 1YUNA 5HTOA 3T94A 2HA4A 4Z3DA 3CLTD 3OD1A 1GPLA 4QG7A 1B23P 3DDZX 1G4AE 4BWYA 4DDHA 3RTDA 1XL0A 3I9KA 3QQPA 3UW3A 4AJ1A 2WJYA 5JS1A 3GBVA 3VH4A 3IQWA 2WUGA 3KV3O 4MW1A 1Q74A 3GJYA 4NBUA 1FJGB 3U4DA 4ZU1X 2D00A 2OPBA 3NHYA 4CRWB 1N2SA 2OHGA 1A9RA 4IVPA 4NTZA 2VT7A 4Y2TA 4HWSA 1SC1A 2A4MA 4ZCPA 4EB6B 2XUPA 3D31A 5ALLA 5KTOA 3LSYA 3CLRC 2WKSA 2EFJA 1HGXA 1JHAA 1WNFA 4G0NA 2YOHA 1JIIA 2PGAA 1OBVA 3IP5A 3OF5A 4PLWA 4TTVA 4UUOA 3SDSA 2F3RA 3VNQA 3K5HA 3RJTA 4JXZA 1KTVA 3CSUA 3PPVA 3LBNA 2YW2A 1CE8A 4F2PA 1N5MA 4MXDA 5DX0A 3LPDA 2NV2B 1ZMTA 2PVPA 1G16A 4AURA 3T9AA 3NC4A 5IC5A 2JLYA 3STVA 1ISSA 4ZQHA 1I0LA 4WXEA 2FX2A 1Q20A 1RM3A 3NNSA 2A9OA 2O50A 3OTGA 5K0NA 1M1ZA 3B1KA 3ORFA 3KR2A 1IM2A 1W6RA 2H11A 3H5WA 3IMEA 4X60A 1EHCA 2WT4A 1U9JA 2BHLA 5LXTF 4DRXA 5CDSA 3LC0A 1E3EA 5M7EA 1Q5PA 4MSUA 3UVEA 4A2CA 2M1ZA 1YL7A 1G1AA 1YK1A 2OZKA 2R44A 2R8RA 3I37X 3FYDA 3CLTC 4Y1EA 1NHGA 3EFBA 3IBGA 3MJRA 3TNFA 3PNKA 3URKA 4X93A 5FTWA 3SYKA 1LU9A 4MKFA 1KP2A 1A4RA 1S4MA 1A5AB 2IYPA 3L4BC 1PK8A 1E4OA 2AK3A 2FUEA 2OBXA 4CL0A 2P8JA 3AP1A 1P77A 3G9QA 4MW9A 4G1MB 1COZA 3CT6A 3WXBA 3ZOKA 1B8PA 1WM1A 3PUJA 4UUAA 5AKYA 5ADWA 5IUJC 4YQEA 3I04A 1U1EA 4JJAA 3F9CA 4IIUA 5AI6A 4BN0A 3QXSA 4KGZA 1WCXA 1XZKA 2F9LA 2ZULA 3DP7A 1ZI9A 1I5OA 3CN7A 2JGMA 4Q9HA 5CB4A 4X97A 3IPCA 4GI7A 5KVSA 3N53A 3CLSC 3QUTA 2BRUC 5FBHA 5TPZD 3AF1A 5EKTA 2HD4A 2O48X 2QMOA 1KR5A 1UJ6A 1QGUB 4KVFA 1OGYA 2P65A 4ZZ1A 3FI0A 4JBNA 3VISA 4ID3A 4DG8A 2GXUA 2JCVA 3MTJA 1WP4A 4XYEA 2J9FA 3G6WA 4WK2B 5ES4B 2IHVA 3HR8A 5ICFA 5C81A 4JYMA 4H31A 1GPH1 4MPPA 1E7WA 2WUVA 2IXEA 3H7IA 3PIIA 4M7RA 4O2AA 4GYKA 4QUIA 4U7WA 3X1JA 4R2JA 1JFRA 4WVLA 1OW3B 4BBJA 3H42B 2DQZA 3A4MA 2FDXA 3R9KA 2OCAA 1AF7A 2W71A 3EA0A 3INTA 3QKUA 4FZRA 3IHTA 1EFAA 1OAOA 1TIKA 2YV3A 1USGA 3O5AA 3GFVA 3PZRA 4OQPA 3B53X 1UJBA 3KXIA 4PRZA 5A4FS 2JFBA 1J1UA 4CG1A 1SD2A 1U02A 1EG7A 4KXMA 1ODTC 2AMFA 4RF3A 1Y42X 4M8IA 3SHWA 4HJXA 2HEIA 4CR7A 2HHHB 4A27A 1MG5A 2OD7A 1MBZA 4AWAA 3LUCA 3DJFA 3TWOA 1CE8B 4D98A 5I48A 3RVJA 3OCWA 2ODWA 4RTOA 1NQ5A 4HJRA 4QM7A 2I4NA 1PT9A 1YC5A 1QE0A 2N1BA 4NCJA 3E27A 1UXGA 2PKQP 3FVRA 3LIPA 1T2CA 4P4TA 4BGUA 1EWQA 1QBKC 4DB4A 1IUNA 3ITNA 1N5IA 1Z0KA 3ZD7A 1AB6A 4UVEA 1GFZA 2J5RA 2UYYA 2VYND 4CLOB 4DMHA 5I9IA 3O7WA 1H8HA 1X1DA 2FEMA 4MP6A 2AKYA 3M6AA 4B2IA 1CUUA 4EUEA 2OO5C 1IG3A 1V47A 2ZUWA 3Q3HA 4I4TF 4XIGS 2VH5R 2WJAA 2OSBA 3UJBA 1RI4A 4PHFA 4Y1RA 3J81k 1AS2A 4KQMA 2GCNA 3FUCA 1IHXA 3SEQA 4MLDA 1YQTA 2ZYDA 1GAQA 4KQXA 4ZO4A 4XIIA 4GQAA 4DM7A 4QVKA 5H9WA 4WY8A 2GA9A 5FADA 3T1TA 1GYPA 1V4BA 4PSKA 3GNLA 1WW8A 3HUDA 3V7YA 3KQHA 4MQ6A 3JASA 5F35A 3LZ6A 3PYXA 1T6YA 1RVV1 1XMJA 2BGMA 2QLBA 3SJBA 2E4AA 3CVOA 3PC8C 4G26A 2G6BA 2KBFA 5DEOA 3FCCA 1BS2A 1WY7A 3JD1A 2LV8A 1P7PA 3IMCA 1CYDA 1X74A 4KE6A 2RI1A 3R4CA 1GN8A 4JKYA 3SBOA 3FCSB 1QGUA 1RYDA 4TT3D 4BX9A 1JQDA 4DLYA 3EXG2 4YV1A 1IM5A 1JAHA 3MRSA 2NO4A 4Z0TA 1F9EA 3LCVB 3V4PB 4FILA 2H7CA 1GNTA 4FCCA 1JJIA 3TSOA 2C78A 2WUDA 3B8EA 3QEKA 2X9LA 3TFOA 1OCEA 1DIHA 1UINA 2JF0A 2PJUA 4HS4A 2D1SA 2GFHA 3BX1A 5C8YA 2HQRA 3SQXA 3DD1A 5B3KA 1V11A 1HZZC 3AHJA 4UMFA 2YQZA 1PJ2A 1QCCA 3WTCA 4FMPA 2RB4A 1BTOA 2YHIB 3B6ZA 1NRWA 4MWGA 5AOBA 4EW1A 1PZXA 3PZBA 3JAMA 1HG0A 2YYYA 4IRUB 2CMKA 3OFSA 2O05A 4PZ0A 1D1QA 1MX3A 1DIRA 1UKEA 2D06A 2GBLA 3AXTA 5EJGA 4AJ2A 2IPMA 2HWUA 3W5VA 5TQ0A 1JJFA 3T3DA 1GTMA 1Q3HA 3EPPA 2XECA 4P08A 2RGUA 4HFMA 1J97A 3K0FA 5BQOA 1UDAA 4G5XA 4YP6A 4PZPA 2E48A 2X22A 3KLOA 2OMEA 4K86A 4HGQA 1TM4E 4MQ4A 1ONOA 1U3UA 3LV8A 3HDVA 4FYJA 1JMVA 4UEKA 2J85A 2JIMA 4BV9A 2O0LA 2ZGVA 1PSDA 2WWXA 2R7NA 4L5IA 4LDPA 1C7RA 1EINA 4QVGA 4U5XA 3FNFA 3OLQA 3OZ7A 4QQFA 3BIXA 1A3CA 3ICVA 2QK4A 3GQBB 2L19A 1OTXA 3C3BA 3OPMA 1M1YA 4CLOA 4M86A 1GGHA 1DLJA 3OQPA 5BUZA 1A2KC 3TF5A 3VR2D 1LTQA 4C4SA 4YHHB 1EG2A 3IVAA 1ZCBA 3GLSA 4UPVA 5BMOA 3H3XA 5BMVB 3PKZA 4WGFA 3EXHB 1WS6A 3ZY4A 4ALMA 1ZKDA 3MTIA 5CFZA 2M6KA 1W59A 5G4LA 4FOPA 1OWLA 5E2AA 3KPUA 4RTQA 2NUTB 1Y3FE 1TD1A 3D5TA 3ZVLA 2R8OA 1ESEA 1AMUA 1L7NA 5C1OA 3IDZA 3ELYA 1TT5B 3HYCA 3X1XA 2OA0A 4D3SA 3ONWA 3R7WB 2RHLA 4Y2SA 4A82A 1K8QA 1ZIPA 4IZIA 3SJ7A 2E87A 4B83A 4F9TA 3I6MA 4O33A 3TR0A 3LBHA 4DNQA 1QDEA 4G5YA 1CUSA 2EJTA 1KO4A 3IXQA 2BMWA 2ZR0A 1KVUA 1G17A 3PU6A 3RF6A 1S89A 4D80A 5DSTA 1DQZA 1M2OA 1XLVA 3JD3A 2UZAA 1XROA 2FE1A 3TTTA 3UJCA 3EY4A 4BYGA 4I55F 2P4EA 2P1DA 3AP2A 3IVRA 3IR6A 2IH4A 4TPKA 3B13B 1Y4UA 1VIMA 3E5MA 3PV0A 3OM0A 5KYWA 1K6EA 1C7FA 3S7ZA 1WMAA 3BRSA 4IIJB 3V4SA 2HF7A 3WA6A 1DAEA 5INTA 5JFOA 1NPYA 3HM9A 1NP3A 3RM3A 1NJ8A 3HVHA 4JASB 4AXXA 3EPLA 1BCRB 1U7ZA 3D7KA 5HF8A 2G83A 4V2IA 4M9RA 3DFUA 3QVWA 5AT1A 4AZSA 5MF6A 1R9MA 3FPEA 3GMDA 3MC1A 3DOFA 3L02A 4RO0A 4BCCA 5AJZA 1GTRA 4RKQA 2WF6A 1QRUA 3NBAA 1PS0A 1M1XB 1U1CA 1YVUA 2CVHA 1MN6A 1BEUB 3QVJA 3T3GA 3V8BA 2D7CA 2Q3DA 4MV5A 3H1PA 4PCLA 3RROA 1P18A 2YN4A 4GPEA 2W48A 1LLDA 2C42A 3Q5GA 5LNK1 2PUGA 2R1TB 1P1RA 2Q7XA 4E2YA 1O8BA 4GOMD 4PAQA 3ZLVA 1I4EB 1JAXA 3KU1A 5IN5A 3VXKA 2JHAA 3L7CA 1HQKA 1TMGE 4HDMB 1TAUA 3HO1A 3IIIA 3WYEA 3ZGXA 1YFJA 3REQA 4QYXA 3TTVA 1EGMB 1W2HA 1FDRA 2OUIA 4TYNA 1C1HA 4DPKA 1QYVA 3DFIA 4D9MA 5CT5A 1II8A 5F9FA 4H15A 4MI6A 3VRHA 3IQIX 2ZG6A 1E2LA 1QGOA 1B93A 5KDDA 4IL5A 2BC9A 1PL8A 1POXA 2PZMA 2P6MA 3IPLA 3V2GA 2VH1A 1PW5A 3DW3X 3GWGA 1NG9A 3KYDA 3WLEA 2PK3A 2V3WA 2G1UA 2R6GA 3FOEC 1J0AA 4CI9A 4QJ4A 3CKMA 3PHCA 3SIPA 1XXHA 2YY6A 3LQRA 4YRRA 1RQLA 4KTVE 2E37A 2RI6A 5DW0A 4EG7A 4BZPA 2FW8A 2HEGA 3NXSA 5E8RA 4J90A 3T5BA 2H7XA 3R7WA 1K2WA 1G5TA 4RDIA 4ZGWA 2NAPA 5H0IA 1N2HA 3BGSA 3I6ZA 4PWYA 4D8XA 5IRCD 1SZDA 4F96A 1N6IA 121PA 1V35A 2C20A 4DW8A 5GONB 3O4VA 4B8WA 1Q0PA 3HU2A 2EX0A 4FMDB 4U7PB 4WOPA 1L9KA 1TQ8A 1ULAA 1Z13A 2VCHA 4BO8A 4TKLA 1UBMS 5GVSA 1E1QD 3WX0A 4MS4B 4UFPA 3U3DA 2B0JA 2W83A 2P9FA 3PS9A 1Q1AA 4JEUA 4OTZA 2XD9A 1ESCA 2CLFB 2ASVA 4QASA 2A84A 4OIMA 5KYWB 1QIHA 4BMNA 1IZZA 2A9VA 3LRPA 5F1OA 4ZYUA 3ZHXA 4HEHA 1POWA 1A82A 4OP2A 5EKXA 3TXYA 3V00A 1XIVA 3HCRA 4HSGA 3JYPA 3TR5A 1BCRA 3FYSA 5CFMA 5FNVA 1PG5A 3SMQA 3FFXA 1TYCA 4PICA 4ND1A 3WJ1A 4B4UA 1UWVA 3NBXX 4OJQA 5K1ZA 4MVJG 2F8TA 2JFNA 4LGYA 3TQTA 1TQ4A 1JIUA 5EJAA 2G09A 1TM2A 4WJZA 3RQIA 2Q4OA 4I9UA 4RSHA 5L3ZA 4QWWA 1TZJA 2AFIA 1WSBA 4BNNA 2QN6A 1WTAA 3O8DA 4BB9A 1QTQA 3CZAA 4QD3A 4IZHA 2WILA 4Y0AA 2BKLA 3WDKA 4ZJZA 3I45A 3HO8A 4ES6A 1R6XA 5JYDA 1COWD 1OXXK 2CV1A 2B69A 4UARA 1KVRA 1T6NA 4E2ZA 2J8ZA 2Q8NA 4M8SA 4D79A 3H87A 2FHSA 4RLHA 4DUYB 3EC1A 3MELA 2CFTA 4X6UA 4MWSA 1LK7A 1FFWA 3C7AA 1HDCA 4GLFA 3TZ6A 1E3MA 1EQ2A 2BMVA 4OHOA 3ZHZA 1U5BB 4DA6A 1N5LA 3HFRA 4JA0A 4V3CA 2XY4A 4WV3A 2IIQA 2IY7A 4BNDB 2HJHA 4KEAA 3IC5A 3QXJA 2O1XA 1ZK4A 1KI4A 5IAAA 1PP4A 1PJBA 3G5AA 4GHWA 1DPFA 2QB5A 2R6DA 4A92A 1RAGA 2YXPX 3BFXA 3CKYA 5K4GA 5ISMA 4QTUB 3TLJA 2P2GA 3NGMA 3G1WA 3VPDA 2VAMA 3FUTA 1N6PA 4MVJD 1ZUD1 5DNWA 4WERA 4RHXA 4HVAA 1UF9A 1RXVA 5DU2A 2I7TA 2Z4RA 4Q4JB 1BKSB 1G6KA 3ROTA 3C0KA 4WKGA 3RC7A 3D4PA 1EBBA 3HC7A 2IV2X 4JJKA 1VRVA 1PR1A 5L8VA 1L4MA 1P1KA 3LG2A 4C4AA 3PE3A 2EG5A 4WACA 3RUAA 4ESHA 3DKIA 5KVVA 1CEEA 3A10A 2Z2IA 4LHZA 3UM9A 1I6WA 2ZUCA 5K0SA 5EXTA 3CNBA 1C0EA 3VU3A 1NU8A 1GT91 1DEHA 4N0PA 1CR2A 2I8LA 2XE8A 3RC2A 4C06A 4GVLA 1CR0A 4Q34A 5FLYA 4XSHA 3R5XA 1IIBA 3E0QA 4HYQA 3CX4A 1L0BA 4AP6A 3KAKA 3HJGA 3IS3A 4QGSA 4MS3B 1FCJA 1CYEA 3H5RA 1QCYA 4A0SA 1ZVVA 4HDAA 2XCIA 3OF3A 4H7DA 1CUZA 1B43A 1KDRA 5HW0A 4L6CA 2WTNA 2ZKLA 1UP7A 3N75A 5L3SA 3EIHA 2CUKA 4XARA 5AVYA 2GN6A 5LXTA 1BROA 1EHYA 2QNRA 2XGSA 1JG3A 4OYHA 3RS3A 4OX9Y 4YJDA 3VU9A 4BE7B 4YJKA 5IULC 5LB2A 5K8IA 1XRLA 3CYFA 2VH2A 4LZLA 4WW0A 1L5OA 1T2EA 2ZZNA 2B4AA 4GMGA 5JVDF 2VJMB 5IDWA 3UQZA 4PV7A 1W75A 1F6DA 1M34B 1UBLS 3E3AA 2W4QA 3K73O 3RYFB 3I6BA 4DJDC 5A06A 3B5JA 3UYKA 1RYMA 1EGVB 1JEOA 4Q7LA 5CA0A 1J49A 4MDEA 5DWDA 1QF6A 1G4UR 1UWCA 3MAGA 3P2EA 5E2IA 2QTTA 3KE9A 1VI2A 3IB6A 5HIIA 4CJXA 1NONA 4IPTA 4LW8A 3A4LA 1DUSA 2QF7A 4Q02A 1NC1A 3ZWQA 1PYOA 2VSYA 3GFRA 3JALB 4Y6GB 2HJGA 3GZNA 4X84A 4LG1A 4GOXA 2D1QA 3WHPA 1QIMA 4WE3A 5L3RA 1XMPA 1KSJA 3WADA 3UMRA 5CEJA 3IKTA 4HPXB 1G21E 4LJ7A 1N8SA 3MMPA 3F7MA 1RTKA 1JNYA 1VPDA 3M9WA 2GVZC 2W6OA 3G2HA 4W1PA 3DB2A 2DLNA 4LJKA 4J0DA 1ADBA 1Y8CA 1KH3A 2ATIA 5E4YA 4EHJA 2P2NA 2HJSA 3H2SA 3QYFA 2PMEA 5ADUS 1QTIA 5AIBA 2N1MA 3ANYB 4H1HA 2UUPA 2PTGA 3UIEA 3C5CA 2NZWA 1JB1A 4KN5A 4FIDA 3C5EA 5AVXA 7GPBA 2J3QA 2OVBA 1QYRA 3VDXA 1PEAA 1UBNA 1Z15A 2HM7A 3LVRE 3Q3VA 3SEFA 3EIQA 3MJCA 3QXCA 4BX8A 5H70A 3MGBA 1H2XA 3EGCA 3FBGA 4HSEA 5HFJA 4MHTA 3A4TA 3JQDA 4GMDA 1ZD8A 4HUQB 4B1FA 2OCXA 4YLYA 2KSQA 4MUXA 2VTDA 3DA8A 1GQQA 3UJ6A 3WC4A 4TWJA 3Q2OA 2CNNA 3K94A 1ILEA 3AR7A 4ZO7A 1EVJA 1RM4A 3JZMA 3WRYC 4F1JA 1M2VB 2B37A 2QQGA 4EARA 3ONEA 3EE6A 5F5XA 2MSKA 3BXXA 2P7IA 2XMSA 3G2PA 2PE5A 5LXTB 1CJVC 1FTGA 1N1EA 1ZXXA 3S2YA 2A67A 1NMQA 5K0GA 2CD7A 2C2XA 5TX7A 2XUKA 4UUPA 1O9BA 2YUIA 2X9QA 3Q7SA 3NKVA 3BH0A 3E3LA 3CUUA 5JDIC 3KTAB 1B1CA 3NOXA 4IDGA 3T3PB 3WLOA 2RHGB 4NCIA 1BOOA 4P0TA 2ESRA 4P38A 1XYGA 2P1ZA 3FNGA 1T0PA 4YRJA 3SKYA 1L4FA 2QTWB 3QOXA 2X6RA 4IQ0A 3FPSA 1DI0A 3LFUA 2PQ2A 2QLNA 5FNZA 5HQJA 4N3CA 1VYUA 3W4IA 3ZCUA 1AHPA 1H9CA 4Y18A 1ZQ9A 1YBMA 4DQXA 3BXZA 3AQIA 2WZBA 2CHGA 1BH2A 1K5DA 5B53A 4ZVPA 3VPXA 2XCQA 4POAA 5EWLB 2W9XA 2XAAA 1AZTA 3E61A 3JALA 2NXNA 3I8SA 4I2VA 4YCJA 3U0VA 4DUGD 4WT7A 4Z8YA 3SLKA 2WWRA 2B30A 1MT3A 2WHXA 3T5TA 2VUIB 3Q3GE 1KVQA 3PQ7A 1WHTB 4HAUA 4EHLA 4GI1A 2N3ZA 3F90A 1TKAA 2Q2NA 4ASUD 4V0LA 1KY2A 4GPBA 1KKMA 4XH9B 1W47A 4AU1A 2I6XA 1SMKA 1NXWA 3PT9A 2OG2A 1A2QA 2XWBF 2QN2A 4X8MA 4IXTA 3BK2A 3ZIAA 1M7GA 2XNHA 1HE3A 4N6NA 3WGUA 2OORC 1RXEA 4G4IA 4CCAA 2OBMA 5FORA 5EMLA 2WWFA 3ET4A 4JJFA 5JPDA 2V8OA 4BNJA 1HDRA 1W94A 1CKEA 3WP1B 3H2HA 2P35A 5CIQA 3B2NA 5G53C 5HCNA 3C1AA 3SOPA 2CMFA 3ASUA 2KJQA 3ABOB 5AUNB 2DQSA 1LSUA 4FT2A 3KFLA 2MU1A 2R6HA 3DMPA 1T5DX 2FF5A 1IEXA 2PWZA 2BBWA 1SHUX 2A7XA 1DBIA 1HT2E 3IJRA 3P9CA 1QHIA 1H5QA 4IDHA 4B3GA 4NJEB 5C7IO 3PD1A 1DJMA 1GO2A 1U28A 2CLKB 3B1YA 4MAAA 1K7CA 1K92A 2PZEA 2R7AA 4G0OA 4PG5A 4Q05A 4QO7A 1XF1A 1E9RA 1WOYA 4NJMA 2VDJA 5JMPA 2CFCA 4CGYA 3FDXA 5F7OA 5K0CA 1Z88A 1UBJS 3PR3A 5AHXA 1FF9A 3VU1A 2Q9BA 4EYEA 2C4NA 3BRWD 3DF7A 3JQAB 4M60A 1TCVA 2YZGA 4QOHA 3RIEA 1TUIA 5F9MA 5AFSA 1J1ZA 3GFSA 1U0BB 1N0VC 3U16A 3VZRA 4RESA 3MZ0A 4JGIA 3RK1A 4BMDA 3O4IA 4XLTA 1Z2AA 4EYKA 1EXDA 1CDDA 1TO2E 5FR1A 1DJQA 1NQOA 3CRMA 3M83A 4BV8A 2QIOA 4PAMA 1X8XA 4Y2VA 4ACBA 4UTZA 3O8OA 5L3QA 1YCDA 3UH1A 1IY8A 2HHAA 3FNIA 3YASA 5D3MA 1KJIA 1E6WA 4HDRA 1SKYE 1JSLA 2H5JA 5DV9A 2QUAA 4NZPA 3T7AA 1X9HA 5UKDA 3S99A 1DCFA 1R66A 4I3HA 2WPDD 4W1SA 2L69A 2HZ7A 2P6OA 2RK6A 4BY9E 1DIAA 2FWAA 1ODJA 1SVIA 1ZPDA 2ATVA 3MJHA 2H2AA 2ZRIA 2PQ0A 2QRKA 3G79A 4KODA 4U63A 7REQA 1NN3A 2NWQA 2JEOA 4W9NC 3GFOA 5G0TA 3T3OA 1RCUA 2RH8A 2WJGA 3MPOA 2AOWA 5F7JA 1YB7A 5GJCA 4ARVA 2EP7A 1PUXA 3I9NA 3JQ7A 3MCUA 3PSHA 2QM3A 3K2IA 4D57A 4ZKDA 5JS6A 4V2UA 3W6PA 3E8XA 1AO0A 5KI6A 4P4NA 5B7GA 1M8JA 1IZ0A 2DBYA 4LHVA 2JGJA 3PDWA 1O6BA 1VMIA 1B15A 1FEZA 1YQUA 2ECPA 2IEDA 2PZ8A 3AWDA 4RL6A 4OQDA 3G9ZA 4ZWNA 3IURA 3PUIA 5TGZA 3GRVA 4RS3A 4W6QA 2ZCUA 3KPYA 4D96A 1Z73A 3HI4A 2GK4A 2P9GA 2R79A 3PEVA 1GL7A 3R77A 2C4WA 3D4LA 4QQKA 2FFJA 3D5QA 2HYDA 4V0SA 3RAJA 1FXUA 2CV2A 1ZWLA 4B87A 2NSLA 2DUNA 2QAJA 3UV3A 3HZRA 3OETA 2ECOA 5JNLA 5CA1A 1FP2A 3N9IA 3I5XA 5AM5A 4NH4A 2O8EA 1F4LA 2B7BA 2B1GA 2QTLA 2WVGA 3VR6D 2OEPA 1QH1B 3TNYA 2B9VA 4OMFG 3O8CA 4NJEA 2Q45A 2X1MA 1K08A 1V2GA 2RC5A 2XCTB 4NK5A 1SOWA 3OM1A 4UAUA 1CVRA 1AKWA 4XQCA 1QK5A 3ROZA 1WTCA 5EP4A 3ESXA 3FWZA 2O59A 1ZD2P 4FN4A 1JAIA 3R3UA 3LZCA 3E1GA 2V45A 3P0RA 1KMQA 1OPXA 5GGYA 5A3VA 3U7JA 1JSXA 3I23A 1VPWA 13PKA 1P1HA 3IVXA 2Q7OE 3GMTA 3AVUA 2IBSA 2Y0EA 2HADA 2JG3A 4DVGA 2C99A 2GJ9A 1LJUA 2IP4A 1P73A 5E9AA 2FZVA 4PSUA 1T34A 3F74A 3BIOA 2P2DA 3BMNA 3KWFA 3HJBA 4X63A 2JJ1A 1YVPA 1E3TA 3NWJA 5L3QB 3L0CA 5HKKA 1QIIA 3T9EA 4RTRA 5K4AA 4GZ3A 3H04A 4Q7MB 4NAHA 1Z5PA 4EZBA 1EVKA 2I54A 1P2BA 2ETVA 3NAZA 3V1UA 3JQ9C 2CSXA 3Q7PA 3TLEA 5I7UA 1ISFA 1XDZA 3IDOA 4CKWB 3GGCA 1SZCA 4KXQA 1VLVA 2HO4A 1ONBA 4PWZA 3SU8A 3EXIB 2BIFA 3IT2A 521PA 5TPWA 4D0LB 4M1WA 2RFLA 4GFDA 1EFLA 5ICMA 5JAQA 1SBTA 4K6CA 1LK0A 3ST7A 2J3IA 3NEAA 1PEKE 1V8OA 3I2YX 3N8KA 4KCGA 7REQB 2WM8A 3W5SA 1P5FA 2ZJ8A 4I4IA 1H42A 2OXEA 4F8YA 1ORTA 2PUDA 5K05A 4H1VA 2HQSA 4EKNB 4YMTA 1DB3A 4TVOA 1QH8B 2KPOA 2E5FA 3W2HA 2UU9B 1Y1SA 3OC0A 1NW9B 3KP1A 4D3XA 5F2EA 2F62A 3RNOA 1H9AA 1TUBA 3LUAA 4IFIA 4EI8A 4D0SA 2A5DA 4AJ9A 1SCNE 3EPJA 3CGGA 3ADDA 1EFPA 1SCBA 3SNKA 3E9MA 3L1HA 2JCXA 3P5BA 4Q15A 1CBUA 2JFYA 3OIDA 3R24A 2WD8A 2X3YA 1RWPA 1YTLA 1B6GA 3KHTA 1TRHA 3CW8X 2P0EA 1GZUA 2MCFA 1IMOA 1KZ7B 1WCIA 4BRUA 5CA1B 1DXHA 1KDTA 2H1HA 2WU4A 3TKYA 1AQLA 3FKQA 4CCYB 2AHRA 2BZ1A 4KRXA 1QH1A 4IIEA 3RRMA 3RSOA 1VSBA 1GCOA 4KGVA 1RJ9A 1USKA 2OPHA 4X20A 5IAGA 4A10A 3K6KA 3THYA 5D84A 2E55A 4PYMA 3GBSA 1LWOA 4BDSA 1FTSA 4EHNA 4A8JA 1LQTA 4KBGA 2B8EA 3SS9X 3LLMA 1E3IA 4QOFA 2A1IA 3IP7A 2PZLA 2J6IA 1PSZA 4AF6A 5A02A 1VSUA 1DMSA 1GDHA 1WDLA 1CUFA 1TAGA 3N6XA 4WCFA 2A1TR 5A9TA 1UZMA 3RHTA 4EJSC 5IK2D 3W6OA 5IZ4A 2ZJ2A 3C4JA 1AKVA 2PMCA 1U7UA 4OXXA 4DRZA 3KBBA 3PXGA 1KSFX 1G6OA 3KLNA 4Q1CA 4URZR 4M1EA 2PNFA 5L40A 5KX5A 4Q6WA 1BFKA 1RWMA 5E4JA 4EY7A 1RKBA 2FQ1A 1DNPA 3MWFA 4HCJA 2NVUA 5CYOA 3NALA 4AMZA 3FZNA 2ZYVX 3OQIB 5JDCC 1IBKB 4EGQA 3G68A 1ZJJA 3D2LA 4E5YA 2J6HA 3GXBA 5HJEA 1DKOA 2C9CA 4Q18A 3A0RB 1V39A 1OFUX 2VOEA 2IZ6A 3Q0TA 4GPIB 4OGLA 4BLOA 3FUUA 1OV6A 2QRVA 2WNHA 3ICPA 3NM4A 2A5JA 2DAPA 2OC4A 2X58A 3EBLA 3H19A 2W2PA 4JK3A 2A3RA 5TQJA 3SYLA 4ETIA 2HRBA 5FWNA 2IRWA 1XQWA 1ZYUA 2AG0A 3IO3A 2ZRFA 4OMUA 5A3SA 5JECA 1JXAA 3R6WA 5MGBA 1WCYA 5EMNA 3VR4A 3GX1A 2FVYA 4NY1A 5DHTA 3CW2A 3KDSE 3W5UA 2W90A 3RKRA 3TS1A 3QU4A 2G5PA 3C6MA 3W7BA 1PHPA 1A8HA 2OCYC 3OMLA 2X8BA 3O3OB 4JI5B 1BXZA 2KWIA 2GCEA 3KOXA 4ROTA 1XAGA 5DISB 2G9ZA 4RGBA 5TQ2B 2SECE 621PA 1I4DD 3M1IA 5FIUA 3UA3A 2JC3A 1II0A 3IYLW 2J5BA 2QQEA 2VS1A 1YZTA 3W34A 1YDFA 2AJDA 3MCVA 1GTZA 1BVRA 3V97A 1R0YA 1D9XA 1NN1A 3PDUA 1RM5A 3KPJA 4IGEA 2JKVA 2ERCA 2JEZA 2ZSBA 4ZI7B 4DCNA 1DWPA 3I0ZA 1YQQA 5G3ZA 5KNBD 4TXHA 1VBKA 4OJMX 4MH0R 2ZB4A 3EZGA 1NVXQ 1QFYA 2FEKA 3GH1A 2UVQA 1R4AA 3L9XA 2V5VA 3CZ4A 4TSFA 5IDYA 4CCYA 5DKFA 3OQMA 4UHBA 1HT1E 4WVFA 5FYDA 2H2HA 1J0DA 3J81A 4HS9A 2M1XA 1RJ9B 1U2DA 4N03A 2PWBA 4M0PA 3N2GB 1ISPA 1UBKS 2IPNA 1KZ9A 3K6RA 4UNSA 1R9JA 3VJRA 1XK7A 3DCNA 2FE4A 5AK5A 3E1KA 1WUYA 3CNLA 2DCMA 1B16A 3CSDA 4WAUA 3AHDA 5JAOA 6ABPA 1BQEA 1PJZA 2O9JA 3GCZA 3KTFA 3U7RA 5J5CA 2J9GA 1RHKA 4HAWA 4UE2A 4UM5A 3NBUA 3WQSB 4DCSA 3HP4A 5LQDA 1GT6A 3CH5A 4H2DA 4PBRA 2GPBA 1HL7A 2J9FB 2DOKA 3N2KB 3CN9A 4JJZA 3A1CA 4OHBA 5C0OE 2CL0X 3HV2A 4PPGA 5HBGA 2QP3A 1CUYA 2BONA 1IC6A 2M9MA 3GVXA 5C31A 1G4HA 5JFTA 4NU5A 4OQQA 2GF9A 4CTKA 2QD2A 1JJBA 1KIFA 3NEYA 1WUTA 3E81A 3H9BA 1N77A 1NN0A 1KPHA 1FNBA 4MUIA 3ZY6A 1LKZA 4BQOA 3K9NA 3UTCA 3W4KA 3PEUA 4PX3A 4PTLA 2FUNB 2BY4A 3ZDFA 1QP7A 1EPUA 2EGUA 1YZHA 4EUNA 3E5HA 2NQ8A 3C1UA 2QRVB 4PC2A 1O96A 4OO3A 4RX1A 3NFRA 3CEPB 3M5WA 3FCOA 1E1RA 1GGNA 1YH3A 1ZUHA 4C7XA 1QS0B 1WMBA 4ZVRA 4G07A 3BTVA 4EF4A 5JS2A 1O3YA 2NXJA 1OGIA 3H2IA 4G84A 1V96A 3WKEA 1VBMA 4CUKA 5EE0A 5KWVA 2AQIA 4P0PB 2GS9A 3WOHA 5JEEA 1KYYA 1C3OA 3HFGA 2LKCA 1GPAA 1QO0A 3LMKA 3OIYA 4P6VF 4HN2A 1XVTA 1KJ8A 3KPWA 4JI6B 1SPXA 3LLUA 1VYTA 1C30B 1VL8A 1Q15A 3ZWBA 3KVRA 2VK4A 1RHJA 1J06A 2QD5A 3OQVA 4FJ0A 3OESA 2Q1SA 1P4RA 2AJ8A 1H0HA 2EGHA 4AMYA 1RC1A 1B1AA 4RBNA 3VR4D 4DR5B 4DG9A 2BI8A 4R98A 3UUEA 4FHCA 2A0KA 2IDKA 5A2GA 4DBLE 1RS0A 4YMGA 4TS9A 5JXHA 3DUFB 4N47A 2FUG6 4ZI7A 3F78A 1BFDA 3ZWPA 3DZIA 4GXQA 4F2HA 4YDQA 1RNLA 3JVIA 3DBHB 2P5TB 1U65A 3M5PA 4KMRA 4LKRA 3NWBA 4IHJB 4RY0A 5JLJA 4BJ6A 2WIDA 3OFNA 2HSEA 2OECA 3A3YA 2PKEA 4XW2A 1YA4A 2F64A 2PG3A 4Q0MA 5KHAA 5DWQA 3VHLB 1YKSA 4DDMA 5CFLA 2NZYA 3E2MA 2QR2A 3RWBA 3NHKA 4BO1A 1FU7A 1UMKA 1SEVA 3MGAA 1XJCA 4HAVA 2C3UA 4MLPA 3UANA 4ENSA 1JECA 4GRAA 1I33A 2QZSA 3I3SR 4MEAA 5IU6A 1GL6A 3UWOA 4C3ZA 3EIOA 2BJVA 1U6KA 1QZTA 4HB3A 1I14A 3RW9A 5JAMA 4IBOA 4RJLA 4UHKA 1EX9A 3GEDA 2YV4A 3PGMA 4R84A 3U5TA 3G2MA 5LBUA 3DTVA 1O87A 3FCUB 3PPWA 4RTKA 2ZWIA 2EF0A 4L73A 3BD7A 4RD1A 5LQAA 2HT1A 2XCSB 2COEA 1I6MA 2FK8A 4V0KA 1E1YA 4MW5A 5ICEA 5HP4A 4L0CA 1JR6A 1D6JA 4ZI3A 2L2QA 3BH6A 3ZXXA 5T5QA 2B21A 4Q4LA 2B9EA 3GEEA 3RWMB 2YHIA 4UVIA 2BV3A 2D54A 4MQMA 1ZW6A 4TQAA 3WMGA 1CJMA 2PLFA 3ZGOA 1JE0A 4H1WA 4JUBA 1S0UA 4I9FA 1TJPB 1DG3A 1NF8A 2EEPA 3F73A 5P8WA 1BS9A 3DXZA 4TT3A 5EKDA 3G0IA 4XOUA 5AWFC 3ZHYA 1C1XA 2JZOA 2WLTA 4JENA 5CNIA 3RRBA 3K0FB 1M54A 2DPMA 2AC2A 4FE7A 4L2IA 2O3JA 2BKUA 1C2YA 1HBJA 1TF5A 2BI4A 3GG2A 4PZ9A 5DLDA 3ONDA 5ALPA 1T1GA 4ZQFA 3ZDYB 2VQFB 1PEDA 4WQMA 4NPHA 3VZBA 2PX6A 3ADBA 4G4SO 4N5IX 1KEUA 3EVCA 4JBLA 1DRVA 5LCXA 4DILA 5B7PA 1TM5E 3GZ4A 3Q85A 1JLHA 2MOKA 3MCTA 4CIBA 1RYYA 1TFRA 1XPJA 3OPNA 3R20A 2BL4A 3EFHA 4X7BA 3ZWCA 5BOSA 1NY6A 1TVKA 1C30A 1U8EA 1RYFA 2MINA 3QELB 2JIZD 4LX0A 4BVEA 4G0ZA 1A8SA 1FQKA 1ZWKA 2WHPB 2C0CA 4MRPA 4FR0A 2HMTA 2RONA 1XZBA 3I2IA 1A5ZA 2BP7B 2H85A 4HOYA 3EOAI 4IDCA 3WOVA 3ZBTA 5HWSA 2DERA 3GUUA 2JI4A 4UD2A 3LP8A 3ACCA 5ELXA 2WQ6A 3NP7A 4HF7A 2W2KB 3S1AB 1XZ8A 3KL4A 2YN2A 4R05A 1IVSA 3ZVMA 4ZAYA 2R97A 4TQGA 1KI7A 2VPYA 3FF4A 4QICA 2RJ3A 1SHTX 1UDCA 3M82A 1GNLA 1XZHA 2OLKA 1AUQA 2OO7A 2IF0A 4J7UA 4B3SB 1THMA 3E9CA 5EZQA 3IOEA 4QBTA 5CD9A 1JBKA 4II3A 3PFKA 4N82A 4CR6A 6LDHA 1DC5A 5IXJA 1IXZA 4XTCS 5LZ5A 1EK2A 2XUAA 1A9OA 5L6MB 4X6LA 3QE9Y 3H4IA 1FVFA 2YMQA 3OJWA 4LK2A 2JJMA 1JEAA 2A33A 1Z47A 1TPYA 3P9ZA 4CWAA 3I53A 3G0OA 3ZQJA 2C9BA 3B36A 3PFBA 5EUMA 3OFJA 3W8FA 3ONNA 1K3FA 1KEPA 1QCDA 3X2EA 2C8JA 1COWA 5JNRA 1I7SB 4OK3A 4CMJA 3F98A 4RK4A 2J0UA 3TMAA 1U7DA 4I5IA 3BIFA 1B0UA 3UA4A 2YOGA 4JJ8A 1VKHA 4GLBA 3AFOA 4YP7A 1AH2A 3SX0A 2X2PA 1GNPA 1M83A 4DBVO 3AUTA 3SEZA 1Q12A 1VC2A 3SQLA 6AT1A 4DR1B 2GCOB 4GKVA 4COOA 3J80A 3E22A 5EJMA 2R1TA 3E8MA 3I9LA 1WDMA 2BFMA 1PAUA 3UUFA 5FL7A 3QVGA 4LYFA 5HKBA 3B8HA 3Q3JB 2QMZA 3ONVA 4P4LA 3W3ZB 1CP2A 2WAXA 5K51A 1FVHA 3UK0A 2O0MA 3BD6A 4N7MA 1Q1BA 3TW8A 3NJ8A 4MUGA 2Z6AA 3H8WA 1H8ED 2FSUA 2JVIA 1Q1EA 1R8SA 2BM0A 2XNDD 1A2OA 2Z04A 5E4FA 1PBNA 3RU7A 3MN1A 4L5JA 2C29D 1N9GB 4TM7A 4ZICA 3IBTA 1JR2A 1FFAA 3E15A 3E18A 3GT4A 1UKAA 2BFAA 3EXHC 4YCAA 4QRDA 4AKTA 4EY8A 3W5CA 4XKJA 4TWAA 1D04A 2IHUA 4F5WA 2GOYA 3M0EA 1VA4A 3D6MA 5GWXA 1E2BA 4UQLA 3GYGA 2GHIA 4JT8A 4A26A 4AB1A 4GRIA 2VP6A 1VKRA 1ZH4A 1KC3A 1JLKA 2FZLA 1NNSA 2AI3A 1E59A 3QRWA 4CIXA 3E6AA 3COPA 4MA5A 3E8SA 2EBUA 4L50A 4QHYA 1OQAA 2VPQA 4U8HA 5C1IA 3TL6A 2X1HA 4OAOA 4KO1S 4TTIA 2YS7A 3UMCA 4C07A 4E5KA 2ZWMA 3C74A 1ZH6A 2VBCA 2WE7A 1AGNA 3FX2A 3FGNA 5GONA 2VJDA 3HRHA 3OTQA 4TL7A 2F90A 4S1NA 3PLNA 1Z4JA 1E5LA 1JEDA 3DMHA 4XRRA 1BMFD 5CIYA 4RTPA 1E9CA 5D7BA 4UJ3A 4ND5A 5JNUA 3PR1A 1NBWB 5DCWA 4BMVA 4AJHA 1X1TA 2PXCA 4B0PA 4FE3A 4W6ZA 3C5WP 4W9MC 5FOSA 4CLRB 1DCMA 3M70A 4W7SA 5F7XA 4RKFA 3JQFC 1BWPA 4JYPA 5BSKA 2A5LA 2PNJA 1T36A 4D8UA 5DX8A 5JUWA 5BSFA 3D8SA 2QX9A 4F92B 4OLHA 1MB3A 2ARKA 2JIOA 2IKSA 4MP3A 1CY7A 1OD6A 1KYZA 4BN5A 4R0MA 1TZCA 3ETGA 1DSSG 3S2UA 4JAVC 4Q4HB 5JV5A 4FI3F 3CVVA 1KR2A 5JJKA 5IJ0B 1QPGA 1T10A 4EO4A 3RHZA 3KZCA 2QXUA 2GCOA 1IUOA 4BNWA 3W79A 2G77B 3LWZA 4BZWA 3TZBA 2R8YA 1I2ZA 3NRJA 1JYFA 1RCTE 4J6FA 4KLRA 4V0RA 1P39A 4BNMA 2X5JO 1TM1E 4NARA 5T67A 5IT0A 1IRIA 3VR0A 3LE8A 4I66A 1SUIA 1YV9A 4M8LA 3FAZA 4JB2A 2C2WA 1YUBA 3HEBA 2XUOA 4L9AA 3OECA 1E3SA 3DYIA 3RS9A 1ZVJA 1U7OA 1PR9A 1TECE 2FFBA 2RIPA 1Z4KA 1MF7A 3DO5A 5JCJA 5B4UA 1ZD1A 3GFTA 1V3QE 3JQBC 5DOVA 3ZHOA 2QTCA 3AT1A 1F38A 4E4YA 1XZQA 1NR1A 5BP7A 4JJIA 2CCGA 1CTQA 4PGMA 3FDJA 2AKAB 3I12A 2Y6VA 2HRQA 4GKJB 3LGAA 4AY5A 4OB7A 2JFOA 4XIJA 5DT9A 4XGNA 3KAPA 1LW7A 1HPLA 1RTTA 1AZLA 1XZDA 5CUQA 5EZ6B 3VDRA 5CAEB 4XX0B 3EZ9A 4Q66C 3EH1A 2ZSDA 2DBQA 1ZONA 2IITA 4DJEC 1HDYA 1NVKA 1FYXA 1UBTS 2D4HA 2F59A 1FE8A 3MUEA 3CG0A 2DLDA 3E9ZA 2PM8A 2VAVA 1J56A 2JIQA 5LDHA 4DLXA 1WABA 3MJSA 3OHSX 4M0UA 4C4PA 2XQKA 1DP4A 2XCUA 2HV9A 4JCOA 4QXOA 3V8QA 1BS1A 4BNGA 1JA9A 1OFHA 1XRRA 5HSGA 3AZQA 5JZMA 1BZYA 1L7OA 4TLBA 2E6UX 3MUOA 2NADA 2QU8A 1R74A 1IXRC 1GGJA 1HV8A 1HMYA 1QXSA 1UDRA 2BBSA 4YRDA 1M2WA 2A9KA 2R00A 3F0TA 3GJQA 5MN4A 3IAHA 4RY2A 5CU7A 4QDKA 3BQNB 3IUEA 3VKFA 4B17A 3UTDA 1RAAA 2HMWA 3W8NA 1XRJA 3O4FA 2QAGC 4B32A 3ZEAA 4YUXA 4QJ5A 1FJXA 3AF3A 4L08A 2WF5A 1O77A 3K8YA 3U48A 2IV3A 4E88A 4RPIA 1NP6A 1NBME 3EAQA 2B92A 3QBJA 4X3PA 5FJIA 1PLLA 5A5GA 4TSKA 3GHYA 1YMQA 4U2KA 4PLYA 3A37A 3L1KA 3WTBA 5PGMA 1J42A 1Y8RA 3L6CA 3O84A 4NCAA 1N4DA 2BKXA 4TSFD 3D7NA 2BR3A 4M9UA 2QR5A 4MWCA 3L6RA 3QBEA 1YDMA 4Q39A 5IJ0A 4KPEC 4IIXA 4E51A 3GFPA 3ZJ4A 4XJVA 1Z9BA 1KYVA 4REMA 3TW6A 1VHLA 2HRRA 4I46A 1HR0B 3BDVA 3LC7O 4R0NA 2O8CB 3LCUA 4C5CA 2CFIA 1NPTO 2FFQA 3IQXA 2JBAB 4L16A 4LBZA 5F77A 1GFIA 3ZBQA 2XB2A 1BWSA 4KUEA 5KQSA 4N9WA 3ADCA 1IZ7A 4N12A 2NUAB 5B2EA 4K6GA 4EIWA 2GKSA 1WY5A 2Y8EA 1F20A 3JQCA 4UHCA 1BGXT 1B76A 3N2NA 4WGGA 4EB0A 4KFCA 3LY7A 3VYUB 2GN4A 4KKVA 4UHEA 4KOAA 3QMPA 4W8HA 2NM0A 4HEA1 4UBLA 2X0DA 3WKAA 4IFTA 1UODA 2ZIWB 1SFRA 3ESZA 1J9GA 3HCCA 4MRNA 2ZQZA 4A0HA 2FRVA 2RDMA 2HU5A 2YJGA 1KE2A 4IG4A 3DTNA 2GK6A 3C4QA 1BDHA 3LHKA 1RKVA 2DPXA 3LHFA 2HRCA 1M6VB 4X71A 2HJRA 2NU8A 3PEYA 1F8XA 2QI9F 3QI2A 2JGRA 3QVUA 5BUCA 1J00A 1DAOA 1MO5A 2Y68A 4TKUB 2C31A 1R18A 4ZZIA 1ZI8A 3B9RA 4LJ8A 3OX1A 4L1KA 4B4KA 1YHYA 4RADA 2J0QA 1ECGA 3OTWA 1G3QA 3H16A 4RGYA 3EWSA 2RHWA 4DMLA 2YX1A 5HF6A 4DE5A 1JQ3A 4D9FA 4P92A 1Y3DE 2Z8ZA 3FYCA 1TC2A 4ZI5A 3U6BA 2VTEA 1BVHA 3TRDA 1V5FA 3N5KA 1ZU5A 3B1XA 2EQAA 3PJGA 2ZROA 3HGMA 4EG4A 1BCSA 1ZD5A 2ZJFA 5COQA 2XUGA 1Q44A 3AERB 1MV5A 5I9MA 4D8TA 2NIPA 1XTZA 1M2VA 4YVFA 4NPCA 3BKWA 3FPHA 3M7IA 3IOYA 4H3SA 3G23A 2YNMA 2W6IA 3BN3A 4RPHA 2PLWA 2WNSA 1P6QA 1V4NA 1W4CA 2GETA 1SNYA 4OG2A 3V3TA 2H1WA 2VYFA 2Q50A 2ENWA 1R88A 1VG1A 3L49A 1H2FA 4KVAA 4F6LA 1PS9A 4FLEA 1WUKS 2ZI5A 3KTAA 5HA5A 1ZVQA 3X1WA 4C0LA 1P5JA 3ASVA 5HDQA 4Z4FA 1S96A 2Y9PB 4DWWA 3QEJA 2BW0A 4N5MA 4O3FA 3H2ZA 1ZNQO 4K8OA 2BGRA 1L5RA 5T4EA 2BT4A 3S81A 5HQ3B 2AG8A 4I5EA 1R0LA 5HRCA 1E7YA 4EFMA 2WBLC 1CHDA 3E5NA 2WFAA 1E1DA 3ZDQA 4CG3A 2DTDA 3K6SA 3E23A 3L0OA 4A16A 5IEJA 1ODFA 3PI7A 5K4HA 3R74A 4K28A 3ACDA 2NUAA 3ILYA 4W7HA 2F3SA 3R7SA 3ZQUA 1R37A 4YAKA 1UWLA 4M0CA 1IH8A 3UH0A 1NC3A 1M2HA 3F49S 2Y1KA 3GDWA 5DCYA 1OTHA 3MS2A 3Q4GA 4INPA 4EPYA 2ODTX 4HFNA 4HH4A 3D8HA 2RHCA 3IDFA 1Q11A 4EG6A 5JSQA 3K53A 2IODA 5G0VA 4RF5A 4D4KA 3VAAA 3ADKA 5DH9A 2DULA 3PQ5A 4EFKA 2PO7A 3CLRD 1M6VA 2X15A 3FOZA 3DEKA 5CNMA 5C8XA 5K6TA 2PH3A 1W0KD 4INAA 3K1JA 3IIJA 3OJFA 1BN7A 1GAWA 2O0KA 1CC1S 3C98A 1FSZA 1SU8A 4TSRA 2LNDA 4S04A 2XZOA 3VSCA 4TTJA 4WLOA 3H11B 3A9VA 5L4LA 2O2SA 1W1WA 3M3HA 3SKVA 1CR1A 1RQ2A 3U9SA 5C5IA 3FNEA 4GX5A 4CF6A 2JK0A 1TB4A 1E0KA 4FGZA 5TVGA 1FVXA 2VHXA 4EDFA 4YPOA 1UKBA 1WCV1 3ECCA 1WMDA 2KE5A 2VEDA 3PE4A 4R2XA 3TCXB 1UR5A 2XSZD 3NTUA 5K0FA 1MABA 1OX6A 2OQRA 2X0EA 1X7YA 2PRKA 2PT9A 1HFWA 3ACBA 5BR8B 1IN8A 4LY9A 1GILA 3OE5A 2FJ0A 4DV1B 4MB0A 2OZPA 4C4RA 3F6YA 2W2QA 3TRIA 4MV9A 1IUPA 1MPXA 4BKQA 4PNEA 1YQWA 1XOIA 1H5NA 2ID8A 3HBJA 1PJRA 1NYLA 1XTKA 2C2ZA 1JR3E 2G4CA 3PNMA 4ZK2A 1XQYA 1DRWA 1QQ6A 2VPXA 1M74A 1S2IA 1WXIA 2Q4RA 3KEQA 3W5AA 3HXLA 3TJZA 2JBWA 3G2IA 2H7VA 2O4CA 4AAYA 2O52A 2BELA 4ZYYA 4Q21A 3ZS8A 2HWYA 1N8KA 1RAIA 1NVWQ 3BCSA 4KACA 4ZMRA 3JYNA 2BGUA 1OIVA 3A2MA 1YR6A 4V0MA 4K3UA 2AR7A 2QPTA 2GZDA 4IVNA 4GBMA 4GMFA 3C3MA 1SUDA 4YRSA 1XA3A 3HA3A 1KGSA 3DYBA 4UE6A 1BX1A 4OHWA 4E5PA 4CXMA 3I9V6 2C2KA 3HU3A 1NXTA 3QPDA 1XMOB 1CZNA 1JPVA 3SIRA 1O5OA 1XZCA 2F43A 4MWZA 1IXSB 4QUHA 1KRHA 4LY6A 3LTEA 3U4GA 1UP4A 3C7CB 3Q8WA 3EA4A 5BSMA 3C45A 3KFVA 4WTOA 1VCOA 1B74A 4GEGA 2YIDA 4CODB 4A4DA 4Q9NA 2C7OA 1L4LA 2I5PO 2ST1A 7MHTA 2HBYA 2ZI3A 2IH2A 4RCYA 2RHTA 4LVOA 2E1PA 4IM7A 3T54A 1T2NA 1US8A 2H4WA 4Q37A 1PBTA 2H5IA 2VWPA 3K2BA 4J6EA 4Y7CA 4XE5A 3RDPA 4QUJA 4FW9A 5KTYA 2YKGA 1WVMA 4JGBA 1Z0UA 3V46A 4NATA 1UFOA 2C8VA 2QG9A 3CJQA 3N70A 2RGDA 2VT3A 5J5VA 2HWWA 5AVRA 4GZLA 2X2OA 4GYJA 3HN6A 4I08A 3BEDA 3OMXA 4BNHA 5C4GB 1VGRA 2PUCA 4QAQA 3HTXA 4PLFA 1Q0ZA 1A50B 1GXSA 2P69A 4BUZA 5H8WA 1O6FA 3AR8A 4W5OA 2FMHA 5MN6A 2PUFA 5AD1A 4EMTA 1L5VA 2RKWA 4LKOA 1OHHD 1U0TA 3A25A 1PD1A 2Q1YA 4TMYA 5EJ6A 2HR1A 4R2IA 4LWPA 3ZVKA 3PC7A 4UPDA 3UWDA 3FJYA 4OXIA 1SUBA 3U4QA 3ENQA 4QE3A 1S4QA 4DXAA 3L77A 4ARZA 1HI9A 1SCIA 5TJHA 2QTRA 3GGOA 1HFJA 2YZ7A 1SUSA 1E2DA 2PIAA 3AUKA 1JDZA 1PWYE 5FUVA 3FNHA 3Q8XB 3B6JA 3PKIA 5LR6A 3C3PA 3KQMA 1D09A 3LM8A 5DMHA 3SZLA 4KLAA 1XXLA 3U26A 4N76A 1UKCA 2ECQA 2UDPA 3MT8A 2Q07A 4YAJA 2QENA 2VSXA 4JVMA 1C7EA 5LP6F 2ZSEA 2VP5A 5CTJA 5FB3A 4PYLA 4CU5A 2WAYA 4TXLA 3OCYA 1SZPA 2JLXA 1T1RA 4Z9AA 4MR7B 5EPEA 5TGTA 1W88B 1KK2A 3HVKA 1NQUA 4J9UE 1P8JA 1SG9A 4FYYA 1V5WA 2IJGX 3W90A 2VP2A 3F7TA 1UZLA 3PPXA 5KWJA 3IVMA 1JIQA 1NJ1A 2REQB 3FNRA 4DTIA 1YE5A 1X7GA 1GPWB 4BO2A 4JJ4A 5AW3A 4KR6A 4YPVA 2WU0A 1VIVA 3MMXA 4WESB 4AICA 3CR3C 3EWAA 3S3TA 1ZLXA 3MJFA 2ADFA 3A9SA 2FSHA 4OBBA 4ZQGA 5DXAA 5IYZF 4FBMA 2AI2A 1IPFA 5LJLA 1D0SA 3IBYA 2QRGA 2R4QA 3AGQA 2B83A 3EGWA 3NRBA 3IXLA 2JCBA 4HQ6A 4I4NA 4EGCB 2E85A 4PLGA 3IDSA 4CHGA 1FVOA 1PK9A 3OKAA 4DZZA 5CURA 1QE5A 1RXIA 2D2XA 5E2BA 4AQ7A 3S28A 1YZYA 1I1QB 3ZU5A 4MMYB 4S2EA 4P83A 4H18A 2Y1CA 4MV1A 1JI3A 2WD9A 1U9CA 5ALEA 2DG2A 1R6DA 4RC9A 3H0EA 4BO7A 2I2DA 2Q9CA 3ETJA 1C4WA 1GZ5A 2JD2A 1RRCA 2J45A 1R0WA 4LY0A 3G89A 1AXRA 8AT1A 5I8PA 1CV2A 1MJ5A 5JI2E 1CNFA 2W98A 2A92A 3V80A 5AOCA 3M8KA 4YJ3A 1NIJA 1X2EA 1DELA 5HG0A 4P5DA 3VI3B 3MLAA 4ESOA 3PLRA 1X1SA 2FPIA 3W3AD 4R1NA 3WWPA 4ALKA 4E70A 1SULA 4KP7A 1LSSA 2D2VA 5GZ3A 1LI4A 4MMZB 4X20B 1P7VA 5T6MA 5D5PA 2VBIA 6PFKA 1L5ZA 3TQQA 5EZYF 2JD1A 3IT1A 3BJZA 2XOKD 4OBXA 3WDMA 4BMXA 1WPQA 3DBIA 1ZM9A 3E70C 3S2FA 1G9SA 2QZJA 1E63A 1K9SA 1FSGA 1JTFA 1HY3A 3DO8A 1RCFA 3R5KA 1CIVA 1JDNA 2W70A 4B31A 1GPDG 3A32A 1YR1A 4JL5A 5DI3B 3CA8A 2EW1A 2FDRA 5E1BA 3BK1A 3N2IA 2CDBA 2PO5A 2WPNA 1GSOA 1YHNA 4WFJA 5GONF 2WAOA 3DZFA 4RACA 4RYLA 3BZBA 2VDVE 3EHDA 4FZ5A 1QJ4A 1XRMA 4PRLA 4R9SA 3ZDDA 1IQUA 1YQDA 4KN6A 2BFWA 4BLSA 3OQIA 2R3SA 3I28A 3EK2A 3NG1A 1CZLA 4JT9A 1W88A 4DIBA 4KWCA 2L18A 2ZRCA 3DFMA 1YZKA 5DHUA 4ZDWA 4RWEA 4AROA 4E4TA 4OEHA 4ETWA 2HTFA 1C0KA 1OJ7A 1EP1B 5I7EA 4MKGA 4F1KA 4PHTA 5HJ5A 1C14A 3K30A 1E1KA 1P44A 4CDNA 2VAWA 2AC7A 3GJSA 4FYKA 2EZTA 1M67A 4WEQA 4GC5A 4OMDA 5KQGA 2A0UA 5E9QA 1EDBA 5AP9A 2WAMA 2ZDHA 5LQCA 4OSOA 1X1RA 1MJGA 2OM2A 3P9PA 3C8HA 3HKDB 3HCBA 4HPWA 3ORYA 4WLEA 3K15A 5JT1A 3ICEA 4V0ME 4MVJI 4TS3A 3VO1A 2NUPA 4IEIA 1XVAA 2ZIUB 3FWPA 3KYIB 2JGNA 2QW8A 3Q9LA 3SE0A 2V4ZA 1IOWA 2VK8A 2NPFA 1O6ZA 1UQUA 1X8LA 4O4JF 1XTJA 3STTA 3DM5A 3TW0A 2FN8A 3U37A 5ESWA 1AA9A 1FA9A 2YW9A 4OB8A 2VHUA 3L7NA 4XCXA 3D6VA 2ZT8A 3KEGA 3EG9B 2XTJA 1LC3A 2O3RA 3HWSA 4PYQA 5LDGA 4QBFA 4FGKA 4B6PA 4MWBA 3NC0C 2B94A 4ZRNA 5JSZA 2GLUA 3G49A 1RRVA 1BDBA 4X24A 2OCDA 5CH5A 2A9FA 2GNPA 4FGLA 2TMGA 4P53A 1M8FA 2RBGA 3P27A 4MYDA 4EI9A 2ODQA 1DGQA 4L74A 2FU5C 4TL6A 1D1TA 5A3JA 2RH5A 3ETCA 3NIBA 4ZO8A 3L5KA 4F3CA 4UDNA 1YBHA 2F17A 3IPAA 1V26A 1Z0IA 1BC5A 5DTEA 2P1RA 3RKSA 2G5TA 4NX2A 5B58C 4RPKA 3CONA 4J1TC 3PUYA 4CG0A 3IP1A 3T5AA 1QZ3A 2D5IA 3PUVA 4X1KB 5E6SA 1WB5A 1MP0A 3CUWA 4ZOLF 4MYRA 5AHKA 4MB6A 1VIYA 1EA5A 2WR8A 3IE0A 1EFUA 1GRCA 3SR4A 5TMDA 3ABIA 1CJSA 1DBVO 1OBCA 4PLPA 4G4SP 5TGDA 3KU4A 1PFYA 3OLCX 3FSJX 4KH0A 1M72A 2GJSA 4NMLA 3RJ5A 3WJ7A 3WYAA 3P0IA 3X1ZA 3I5UA 5TEWA 1WD5A 4RLFA 1QC5B 2G9NA 3T15A 4HDSB 1GOTA 3CB4A 4XPIA 2C5BA 4OHZA 4IJQA 5GOZA 4GKAA 1CEQA 1VRWA 1FXWF 1T2VA 3DL4A 4I55A 3PNOA 4RY9A 2I03A 1XU4A 2QYHA 5ITWA 3L8MA 3HCWA 5IAOA 4KHPB 4I14A 2HLNA 1A1VA 4GD3Q 3OWHA 1CLUA 1LV8A 1UCFA 4LZPA 1BGWA 3Q72A 5F1PA 3AKZA 2ZUSA 4RXMA 2Y77A 1H2AS 3CB2A 4QYMA 1O96B 3OEHA 1K97A 5JO0A 4MHOA 2TECE 5IEBA 2CXNA 3PXCX 1SQ5A 1QS0A 3FNBA 2XRYA 3ZLJA 3FKJA 3BULA 2SHKA 4AO6A 4B7ZA 1N6RA 2ORYA 4B85A 1JFTA 3OX3A 3FB4A 3D7MA 4PGHA 1E1QA 5D87A 1SBZA 4AKEA 1EGAA 2FZGA 1VKOA 6GPBA 4IQFA 2GBLC 2Z9DA 4X92A 1O03A 1X7DA 5FI3A 4MITA 1I30A 2XT9A 5IKPA 4D74A 1C0IA 1UPFA 4P54A 1UMBA 1ECFA 2KLBA 4QFCA 3GP3A 3Q6NA 2OFWA 3UW1A 2A3NA 3RJMA 3MOIA 5JJCA 1TJ3A 3UPDA 4LISA 2V7WA 2ZAIA 3LDFA 5CX1A 5HKLA 2I4OA 2VUSA 3A27A 2XA2A 3TLKA 5I7VA 1G2PA 5I9SA 1J70A 2CNDA 4LPSA 4MV7A 3O8LA 3PDCA 4D4IA 3W8EA 1AM4D 2CC2A 4MIKA 4IHJA 4YP9A 4HWPA 1BMTA 3DE2X 3RYCA 1I5RA 3N6VA 4HGNA 2Q41A 3DBOB 3E9QA 2YC2C 3VPSA 1XMQB 3DO6A 1V7QA 2NYRA 2XMBA 5B4TA 5BN4A 1X19A 2WIBA 3FH0A 3MMSA 4RV4A 3FZYA 4C14A 2VNIA 1ZGJA 5A0VA 2YRWA 1BRMA 3EGDB 3O3MB 5CT4A 3QW2A 4MP8A 5E6SB 3WGVA 1E1RD 2XUHA 2XTAA 1NVDA 4MQFA 1ZJ5A 5FV4A 3OFVA 3IB3A 3IKMB 1A9XB 1K3TA 2CGEA 5CT9A 4B44A 1RXWA 1CUBA 5AW4A 4L8FA 1WVIA 3HI6A 2VQDA 2DUWA 1DAGA 3WNCA 3N8IA 3HO6A 3EF3A 3SJAA 3OQNA 2SKDA 3H5LA 3QLUC 1QC5A 4OOFA 4Y1FA 4ACAA 4L57A 4HDSA 4TRNA 1VYHA 4KWHA 4EO9A 3TZHA 4H1UA 2VZ8A 1CUAA 3DLTA 1S02A 2A4KA 3SF0A 4MW7A 1Q1ZA 2BR5A 3ENKA 4BNZA 4D44A 1NI4A 2G71A 2CF6A 3D0KA 1VL5A 1UL1X 2E4UA