3Q1EA

Crystal structure of y116t/i16a double mutant of 5-hydroxyisourate hydrolase in complex with t4
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
SPLSTHVLNAAQGVPGANMTIVLHRLDPVSSAWNILTTGITNDDGRCPGLITKENFIAGVYKMRFETGKYWDALGETCFYPYVEIVFTITNTSQHYHVPLLLSRFSYSTTRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the Evolution of Hydroxyisourate Hydrolase into Transthyretin through Active-Site Redesign
doi rcsb
source organism Danio rerio
molecule tags Hydrolase
molecule keywords 5-hydroxyisourate hydrolase
total genus 26
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3q1eA00
4L1TA 2PABA 1TTRA 2TRYA 5FW8A 5FW7A 4PMEA 1Y1DA 3DO4A 3GRGA 3P3UA 4TQPA 3A4DA 3CFQA 3DJRA 4TQ8A 5CR1A 4TQIA 2ROYA 3DJZA 1BM7A 1SOKA 1DVTA 1ZD6A 3NESA 4DESA 3IMUA 4Y9FA 2GABA 3P3TA 3A4EA 2G3XA 1KGJA 1IJNA 1TFPA 3DJTA 3NG5A 2QGBA 3P3SA 4PMFA 5AKSA 2B14A 5E4AA 5AYTA 4DEWA 5IHHA 5AKVA 1SN5A 4KY2A 4MRCA 5BOJA 1TTBA 3FC8A 3KGUA 2ROXA 1X7SA 3GS7A 3B56A 4TLSA 4PVLA 5DEJA 4IKKA 4TQHA 4IK6A 4PWHA 4HIQA 3IPBA 2QPFA 3CN4A 1IE4A 2G4EA 3DK0A 1BZ8A 1QWHA 4YDMA 4Y9EA 4TM9A 4TNEA 5E4OA 4ACTA 1BMZA 2TRHA 1G1OA 3M1OA 4I89A 4PWIA 4N87A 5L4FA 1SN0A 3CFMA 4PWJA 4FI6A 1IIKA 2NOYA 1F86A 4WO0A 2H1XA 3IMRA 1THCA 4QRFA 2IGLA 1TT6A 3DIDA 3TCTA 1E5AA 3I9PA 5CN3A 5DWPA 4I85A 1RLBA 3ESOA 3CN1A 4TNFA 3CFTA 4PVMA 4IIZA 4FI7A 1GKOA 3IPEA 4TLKA 4ABWA 5EN3A 1TSHA 3I9IA 3IMWA 3IWVA 1FHNA 4Y9CA 1ETB1 3GPSA 5L4MA 4ABUA 4L1SA 4PWKA 4ABVA 4IKJA 3KGTA 1X7TA 3QVAA 3HJ0A 5E23A 3D7PA 2H0JA 4ABQA 5L4JA 1TLMA 2B77A 1BZEA 4WNJA 2B9AA 1TTAA 3NEEA 3SSGA 4HJSA 5A6IA 1DVQA 4DETA 3OZKA 5CNHA 3NEXA 1OO2A 5JIDA 4DEUA 3BSZA 4MASA 4TKWA 2G4GA 3KGSA 4FI8A 3I9AA 4N86A 2QGEA 3OZLA 2G9KA 1FH2A 3A4FA 4HISA 4N85A 3U2JA 3CN3A 3GS4A 4IK7A 5EZPA 3CXFA 4IKIA 3CBRA 5TTRA 1ETA1 4TNGA 1U21A 4QYAA 3W3BA 5L4IA 1SN2A 5AL0A 4I87A 1ICTA 1QABA 4PWGA 3U2IA 3GLZA 3D2TA 3Q1EA 3DGDA 1GKEA 2H6UA 1ZCRA 3IMTA 1TTCA 4YDNA 3DK2A 4Y9BA 3CN0A 3TFBA 1DVSA 2H0EA 4PM1A 4PVNA 3BT0A 1DVUA 4PWFA 1F41A 2G3ZA 4Q14A 4PWEA 4TLUA 5FW6A 2FLMA 4ANKA 3IWUA 1SOQA 1E4HA 5AL8A 4TL5A 4TL4A 4IKLA 2FBRA 3P3RA 4D7BA 5K1NA 4WNSA 1BZDA 2G5UA 5HJGA 2QGDA 3IMVA 3IMSA 3GS0A 4HJUA 3NEOA 4Y9GA 4MRBA 5AKTA 1DVZA 4HJTA 5K1JA 2GPZA 5CLYA 2B16A 3DJSA 1DVXA 2B15A 4AC2A 4DERA 4TLTA 2H4EA 3CFNA 5CM1A 1DVYA 2G2PA 3CN2A 1THAA 1TZ8A 3GRBA 2H0FA 2WQAA 1E3FA 1Z7JA 2QELA 5CLZA 3FCBA 3ESNA 4QXVA 2F7IA 1IIIA 2G2NA 2QGCA 5FO2A 4AC4A 5JIMA 5JIQA 1TYRA 2F8IA 1KGIA 5CLXA 3ESPA
chains in the Genus database with same CATH superfamily
1RVFH 1F18A 2CK0H 4QF1B 5CIPH 3SODB 3BAWA 3CZJA 4XPFL 1AYRA 2W0PA 3EYUH 3QUGA 3D39B 2M83A 1AHWA 4OD3L 3WTWA 3IE9A 3WHXB 2X4TA 3C5SA 1BEXA 3K4ZA 1N5YH 1M71A 3SCMC 1EEYB 1QLEL 1A3LL 1XD0A 2NY2B 3RG1C 3TF7C 1BXVA 3RWDA 4G8GD 3EJCA 2L3BA 5AKSA 3CE1A 2FYYA 1Z5LA 1QWUA 2GK2A 3I9GL 5IHUL 1QBMH 5DEJA 4WGWB 4G70B 4BQBA 1HNYA 1ES0A 4PJDE 4MAUH 1RZ7L 4LASH 3OHMB 3AU1B 3PDOA 4MAUL 1YEGH 4P9HH 2X7LA 4QRRD 2AQQA 5CWSA 1DUZB 3L2MA 3VX0A 4GAYB 1NGPL 4KX8A 1CDCA 5ESQA 3N2JA 4AQ8C 5AZ2L 2R2CA 1FE8H 3NJGA 2IDCA 4OJYA 1OT2A 1W8EA 3SCMD 3BAYA 5K1VA 1E9QB 1XL4A 3JYBA 3SD5A 1NJ9A 4AK1A 1I7UA 4Q0XL 1K6QL 3KJ4B 1T5XB 4PFEA 3KHOA 3IKCB 4ODBD 3SY6A 4F20A 3Q6FB 2BSED 4PCSA 4GG8B 3WKNA 5HI4D 3L95B 4IJ3B 1P4IH 1MWAA 5C6WH 4QRRE 1P4IL 2ICEC 3BT2L 4P05A 2WVVB 3UAEA 3R1GL 5L8JB 3X17A 3GTTA 5AW6B 3LD8B 1JRHL 4N9GB 5F44A 5D71L 5CCKH 3BKMH 2F1EA 5CEXA 3ABKB 3MV11 3N41B 5K33A 5KSAB 5KJ7E 3KW8A 3PAUA 3B2UC 4M6ML 3HAEH 4MNQD 5D2NC 3GIZH 2ZX5A 2F8OA 2JIXA 3Q3GB 3I50H 3HG3A 1R4XA 2XQYA 3F65A 1MLCB 4JY4B 3RJDA 2WUCH 3NAAL 5IHZA 1A6ZA 1WIPA 1S9YA 4YSTA 3PHQB 1G1CA 1F90H 4HS3B 4ZAKC 3SDXA 1TUPA 4HIHA 3HS9A 4N5UA 1Q72H 4PJXB 1KC5L 2F9BT 2MHAB 5BVPH 1W9XA 4FLSA 2VWEC 1OE3A 2HKFL 3WIFA 4KDTC 2ALAA 4ISVB 5CGYD 1OGSA 2I9LB 4JDVA 4U49A 4FL4B 2VDRL 2XBTA 2P52A 1A14L 2XV6B 3OLIA 5HYSB 5JW3L 2RAMA 5HPOA 5JIKA 1ZT1A 2YD1A 1OTTC 1MAML 5CR1A 2YD0A 5TF1L 5FYKL 3IDJB 3ALWA 4HWBL 1G1KA 2Q3ZA 4POZC 4PUBL 3COOA 3OKKB 5KBLA 5K39B 2G3XA 2ZOKA 5LN8A 3UCRA 2FYYB 3VB9A 2NYZA 2NY4C 1PCSA 2YGVA 4N9GA 3GXTA 5SWZD 3TV3L 2O61A 5CEXB 3QEGH 3D85B 2DIAA 1OQXA 3ZKND 3VG0L 1T1ZB 4XPTL 4P2RB 2YPLB 1G1OA 4CKVX 4YSEA 3MOQA 3EADA 1F3JB 2ATPB 2B1AH 4L9DA 4HJJL 3M88A 2Y23A 4K3DH 4Z76B 2J3SA 1MJUL 3JBG7 3B7TA 4BWWA 1DUYB 2EC8A 2C7FA 1ACZA 3QIBB 4AEHL 4PBVC 1UM6H 4PGBB 5GZND 5F89A 5I71B 5KVFL 4LCYB 3NJFA 1ZIBA 5AVTB 5I1KH 3VYNA 3BAXA 4ZNEE 3N85H 3AROA 2ZT9C 4QKXB 1I1YA 1BXUA 5IK3A 1A1MB 2R0LH 3LKSA 3PFUA 3OMNB 2P5EB 3CN3A 3QWQB 3RYMA 3GLDA 2FL5B 5CINL 5IEKA 4Y4HB 2WN3A 1SN2A 4YHIB 3FQWB 1U8CA 5DRXA 3O6FB 3MO1A 1O0VA 4OLZH 2IJ0C 3ZYJA 5DCCA 1A1OB 3EJRA 5SX4H 3VSTA 5FA4A 5DJAB 4PWEA 1BP3B 2BRRH 1H8OA 1WUZA 1R5VA 2H47C 3VXTB 3ZDZF 3P3RA 3SO3C 4J7RA 5BRPA 4KK9D 1UGKA 3Q8EA 1K6QH 5JPNB 2GC7C 4ZD3L 3NFNB 2OMTB 1CDIA 1OTTD 3EYUL 4BA0A 4CN4A 4AK2A 4WU5A 5H8DA 4WCYH 4GKLA 3CHQA 3DSFL 4IS6B 3CDZA 4GB9A 4ISVA 1OAXH 6FABL 1OB0A 4PJFB 4CVXB 1GYUA 2TRYA 1KN4H 1PZ2A 1R3HA 4GEIA 2CIKA 4JEGB 2XKNB 4JS7A 3MRIB 4PTTA 2G9HA 4QRUA 5EUOF 3NIFE 4OV5B 3DO3A 5EBGA 3GJFB 4JPSA 4X6FB 5HHQA 2VGLM 2Q6WA 5ENWA 5CP7A 2VDKB 5D72L 3IJYB 4LE8A 1EA9C 2FDBP 4S10A 4Y9FA 3U4BL 1HYSC 2BSCA 2ZWKA 4BK8A 4NXSA 5D2LE 4I3SH 2H8PB 3R7RA 3S3PA 5IVNA 4GW1B 1XSJA 4XI5D 1OY3B 1S4IA 2BSSA 3VXSD 4L05A 4K7PY 1YYCA 3F04A 3V5HB 3VFRB 4AENB 1NKRA 4J12A 5H4YA 4G7RB 1YYMH 4M1GH 5EU6D 2ZWLT 1JPSL 4IKNA 4K94C 1JMZA 4XNZB 5FGBA 1N6VA 3X1EA 2XYBA 2NT0A 3MCLL 3NCYP 1FSKC 4NO5A 3QCVH 3WIAA 4KZEH 3CFCL 4HIXH 1NIEA 4WK4B 1UTDA 3VXSB 1F42A 2NW3A 3T4AC 4R4FL 3KPOA 1L9RA 5L4MA 2KQNA 3LVTA 4XBGA 1SM3H 5D1ZA 4JKMA 1DZBA 1H3WM 5AVRB 1L7TL 1OAQL 3HZKA 5HVFB 1T89C 4R84A 5I75B 3MXWL 4EDXA 1IEBB 5GRVL 4NN7B 5IREA 4QHNA 3D5OF 4NHUB 1B6UA 3FRPA 1W6WA 2OP4H 2ZKXA 5JW4Q 4WKZA 4PJ9D 1R19A 4G42B 4EVNB 1R3HB 3QUMA 4XVSH 2CR3A 3ZR5A 4YGVB 5I1IH 2PO6B 5EEZA 2ICCA 4HISA 3WNLA 2ZXQA 1HE8A 3HI1B 3MNZA 3D6GA 5L2KB 3DOSA 4YHIA 3KPNA 1A4KA 5EHFA 2VWEE 2OW6A 4PWGA 3UAJC 3GBEA 3JWDL 3RIFF 3FSVA 5CEYA 1BCIA 5EC2A 3SPVB 1PQZB 3SPCA 3LEXB 5T3ZE 4JFXA 4WY7H 4ZZFA 3L3DA 2AQSA 3SB3A 2QJDA 3J7HA 5FM5O 1B4LA 1H5BC 4PJBA 3WY4A 4Y2NA 1QASA 5DJ6A 2NNCA 2XWJA 1DQML 3FOMA 4YHLL 3QH3A 3ISWA 2JELH 4IDLA 4CVUA 5I15L 1DQMH 2GSIA 2WNWA 2L7QA 1UKTA 3MNWA 2BSRB 1FPTL 4JRYA 5H2BA 5LNDA 2CMRH 1UCTA 4LLDB 3A21A 3FQ4A 3QO0A 2ZQKA 3A23A 2VISB 4LLVA 4K5LA 2OTPA 5IW6A 1DO5A 2DMBA 3MGTB 2OKMA 3I9GH 2ZSWA 1MF2L 3QJVB 4HBCH 4PJCA 2JKNA 4XE5B 3V6ZA 4KHXL 4L4JA 4LHQB 4OGZA 5ITFB 2EEFA 4O02B 3VYOA 5F89B 4HEPA 1ADQH 1I8LA 2UXGA 1UM4L 4B7IA 4E36A 3O11A 2PPCA 1YEIL 3OAYH 4GP8B 1BEYH 1NPNA 3K2UH 3LTVA 1WK0A 4P2OD 1TETH 3ILEA 5D4QA 4OSUH 4L2YA 2AEPL 2CGRL 4FQIL 4G8EB 1W6LA 2A9ML 4GEJA 4W9HC 3DPDA 4Z78B 1SOKA 1BZQK 1DVFD 3MRFB 4NN5C 3QUXB 2H1LM 4JVPA 4BIKA 2Y3NA 1NAMH 3PG2A 5C7XL 4JRXE 3GJEB 2OZNA 1UFGA 4Y4HA 1Z3RA 4XMVA 1ZT4B 3SE4A 1S8DB 4Z5RB 1XGYL 3S9DB 5HHOB 2QKIC 4KI5E 4PJGF 5T3XH 4PLNC 1XCTB 1CLZL 1QNIA 5BMFL 5MEQB 1S7SB 3BEWA 1QWHA 1SMDA 3LIZH 3AAZB 2FJHA 3IN2A 5DJAA 1MFDH 1A7RL 1ZLDA 5HGHA 5D1QC 3L3OA 4FQJL 1SOXA 2MNWA 2O6EA 3Q6GH 3ZT5A 4RFNB 1LYQA 2IANB 5CJ8A 5E8DH 4PGEB 1OGTB 1CD1A 1NOLA 1VA9A 4KJYA 2AJZB 1D6VH 4K15A 3F7YB 1EAPA 2XWZA 4B60A 5IQLA 5C09D 2C34A 3HJ0A 3G9AB 3LY6A 2CO4A 3CX5J 3WENA 4M6OH 3DX8A 2TSBA 4UV4L 1YNLH 3O2WH 3VDBA 5BQ7A 4MNQE 5EUOA 1N8OE 1A6TB 4X8CA 2A3TA 1YEGL 1HL5A 3QUZB 4G8AC 4FHJA 5DR5L 1CFTA 5EIQA 2Y7MA 3APFA 1VGKA 4XXCC 3VD5A 4LBEB 4GQPH 4OJFH 3MV9B 1BX2B 4M1GL 5B7FA 1K8IA 4RMWA 3U2IA 2BERA 3UYPB 4HJIA 5KSVA 4G72B 3NT0A 2NY3C 1CURA 4N9OB 1BGXH 4YDVA 5GZOD 1IM3B 1ZHLA 5F70A 3VACA 4JG5A 5DD6B 1HC1A 4K5MA 4E41D 3Q8CA 1XT5A 3IWUA 2O30A 3DRTB 2Z93B 4JREC 5KVEH 4NM4L 1M1XA 1WCBA 1IGYB 4L8SC 1W8NA 3IMSA 2QVIA 3K6FA 2P24B 1JCKA 3KPSD 5FYKH 3T4AA 5AKTA 5IEHA 4ZOEA 4PJ5D 1D5ZB 1E7VA 1WGOA 1HYRC 3VXSA 2XZQL 3VTTA 1W72B 3WD5H 1OHQA 3PHQA 2NY0B 4HCGA 2DLEA 4LK4A 5C3IA 2YLKA 4G8FB 4CADB 2AJZA 2Z8SA 4D8OA 3CSYB 1AGDA 5CP3H 4F3FB 3ARPA 3H9SE 2OSYA 4DP8X 2WXMA 3L16A 4Z3EA 3V6OE 2NDFA 1R47A 2YD7A 3BQVA 5KG9A 1RZJL 1QD0A 1L0QA 2X2HA 2X87A 5E0QA 1U58B 1KGYE 2MPAL 1O7SA 5JHLL 1KEMH 2V3FA 1MCKA 4G7SB 1K4CA 3SPIA 4ZMYA 1CFQB 2AQNA 3T1FA 2MPAH 3LHAA 2A9NL 2QADB 2F54D 4LPUA 2CO1A 1NCHA 1JHLL 3MBWA 4LBAA 1C5BH 1T1WA 3KPNB 4DEWA 4XNUH 2ZUVA 4CN1A 4NQCD 5IF0A 3LRMA 1KXTB 3CXDL 5IWLA 1FFTB 2C4FU 3KLHC 4GRWB 3RWIA 2XZCL 4PGJA 2OSLB 3CN4A 2NXYD 4O2CA 2ZWNA 4QRRB 1NCOA 4ZX6A 1F56A 4UQDA 4N87A 4GBXA 4H20L 4EXKA 3ULVH 1YEJH 4TVSa 4NRYA 4ODTH 4FJZA 4K9EC 2VRAA 1ZE3H 1UJTA 5A40E 3WS6C 1QUNA 2MOQA 2UY6B 4DVRH 4N26A 1EH9A 1RU9H 2VE6A 4FQLH 2CGRH 4IOSA 3KGTA 4N28A 4X98A 3HTLX 2BNRB 5DUMH 1VZIA 4RRPM 1H3GA 1DANT 1TLMA 2O5XL 3QHTC 2OQJB 3PJSA 3CFKB 4W9GC 4WUUB 4E9YA 4LIQE 1CK0H 4DTGH 3G6AA 4JPVL 4HZAA 1FAKT 2X6VA 3BH9A 2VM3A 4Z6AT 2VR3A 1XGYH 3ZDYE 3LPPA 4GQZA 4HWZB 5D96C 3S3JA 3ARFA 3D9AH 1Q38A 3NZ8A 3LNDA 4KJPD 2ZCZA 4HLEA 4LLUA 3J27A 4NKIH 3ULVD 3PXJA 4N0YH 3UTTE 1FCGA 1FV1B 1FFNB 3DC0A 2WXKA 2ZUUA 2IH1B 5TDNB 4JRFA 1SY6L 1T1WB 4K73A 3EOAA 1HQRA 4PLKC 1M57B 3NFSL 5DD5L 1E6JL 5I18L 1LE9B 1D5IL 1FFPA 1T0NB 3D09A 1VPOL 3BGAA 4NFDA 4OJDH 1R5WB 5DVNA 3S97C 3SIKA 3QFJD 4ZXBB 2BZ7A 1Y6MR 3TO2B 2Z93A 5IWLC 5J9PA 2VN3A 2DKSA 1T0OA 2FBRA 2P8MB 4W9KC 5IB1A 4EKJA 1BIHA 4HETA 4LIQL 1KGCE 3T6ZA 4HJUA 5E1QA 4BWUA 1E2ZA 2EO1A 1W91A 2WN2A 1KV3A 5GJTL 4MX7B 2IAAC 4Q2ZB 4JGMA 1NUGA 4K3HA 4IRJD 4K7FA 3MX0A 1G9HA 4OLZL 1OXYA 2YA1A 3B8SA 1WBXB 4HKXB 4O02H 4WNQB 2R29L 2VXVH 4U1JB 4BXSV 4AYMC 4JUSA 3S35X 2F8IA 4QXTB 3P4NA 1FNGA 4N2LA 2XN0A 3BYYA 3E1ZA 5E5LA 3V52H 3E8UL 1A6VL 1IBGH 2DEYX 5M95B 1MDTA 4YE0A 4TQPA 1ZLWK 1M3IA 4GW5A 3R7QA 3WTSA 3WS3A 3DETC 2RJMA 3MRGA 3V6FB 4NKDB 2PN5A 3EJQA 1IQDB 1EMTH 4PRNA 3DJ9A 1Z9SA 5B8CC 1A7RH 2V3DA 3N55A 3VFPB 4MRCA 1U3YA 1AZZC 2ROXA 4JFEB 4LU5H 1X6LA 3VMOA 5IMMA 2BVUA 5EN2A 4ONHA 4WWKC 2XV0A 4KKZA 1DLHB 5IMOA 3FFCB 2CJSA 2BH0A 3GBNL 3N06B 3Q8AA 2EKSB 4JCWA 2ZXDA 1JXGA 4FHBD 3RWGA 1R24B 2XVGA 3TA3A 1JRHH 3S5LB 4V2CB 2LOEA 1PAMA 3N3EA 2JKWA 4L29B 4JRXD 3VFTA 3QUXC 2I7SA 4OFDA 5C09B 1HE7A 5LCVA 4YHOL 1UWFA 1X9QA 1MFBH 1HILB 3QULB 4Q74A 1SFDA 1TSHA 1L6XA 3I6GA 3IMWA 1MJJA 2GFBB 2H1PL 2H6PA 1S7RB 4EDXB 1ZIAA 3CFKA 4G8FA 3H6JA 3OKLB 3V5KB 2EXTA 1N59A 2Q87A 3W11C 1IJ9A 2ZXAA 3X2QB 1PAZA 4RGOL 4BJLA 4FQ1L 4ZO7A 1VSCA 4I3GA 5HYSA 5E08L 3N9GH 2HSIA 2W9DL 1JGDB 4LZKA 1BVNP 1QR4A 3N9GL 2WP3O 1CU4H 4QRSB 5HHOD 2A38A 1KOAA 1NGXB 3QFDB 4M7KL 4XZUA 4DPCX 1XHHA 2BP3A 1CR9L 2V7NA 1UVQB 3K74B 2WOBA 4G6JL 3BSHA 2COQA 3T8VA 3QUXD 4ZOBA 3RNQA 2BVTA 2XZAL 1NMAH 5HDWA 1L7TH 4H13C 3O6KH 5J8OA 1AE6L 3HG5A 4U1SB 5DMGD 2DI9A 5E8PB 3AABA 1VGEH 2JLLA 5AQ0A 4ZNEA 3WY2A 3UIYA 2UZIH 1SXSA 4LAQH 3DURA 4E41B 3REVB 4XX1E 5DUML 2QBWA 3UO8B 3A67H 2X6AA 4HLZH 4RETB 3TA3B 5DVLA 1G9MH 2AEQL 2DMKA 4IGBC 4WEBH 1R3JB 4M93B 5DO2D 4XVUC 3MGTA 1A64A 4DJMA 2H4EA 5HHOE 4HBQA 1RZJH 4ANXA 2VISA 3DSNA 3KEDA 4LSPH 3RVWD 3VFGH 3ECUA 2C1PB 5KVGH 2ZSWB 1NLDL 1XF4A 1IFGA 3FQ1A 4PJCB 4HUVB 2APXA 4XNQA 3PAVA 4P2OA 1JDDA 2EH8L 2R23B 2MCPH 2VAAB 5EC1B 2B4CH 5AW7B 4ZFOB 2FEEL 4CN6A 3G5YA 1Y0LA 4P46D 2B4CL 4U6YB 1E4KC 2A1WL 3RWFA 5ANME 2UZYA 3MRFA 2CO6B 1K5NB 4IOSD 1P5VA 3DHMA 5FGBC 1XEDA 3HHRB 3PV6B 4JR9H 3M6DA 3MLYH 3QJHB 2VLJA 3W0WD 3U6XA 4XCCL 4F7TA 2WNKA 2F7PA 4H8WH 1RK1A 3QHFH 4LCUA 2DM7A 3LZOA 1BVLA 4HUXA 1JK9A 5KBDA 1ZT4A 4OFYA 2XVLA 1UYWL 3EBAA 4EI0A 4X9IA 3Q2NA 4FFTA 3BJ91 4DFHA 5B7MA 3SQOH 3T77B 1NDMA 2WKOA 1DTUA 1UGNA 2A77L 4P57A 3HC3H 5D2LB 4YLCA 1GW6A 3KYAA 4L5FH 1F4WH 3TBWA 1H0DA 3GYRA 4GY4A 4WU7B 1KZQA 1YEHH 4LP8A 1IC4L 1NMBH 5BOPA 3HE7B 4X6DE 1A9EA 2VXQH 4HPYH 1R3JA 4D2NA 4S1QL 3HOGA 5E24E 2VXQL 3KVPA 4HPYL 4MNGE 1QP1A 4R26H 3QPQD 3D18B 4WJ5A 3K1DA 3PWNA 5C6TH 5T1LD 1E40A 3MV7A 3UFIA 2KYIA 3FQUB 2DLIA 1KCUL 1DQJA 4RESB 1FA4A 1UACH 2NY6C 2WGXA 3MGOA 3QQ9C 4WI2A 5GS0D 3S2CA 1T89A 4YXHL 1HT6A 2JQMA 4NM4H 5F7WC 5L2JA 4LVHB 1H3TA 4LRNH 2QZQA 2OZ4A 4WI8A 3LDBC 1JDCA 2YMOA 4P3CH 5DZNA 2FJFA 4XC1L 2I69A 3KXFD 3VAEA 2DRUA 1FVCA 5AB2A 5E56A 4UILL 4TTGA 1QSFA 3NIGF 2CHZA 1NAMB 1WCQA 4FA8A 4KY1L 3WFDL 1KLGA 4XMLL 4TLUA 4M6MH 4H1LH 1ROCA 3DURB 3QRFM 4ORGA 3FFCA 5I74B 1E7UA 2BY0A 5AVXB 1KFAL 3HC0A 5EUOE 1OSEA 2X4RB 3IFNH 5MP6H 2HN7B 3MXVH 1IKFH 1F6FB 4GINA 3II1A 4HEME 5FM5M 1JFQH 2VLJE 4B9PA 2OMBA 1JDAA 3F00A 4M3HA 1BYOA 2BNQB 3CC5A 1JPSH 1YMME 1MHPL 2HP4A 1C7SA 3H9HB 1U8LA 4JHAL 1MHPH 1VFBB 3CDCA 1Y18B 4MMZC 5L0QB 3RUGA 5L7XH 2EYRB 3T2NL 2G60L 4XGZA 1R3IL 2VSKB 4AMWA 1BVOA 3CWGA 1UB6B 5HP5A 4P5KB 2X6MA 3A4DA 3T2QA 4LEOB 3TS8A 1G7QA 2Q76B 3TBYB 3NJLA 4X4YA 4PEEA 1RZFL 3GSOB 3E38A 4JW3A 4N3UA 1OP3K 1ZTMA 1NGYA 4LVNB 4R7VA 4LAQL 5FF6A 2K6ZA 1IAKB 5C2BH 1BVZA 2H2SD 5JW4M 2GTZB 3LRKA 4ZFGH 2FZ3B 4NI3A 2VABB 2OSLA 3IBEA 1QVOB 4OUUB 3TV3H 3OG4B 5TGBA 2GY7B 1CGXA 2HWZL 2B5IB 1MCPL 3OMIB 3GUTB 1SN0A 2CO7A 4U4BA 1BD2B 2GJZB 2XA8H 5I1CH 2AAAA 1G0DA 4J2QA 1UJ3A 3MRCB 4XB3A 1NGQL 1JK8B 3QAQA 4MCYB 4JN2B 4XO5A 1C5CH 2OSXA 3I9IA 2PXYD 3D34A 1ITCA 1XFPA 4GAGL 4WW2A 4LESA 4IKJA 1YMHA 2DQUH 2OLDA 4FXGB 4BM7A 2X09A 3FRUB 4N8CL 4D0DA 4U6TA 5IBTH 1VPOH 1IL1A 3ABZA 4CDHA 4NQEE 1J5DA 1DCEA 5DJ0A 4NPKA 4PJ9B 4A63A 3SE8L 1OSZB 4XGZB 5EU3B 3BZEB 1LO5B 4YDJB 3UYRH 1I85A 2ESVB 3DTXA 4OGYH 1AQHA 4QMEA 5CINH 3IJYA 2DLFH 3WHXA 1PBYA 3MRHA 3CXFA 1MNUH 3QGVA 2JJVA 1ZTXE 1CG9A 1E65A 4NI6A 2WYTA 4MCMA 1FV1A 3BP7B 4FQLL 5SWSE 3K6OA 2H3NA 5KBKA 1J10A 1HQ4B 2AQ2A 1KXVC 5C0GB 2BLFA 1AGFB 4P5TA 1R5WA 1CLOH 5DQ9B 5J9PB 4R4BB 3ROOB 4UOW0 2X4RA 1MIEL 3ZRFC 4BSVA 4FQ2H 3AZUA 1L9NA 3O3EB 5GGUB 2AK4A 2CO7B 4AH2A 5EB9A 2J71A 2Y9RT 1YAZA 4FTVE 4NQEA 5BPPA 4LSRH 1AP2A 3OB8A 4KX9A 1BQHB 3UBXG 1WAAF 2MCPL 1CLZH 5LXVA 5FDWA 4HIHB 1WD8A 2DIEA 3EOYG 2CR0A 3B7UX 3KJ6L 3TWCL 1A9EB 1KPVB 4R5VA 3IU3A 3QIBC 2E7LA 3T2OA 1J9RA 3WXWH 2XQBH 4PVBA 5BCAA 2YMXL 4Y4FC 5J13B 4EMZA 1NFDB 4NXKA 3T3ME 5I17B 3AB0B 3CZNA 3RB7A 1F45A 1CFMA 3IRPX 43C9B 4AGMA 2QHRH 1X5HA 1JYVA 2GEQA 3NA9L 2X9ZA 4BZYA 2PPFA 3JUYA 3KWTA 3TBTA 1P7QD 5E6IC 3A0OA 3Q13A 5DT1L 2LLLA 1PYWA 3EH1A 3IMUA 1JD9A 4PJBF 5IOPB 2K0RA 2PYFB 1KGWA 1ZJBA 4FL4C 3BN9C 5LBSL 2EDYA 3UGEA 5IB3B 5ABZA 2N7AA 4FNRA 4L9LB 1X7SA 4BXVA 5F7UA 2AGJL 5E7BA 4MZ2A 3NZHL 4JL2A 1JZDC 3IDIB 3B9KC 1OM3H 4P0DA 3BFWA 4KZ0A 4AI7A 2NQCA 1DJIA 5DQ9A 4FS0A 1KXHA 1DQIA 1LQBC 3EKCA 4LLQB 4LARL 2J4WL 3BPNB 3KW7A 1D5MB 1JPGB 3O0LA 5CD3A 1CTMA 4AGPA 5HYIA 2VERA 3EAKA 1W72A 3FK3A 3ARBA 2WXJA 1TTGA 5MERA 1EFXA 3PL6D 1KPVA 4DPBX 1SYVB 2ATKA 2CJ3A 3BEVB 3OSVA 4G7YH 1A1NB 3KDMB 5TH2B 4JKPL 2PW1A 3LEYL 3BZEA 4BGDA 4YE4H 4U1GC 1A4CA 4NZRH 3CQFA 4OLWL 2AKRB 1MI5B 1TFHA 1ZT1B 5C1MB 3NACL 5JHDB 3QYNA 2O26U 3L08A 2VLKD 4NYLA 1XH1A 2LFGA 5TTRA 2ED8A 4Y5XC 4PLJC 3U25A 3UO1H 2H3NB 1GGIH 1XF5B 3T1WA 1EJ8A 1E4WH 4PP1D 5I1EH 2NY2D 3DROA 2WXLA 2YZ8A 1XH0A 5IB3A 3EDEA 1S7SA 4GSRA 4PIBA 4RBPH 3BQUA 1DBJH 2G3ZA 2JQAA 3CDYA 3HCVA 4HIEA 4XCFL 1WFIA 3VRIA 2X0VA 1V54B 4K8RH 1QEXA 2GJRA 3RKDD 1UURA 1KCVH 2Y7QB 4OFPA 5EU6A 5EWIL 5FHAL 4IBWA 3DMMD 4XWOD 2YAFA 1XR8B 4GKSB 4NGHL 2OZ4H 2DQTH 2CMRL 4K55A 4KITB 2Z31B 1U42A 3HUJF 4ODVH 3PJNA 4OFQA 3VMNA 2J72A 1IGIH 5KUKA 2XX0A 2XZAH 1KG0A 2A6IA 1J9SA 1HDMB 4Y4KB 1NFDA 4UANA 3ZLQC 5BOZG 2CQVA 3MLVL 2XG4A 3EDKA 4NM8H 4CC1A 3DX8B 3BZFB 4WHYH 4HUKB 4Z7VA 4RRPA 3TA4D 4Z7NE 4HUMB 3H0TA 3UTSE 2HAZA 3F6IA 2UZYB 5EBMA 2OXHA 1HOEA 1E6OL 2ESVA 2ZCHH 3C5SB 2X12A 1QYGH 4OU3A 4N2KA 3GINA 3VG0H 1OF2A 1YMMD 3QDMA 2IH1A 2AZUA 4AGOA 5JYMA 5F88B 1VFAA 5AENA 2Q7YB 3O81A 3DBSA 3V5HA 4U3CA 5C6TL 3BIKA 1BJ1H 2P26A 1GZPB 1SYSA 5EF3A 4LSTL 2EADA 1TZIA 2IPTH 2F8VA 4P3DA 4U1NB 1FF5A 4P4KA 3P0VH 5FK9B 3X3GH 1U93A 2AQ3A 2HCZX 2K8QA 5DQJB 4BSVB 2Z1KA 5IESH 2HMIC 2YPLD 3FNKA 4FZEH 4YUEH 4LSUH 4AH2B 4KVNH 4Q2ZA 1AZUA 3IPEA 5AW9B 2DKMA 5T3ZL 1XIWD 1WFMA 5HHVH 1QA9A 3KXFE 2ITEA 5KBMA 2WTRB 4PRHA 3FZUC 3HFFA 5EU5B 2I25N 4ZAKD 3TBSA 3TZVC 3O9WD 1RPKA 2R0WL 1RIHH 2B39A 3FRPB 3EGDA 3TV8A 3ZPDA 1IGCL 4K4KA 2ICWI 3MZGB 1B4RA 3CCHA 4DGVL 4TN9A 4XAWL 5CXPA 3H3PL 3JT0A 1OAKH 1T3FA 4U1LA 4FZ8L 1LTXA 1NCDH 3GFUA 5GGTH 1BFVH 3TGXA 4LFHD 2Q6WB 3D52A 1QO3B 3FTYA 3EZ8A 2YSTA 3SGKA 5LG6A 1MCQA 1YMMB 2BRRL 3VFPA 5ELIA 2W9EH 4JFTA 3HS0C 3LB6D 4FYTA 5FYKD 4BZ2A 5I8OH 5JDSB 1C08B 3TLRA 2W92A 4NWUH 4XN2A 4LSQL 4WHDA 5DJZA 2AMGA 2Z7UA 3PCYA 1ZDQA 4L3ED 4UF7C 3VRLE 4QRRA 3PHOB 1KEGL 1SDAB 5C08B 4GFTB 3FO0H 4JFFA 4BQ9A 2ED7A 3KWUA 3ZIMA 2DDQL 1C12B 4X5XB 4D9QE 5AUMB 3QORD 4A6YB 2ZOTA 3O41A 5ICZB 3HI5H 3FPXA 1NKOA 4V1DD 1MG2C 2Z31D 1JOIA 3W5NA 3W39A 5F96L 3G5ZB 2MMXA 4XNMA 2R4SH 3CC5B 3IB4A 1M7UA 5C9KA 4WEMB 5DEZA 2XLLA 2F1AA 2N01B 4HF5H 4ETQB 4QXVA 3RUGB 3P3YA 3SDXF 3ZE0F 1AO7D 3D1MC 4ACPA 1LO2H 1S7UA 2C9UA 4M7LL 3U1SH 1AIZA 3WY1A 2G2RB 4QHNB 2IV9A 4HWZA 4I3SL 1VFUA 3WN5B 4HW6A 5LGHL 1EJOL 2LU5A 3OAZH 3GRGA 1UD3A 1G7MA 3M45A 4JDZB 5MEPA 4L3EB 2C5DC 4LEOA 1DVTA 1KDIA 1CYWA 1RK7A 2JELL 3MKGA 2ZP0T 5EU7E 1B0RA 5EMYA 3RKPA 2VABA 4GP5B 1WA0X 1HL9A 3AY4A 4X9BA 1DZ0A 5TPWL 2IOOA 2AJYH 1GHFL 3L3IA 3QNYA 4NGHH 1RV6X 4WI6A 3TTSA 4Z7NF 1UWGH 3UP6A 3O6LH 1QZNA 5FO7B 2D03L 4MMXB 4NNPH 1HHJB 3ZKSD 4F58L 3EYOB 2VITB 5T1MB 1C5DA 4DCQB 1TJGH 3OXSA 3WFBH 1LDPL 3R18A 2UWEA 3T3PB 4ENZA 5CCJA 4P4RB 4UZUA 3LV3A 4ZW5A 4X7TB 2NZ9C 3QA3B 5D1QB 5ANMA 5J13C 3DV6A 4YHKH 1I8KB 3H1ZA 1CVSC 2KKQA 1I8MA 4TMPA 3DUSA 5H4ZA 2V2TB 1UOLA 2G5BA 1I7TB 4TUJB 4WO4A 2WBWB 4KKLD 1EHAA 1BF5A 4TUOA 2E3VA 4QPEA 2BIIA 3VI3A 1NIAA 4WFGD 2Q7AA 4NBYB 2CO6A 4A2GA 4JPIA 1OWRM 5TK4A 1PZCA 2FH6A 4LNRB 3CVIH 2AQ1A 2ICWJ 3QEQA 3PGFH 3FBQA 5E1AA 4YHPB 1JXFA 1D7CA 3BE1L 2ATAA 2G0LA 4M7ZC 3VXUA 2ENPA 5JORA 3EGSA 2I9TA 4WW1A 3UABA 3SYAA 3NRFA 3CBJB 3UERA 5EOCH 1N3NB 4IU2B 1GJWA 4M8QB 3WJLA 3T77A 2DTMH 3QEQE 1JN6A 6PAZA 3C6EA 4Q6YA 5AVSB 2UXVA 5F7EL 3TO4D 1RMFH 3B6SA 1EEZB 4JFVA 3LXBA 3ZMEA 2AK4B 1RUPL 4IJ3C 1U8JA 2DBLH 1TMCB 3GS0A 3X1NA 3WOVA 3ZZLA 1P4BH 1WWAX 2R1WB 3U7YH 1ZLVK 1GYVA 5B8CA 3UPCA 1K8DB 2HUHA 3MBEC 1DVXA 5EFIA 2ZP9A 5FCUH 4LCCA 1TYEB 3OKMA 3MJ6A 1F4WL 3K0YA 3IGLA 3POHA 3KBEA 2GSMB 4MDIA 3X12A 4K9JA 3WFZA 3WFHA 2CG9X 4E9XA 1XH3B 2NXZB 4BCZA 4HWEL 1N4XH 4Z7IA 1NMCB 4HXBH 3FO9B 3BVXA 3BDYH 3S36L 3O3AA 2MJWA 2IGFH 1ASQA 4JRWA 4TUOB 3NRQA 3P9MB 2CPCA 4LGSB 3REWA 2VAJA 3IGAB 5D6DA 1FVDA 3WV0A 5GRUH 4W6YB 4LDLB 4L8BB 4KX7A 1GXEA 2X4SB 2A6KB 5C0EB 4KJQC 5GQBA 4AX3A 4FA6A 4V11A 5HHMD 4RA0C 3TN0D 2Z35B 1SF3A 3QK0A 3RWJA 2XNAB 4HEPG 4IDJL 2BIHA 2YPVL 4HOXA 5TE6H 1OV8A 3K1KC 4NJAL 3UTSD 4HGMA 4B0MM 2YWYA 1NCAL 4JKPH 3S8WA 5D1XE 4AENA 3IDIA 3JV6A 1OP3H 1CC3A 4KROB 4QYOA 4BBWA 4X6BA 1A7PL 3QFJA 4YC2C 4W9IC 3CU7A 5DWPA 2AK1H 3UGUA 5DHVB 3U9WA 1D5RA 1QZ1A 3F7LA 1GAFL 2AK1L 4L1HA 4EUPH 1KBKA 1P5UA 4U6XB 5I6XB 3WSQL 4BE6A 1A3RL 5EFIB 5KAQG 3FTZA 4WIQA 5HI5D 1F4YH 5D5MF 3VUAA 3D7PA 5B39A 3JVGA 2FCBA 3FSWA 1OM3L 4NHUA 2YXFA 3ARFB 4MXVF 4UOW1 5KVDL 5T1LB 1DJXA 1IVTA 3OB0H 1CDGA 1NBVH 3QDGA 1GA2A 4MQTB 4DSYA 3LRGA 5EOQL 3U2JA 4JANA 3NCCB 1H9DA 3VWKA 2D03H 4FEMA 1X7QB 3E6HB 5FO9A 1IC7L 1X44A 3OKDA 4XBEL 4XPAH 5I2IB 2NUTA 5JORB 5L2KA 5FR3A 5L88L 2HTKC 4HOMA 3Q5YA 1DL7L 4LP5A 1H3UA 3RTLA 1EVUA 2EXWC 1TJGL 1RIUH 2X6BA 3KVQA 5KVEL 3A6CL 3EF4A 3D0VA 4FERA 1RIUL 4CSZA 3FO1A 3C6LB 4M8UA 4ZO6A 3N91A 5KJ4A 2EC9U 2A6DB 4O2EB 1R0AL 2EEXA 2AEIT 4ZODA 1U8JB 3L5WA 3VXRE 1J8HA 2VDMH 2EEAA 2VQUA 1ML0A 2CKBB 4M48H 3QQNA 2MQCA 1BOGB 4JN2A 3GO1L 5EORH 1JI1A 3VQ2C 1JV5A 3VNYA 4ZT1A 4PBXA 3H9ZA 1A7NH 3ZSSA 1TU2A 4NZTL 4FQCL 3D9AL 4XCNB 2WVTA 4M03A 3SDDA 3VFNB 1UA6H 1K2DA 1LO4L 3TT1H 5IW6B 1WBXA 1TVHB 4HKXA 1HINH 1U2YA 4RQQB 2KDYA 5IHBA 2GI7A 4LCWB 2DKUA 4U1JA 5BJTA 1UOWA 4Z7VB 5FWRA 1Q1JH 4M5TA 1NLDH 2YXVA 2XG4B 1JHLH 2CHNA 4L1TA 4U4IA 5I0ZA 3HVDA 3V0WH 5EOCL 3ATEA 1JUFA 4LL9A 4C54A 1FH5H 1QLEH 4MB4A 4GW5B 4PHXA 1HX0A 1ZY9A 2VXUH 4F57H 4PRIA 2VDMB 4GKZA 1X4ZA 2EE6A 4FNSA 3P3TA 4NKMA 3D8MA 3EBGA 5J4MA 4D0CA 4Q8BA 1N64L 1MPAH 3FB8B 1DJWA 3ROLA 3UADA 3FC8A 3KM1A 4H8HA 4GJTB 4NQQA 3EJJX 1DDTA 2R0WH 4RISL 4E9TA 5DHXB 2WJ7A 2ZOLB 4G5ZH 3JV6B 3RBSA 1MNUL 2C9VA 3MJWA 3M1BA 3D08A 4GI6A 5L6YL 1BMZA 2EIZA 5EBWB 3CX2A 1TZIB 1OQOA 5E2WH 5F1IB 4FXGC 4R3SB 4J8RB 2HN7A 1XX9C 2JI2A 2BJML 2VXVL 5IQ7H 2E75C 3HKFA 3NYKA 4HGWB 4HT1H 5KTEL 1VACB 1HSBA 3U4AA 4Z3JA 5IT2L 4OLUH 2WTRA 4PRHB 2XPGA 4TRPL 4NX0A 4LEEA 2EUVA 5T3XE 5MENB 4W9FC 3I02B 1BZ9B 1FDLH 1R3KA 3NSCA 4PW4A 2W8CA 2I9LA 4JDVB 3LZLA 1CUOA 4J3BA 4JQXC 1DVFA 4RFEB 2C9SA 3GGWB 3CZLA 4AYFA 4AYBA 2AJ3A 2IDSA 3F01A 4E5XB 2HJLB 2Y2WA 1JUFB 1TOXA 3MA9L 3VXME 4FFWC 2J5WA 4JM2F 5EZPA 5FGSA 2BMKA 1YAIA 1P7KB 1KF9B 3IJEB 3K6DA 4GS7B 5DEFB 5F7EH 5FA3A 4CL7A 2O5YL 3NGBC 3VI4F 1N8ZA 5KYXA 4LCIL 3H4HA 2BSTA 3QI9C 4LIQH 4X50A 5D5ME 3HHMA 1T0MB 4PM1A 4XTRD 1UKQA 2HH0L 3C87A 5ACMA 3TFKC 2IXQB 3KDPB 3D33A 4TUKH 5HJ3A 2IH3A 4TL4A 2CCVA 3O6FC 2J6EA 1WVZA 1EAOA 1BQHG 3UBXB 4UMGA 1AMYA 1ND0B 2ESVE 4XPGH 1NPJA 4WHTA 1HESA 2YUWA 4QY8B 4XCYA 3T6WA 4Y4FD 3UTTB 3VXMD 3BP4A 1DBBL 1RUQL 4LF3B 4NRXA 5D70H 4N2HA 5DJ8A 4U0QB 4N6RB 2R4RL 1MFMA 3H7BA 5AG9A 2PTTA 5LB1A 2BOBA 3CZGA 1FIEA 1CXKA 4K0OA 4YGAB 4GRWE 4YHNB 3CH1A 3IDNA 4MJJA 4A67A 4JDTH 2GEEA 3BN9D 3MRBB 2VJ8A 1MRDH 1B0WA 4M4RB 1OCOB 2FVNA 2PW1B 4AC4A 4NQXA 3CFBB 1JZHA 4D8PA 4GMSL 4BFJA 5FW7A 2V0AA 3SD2A 3UBHA 3HG1A 1TYJA 2NSXA 4Y2DD 4NQVA 4PCKA 2WWMC 5IB2B 3QDGB 4LPCA 4OCWH 1T04A 3LVEA 1XMWA 2RHEA 4PJ9C 3B7RL 3OX8B 3GF8A 3IAPA 5EBLA 3VGBA 4AOFA 4ZI8A 5I6OA 4XODA 1P2CA 2UZXA 4U2YA 2A2QT 5KOMC 1GGCL 1U8CB 5DRXB 5FUZL 1COBA 4GSXA 1QQDA 3LHPL 4U3SB 1F4XL 4P57B 3EGXA 3OWRA 3ZE1F 3CD4A 4UZSA 1YJDC 1PNCA 5ITBH 2G3MA 3QWOA 5PCYA 4AV0A 2JXMA 2QQKL 4UDUA 4X6CE 2B4CC 2SEBB 1NSNL 4LHUA 4M5YL 1XGQB 4MGXA 1OK8A 4N5ED 3VGAB 2VL5B 1T1YA 4DGIH 2XVBA 2WQVA 3OAYK 4GAYA 4K2UH 3SBWC 2ZYRA 3EJTA 1H3VA 5FDWB 6TAAA 1Z66A 43CAB 1WGVA 3MBEB 4OD2A 4NC0B 4WF7A 4JFUA 1WT5A 1NCTA 5I0DA 5DU7A 4ABVA 1BV8A 3SDDC 2RD0A 3CH1B 1DSWA 1T80A 2DQEH 2AJYL 3B9EA 4NENB 3FQRB 1TZHB 1J5CA 1OPGL 4XNQB 1YECL 3FF8A 5EBMB 2AZAA 3H42L 4AIZB 4Z7UF 1QG3A 3UC0H 2D3LA 3S4SG 1SDDB 1P4BL 2WB1A 4ODTL 3BP6B 4ERSL 3MUUA 4AJWA 2WWKO 4JVWA 5HHMB 3H9SB 5F9JA 4PJ5E 4LB8A 2IQ9H 3L3KA 2FGWH 4X8JB 1XF1A 2R29A 5B22A 4YLBA 3F7RA 4GUPB 4I0PB 3QQXA 1RHFA 1MCSA 5D2LA 3PHAA 3AQXA 3ARDC 2VDNB 3L1OH 4BH8A 3RI5F 3RWHA 4NOBA 1CO1A 3BPOC 1SVBA 4FQXB 4B3EA 3ULUF 4HKBB 2OI9B 1R5IA 1T4WA 3R8QA 4OJAA 2X89A 3ZR6A 3V4LA 3MNDA 2J1XA 3HZKB 1THAA 3QISA 2NR6D 2QQLH 1LO0H 2HFTA 1ZXQA 3Q48A 3W2DL 2NZ1A 5C0DB 4NJAH 5EU6E 2ZYHA 3V4PL 4FQJH 4JG9A 3L5XL 3TM6A 5DYFA 3IT8D 4KRNA 3ASWA 3GSRA 3QUMB 2AKRA 1KJ3L 4W6XB 2DEXX 1CE6B 4O00A 3UBGA 2XXCB 4ICXA 3QUYD 2WZ6A 3T04D 4KY1H 5AKRA 3OX8A 3OLGA 1SLUA 5DLLA 4G5ZL 5JQ6L 2BY2A 3FDWA 3CVBA 4AXWA 4EN3B 4Y16A 1SZNA 3QCUH 4MKTA 3VGAC 2DH2A 2PCPA 1LE5B 1O6SB 1WFOA 2H26A 1BPLB 2D9QB 5FHBL 3SYQA 4FFYL 3ZE2E 1NCDL 4L18A 1A0QH 1RZPA 4LPVA 3ULSB 4YDKH 1NCNA 4ZQKA 1FNLA 2NR6C 3APCA 4C57C 1LP9B 3UTSB 1F86A 3KLQA 1AANA 2CD0A 5KSAC 4IEFA 5JXAH 1MH5A 2HLFD 4J27A 5HDOA 3LS4H 1BXXA 1NLBL 3RFZC 3AB0C 3QRGL 3OMZA 5C70A 3HLAA 3ZZSA 3VG9B 3OM3B 4K23L 4AJYV 4DW2L 1WA2X 5EZOL 4HYTB 1TSRA 2IPUG 1LXMA 4GI8A 3KPQA 4QHLA 2CDEA 4K3JH 2D0GA 2H32A 4NDMB 1G43A 2F54B 3Q2WA 3QUYB 5C2BL 1XGPB 2ZWSA 2AXGA 1KB3A 1T66C 4W9JC 1KPRB 3MRJB 5IQNA 5ACLA 3L95A 4EZMA 3LHPH 3AGWA 4EBQH 3TN0C 2NUPB 2BC4B 4PJDB 1MN4A 5DEGA 3DX6A 3TBYA 2EE9A 4PRPD 3WGVB 5GRVK 5B1CA 1QABA 3IDXH 1FJ1B 5JYLA 3I50L 2BO0A 5AVVB 3FO1B 1OALA 4WV1C 3ILDA 1I75A 2NZ9D 1E5ZA 3HJEA 3MJ9A 1NDGB 4Y4KC 4YHLH 3C6LA 1U8MB 2R56H 3UG4A 1G9EA 5HYJB 4A2LA 1YYLH 1Z2KA 5GS3A 4RSVA 2B3IA 1M7DB 2CKBA 1J1XL 1I1RA 3D2UB 1NBVL 1BZDA 4G8IB 3EJPA 3QYMA 2PP9A 2F5AL 2BFVH 2BSBA 5F97E 2F68X 1BIIB 1JV5B 4XP9H 3RWCB 5EU5A 4UDTA 5E6ID 2H0FA 3HA0A 3AREC 2VR6A 3ERXA 3US9A 5EF2A 2GUOA 4GP4B 1AQDA 1E8WA 2DQFB 5HVHB 4IBVA 4I5BB 3EDDA 4I9WD 4PJ7F 3U0PB 5LXGH 4LNVA 2Y07H 4HFUL 1RU9L 1QBLL 1PMYA 4Z77A 1EIBA 2OA9A 5EUOB 1AHWB 2XFGB 3CFQA 1A1MA 2BHUA 1UXLA 2J88L 3IN0A 4AL8C 4GXVH 3FOLB 2QQNH 1CDHA 3NQKA 3FFCE 1PDKA 4I77L 4K71C 4O4YL 3SPJA 3MV9D 2NQ3A 4IU2A 5FYJE 1N7MH 4GG6F 3HR5A 4YWGH 2HTLD 4PJXE 4X4ME 3RVWC 4I0PC 4TQHA 4KKCC 1JPFA 3OR6B 3P4MB 3M1BB 5B4MC 2VDLL 3RBGA 3CH8A 3MU3A 2ZOWA 3LOWA 3QR1A 5K9QG 1KFGA 3UX9B 4LSTH 4PR5B 2DQUL 1R5VB 5IEHB 4OF0A 3BLBA 3L5HA 4FLRA 5GIRB 2QHRL 3FONB 4J3OH 3T71A 5MEND 3PF2A 2EACA 5FOBB 3FTVA 3NJMA 5I6KA 3OAWA 3QUMH 3DMMA 4I3RL 2BXYA 1S7WA 5FS5A 1CGSL 3UDWA 5AOLA 4E41E 4IOFC 4Z7WE 1F58L 1GTFA 1E4XL 4W9ZA 1AGDB 3O2WL 1NCBH 3TJHC 4PREA 3C9NB 1YLBB 3V9FA 3QCUL 1BVKB 3U2SB 2YFOA 1NKGA 43C9A 4WKXA 2FGWL 3UH8A 4DIXA 4S0SD 2XPYA 1PSKH 4ZTEA 3WEXA 3TYFB 3PXLA 5EA0L 1J5OL 1IC4H 1MAKA 3G6JA 1AOHA 4YSAA 1EZVX 2BW5A 3HHSB 3S3BB 4FNQA 2DYSB 2LR4A 3ZKXC 3DROB 4NJ9H 4Z7QE 2Y1YA 4PV8A 5E8NB 2OMNA 1DVUA 2QADD 2L7JA 2NT1A 4WWPA 4C4BA 2VIRB 3DI2B 2FQEA 1TZGL 2EC9T 4RX4D 4X99A 5C0AB 4R8WH 4L8DA 4UT7H 4MNGA 2WP3T 1CF8L 2YRBA 4BK5A 2DYPB 3KZ8A 5DMIL 3JV5A 1U2HA 1ZS2A 1RURL 1T21B 4U2ZA 1L5GB 4ZUVB 3OZ9L 2VDQH 4N25A 2Q8AH 4QHKJ 3DMMB 4IYKA 2DQJL 3NACH 4PJXA 8PAZA 2Y7SA 1KN2L 3TT3H 1EGJL 4YVUA 4OF3A 5IUCA 1WHOA 3HE7C 1MREL 4Z3FA 1NGWA 2JJUA 2D3JA 4CUCA 2WLHA 4HH8A 4B9YA 4JFDB 3WHE1 2Y6SC 3DO4A 1E4JA 1PY4A 2XJKA 3KYMB 4MCZB 2H2PC 4QXGL 1P2CB 4NN6B 4X6DA 5BRZA 2ZONA 5CGMA 4NLAA 4HWUA 4E5XG 1TQBC 2MOGA 1A14H 1CXEA 4GAJH 1ORQA 2IOIA 1PF3A 5I23A 5AOKA 4LQFL 4IKKA 1G6RH 4ZXBA 3AAZA 2X4NA 3AT0A 3FB6A 3V7AG 4F7EA 2LAAA 4M7KH 2XRAH 3MOAL 4MS6A 1R9FA 2JXMB 3TZVD 1CDJA 3IAQA 4MNGB 4PJHF 4KQ4H 5J06A 1MIML 2IPUK 4NM8L 4XNDA 2X7LB 2MSPA 1U8HB 4JM0A 4PGEA 4O58L 4I1RA 4PH8A 5DLML 4N2BA 5D7IB 2Y4SA 5JHAA 5ALBH 4ZUSB 3QDHA 2WBJB 1R0AH 4QI3A 4UYQA 1AACA 1E6OH 1DJGA 2QR0B 2K1MA 2WZ0A 5E23A 3BO8A 3WEMA 5HGBA 1E5BA 3OKOA 3WTXA 4I0CC 1FNGB 2C9AA 3B3IA 5BQ7B 3S34L 2ZE0A 4KV5E 1SF5A 1OO2A 3ZKXB 5IJCC 3AG1B 4AEHH 1AXIB 3D25B 4I18A 4L3FA 1JHTB 3IKCA 2HTKD 4YDJA 1PD6A 1IC0A 5I26A 3TWYA 2Y36H 2XIBA 3HLKA 3IU4L 4IK7A 3ZTNL 3S88L 5I73C 4L4VD 1WS7A 1FBIH 1W80A 3CHPA 4PQXA 4RMRA 3V79C 2IO5A 1IQDA 3BAJA 4EOWL 3PHSA 2H6UA 2CLRA 2A74C 4PG9B 4BZ1L 1DEDA 4MQSB 4FMKA 3BKCL 1MOEA 1CICA 4NBZB 1OB1A 3IETB 1AG6A 2N56A 1V3MA 2TSAA 3BGMB 3WO4B 3PNRB 2QPDB 1WUNT 2V9RA 3O41B 5DRNA 4Y89A 3W57A 5C0JA 2QSQA 3MC0A 4PR5A 3QWRD 2EIDA 3VD1A 1YA5A 3PU7A 5C0NC 3ARZA 1MLCA 1YNKH 3S5ZA 1TVDA 4OGXH 1Q4NX 1U8NA 3C60D 5CZXC 4PJGA 3ELQA 2H6PB 2N0MA 3V0VA 4ONGH 2WZ5A 3GSUB 4PJ5A 3AS1A 5KUMA 2OS7A 2X6CA 3VQLA 2YRPA 3RGVC 4H5SA 4MD4B 5E9NA 3L81A 5DZLA 3KH3A 5F6HI 1J86A 2QQNL 2WBKA 4FFZA 4K5PA 1NMBL 1UKSA 2FJUB 1CE6A 4X4XB 4HS6A 2KLRA 2VMJA 3G5XB 4LHJB 4QHKI 2N1TE 3LKSB 3BDYL 3S36H 1V8HA 1A6UL 4H0HB 4ODXB 5DHYB 1AHMA 5HD8D 4YBQC 1FLRH 2FJGA 3BKYH 3GJFA 5E9AA 5KS9E 2NSQA 2QQQA 3E6HA 4PGDA 1Z3GL 4OD1H 2X70A 1BQUA 1WAEA 3IBOA 2BSTB 5AW8B 4UINL 4PJCF 3H3KA 2JLPA 3HVNA 4N8PA 3ZL4L 1AS6A 1IB5A 2CLRB 4KGLA 3SDYH 1Q90A 3O3BB 3BVVA 4AYSA 1C08A 4P49A 2FO4A 3FW6A 5FO7A 3CZFB 3HMWL 4DPAX 4PRAB 2FT6A 2H3XC 3DPBB 2ADYA 4PWIA 4OY9A 1KWGA 5CILH 4LGRB 3MBXL 5HDBB 4NQUA 4AYID 3TO4A 1KN2H 3UPRB 1E5AA 1N5AB 2VLME 2FHCA 3AXLA 5AW2B 1TU2B 1J7VR 2FWOB 4YVNA 1X5YA 5CZKA 5CKGA 2OPCA 5SWZB 4J3XA 4APXB 1UQSA 3HLAB 3MLRL 5HY9A 4FZ8H 3MCLH 1I4FA 5JUEH 3OKOB 1LILA 1ZLEA 2QTVA 1TDQA 1JP5A 3DGGA 5I1LB 5IKCA 2DB8A 4ZFOA 2IF7A 4G2AA 3EYSH 2R23A 2VAAA 1RCYA 3ZL2A 4ZS6D 3O4LB 3FSAA 3ZJAA 2UYLA 1I82A 3FCTA 3SCMB 1EEYA 2WPGA 3SDCD 4XBEH 4XPAL 1QUPA 4LRIA 4OCYH 4AEEA 4G1EA 5EZLA 4NKOB 2ODIA 3ZKMD 4MJHA 4LCUB 3ZHFA 1MQKL 3PGCA 3ZT7A 2O72A 1CF8H 3K6NA 3HBQA 5EZOH 1CGUA 5J6GA 2DM4A 2CNZA 1I9JL 1MEXH 3EBIA 1VGEL 3MDJA 5H37H 1A1OA 3PRZA 4CC4A 1B2WL 5IFAH 4QJ3B 2IFFL 1TJIH 5ABDE 1SOQA 3US0A 1WZ1H 5L9DL 1AFVH 4NS0A 2CDFB 1BF8A 3PQYA 4OLWH 2DQHL 3AITA 3L4VA 1CT8A 4PJIB 4WEBL 4X9YA 3L1EA 1JTOA 3ZTJH 3VFSB 2XG5A 1OCWL 4XMTA 2AITA 4ZW7A 4AC2A 3NIGB 5CZVH 1C8PA 4MFHA 4CADA 5HTSA 2ZKHL 4XPBL 1E9QA 1T6WA 2XIDA 3IM1A 1QFWH 5GS0H 4M1DL 3TT1L 3IDMA 3D39D 1I8KA 1I8MB 2DQIL 5ITFA 1WQVT 1Q1JL 2PABA 5DFTA 3KPPB 5F3FA 5GXBB 4WI7A 2ZF9A 1Y6KR 2OMWA 1FFOA 1RUAL 3QDJB 3QCTH 1JHKL 5LNGA 2WAQA 3Q6FA 4TQ8A 4KRLB 4R83A 5GGSY 3SCMA 4PHZA 3VD4A 3EYFB 2QMJA 2QSVA 2ERJC 3EH5B 3F12B 3RWJB 3DA0A 3RX5A 2YO3A 1Q0YL 3W1ZA 4G9DB 2AHIA 4OSUL 4C58B 2SODB 1DQDL 3SBQA 1DN2A 2HJKA 5FKPA 2A77H 4OLEA 4ZW6A 3ZDYF 4YPJA 5I0VA 1XIWC 4F9PC 1HZKA 4XHJD 4F5CA 1UM4H 2EKSA 3LNIA 5CBEB 1LK3L 2C9RA 2FJHB 1S7QA 5A2KH 3NSJA 1WBZA 3LZFH 5LDSA 1XZWA 2IGLA 4X6CF 5FECB 2VYRE 1MW2A 3FH7A 1PJ9A 2MQ0A 2WGNB 2MCAA 3L9EA 4MXWH 1UM5L 1OGTA 3FMGL 1UZ8B 2J2ZB 3CG8A 3T0EE 4H25B 4HHAA 3WJJC 4C56D 3F85A 3GXNA 2FT8A 3WIFB 5C3LD 1KIPA 4WDIA 3WMSA 2NY1B 2NX5E 2K6WA 4MZRA 2HVJA 1AH1A 2BSDA 1NGZB 3LQZA 2IH8A 3SDYL 1A9VA 3P0VL 1MAJA 3Q9PA 4OZHA 3L17A 5AW4B 1MCOL 1PTZA 1TCRB 3D85D 1LO0L 4YXLL 5K39A 2VO8A 3UTQB 3LSOB 2JH2A 1U30A 4IIQA 3NCJL 4UILH 3CGTA 4YXLH 4ALAH 3QUHA 2DMHA 5HHOA 3NIDE 4C83B 3R06B 4QUOA 3RA7H 1FORH 5FFGA 3VH8B 4M6AA 3EUDA 1GGUA 4OJFL 1G0YR 1EBPA 2FO4B 2YPLA 2PWGA 3FT4B 3QDJE 3T3PF 2ADGA 3F58H 1A7BA 3FN0L 5BZDB 3FTGA 2Y1AA 2D7TH 4NUJB 2X05A 3GSXB 1U9KA 2YEQA 1IU1A 1WZMA 2RQ8A 2VUKA 4NUQA 2VZTA 1ANUA 2YC1B 2F08A 5HHPB 1TO4A 2Z34A 2OV0A 2ORBL 5H2BB 4XCNA 4P2AA 1I8AA 1XQ4A 2X10A 3MX0B 1TZ8A 1MCWM 3INOA 2WXQA 4M62L 1HTYA 1N2RA 3VVVA 3FT0A 3DSFH 3FCUB 3KPPA 3RL2A 3ESPA 4ZTPL 1FYHB 4BE5A 3UPAA 3DRQB 4DK3A 1A3ZA 4OTXL 5KZCD 4XB8A 4UTAH 3SGEI 4I1PA 2NUPA 4KXBA 1JGDA 1KNOA 4JRYE 1BM7A 4LLWA 5HHXH 3OSKA 1PZ5B 2DQMA 1MUJA 4Y8DC 5B1BB 3MTXA 5E8EA 3WD5L 3ZVVA 5I1AA 1J9CT 3CSTA 4OIIH 3W0WA 3OV6A 4JFOB 1E2WA 3BD4A 1TEFA 5EORL 5GGSB 5DC4B 3ML8A 4H7VA 5ADOL 3S6CA 2IADB 4R5XA 2DWDB 4BUGA 4HV8A 1HXKA 2EIZB 5EBWA 3S34H 3SDCA 1DQQB 2I5YH 1QNZL 3ARDB 5ESAB 3M1OA 2OJEA 3RWEB 4AGLA 2EDMA 2J21A 2OR9H 1VCAA 4L29A 3VFTB 2FWLB 2OR9L 1BQHA 2EYSB 4PRIE 3VWJB 1ET7A 1FP5A 1H6TA 2ENJA 4X0NA 1R33A 5ESQB 3ZXAC 4DO6A 4R4ND 1N0LA 1BLIA 3LKNA 5SWSD 3RAJL 9PCYA 1SNRA 2YPVA 3SYOA 4U1IB 1ECYA 1FH5L 4EI5A 5F1OB 4L4VE 1V7NL 3QVAA 2H7WA 1J1XH 3VXMA 4HOWA 1SM3L 3BKCH 4HIJA 1DJYA 1AQDB 2CUHA 5D93C 4JPKL 3PQYD 4AQEA 3AG2B 3WLWC 3QIUA 1NANI 4YHYC 3PUCA 1AGEA 4CVXA 3B2UD 2C9PA 2OR8A 3M17B 2ZCKL 3MV7D 1KJ2B 1XAKA 4XVUD 2AW2A 2YSSB 3FHAA 4MJ2A 4XOCA 1UOVA 3NZ8B 3V8OA 1A9BA 3MNVB 4JO3L 5CEZL 1KIUB 1FC1A 4M43H 1OW0A 1RJLA 1RZQA 5ID1A 3JZYA 4MXQC 5IV2A 2ADFH 3WJMA 1MUJB 4X7DC 3VXRA 2H26B 3ZHNA 5E8EB 1HHKB 1HH9B 5F9DC 3OHXA 1JK9B 4FQXD 1ZWIA 4QO1A 1PZBA 1F11B 5C0BB 4LRIC 1N0XL 3FPYA 4PJIF 2O6CA 5D4HA 1IC5H 4JZOA 4GUQA 4D3CH 1BMGA 5DRNB 1E4HA 3NIFB 2VJ0A 5KAQF 3BPCA 3IDGA 1PEZA 4B96A 3II3A 3EFOB 4ZSOB 3RFZB 1XGRB 4S1SL 3L9BA 4F91B 3KPOB 3CFIC 3FQTA 1AZNA 3S5LG 1AGCA 1QRNE 2IQAA 2FECI 2V5SA 4WUUA 1Y18A 5D8JH 1JBJA 2H5UA 1SLWA 2FEJA 2KL6A 4HKJA 2H32B 5LGJB 2CBMA 3KL0A 4NZ8A 3V4VH 2BVPB 3EO1B 3QNZA 4O51A 4WJ5B 3W2DH 4ALAL 4IRZL 4RAHA 4X4XA 5C8JA 1Q94B 1DSFL 5DURD 1RULH 4ZK8A 2W5PA 2LQRA 3I3EA 2V7HB 3ZZQA 4XO9A 4G42A 4HUUA 2BP0B 4UOJA 1BJ8A 1P5VB 2ILLA 3NZUA 1JCVA 4OQTA 3ZU8A 1QLFB 3FYEB 1I8IB 4OW6A 1ZOXA 1SJEB 1J05A 5D7JB 5FV2A 3GSQB 5JHDA 4WENB 4G6MH 4HIPA 4UV7H 3V0EA 1WTLA 2LVEA 4IIQB 2ZUSA 5FCUL 1W8OA 4ZUTB 4XXWA 4XT1C 4Y1TA 2UY7A 4YPGB 2KZBA 4UU9A 1I7RB 2E47A 3JWOC 1KXTA 4I4WA 2EZ0C 2R29H 7FABL 3U82B 1NBYB 5E4OA 3JWNE 4HK0A 3VD9A 1BWWA 3BKJH 5DD1H 4KVPA 1J87A 2XTLA 2CJUL 3FTGB 5TE4L 4WFGE 2APFA 3ISRA 5DUJA 3QT2A 3C5XA 5D1ZD 4D0BB 4AWJC 1BQSA 1EHXA 4KMLB 1HHHB 4HQQL 3IF1A 4DZ8A 3HS8A 1GPOL 4PY8I 2PXYB 2JKRM 1E42A 3L5JA 3UYOD 3QYCA 4JN1H 3LCYA 1NGWB 3HI5L 5CD5D 1CGVA 3MYJB 1EUUA 2A4ZA 2P4AB 4HK3J 5ESVB 4N2NA 2EYRA 4AYDC 4JM2C 2JB5L 3EH4B 3O11B 4K3JL 5L9DH 5HXMA 1IM9B 2H1PH 5ISZB 3EXJA 1M42A 5ILTL 4DT2A 2V5YA 3IXAA 3HG1B 4MB5A 3A4FA 1EHLH 2VLRB 1D2OA 4XP5H 1HEZB 4RDQF 3A47A 4ZMNA 1R46A 1RK0A 3AMKA 4QCIB 4S0HA 1GJUA 4OZIB 1VFAB 2EDQA 1GKEA 3MN8A 4EN3C 5GGRY 3GHEL 2Y22A 1EJOH 1BZ7A 3FB7A 4GUPA 5AVYB 5IJKA 1DLFL 1E5UI 3ARUA 2DAVA 3A22A 1IE5A 4DKEH 5I30L 1ONQA 1P7BA 4KRMB 1CLYH 2DIBA 3HN3A 5F3HB 5AYUH 4GQRA 3IGUA 4I18C 3W9DB 1DR9A 1LP9F 2MTPA 4FN0A 5EOTB 2C3XA 3KNBB 1N10A 4Y9GA 3ES6A 3SOBL 3V0FA 5TPWH 4FLOA 1LEKA 1F2XK 4M3KB 5KYNA 4B9GA 4G43B 2ZG3A 3D05A 1DDHB 4L1BA 1NCWL 1MLBA 1ZPUA 3ESUF 1KBVA 2ZCKH 3T65B 5L88H 1ORSB 4AEFA 1MFCL 1HH6B 1WICA 2NY7L 3IF1B 1BQLH 4KJYB 2FGZA 2EDBA 3OKLA 5JHMA 5KS9A 1AKJD 2G3NA 3DHJA 1GOHA 2QGCA 3VGEA 1HN1A 4DOHE 3N44B 3WS6A 2GJ6E 1B2WH 3H7LA 1KIRA 2L04A 3VH8G 1TNNA 4W9DC 4UT6A 4HUUB 4J6IA 4FNLL 2PYEA 3M17A 3LZFL 5EUKA 1I8IA 1PY9A 2WXIA 3FU8A 3QUZA 3KPTA 3OL2A 3TL5A 3UZVA 4DAGL 5IFHH 2D7MA 4PJ7B 3BCDA 1JV2B 5KANG 1O75A 4MAYD 4Q9RL 2CUAA 3EG9A 3T0EB 1M3JA 4YPGA 3QE5A 3LKOB 5GS2D 5JPMC 3GSNB 5ADPL 3GS7A 4U1SA 5CCHE 1HHKA 2NXZC 4XZ4A 3MV8B 2HFFA 4TNWK 1G9NL 1J8HD 1LNUB 5IMMB 2JKTM 5FYLL 1MJUH 3S88H 3LZPA 4L4TD 1IBYA 2DMCA 1IAIL 3JYCA 3JWNH 3EHBB 3IRZA 2E86A 2AXJA 1ILSA 4J8RA 3TYGL 3V4VL 1ZJAA 3QHZH 4O2FB 1CN4A 4HULB 4PJGB 4B9CA 3BXNB 2QDVA 1FI8C 4XMPL 1LEIA 4ADGA 1JNLL 2D4FA 2Y6SD 4EI5D 3SE8H 4LASL 4PV1C 3ARGC 4ELKB 1JXJA 1JGUH 1AGCB 3UC0L 3ARBD 1E4XH 3HE7D 2ID5A 2R0ZH 3EHBD 3NP4A 2GITB 5EO1B 4PJ9A 5FYJH 4N2EA 5GGVL 2B1HH 3WN5A 4S1RL 3G5XA 4N2FA 1VB9A 2CM5A 4Y1AE 2YGQA 1F5WA 4EVNA 1LK3H 2W80C 3BLPX 4M56A 1WSST 5MEPB 1SLVA 3RY6C 3RWDB 3ME0A 5E5UB 4J3WA 2JJSA 4QRSA 2BP5M 4ZD3H 2YPLE 4E9VA 1EPFA 1PQZA 4S1QH 1YUKB 2AS5M 2R2HA 5LBGA 1A7QL 1OAXL 1Q9KB 3MRKB 1VEMA 4UU9B 3FO0L 4Y4FB 1OW0C 2NRDA 3LEVH 4KHTL 1T0MA 3V2AR 4ZUUB 3N42F 1YQVL 4PS3A 5IROA 4JQIH 4P5TD 1LQSR 2IDTA 4WNSA 5T1MA 4DUWA 1YNTB 3MLXL 2B08A 2EEDA 3MJ9H 1W0VA 4PS8A 1F8TH 1MH5B 4KUZL 3FYIB 4KWUA 3TIDA 1KSRA 3MUHL 4GSDL 3IDUA 4Y2DC 3UDWC 3CVHL 1I4FB 3CZSA 4WWNA 5GRJH 1P53A 3RZWA 2WQAA 4EI5C 5BO1H 4HDIB 1HNGA 3CVHH 3UJIL 3WNPA 1QSEE 3MBED 2UVEA 1E50A 1ODUA 1GS8A 3BUQA 2YPKA 4MDJA 4QHLB 3POCA 2F74B 4PTTB 1PD0A 5F7FA 3O4LA 4GXUM 4GG8A 5HHQB 1TKWB 2V8MA 3PREA 4Y19A 3UZVB 4F37K 3HAEA 4H0LC 3E8UH 2VW7A 3F6LA 1WFNA 2OL3A 3OGCB 4L4TB 4K5NA 4CMMB 5KSUB 3NZHH 3VO0A 2AERT 5DEGB 2P45B 4NQCA 1VEPA 1BF2A 4PG9A 5M94B 3OXRA 5FF6B 2CBTA 1A6AB 1MFNA 3QDMD 5GGSA 5F3BB 2PKDA 2BVQA 1LNUA 5E2VL 1T1XB 2IAMC 2XBZA 5BUGA 4ZZKA 2A9AA 4MD5B 5EU4B 4LDOB 4F8PA 4KVCH 4PJFF 1FNHA 2XBDA 1P69B 4GO9A 5F0JB 5FK9A 1TZAA 2EE2A 1H8LA 4YK4C 3WTYA 1GSMA 3AU1A 3CBKB 2DH3A 2YD8A 2VO5A 1H6UA 4PTUA 2WJ5A 1QKZL 3HPJA 1XAUA 5DTFA 4TTDC 3KPRB 5E4EB 3S37H 3JTSB 1VLXA 5IFAL 5J5EA 2BDNH 3QJUB 1AOZA 3MLPA 3TBSB 3OKMB 4GIOA 1EFXD 1XCWA 2Z64C 1PLCA 3VXMB 5GGRB 1P4UA 4Y2DA 3C8KB 3ARFD 4NENA 3CHSA 5ITBL 1QHOA 3FTSA 4HUNB 5F8RC 4P46B 4APQC 5KW9L 4G3YL 3WLBA 1A7OH 4N2DA 3H0TB 4N0UB 4M5YH 4YBLC 4U1KB 3IGAA 2V9QA 2H9GB 1RJLB 3A6BL 2YEZB 3L9RA 4OZ4B 2Y1VA 4KTEH 1UZ6E 2I07B 4B9FA 1DVFC 2FJFB 3WYRA 4LKCA 2NY4B 2EJ1A 3WI9A 2GTZA 2ZCLL 5IFJB 5LBVA 4GRWF 5FKPB 4BKLB 1NC2A 2IDUA 4TSCL 1VESA 4K9EH 1NFIB 3P30H 1RMFL 3VX1A 5I9QC 2NNFA 4KK5C 4L2LA 5IJBC 3NTCH 3CSFA 3UJTH 5JXEC 5IP4A 5LGYA 1IGYA 3UJTL 3QDGE 4X4MA 2Z4QB 5BZWB 4ESKA 3U4EB 4JZNB 1GTNA 1XWVA 3C2AL 2YS4A 2X38A 1BEYL 1TG8A 2WHVA 3D0LB 4HS3A 1CDYA 1F3RB 3O2VL 1OP5H 3W56A 1GGYA 2F7IA 5C0CD 3KR3H 3QZWA 2DD8L 5T1DL 2ZUWA 4WGVB 5D7HA 5DXWA 5A6MA 4Y2OA 5IVXF 1AI1H 5IT2H 2CK0L 3GK8H 3K71A 3GMQA 3I74A 4JFPA 3P3UA 3KWWB 3LEVL 2BP0A 3DJZA 4QT5B 3FZUD 5EDSA 2GSGB 5I2IA 2H9GA 4EI6A 5D1XA 2ZPKL 2FX8L 1SRDA 2WZPA 1A47A 4NZJA 3X11B 3UAFA 3WU1A 5J6GB 1H15B 1P5UC 2CAKA 5IUSA 5E1GA 4G9FE 4XBPA 4O2CB 3SE6A 1SFHA 5FEBA 4Y9EA 4MTMA 3ZTJG 5E2TH 1AQMA 4R0LC 1CQYA 5ETUA 3PQYB 4Z7UE 1Z9LA 4L5FL 4KROD 1MRFH 4GRWH 4OIBA 5FYJL 4GMTH 4XH2A 2JJSC 4DGUA 3CPLA 3MJGX 2MCG1 3RU8H 2DIJA 3DSNB 1F13A 4KK8D 5SWSB 3U36A 3IS1X 4PJAA 1EZUA 5DR5H 2V33A 2D7TL 2BWDA 2XTJB 2CDGB 2FIKA 5FHBH 4HU2A 2Z8RA 5I6NA 1DQLH 3VD3A 4NERA 4PBWD 4HJGA 4WK2B 3RTQB 5J1AA 1JVLA 2DL9A 4XI5C 5EOQH 1FNSL 3LZQA 1I1AB 5I6LA 4H44C 4J3SA 1BX2A 3WELA 5A43C 4H8PA 4KVCL 3E3QE 6FABH 1RSYA 3VFOA 3LN9A 1O5DT 2D2CC 1VIWA 1YN7B 3QDAA 2AQPA 3VSUA 1KACB 1DBAL 1MHCA 4NQCB 4BKTC 1D2PA 4MXQD 2UZPA 3WEAA 1MCJA 1PKQA 1OSPL 3RIAK 1RUKL 2ZSVA 2P5WD 1HCYA 4N0FA 4PJDF 4K5OA 4P5SA 1BJ1J 4NQSB 5BS0D 4NRZB 3V7MA 5CJQL 4TV3A 5HYJA 1CXIA 4LLQA 5CFAA 2EE3A 1AGBB 1U3JA 3P2DA 2HJFA 5DJXA 4OIIL 1KFAH 2OCCB 3O3EA 3TASA 4I13B 4OCMC 3OR7A 2VN6A 4FQCH 5CLYA 4BSWA 1IAOA 5FUCE 1HSBB 5KYUB 1BIIA 1DDHA 4GH7B 4ETQA 1R75A 2V5RA 1GGBH 3MV8E 4DO4A 1OHZA 1WZKA 1HAWA 3FHQA 1OTSC 1LHZA 1H6FA 1VCBC 4X7SL 1T5WA 3DUSB 4M1DH 2V2TA 3WNIA 2PYED 2C7UA 2DLHA 1U92A 1MVYA 4CJ0A 4YGVA 1ESOA 3NCFB 5DVPA 2OJZL 4L3EA 4Z77B 4NO3B 1AS7A 4UB0L 4JFZH 4JX0A 4F2ME 1A02N 1TQVA 5D6CA 1MCFA 2JQZA 4PMFA 4Q9BA 5FA3B 3ZHLA 5IHHA 5I66A 5A3ID 5F9AC 3TN0B 1MNNA 4HSAC 2COVD 4F93B 4EJ1C 3FU5A 4PJBB 1CE1L 2BSSB 1SHSA 4NFCA 4DPRA 4XN7A 3MRQB 2EQDA 2IXQA 1P4LB 4AZUA 1MCLA 5ERWA 4NRZA 2W94A 2QV2A 2X0UA 4WFFE 3VDCA 3OAZK 5D1QD 1AR1D 2TAAA 3BXNA 3HE6A 3MRMA 1UWEL 4HWBA 4ABWA 1MJ7H 4RAVB 5HBBA 5EN3A 4UBDD 2OX5A 5GS1B 4J28A 2NY5L 3DVNB 3E6FB 2IAND 4KKLC 1CFVL 4WO4B 7CGTA 2B9AA 4K7PX 3RVUD 3RLSA 4GLRH 1ZLUH 3MOBH 3KS0J 4M4PA 4JQIL 1E2VA 4AE1A 1FZMA 2YWZA 3WXVH 3HUJB 4BFEA 2RR3A 4K8RD 4ZUTA 3K2MC 2BNQE 3PYCA 1JWUB 1QSFD 1V27A 5ISZE 4V1DE 5CILL 5CUSL 1HKLH 5D6CB 1YY8B 4H1LA 5DZJA 1T20B 5IG7A 4OZIF 5D2NE 3AREB 3GNML 3UTPE 4UUJB 1FORL 4O2EA 1KXQA 2K9FB 4H2AA 3RDTC 1S9KC 3KLKA 3RZCB 1Z9MA 3OTTA 5HGDA 1JNHA 5K1NA 3K72A 3BVUA 3HBGA 4A37A 3U6XS 3WY3A 4LSVL 1F3JA 2ATPA 1BQRA 4X5LA 3SY0B 1ZVSB 4AZ8B 5T3XL 4QLRA 4WSGA 3U0WH 3QB7C 1QFPA 2GPZA 4U1IA 3T2PA 4W9LC 3OKNA 1B0GA 3MFFB 4E9QA 3C6SB 4WV1B 3QEQD 4L37B 2P80D 3ZDXE 4WLCA 3QQ4A 4OT1L 4UNUA 4PGBA 3FRUA 2G2NA 3EGDB 1X5MA 1HDMA 2HX8A 4GMSH 4F7PA 1S78D 4OT1H 2BZDA 3KH4A 4PW3A 2E7MA 3F7VA 4FGMA 2CUIA 2Y06L 3OGCA 3W81A 2E74C 2XY1A 4JFDA 1JGEB 2Q3AA 5LCVH 1MZZA 2BFGA 4YSPA 4ZTOH 2OXHB 2Q3XA 3S37L 1CBJA 1D9KC 2FL5A 1U8PA 3TEXA 3FB8A 4WUKH 5LJYH 3QORC 4GSDH 3B5HA 4UQ2A 4QOKB 1SBBA 1KEML 3IRCA 4HC1A 4PY7A 4D94A 5L0QC 4H40A 4HLJA 2KMWA 2GJJA 5DD6A 1TIUA 3PWUA 1PKQB 2N7SA 3NJVA 3FU7B 5GRYA 3NJXA 5F3HA 4Q9QL 2G4EA 3A4AA 1E9OA 3W9EA 1T7ZA 4QYOB 4BH8B 1FFQA 4KOCA 3GBMH 3NJIA 2AXHA 3R8BB 1AHWC 1C8QA 2H1XA 4JO1H 3QP3A 3MRMB 3UG5A 4EZKA 1OK0A 3AWEA 3FUMA 3MLZH 5J1SC 3HC4H 3WFEH 2XTJE 3CFUA 4KQ0A 1MLBB 3HB3B 1XIWB 3KJ4C 3CLEL 4WK0B 1AC0A 4U6XA 3LKQB 2R56L 1CGYA 1BHGA 5C9JB 4O9HL 1S9WB 4LXFA 4EIZC 3EYVB 1P7QB 5F6IB 4L37A 3RDJA 4X6EA 2EDFA 1PKOA 3IDMB 2R9HD 3FUFA 3LH9A 2Q0ZX 1A6WL 3Q2LA 1UWGL 3H42H 2WK2A 4PJFA 3MHZA 4JB9L 3TVMB 4XP9L 3LRSB 3M46A 3GSRB 4QRQB 3A6CH 4PJEA 1RZGA 3NIFF 4ZFZB 2HFGL 4OM1L 3UAJD 3ULUC 1OE1A 2DJUA 3UTQA 4NQDA 4R7XA 1G5AA 5DK0B 3FTWA 4NO3A 5AD0B 4MQXD 1W0YT 2IALA 2VR7A 2RMNA 2HMID 1ZPLA 1WF5A 3KWVA 3MUZ1 1ZTXL 4J1UA 3D3VB 3E9TA 3O8XA 1RP9A 4RZCB 1GGIL 3BPLC 4XPHL 1FL3B 3T2LA 3K8KA 3SN6N 3FT4A 4J3OG 4X0KA 3FUEA 4YQXH 3WN6A 3HI6L 3NBNA 3FMGH 1ZLSL 5KVDE 2ITCA 5J57B 5DJ2B 3B6SB 4D7BA 4WVRA 2WLIB 2BWIA 5CD3B 4Z3IA 2V6HA 1FN4A 1OAZH 2NMSA 4WW2F 5CMAB 2PCFA 3TCLA 3FHEA 1HEHC 2VLRE 4N6RA 1DP0A 2R39A 4N8VG 4RWYH 5CJXA 4AGQA 3U7AA 3UTOA 2E7BA 5B3JF 4OZIE 2WLMA 5EIVA 3ZSTA 3CUPB 1QPPA 1KCRL 4HMCA 3QZWB 4PJ8C 4BINA 1OT4A 5L2KD 2XCMC 4ODUB 3TURA 4KHXH 3UJJH 1S7UB 4LOUC 3GSWA 1ZHKB 3SKJH 4XP4H 3GM0A 4KZCA 5GSRA 3RWFB 2E76C 2V8LA 4M9OA 2FT7A 4QT5A 5HJDA 2KHAA 3RX8A 2WYZA 4JDZA 3DXAE 1IBZA 3NGBB 4WSJA 1PLAA 2WXGA 4NYLB 1NEPA 2XV3A 4YBHA 2QGBA 4ODSH 1WYJA 1MCEA 1QQDB 1QRNA 3N41F 2WQWA 3QO1A 5BOJA 4NSKA 4QRBA 3HZMA 2KH2B 3NSXA 3BQUB 1PZAA 5IB5B 3SDCB 4LL4A 5HD8C 4P04A 5EIIG 2VQ1B 3QJQB 1S7XA 1OAUL 4FFZL 4KMTL 5TK2A 4TVPE 4I89A 4OM0L 2BS9A 1HHJA 3RUGF 5HJ3B 5TE4H 5EOTA 3NABL 1UJ3B 3MRCA 4KJQD 1Z0MA 4IRSD 4OLVH 2QADC 2BVOA 3O2DL 3BKJL 5DD1L 1ZEAL 3V10A 1FLRL 1N0LB 1SMAA 2AFNA 2P8LA 4FMVA 5CAYB 4JNXA 5I1JH 2QSCL 4PVMA 3SY0A 4X6DF 3AXLB 4J5VA 4LLDA 2GK0B 1QUNB 5F1SA 1PCXA 4OIFA 4HDIA 4FABL 4LLVB 3RPKA 1RL1A 3BZDA 3RWCA 5HDQL 2PTTB 4ZMAT 5DQDH 4UI2A 1CTOA 5DQDL 2W0LA 3E3QC 1KTDB 1WFJA 3DGGB 3HN5A 4NO0A 1RURH 5DF0A 3IJ7A 3ALPA 3IKKA 3ZKQD 4UT9H 3WDJA 1YEKH 1JE6A 3I6SA 2FHFA 1EHKB 4LOUD 4OI8A 4XAWH 4J3OC 4JY5H 2VZVA 4L1LA 1A7PH 4TVPD 2ITFA 4LVOC 1P6FA 1ZSHA 3DVIA 5IV2B 3OPUA 1XZ0A 2AEWA 4DKAA 4MB3A 2UX7A 2AMUA 4PJEE 4CMHB 5IIEA 3EOAB 2HLAA 3U0TB 1S5HA 2R69A 5DSCA 5BV7L 1CVRA 4JFDD 3BIKB 4XMKL 1DLFH 3IFLH 3WG7B 3ARBC 4UMSA 3RWHB 3NK4A 3SBPA 5BW7C 5KVDH 2HJFB 5DJXB 5K9QI 2Z9TA 4QHMB 1ND0A 3LKPA 4POZD 2DI7A 2QGDA 4PTUB 5KS9F 4MLSA 2X1PA 4WGKA 4GAFB 3B7YA 2R59A 4ZTPH 3BHBA 5E9DB 3Q1SH 4X7FC 4MJ5A 1JZ7A 2C3GA 3NVQA 5D7LE 3C08L 3SDDB 5CSZB 4QTHB 2OL3H 3THML 1OP4A 4AUJA 3IYLW 3C08H 4LLMB 5I1GH 1B4TA 5FYKE 3V4PB 2WLNA 5T3ZD 2P5ED 5IVXB 3M1CA 2HPTA 3P4OB 1UWXK 1KMGA 1AGEB 3FS9A 5ALBL 3WEBA 2ESVD 3TEWA 1K72A 1IMHC 2Q76A 3O45B 5T5FH 2Y25A 2EIEA 3UTZB 3BUBA 2Q86A 4ZAKA 3NESA 4Y2LA 4ZJ9A 1EXHA 2V2WA 3O9WA 5DMYA 2W65B 1FG9C 1UH3A 2RCSL 2VLMD 2HTLC 1E9PA 1ET8A 4X5WA 4KY2A 2R2HB 3EDFA 1IGTB 2H2PD 2MWCA 4Y4FA 3MGAA 3NFPB 3OKEB 5D7LD 5BVPL 4HZLB 2WOYA 3QIWA 5TDPA 5K59E 4P4KD