3Q1EA

Crystal structure of y116t/i16a double mutant of 5-hydroxyisourate hydrolase in complex with t4
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
b'SPLSTHVLNAAQGVPGANMTIVLHRLDPVSSAWNILTTGITNDDGRCPGLITKENFIAGVYKMRFETGKYWDALGETCFYPYVEIVFTITNTSQHYHVPLLLSRFSYSTTRGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-hydroxyisourate hydrolase
molecule tags Hydrolase
source organism Danio rerio
publication title Probing the Evolution of Hydroxyisourate Hydrolase into Transthyretin through Active-Site Redesign
doi rcsb
total genus 26
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3q1eA00
5E4OA 3GRGA 4HJUA 1GKOA 2QGBA 2TRHA 4HIQA 3SSGA 3U2JA 5JIMA 1DVYA 5E23A 4ABUA 4PVLA 1DVTA 3FCBA 1SN0A 3IPEA 1U21A 2B14A 4PVNA 1E4HA 1RLBA 4TQHA 2PABA 3A4EA 4IIZA 3IMVA 4Y9EA 5CNHA 4Y9CA 4D7BA 3DJZA 5FO2A 1IJNA 5IHHA 1FH2A 4TLTA 3DIDA 3BT0A 3I9PA 1QWHA 4MASA 4HISA 2QGCA 3A4DA 4AC2A 5AKSA 3QVAA 5AKTA 4DEUA 1BM7A 3M1OA 1SN5A 4DETA 3IMWA 4QRFA 3DJRA 4PMFA 2QGEA 4TL4A 1ETB1 2H6UA 1E3FA 3D7PA 2G2NA 3KGSA 3CFTA 3ESPA 1IIIA 4DEWA 1DVZA 4AC4A 3KGTA 3W3BA 3NEEA 3Q1EA 4PM1A 4PWGA 3I9AA 4PMEA 2TRYA 1E5AA 5BOJA 5K1NA 3DGDA 4Y9BA 2QELA 1BZDA 1KGIA 2B15A 4Y9GA 2QGDA 2GABA 5CLZA 5CLXA 2G3ZA 3IMRA 1OO2A 3IMUA 4FI8A 3HJ0A 2FLMA 3CFNA 4IK6A 4TLUA 2B9AA 3DO4A 4TNEA 4ABWA 5FW6A 1ZCRA 3CN4A 4MRCA 1TTBA 1FHNA 1QABA 5FW8A 5L4IA 1X7TA 3ESNA 3I9IA 3DK2A 3CBRA 1TT6A 4TL5A 5AL0A 4IKKA 1IE4A 2H0EA 4TLSA 1DVQA 4IKLA 5EZPA 3IWVA 3P3TA 5E4AA 4Y9FA 2G5UA 5AKVA 4TM9A 1TZ8A 2H1XA 3TCTA 4FI7A 4TQIA 4YDNA 4PWIA 5L4JA 3A4FA 3GLZA 2F8IA 1Z7JA 4ANKA 1Y1DA 1F41A 1G1OA 4WNJA 5JIDA 2GPZA 3GPSA 2G2PA 3BSZA 5EN3A 5FW7A 3P3RA 3OZKA 4N87A 4PWHA 3IPBA 1TLMA 1THCA 3GS0A 4HJTA 3IMSA 3DJTA 1ZD6A 5AYTA 5DWPA 2B77A 1DVXA 4L1TA 2G4GA 5AL8A 5DEJA 3U2IA 2ROYA 1ETA1 4PWFA 4YDMA 2WQAA 3CN3A 5CR1A 3KGUA 4IKIA 1ICTA 4N86A 3CN2A 1DVUA 3GRBA 3CFMA 5CLYA 2QPFA 4L1SA 2IGLA 5K1JA 4ACTA 4WO0A 4I85A 1BZ8A 2G9KA 2H0FA 4DERA 2F7IA 5L4MA 3P3UA 4PVMA 3IMTA 3NG5A 4QXVA 5JIQA 1TSHA 1KGJA 3B56A 1F86A 3GS4A 5TTRA 3FC8A 4ABQA 3ESOA 3OZLA 1TTAA 3IWUA 5CN3A 1THAA 4IK7A 3NESA 4MRBA 3TFBA 3GS7A 4TQPA 4TNGA 1DVSA 4TNFA 4QYAA 4HJSA 4TKWA 1TTRA 5CM1A 1SN2A 4KY2A 4WNSA 4TLKA 5A6IA 1TTCA 5HJGA 1TYRA 2FBRA 3D2TA 3DK0A 1TFPA 4PWJA 1SOKA 4PWEA 4ABVA 2G4EA 3P3SA 1IIKA 3NEOA 3CN0A 2H0JA 4Q14A 3CN1A 1X7SA 2ROXA 4I87A 5L4FA 3DJSA 4DESA 2NOYA 4I89A 3NEXA 4FI6A 1BMZA 4PWKA 2H4EA 3CXFA 1BZEA 4N85A 4TQ8A 4IKJA 3CFQA 2B16A 1SOQA 1GKEA 2G3XA
chains in the Genus database with same CATH superfamily
2O5XH 3MLYL 4WJ5A 4M6OL 3ARGD 3ARGC 2NQCA 5B7MA 4LEEA 3EJRA 1X9RA 3RGHA 3N40F 2DBJA 2DV6A 1J1XH 1DO6A 2BS8A 3V52H 3WS6C 3HKFA 1L0YA 4YFLI 5GJSL 1MCFA 3UABA 3MRNA 3NSJA 1YEKH 5FO2A 5LWYL 4F8QA 2FJSA 3EH4B 4LVOB 3AXLB 1MIMH 4MQXD 2NY4B 4JO2L 3GUTA 4BWUA 1UA7A 4OU3A 1E2ZA 3OWRA 1KXQA 1R34A 2IQAA 2GCYB 2WC7A 1O9WA 3RA7L 2H2PC 4XWOD 3SDCC 2RMNA 1KB5H 1T7ZA 2BHUA 1U58A 2XWXA 2HLAA 2FJGA 2EEAA 2VDLL 3LVTA 4IRZL 4KQ4H 5ENWA 4OR1A 4KI5F 4N1HB 5AW1B 1T0NB 4E68A 5C0CD 3VWJA 4C4BA 1E28A 4YZWA 1E6OH 1ES0B 3N1GC 4O4YH 1ZANH 2I24N 4X6BB 1DLHA 2EIMB 1TTBA 2OMXB 1OGAA 1S6NA 1X7TA 2Y06L 3MRKB 2ZE0A 4WHYH 4KJWD 4DAGL 5B38A 3CWGA 3TBYB 2J1YA 2ESVA 4HJJH 3RNQA 2VAAB 3QQ3A 4PJ9C 4GAYB 1CL7H 5T3XL 4BRJA 1U3ZA 3AS0A 4PJXE 2FCBA 4R5VA 1OARH 3MJ6A 3GMQA 3WIHL 5DD3H 5TDNA 2G2PA 5L2KE 1DBJH 3JXAA 5DSCB 1RIUL 4XMLL 3U82B 1KELL 1FL5B 1KZYA 2FT6A 5EF2A 4GH7B 4HUWB 1VHPA 3KHQA 1TJIL 2DQCH 4P05A 1NGXB 4GBXA 3TF7C 3KYNA 2PLTA 5HHXL 2IGFH 3BGFB 2AQ2A 5DUBA 3L4WA 1SDDA 4O02H 4BFIB 5I74B 3U9UB 4OCRH 5EDSA 3QXUA 2X0UA 4G8GA 2H8PA 4KWUA 4FA8A 3MJ8A 2VXUL 4HIEB 2H6OA 3GSXA 4Y2DB 1X6LA 1W6WA 3ALWA 1XCTA 4G2AA 1K4DA 3RB7A 3U7YH 3DHUA 5D6CA 3O3EA 1YMHB 4RMTA 1JRHH 5I6KA 5I71B 1V7NH 4HJSA 4NN5C 4GLRI 1TU2B 2WAHA 2G5BB 1G1CA 1W72B 3D30A 3X14A 1BQRA 3DHMA 4CJ0A 3RGVA 3AT8A 2OCFD 4YDKH 1DDTA 2BP8A 3ET9F 4P9HL 3TH3T 3HHMA 4NKDB 3FAWA 4JG1L 1QRKA 4FP8L 1XCTB 3GBEA 3VMPA 4LSUL 5HYJD 1NLDL 3GRGA 5GRJL 4F7MA 1K5WA 1IGYB 2AK4B 4S1SH 3HI6H 1SY6A 4OUUA 1A9BB 5EZJB 3UTSB 3H54A 1ZKAA 3P73B 3G9VA 2Z34A 4DP6X 2FJHB 1SJXA 2EH8L 4JKPH 3LRKA 1D9KA 3SDAB 1PG7L 5BW7C 2J71A 3BZ4A 5CEZE 2X4QA 1BWWA 1EDHA 5FKPB 5F7AA 3CSTA 4XVSH 1G7HB 2L7EA 3VYOA 1B90A 1ASQA 1XF1A 3QR2A 1QSZA 2BCMA 2VC2H 2Y7LA 3MXVL 1EUUA 5MERB 2FJUB 3GJFA 3SDXB 2OKMA 5EO1B 1FA4A 4PG2C 2XC8A 5A2AA 4E9LA 2AK1L 1GZHC 4QTIH 1RY7B 1UGKA 4FL4B 3AC0A 3K4ZA 4G5ZH 4K9EH 3QQ3B 5CEXB 3A22A 2WLJA 2F6AA 4HPOL 1PFCA 1N3NB 2VLMD 1G5AA 1A7QL 1XGYL 4M48L 2XN9E 4B6ZA 4HMDA 3WNMA 2VL5A 4MX7A 5A40E 3X1BA 2ED7A 3EUUA 3IDGA 4UIKL 5L4IA 3V7AE 2ESVD 4TULH 2R0WL 2C7UA 3M88A 4PJHB 3UBXA 1ZVSB 5I6MA 4F2ME 5AG8A 4U1HB 1RK1B 3QC6X 2NY2D 1C8PA 2C9VA 1EAPA 1TETH 1UB5A 2EEXA 4I18B 5DQ9A 1XB3A 3WFEH 4J8RA 4QHLA 1D9KC 2IANA 5I8KH 4XCFL 2O72A 4LVHB 1IM9D 1ZS2A 2VOTA 3MO1B 3CFBA 1TMCB 3JWNE 2AW2A 4FA6A 2AMGA 2VYRE 4HS8L 5FYJD 1DBAH 1E50A 2R69L 3GSNA 5HI5D 2UUDH 1F3RB 1U95B 2VDQL 2FX7L 4XCYA 3HAEA 3P3UA 4L3EE 4X9BA 3O2VL 3HRZB 2MWCA 4P2QD 3O9WB 4KFMA 3G5VB 3EBHA 1SYVA 5I0ZA 3O4OB 2BFVL 4ODUA 2WVTA 3N41B 3ZRCC 2E74C 3ECQA 4RFOH 2R69A 2R1YA 2MOQA 1KPUB 3APNA 4FA7B 4K71C 1SHMA 2OZ4H 3M46A 1TETL 4F7CA 5BS0A 4PRIA 2X09A 2NY3B 3JYCA 3ZL4H 5FECA 3RVWD 3HNTL 2XA3A 4FQPA 2ENJA 3EDKA 4BHUI 5JXAL 4QHPA 1N5YH 3LPGA 1BZEA 5AW2B 2M2DA 3K6SB 3GUFA 5F7NC 3F7VA 3O6FC 3T3PB 5DD0H 3Q1SL 3DVNA 5E1QA 2NSXA 1IKOP 1QPXA 5E8OA 2CJSA 3JTBA 4YX2H 1TJHL 5IG7A 3TEUA 4AVJA 3ZLQC 3SPCA 3L2LA 3RURA 3WN6A 1PLAA 2P47B 3FB6B 5FYKE 3AW5A 3O45A 2HWZL 1CFSB 4UOJA 3SDDD 1G6RH 5F9OH 1ZLSL 3V9FA 5C7XL 2L8AA 1LD9B 1BFTA 3GI9L 4IEFB 4IHOA 4A2HA 1PF3A 1VACA 4FABL 4XHJC 2GTWA 4PB0H 8PAZA 3KGTA 4F92B 2AEOA 2HJFA 1D6EA 3CSYA 3M17A 5CJOH 5EIVA 1O6VA 4W4OC 5F21B 2APTA 4IOSA 5B3JE 4LLVA 5MHSD 2HKHH 3KJ6L 4NJ9H 4QRQA 1KN2L 4KUCF 1OB1B 1TO4A 1CFNA 1SBSL 2VXQA 4JANB 5DJCB 5BVPL 3QS2A 4NAJA 4AUYA 3CGTA 3PHOA 3VI3F 4UNUA 3SGJA 4L9LA 2QQLH 4RNRB 3L3OB 4TM9A 4RIRB 1LO5A 4N0YH 4H8WH 4QXTA 2W9EH 3GFUA 1A4KA 3I6LE 1XFPA 4UAOC 1RZKC 4O9HL 1KPVA 5J11C 1XGTA 1JF1B 1TQUA 3EFDL 2HT2C 3WBDA 5F8RC 3VM5A 5T1LA 5CINL 5F93C 4TSAH 1CGSH 4UT7H 4NZRH 2C4XA 3EYSL 5EDXA 3D39B 1U8QB 3VNZA 4JFDA 1XV8A 1RXLA 2WQAA 3LRSA 1WE5A 1GS8A 4AUUA 4NJAH 4EKJA 1DVUA 4ZMXA 1LEGA 4PJ8B 5C0DB 4FQ2L 1ODAA 3ZE2B 5DJDB 4Y5YB 4RZCB 4YNYB 3EH1A 1T4KB 3ECWA 4LGRB 1WBXA 1T3FA 4TN9A 4G8GD 3CVIH 4B9KC 2HKHL 4JQIH 3L48A 4NM8H 1QFWI 4B5EA 2XT1B 5FHAH 2AV7B 4MJ5B 3A47A 2X4OB 4P9HC 4TQPA 2J25A 2JE8A 3FTUA 3X1GA 4OJCA 5L88L 1QSEA 3IXTA 4L3CA 4PCKA 4TLKA 1U3HA 1F3JA 5B4MD 4P5KA 1H8NA 4BH7A 3L95A 1H0DB 4EEEA 3WJMB 5LN4A 1EO8L 1I1YB 3G6JF 3L7EB 3L4YA 3QCTL 4G9FE 4U1IA 3U2JA 4NO0A 3MRMA 3WFBH 4KVNH 1F4XH 1XSKA 1F90H 1YJDL 4X7TB 4YHKH 2W8CA 1EHAA 4WW1A 3EIFA 5D7JA 5LAXB 3W11D 1ECYA 3NIDB 2WAQA 4W9EC 1BVKA 1RURH 1ZGLB 1V5JA 3DSFL 2HMIC 1TZIA 4XN5A 1IL1A 3WHXB 3HR5B 3QZNA 2J1XA 1PLCA 5FUOL 4Z76B 2WOBA 2WZ0A 4BINA 1JI1A 5B1CA 1ET8A 4EI0A 4PYGA 4GUCA 3MNZB 1KFAL 4RFNC 1PS3A 3MI6A 1V3MA 4M1CD 4ZXBC 2B1OA 2QDWA 1S7QB 1AIFA 1OAZH 4UQEA 3O6FD 1MJJA 1L6PA 3THMH 1G0YR 3IDMA 2Q7YA 1TCMA 1IEBA 1H3XA 3AB0C 3QDAA 4EJ1C 5TJWK 1YMMD 2WOYA 3H56A 4PAZA 1NOLA 2XACC 4BFEA 1KNOB 4TUJA 1G7QB 1S5IH 3NN8A 2R0ZL 3GBNH 1UOLA 5D7JD 3WUWG 1EAOA 4XAWH 4URKA 1S9YB 1V7NL 3MCKB 1EEUA 5FK9B 2O61A 3LXAA 4ZMZA 4F8OA 3VXTA 3CPLA 1ILUA 4Q9QH 2DKSA 3NIFE 4LP4A 1DQJA 1NGWA 3UZEA 3CHXA 1KIRB 2HG5B 3RY6A 3BRGC 4X4KA 1L0XA 1B4RA 5AW7B 1T04A 3W37A 2VDOL 4FQHA 5ESAB 1TVHB 2G9HA 3MRBA 3X2QB 5AL8A 4YSRA 3TPUB 3S3JA 3N91A 3FHQA 3OGCB 3MYJA 3DMMB 2IOIA 5D7SH 2HG5A 2PYEB 1A14H 2B08A 5ICXA 2YRLA 5E03A 4DZBA 1E5YA 1PMYA 2XXMB 3VXTB 3VXSE 4X5QA 5EPMB 2VSDA 1XWVA 2F58L 5E2TH 3NCJH 1MRFH 3SHSA 1E9OB 1MCRA 1SJHA 4I0CC 4LFHD 3U1SH 1IUZA 4OLUH 1HSAA 1WFOA 1L9MA 3MLSL 4HJJL 5L7XH 1BF8A 4WUUB 4CC4C 1NJ9B 4XGZA 2L7UA 3VWKC 5T5FA 3FSOA 4L4VA 4XMTA 1IU1A 2VDRH 3RWCA 3TFKD 3IK2A 2FO4B 4N9GA 3FSAA 4NGHH 4H13C 3GWJA 3KPOB 2KPNA 3GI8H 1I8LC 1A7RH 2V0AA 4NPJA 5DURD 2VDQB 2VJXA 4N2EA 2VKXA 3UTPE 3AREA 4JLRB 1F6AA 3U0WL 4PTTA 3ZGIA 3FDWA 4RDQF 3FZUD 4PJ9D 5K9JL 5KSVB 1WUZA 1IB5A 4X4XB 5E6SB 4ZX4A 4M7ZB 3U4BH 4P2OA 4XCFH 2B20A 1R3JB 4PGEB 2X4NA 2K4WA 4A2LA 2HH0L 2GUOB 4A2MA 3A4DA 2N1TE 3DRTB 4PJDB 3VWKD 1J8HB 1XQ4A 4Z8FH 2I60L 2ZIDA 1L9OA 3OXRB 1AGFB 1I1RA 4ZMWA 2W0KA 1QBBA 1RHFA 3OMAB 4L8BB 4CVUA 1JRHL 3GXMA 1NGWB 3OAZH 1H0DA 2NXZD 4XZ4A 4CRPA 1UUNA 4YK4C 3JWOC 4JHAL 1Z0MA 4APQB 5CSZA 3DV4A 3KLAA 2AJ3B 4X5RA 3HJ0A 2FLMA 4WGVB 1OF0A 4TSCH 4KAQH 5H8DA 4X6DF 4Y2OB 1E9PB 4FGMA 4NKOA 1BPLB 2FJFB 4IKKA 3ZK0A 3IGAA 5GGVH 4FFWD 3VGDA 4DUXA 1WVZA 3NBNA 4HD5A 4B9IA 4F33B 2OR9H 3ASNB 4NRXB 4PLJD 5I66A 4PWIA 4EI6A 4U1KB 3WEBA 4M5YL 3PAYA 3QDME 5ADPL 2H9GA 4Q58C 4WAFA 2E9BA 4NI3A 1QTYT 2ZXCA 3EGXB 1MJ8H 1KGUA 2CBTA 4FYQA 2NUTB 3D3VB 3H9SA 4L8DA 3FW6A 3KYKL 2VMDA 4XO9A 1J0ZA 4WU5B 2F5BH 2NY3C 5C0RL 1DBBH 1KIPA 5JIKA 4NUGL 3VRJB 3INUH 3KWTA 4YSCA 1XBRA 4F8PA 3A6CL 2E9WA 4YHPA 1CBJA 1TTFA 2FAUA 2UZXA 3SJVB 5KSBA 5MEND 2EXSA 1S7XB 2FH8A 5FUZH 3ZDXB 1ZLVH 5D2LF 3L3OA 5KJRL 5D7JB 2WQWA 4GW5A 2OQJA 4WUUD 2E7DA 2NYYC 1T2QH 4X7TA 3IJYB 4HF5H 4JFSA 4LEOB 4P07A 3LD8B 2C9RA 1D6VL 4JANA 1H15B 2EEBA 1HHKB 2E7LC 4J4PD 3D18A 5T33L 1L5GA 4ONGH 5B3SB 1HAUA 3T77B 1LQSR 1I1CA 2V33A 3K0YA 2E4TA 4HS6B 3N9GL 4DPCX 4IM8A 5EC2B 3LQZA 2YKKA 4UNVA 1I8IB 3NIDE 2FEEL 2WXRA 3L17A 4ZD3L 5IW3A 3DMMD 3HOGA 5GGTH 4DOHB 4YWGH 25C8L 3W11C 3ARBD 4CNIA 1EJ6A 4GXVH 4D0CB 1T5XA 5DFAA 3V0WL 1MHPH 4XNZC 4D9QE 1U8NA 4WW2F 1URIA 2Z64C 4XH2A 3BZEA 4M03A 4M5ZH 4YE4H 5EUOA 1AI1H 5DJDA 2MOVA 4WEEA 5BQDA 1QSFB 2E76C 2UY7B 1PFOA 1BYNA 3HCVA 3X17A 4RESB 4YHZL 3WEXA 1TPXC 2LABA 5IK3B 3RPIB 3Q3GB 5CIPA 4AENA 3O6KL 5T1LB 4I48A 3L4CA 4YQXH 5C09A 3PP4H 2EDQA 3MLUL 1A6UH 4UV7H 5K33A 3VH8G 3R1GL 5F9JB 2GIMA 1QA9A 3Q1EA 1RIHH 1U8JB 4RETB 2GSGA 3IGUA 5DHDA 4HA1A 4P23D 4YFDB 5A7EA 3QHTC 2N0KA 1I8AA 3OC8A 3IDNB 4A6YL 5H35B 3V79C 4OY9A 1F6LL 4BSVB 1KYOJ 1DJWA 3WIAA 5I73B 1JV5B 1FZKA 2XBTA 3NFPB 2DQHL 3K8MA 2IGTA 1I9JL 1CXFA 2QPEB 3DK2A 3ESNA 3JVGC 5KSUA 3ATEA 2IFGA 4CVXB 3X11A 1DVQA 3HPJA 4C54A 4YO0B 1CFVL 2UZYB 1XXDC 4MYWB 4WI8A 3SGDH 1UOVA 3HJEA 5ID1B 4P48A 2VDKL 2AAAA 4XPAL 4AIZA 3BDYH 5KVGL 1MF2H 4FQXB 3AY2A 4RWHA 3ZE1E 2AMUA 1EX0A 4BFJA 4E41E 3FB7B 1JI2A 3V0EA 1CFQA 1U8MA 1ICTA 1MFBH 4OM0L 3RTQD 1HI6B 2LVEA 1T03H 3L3HB 1A7NH 4E36A 3F65A 4CSPA 2CCLA 2HA1A 2DQTH 2F19L 2QADB 2J7LA 2ED6A 4XAKE 4X9GA 3WHE1 3C8DA 4Z7OB 1UD4A 3QDGE 2AEWA 2ADFH 2AQ1A 4RGOL 3K6SA 3N40P 3OJMB 3QO1A 5KEZA 1A1OA 2VLJD 3MRDA 4UINH 2HN7A 3DI3B 4EN2A 4HLZH 5GGQL 1Y18A 5B39B 3QO0A 4GRWF 3W82A 3F7QA 3AWGA 4AQAA 1QSFA 2ZONA 3UCQA 1UGNA 1D5IH 4K7PL 5IESH 4TF4A 4XCCH 4YFEA 4HIIB 3MRRB 2E8YA 2WXLA 2XFGB 2Z1PA 3QK0A 4DQOL 5L4FA 3H53A 2JKWA 2Y1AA 1CMOA 4F1SA 3P4OA 4Z78B 1HFUA 4H40A 1Y0LB 1OEZW 4FJZA 3PQYD 3C08H 5FKAA 2B7DT 3KPRE 1DVYA 2M26A 2ODHA 2W07A 2NMSA 1AD9B 4PVLA 3BWAA 1JN6B 1TTGA 1QBAA 1OAKH 1JPGA 1RQ5A 2B14A 2CCWA 2PP8A 3C5ZD 3SZKC 2P5WB 3T0EE 3MROB 5CJQH 1W0WA 1XEDA 2CIKB 3B9KD 2H32A 1ZV9A 4HEMA 4X99A 3ABKB 4QHKI 3IDXH 4CVXA 1OP3K 2RCSH 4BK8A 5KSUB 4JQIL 4PGCA 2ADFL 1OK0A 2W0PA 4OB5H 5L8JB 4JQXA 5GZNA 1CGTA 4NIYE 5C0JA 4LRIA 2ZKHL 3MLPA 4E41D 4MS8D 1RK1A 2F68X 1BZ7A 3SGEI 5IJVB 4GW4B 5IHBA 2G3ZA 3B6SA 1RIVH 4Q9RL 3V5KB 1J0IA 2WSKA 1BIIA 5KZCD 4LLYB 1NCCH 2ZYRA 3BSZL 1YDPA 5HPMB 3PXLA 5B1AB 4AGNA 1J5IA 4GT7A 4PJEF 2XV6B 3S3BB 4WK2B 3A6BH 1U6AL 4J2QA 3T0AA 4DP0X 1B2YA 4LGPB 1FCCA 4P2QE 4UNTA 2D9CA 4XN4A 2JIXA 5HP5A 2YA1A 1ZT4B 1F00I 2WWKO 1CGUA 3AWEA 4AM0A 1IGCH 3ARPA 3S35H 2WBJB 1TLMA 4KRPC 5I1JH 1CT8B 3L3IB 1T20A 5ACMA 1U3HD 1XSOA 5L9DH 1HJCA 2VIRB 4LRNH 3I85A 4NO3B 4Y4FC 2AV1A 2XLLA 5I0YA 2EE9A 4ZUUA 4RX4A 4P3CL 2OTWA 4MGXA 4N0YL 1XZWA 3W1ZA 3FQYA 2GB2A 2ESVB 3LKPA 1PNCA 3PCYA 4ODBD 5AVZB 4AGOA 3BAEH 4F15B 2Z4QB 4XPHL 3L6FB 4F7MB 1PU0A 1Z3GH 2C3GA 1WZMA 3CZFA 3ECVA 4PGJA 3DGCR 3VRIB 3RWJB 4CN4A 3NACL 4YVNA 2NDGA 1M1SA 4LQFL 4ZXBB 2BXZA 4PJIF 3OM3B 1D5ZA 1N70A 1YEJL 3BWUF 1VPOH 4IDJL 4QRUA 1OP5H 2XETA 3L5JA 4M43H 1G6VK 3KYOA 3ZPDA 5T1LD 1FVCB 1SOKA 4OLYH 5IBLC 3QCUH 5KSBB 5A6MA 1FYTE 1BOGB 3CVIL 1NGZB 1SXNA 4Z95L 5E95B 1R5VB 2HFEA 3WU1A 4PW3A 3FU6A 3KWWB 4O51B 2YSTA 1RULH 3MJ8B 3OHMB 1JFHA 1YUKB 3JWDC 4HQQH 1A7PH 4IRSC 5E6RB 5D4HA 4ATTA 3FU3A 5F44A 3CSPA 1I8LA 1NWPA 1U21A 3HTLX 4Y4FA 5J4MA 4G7YH 1MWAB 2K3TA 4HD9A 1RL1A 4L4VB 4LHJB 5CEZD 3UTTD 3B2DC 5L6YL 4WUUA 3O2WH 1E5BA 4WUUE 1J8RA 3FB8B 2DQFA 1MRFL 5IVZB 3SCMC 1KXVC 2B1HL 2JTDA 3U0TB 3H9ZA 5KS9B 1T5WB 2D0FA 2HX9A 4NUGH 5JW5A 5G55A 4OLEA 1DEDA 3QRGL 4L4TA 3DTXB 4PBWD 3ZUNC 5IQ9A 2UZIL 3B1TA 2LGNA 3QIUA 3VVVA 2P52A 5EF3A 1RURL 2ARJQ 2P80D 2AGJL 2C3XA 2WB1A 2JJTC 2Y7QA 5CLXA 3H7BB 4WFGE 4WGKA 4EN3B 1MIML 2V7NA 4I9WD 3K2IA 3Q7JA 1N7MH 3GI8L 1XSIA 2YA0A 1DFBL 2CO6B 3FQ4A 5F7DB 3HC3H 4S1SL 1HSBA 4MB3A 2MCAA 3QQDB 1T04B 3N1FC 3SOTA 3WFHA 4KQ0A 4NCC1 4P3DB 4H26A 3V5HA 5D7IE 1QSEE 5DJ0A 4OCMC 4Y16B 4EBQH 3MGTA 1T0MB 2OP4L 3BUYB 3UJIH 4A1RA 3AMLA 5DRZB 3FT4A 4E9RA 4JNXA 3S37L 5I8OH 3I2CH 1N64H 4MNGE 5CCGE 4XPTH 5B21A 1NIEA 4WW2B 3OKEB 2YN5A 4QXGH 4U3HA 1MHPL 4AVHA 2YPLA 3ISYA 1TZHB 3HEIB 1S9WB 3ISWA 8FABA 2VW4A 1VDGA 3EOAA 1Z5LA 4BK5A 5K1JA 3OMIB 4G42B 1FJ1A 3G6JB 3NCFB 2VJ0A 3WO4B 1GC1L 2A1WL 2RFXA 2A73A 2VLKD 3CZSA 5AAMC 3QUYA 1IC5L 5HYSG 3NIGE 3D1MC 4QRRB 2RTTA 2PO6D 2E59A 2QVFB 4QRSB 3WNIA 1BG1A 4RSYA 3PP4L 3AXIA 1E8ZA 1BFVH 1FZOA 4NERA 4POZD 2X1QA 4ZUSA 3ZDXF 4PP1D 1UH2A 5BV7L 2AQNA 1DQDH 2W9DH 3HHRB 4D94A 3QFJD 1MH5A 3ROOB 1LXMA 3WE6B 2H0JA 3KPQB 3RTLA 1W8OA 3AFLA 1TKWB 1TQTA 3UH8A 2DLIA 1ZWIA 3NYKA 1YNTA 1B9KA 2YD1A 3HFML 1YRKA 2ZXGA 3HI5H 4OLZH 5FO8B 5IEHA 2PPFA 5EH1A 1YJDC 2BVTA 2R23A 1QTSA 2WW8A 1ZAGA 3WKYA 5CD5D 1EFXA 1A3RH 2VZUA 1JD7A 1XCWA 2DOCA 4IBUA 4IBWA 3FU0A 5L7XL 1JERA 2YPKB 2JB6A 1LQBC 3VXSA 2KYIA 1MLCA 4YXLH 1XH3A 2VDKH 2WM0A 2G30A 5C9JA 2BNRD 2PF6A 1KIQB 5CBEA 3DXAD 1JZHA 4DEUA 5C0BE 4XBGA 1B0WA 1IAOA 4ZFQA 5I8CA 4RX4D 3KPSB 1ZHBA 4PUBL 3NGBC 1ZLUH 2MTAA 5I75B 1G4RA 1GJUA 3GSQB 3IE4A 5DUPH 5JORA 1WD8A 2GY5A 3VXMB 1U91B 1YMMB 4CUCA 4KI5D 4YUEH 4M7KH 1G87A 1MG3C 3AQXA 3FMGH 4PRHD 3IFLH 5MEQA 2IBZY 3GHEL 5IHZB 3FUIA 3RNKA 5CZVH 4MDJA 1F3DJ 1GOFA 3PL6D 1MWAH 4MA7H 5IMMA 4LK4A 4PIRF 3WXVH 3TVMB 3OSKA 4ZRGA 1CN4A 1XF2A 2W94A 3GSNH 4OAWA 3CQQA 3T4AB 3VXPA 3HZYA 5LXGL 1ACXA 3VFUB 2EABA 1KCBA 5IB1A 4YL4A 3L3OC 5FYLE 1MFAH 4U1JA 3TL5A 2X2IA 3E1ZA 1DLFH 5CP3A 3IVKA 3Q48A 1YC7A 1COBA 3KL5A 1JHLL 3WY3A 3QUMH 4F57H 3TZVC 2FL5A 3QRFM 1BYPA 4ILDA 1BVLB 1CVSC 2X1XR 1H3WM 4LCUA 4JPKH 5IEHB 2YD6A 1YNTB 2UWEF 3B56A 2NY5H 4AW4A 5JPMC 5I76A 2Y07H 1XTMA 3G9AB 1S7RB 3C5ZA 2MHAA 1IKNA 1LWRA 2CALA 3HG0A 4MXVE 3SPIA 2FR4B 3T2QA 5FC9A 5DQJB 2R7EB 2KKQA 1ZS8B 5EUOF 5F2FA 3ARDD 4X8GA 2DWDA 2Z8SA 3QNXB 3L1EA 3F7YB 3IF1A 3T2OA 1XH3B 3UROR 1LE9B 3D2TA 5AD0B 3O3AB 5LXGH 3V4VB 1FORL 4KXZH 5MEOB 1E27B 4U33A 2VNCA 1CTNA 2WSPA 5HGGS 3RY5A 3CQFA 4LLMA 2AERT 4WTXA 3D39A 3HZMB 3MV8E 4MQ7B 3ZHFA 1AHWA 1KCRH 4PB9H 4YHLL 5ICZB 3RE0A 2Q8BH 1ORQA 2F54D 1M71B 1FJ1B 1L9RA 2EC9U 3CFDB 1MCWM 5DS8B 4PRAB 1X5AA 3EOAB 4OT1H 2I5YH 2A4CA 2D7TH 3V6OA 1CD0A 4LAQH 4Y9EA 2ITEA 4RIRA 2YGQA 4NXKA 2BP0B 3FT1A 4L9LB 2JQMA 1KPUA 4MASA 3PGCA 1NCDH 2YQ3A 4JL2A 5CWSB 3IKKA 1MQ8A 5HHQB 1LP9E 1LP9A 1GYAA 2VZ3A 5L9DL 1RZFH 1S78C 1DP0A 1NCWL 2ZP9A 4UT6A 3FT4B 1KTJA 1NFDE 5D7LE 5D93B 3BUYA 3SKNB 2P3YA 1KXQE 1AZBA 2D8KA 5SWSA 5INDB 4IBSA 5J6HB 4ICXA 1M6OB 2DQEL 4NN5B 3E2HB 1QR1A 4XMXA 1IBZA 2VR4A 4LDEB 4G42A 2KC0A 3VQ2C 3FO2A 4FYSA 3LIZH 1J5HA 3MV8B 1RP9A 4AV4A 3MJ9A 2GKIA 4MAUL 8FABB 4YBQC 3QZBA 4HPYL 2YPLB 5D5MB 1ADQL 2VQ1B 3WL9A 4XOBA 4AQEB 3JWDH 2OZ4A 1N12A 1C16B 1VLXA 1HL4A 1OAKL 4UYPA 3QRLA 5E94A 4HEPG 2LU4A 3Q2WA 4PY7A 1I1AA 1DN0A 1LVEA 2CIIB 4XMZA 3MA7A 3V2AR 3TN0C 2XQ0A 3DX8A 2Y22A 3VW3L 1D5MA 4NJ9L 4APXB 2SEBA 3GS0A 3IE9A 3F04A 3UZEC 4NAQA 1E2WA 4KK5C 3V0IA 2WANA 3EF4A 3FOMA 2V7NB 4EDWL 4UMSA 1E8YA 4IGBD 3WE6A 4P46B 5BS0B 2ZXQA 1EGJA 4KJPD 1VEMA 1XTLA 4M7JL 1HNFA 2ZOKA 4DERA 4ENED 5FYKU 3AADB 3VI3B 2WPGA 4PJ5A 2WJ5A 3QI9C 3MLRL 4I3RH 5DRXB 3BDYL 2IG2H 1E6JL 2O5XL 1IC7H 3F58H 3SY0B 4MRBA 5BRZA 5E99L 4BUHA 2IAMB 3TO4A 4C56A 1CDUA 1Q9LA 2IPKA 2A9AA 4H44C 5GRVK 5H4ZA 2B8OT 5IQOA 3DK0A 2HXAA 4JB9H 1F56A 5EA0L 1D9KB 3RZCA 2K6YA 3PNWB 3BVUA 3RILA 2JI2A 4I2XA 2B2XL 4YHIA 5EOTA 4Z7NF 3REVA 2HT4D 3ARFA 2DQIH 3U6RA 3K8LA 3KXFB 1PPIA 5FM5M 3GTVA 2OXGA 1AMYA 2FBJH 4NQQA 1PZ3A 5E2UL 2YAOA 2WTOA 5DWUL 3ZZLA 3TEYA 1HWWA 2AJXL 2VDKB 1T0MA 4Z3FA 2VRKA 1IGTA 3DIDA 5IOPA 5SV4A 5JMOC 4NQCD 1NGQL 5FCSH 3SD2A 2IBZX 2Y25A 2C7UB 3ZR5A 5EEXA 1M42A 3DECA 4JFFB 3D0VA 4I2XE 5HYFA 2VDNL 4H8VA 3VFMB 1TMQA 1QBLH 4AIEA 5DGRA 1V3KA 2HP4A 3VFOB 1G9EA 4DKTA 3ENEA 4PS4H 4G80A 5I8EB 1J5DA 1KLUA 4K9JA 4BFIA 4JGJA 2BDNL 5CLWA 3CFEB 4ODHL 4U3SA 2VO8A 3KYNB 1EWHA 5C92A 2NR6D 2WBWB 4GBXB 1WJ3A 1XF4B 4MRCA 5BXFB 3BUDA 3MCLH 4JO4H 1E3XA 5IBTL 1KFAH 3FB8A 3OSVA 4JGMA 5L2KB 1N6UA 2IH8A 3CFKB 1RUQH 2J1ZA 4MD4A 1A5FL 3VSTA 4FQCL 2N7BA 4A2FA 5I1GL 5HHOD 1UADC 2W1NA 2XN9D 2OMNA 3FQXA 4ZMPA 4JKWA 3ZT7A 4MVBC 4EPSA 4PJ9B 3RDJA 3LEVH 4G6MH 5I9QC 3IJHA 5KBKA 2ZX8A 3WG7B 5AB0A 2DLTA 3A23A 3BAYA 1ZD6A 2B59B 2CO1A 4N0UA 1DLHB 5E6YA 5IQ7L 2QJDA 1DR9A 1SM3L 2E56A 1IM3B 2WIIA 2Y24A 3L1OL 3DX9A 1F4WL 4FXGA 4LPCA 4W93A 1FNAA 1GGCH 1FVCA 1YEHH 3MUGB 4X6CE 1KCUL 5LQBL 3ZMNA 4BK5C 4K23L 5AAWC 1QBML 2Y0SA 3O6KH 4BELD 4UQ2B 4HUUA 4FNTA 1T6BX 2N1KA 3BIKA 3BX7C 4W9CC 1X5HA 2O93L 1MOEA 4BKSC 4IRJC 4N68A 4JKPL 4L8SB 1V55B 3B9VA 4X80H 4A2DA 4LF3B 4TUOA 4NC1C 5D2NC 3MLWL 3MV7D 5D5MF 3TT1L 2XX0A 1DUZA 2C4FU 3NGBB 1HQRB 2WVVA 2Y2YA 1TQCB 4I87A 4R6UA 4IW4C 2XWCA 1BQKA 5GISH 3QYNA 4OI8A 2G3MA 1VGKA 4QJ5B 1UXSB 1W0YT 3CQPA 4HBCL 5F0PB 1GSKA 3GXDA 1XF5A 2A9BA 3QUXC 2VXVH 3JT0A 1R3LA 4U3SB 4PJ5B 2CO4A 4AMXA 5DLLA 2BH0A 4I1PA 2VDRL 3O2VH 4LHUB 1DQLL 5DYFA 1MF2L 2DD8L 2RD0A 1JZ4A 1KBGH 1YDPB 3JVFC 1UHVA 3TF4A 5C8JB 4Z5RB 1L0QA 3D7PA 4B27A 2F9BT 1WSST 3IDIA 3X3GL 4UQ9A 5IOPB 3U0WH 3QFDA 2A9MH 1E4JA 2HJLA 3M45A 1GTNA 2G60L 1MLBA 3L3HA 3DXAA 4Y2DD 1IV8A 1D7DA 4GRLD 4HALA 1BQHG 4DGYL 1FO0H 5D96C 5I16B 2PWDA 4MJ2A 3SDXF 5D7LB 1ACZA 1J0KA 3LYRA 4RRPM 3FT9A 3CLFL 4RMRA 1OE1A 2DN7A 1N9PA 4L0YA 2W0LA 3LKRA 2FUQA 4IKLA 1DVFB 2Y72A 2I85A 1YEFL 2AKRB 2HT2D 5JDSB 5I0DA 4QTIL 3IDUA 1MWOA 1JV2B 3UTQB 1JJUA 5I1LB 1E7VA 4U7MA 5DFTA 5C0CE 2H26A 4OF5A 3AZUA 5F1OB 3Q3GA 4JY4A 5FHBL 4LL9A 4U2ZA 2BOCA 3FQRA 3UACA 3L45A 4XWGH 5BRZB 4MTMA 4HJTA 3SPHA 3SKNA 5I5MA 4LLAA 3VDCA 3CLEL 4E41A 2LW3A 4U7KA 2CLVB 3T71A 4PRDB 3S3SA 3VD2A 2YMXH 5IHUH 3T9WA 3VGHA 4N5ED 3E3QC 1ZTMA 2V7HA 2IGLA 2FSEB 2WUBL 2IPUG 4MJ6A 1LWJA 3QHZH 4WK4B 3TASA 3V4VL 5CGBA 2PN5A 3L9RB 4YHNB 5LHDA 1F13A 1SOXA 1Y6NR 3TYFA 1F86A 2FEJA 3ARDB 4BBWA 4QOKB 3PFQA 4MBRA 1U4FA 5CBAB 1EGJL 1CD1A 4AENB 1QNZH 4APXA 3WJJC 1D5MB 3NCXA 4TNGA 3QDGB 2P5EA 3CC5B 1SN2A 3WI9A 1O6SB 2X0VA 1IAII 2QPDB 3WTWA 2XWBB 2W9EL 2IWEA 3HUJB 1XIWB 3RG1C 1HI6A 1K3IA 2OTPA 3QUYC 5ID0B 4K3EH 2GJ6D 4G72B 5CEYB 3L4VA 4X7SL 2WYIA 3ML8A 4HF5L 4MHHG 3BVTA 4JFYB 4V33A 1BVNT 2R29H 4A7TA 4EQ3A 1G9MH 4LU5L 5FOBB 5I76B 2NY7L 3EJYC 3D51A 3WS3B 4IMLB 4RQQA 1E4XL 1LDPL 2DKUA 3RPBA 2DJSA 4YZFE 3HG4A 4Y9CA 3MREB 2CK0L 2UZYA 1S7WB 2YUZA 2MCPL 3LHAA 3T0VA 5IMLB 3HPJB 4XNXH 4HS6A 4Z7WF 5C0FB 1H8OA 1GZQA 3J27A 2WIMA 1ONQB 1B0IA 2DQUH 4J3TA 4L23A 3VB9A 2LLLA 4PV9B 3PY9A 5EUKA 2NT1A 4HZ1A 5AVVB 4HJGB 3ARYA 4JDTL 1CDHA 3Q1SH 4FD0A 4HUVB 2YFNA 3OZ9L 1U8LB 4TYUA 3HZYB 1TR7A 1ZY9A 3ECUA 1NCUA 4NHUB 1V54B 3MLRH 4I0PB 3TTSA 4YHZH 3ZT6A 1ZA6B 3KDMA 1HWHB 3NIGB 1WUNT 3VH8A 4C83A 3F6IA 4MD0B 1M53A 1S3RA 4Z7VA 5DO2D 4J3OC 5IK3A 4Y4KA 4EVNA 1IRAY 4UANA 2EH7L 1JZIA 4QXUL 3FHAA 1RPKA 3JV0A 5J6SA 4E5XG 1UZ6F 5DZNA 3WN5A 3L8QA 2R2EB 4OGYH 4M6ML 3DIFA 2VDPL 3LHPL 1IBBA 3ZW3A 1OCCB 3QG7H 5MENB 4XO3A 2F15A 2NY1D 4CILA 5A2KH 5AYTA 2Z35B 5ISZA 3ZSTA 5IVXA 4LBAA 5DEJA 1KTLA 3GB7A 3QARA 3UAJD 4YDJB 2DQDL 2QHLA 5BVPH 2FNWA 3UBGA 5ABDE 3MRHB 2E7MA 2SODB 4J6RL 1YEEL 4GO8A 4GRWE 1IEAA 4NQVB 1YC8A 5EO0A 3ZGHA 1YYML 3HE6B 5ETUB 5C3TA 5JIQA 3WSQH 4L4JA 1V05A 4R5XA 4GAAA 3BUQA 5ANMB 4ABQA 4HPHA 1EFXB 2R39A 1OF2A 1YJDH 3CVHA 4BCZA 1TITA 2C4FT 2F8XC 4G8EA 2HJKA 1EZSA 1XR8B 2F5AL 1ZK5A 2YPVH 4H2AA 2OQJB 5CJXA 4KHTH 3SKOB 4NLAA 4Z7UB 3LPFA 2CMRL 4KK9D 4MSWB 3S36H 3BW9A 1UZ6E 4YR6A 3DUSB 5DRXA 5KYUB 1E67A 4JG0H 1QUNA 4GAGL 4LXFA 4NNYA 4OZIA 2OW6A 2Q6WA 3BKCL 1IKNC 2VJ8A 3MXWH 2JSFA 3PXHA 1S9XB 5E9NA 4Z0XB 5JOFA 1TJIH 2R1XB 4HDIB 1KLFA 4JRYD 3BEVA 3MUJA 1KBVA 2FO4A 3QDMB 3IDYC 4E9XA 1FNLA 4NT6B 3PJSA 3V9CA 1YUHB 1J0YA 3KLLA 4B97A 1YMMA 4HKBA 1AE6L 1U2HA 4N5EC 5AOMA 1UZ8A 4WO4A 1VADA 2J8HA 3BPLB 1W91A 3MPCA 1NCCL 1E9PA 2WZ6A 1INQB 2C9PA 3TNNA 4DAGH 2C9XA 4JQIA 3CPLB 3QDJD 1JS4A 3QPXL 1NMBL 3HG2A 3EXLA 1WHOA 2WV3A 4M6AA 4MJJA 2IQ9L 1WWCA 4GUPB 1A8JH 1XGQB 3M8OL 4ZMYA 2PUQT 4OGXH 1LGVA 3D25B 1X5YA 4PD4J 2JJUA 2VLKE 2XPZA 3TPUA 1J1OL 5JO5B 3KPNB 5IMOB 4XNZB 2QKSA 1G7JA 1RULL 1H3VA 4R4BA 2XG5A 3IB4A 2G0KA 1G84A 3V7MA 5EU4B 2NTSP 2JKNA 4YSDA 3ZKNC 1AO7A 1U9KA 2VLRB 4GUPA 3HS0C 1RUKL 2I07B 3OKKA 2EAEA 4O2EB 5JIHA 3FTWA 5HJ3A 4HIJA 4IGBB 4N2FA 5GISL 2JLPA 1PSKH 5TDPB 3PE9A 3E6HB 4IIQB 1KYDA 1SLVA 1J11A 1MCQA 1LHZA 4CW1B 5IWLC 1U8LA 2C3WA 4P5TD 5GSRB 4AEEA 1MFUA 2CLZA 4JVUA 4N90D 1CURA 1X44A 1OZUA 4XP1L 2X4TB 4YXLL 4LARL 4Q9QL 3HZMA 4MQ7A 4U1SB 2AGJH 3H3BC 4LLMB 3WIHH 4BZ2A 1UWXH 4JFWA 5GSRA 2IC2A 1NBQA 2VZVA 4APQD 3L95B 1FDLH 1VEOA 1LJMA 3U2SB 1S7WA 2CGYA 4KKZA 4YIQB 5F7FA 4EDXB 3GMLA 4ONOA 4EBQL 1NIBA 2ENSA 3PWLA 3I9GL 1RZKH 2K3HA 2PYEA 3UOAB 4P2RE 4L29B 3WUWA 1OZTG 5K9QG 5I1EL 4ZMQA 4Z8FL 5B1JC 3DYOA 1NZRA 3UYRL 5EC1B 3VD4A 1IBYA 5GHWH 2W95A 2WMPA 1AY1H 2ATPB 1BQHA 5TQ2L 1WHPA 4Z7VE 1U8PB 2KPWA 3HUJE 2QDVA 3L6FA 3UFIA 5JLZB 2AK1H 1NC2A 1DSFL 2ID5A 3O8XB 4JFPA 3SQBA 2CG9X 5KW9H 1PTZA 5DURB 4Y4KB 1TUPA 5T5FL 2YS4A 1F3JB 4Z7VB 4LSPL 1QASA 3BT0A 2O5YL 1QO3B 4L4TB 4JJOA 4FFZH 2A6JB 1DVFC 5D1ZA 4XMPH 2Z8RA 3ETTA 4P5MA 3TA3D 1OHZA 1FZJA 4E0RA 4MZIA 2J43A 3VXPB 1RSYA 3T4AA 5C09D 1I3RA 4WEBH 2ZUUA 3QZWG 4YLCA 1DN2A 4OM1H 5I8OL 3HRPA 2FEDC 3RPKA 4A7GF 2XTJD 2Y3AA 4WO4C 1DO5A 4YHYB 3BAJA 1MJ8L 1OP9A 4TLUA 1S7TA 4PS3A 3LRHA 1JPSH 1KLFB 4OFPA 4G43B 4J5VA 4DWHA 3CZLA 3LZRA 3KYAA 5C0FA 2EIBA 5D1QC 5ILTH 5DD0L 5EEVA 2HJFB 3M17B 2ZX5A 4FRWA 1T80A 5AOJA 4NPKA 3FRPA 3X12B 3B6SB 5FM4A 4HXAH 1AI1L 4OZIF 4DW2H 2ICEB 4PS8A 1QLFA 1R5WA 3WIFA 4ANKA 3OF6A 2OL3H 1KJ3H 2Y5TA 4BE6A 1XR8A 2WO4A 1M7DA 1RU9H 1ZJAA 5DJCA 3TNMA 1FUNA 1NEPA 3NQIA 5FYJE 5I16A 4PEEA 3P0GB 3SE8H 4EXPX 1UVQA 1VZHA 2HTLD 2Q5BA 5C6TH 2WKGA 3NVQA 4JQXC 1T7XA 1EZUA 2ZPKH 4ZTEA 3R8BB 3FPYA 4EE2A 3NPZB 2DQMA 4J4PA 4KK6C 3R7RA 4JE0A 1A47A 1MPAH 3QWOA 1ZIAA 4JO1H 5C6PB 4NNXA 2NQDA 4PVBA 3ARGB 4JGNA 5IFJB 4AKOA 1QSEB 4FFVD 4DK5A 3S88H 2D2OA 3VFSA 4XP6L 5CIPH 2FDBP 3BWAB 3QIBA 1BF2A 2ED8A 1BQLH 3KPQA 4LOEA 4RLDA 4MCYB 1B0RA 3E9UA 4ZX3A 4QHMB 2NY4C 5A6IA 3QUMB 2DL9A 1R3LB 1P7QD 4OV5A 1NKGA 1TFPA 5C0DA 3IXAA 5FUCE 3T6VA 3ZX1A 5DI8B 2WNKA 5AAWA 5LQBH 3I6LD 4PWKA 4QHUA 3WIHA 4BZ2H 5F7LB 2DAVA 3RGVC 3AT0A 2CO2A 5E4OA 3ARTA 2GT9B 5JDJA 1JGLH 3U46A 4LCIH 4ORZC 3BESR 1G9HA 2R1WB 3GSNB 4GSUA 4I0PC 2X4RB 4L18A 3HBQA 4PYHA 2PPCA 3V6OE 5IHUL 4QXUH 2X41A 1HE7A 3TCXA 4X80L 1EIBA 1HQ4B 3BQUA 1ZIBA 4M6MH 1WBZA 2DYPB 1RZQA 3KJ6H 3RP1A 3BRDA 2GTQA 3BJ91 3BH8A 5MHSE 3GHEH 3LH2H 4ZFOB 1ODUA 3AQYA 3X13A 4YWGL 4KROC 1CWVA 2IANB 3LS5L 1RHHB 4FXLA 2VR8A 4L5FL 4YJZL 3WGUB 4PGDA 4K73A 1CLYH 1MEXL 3AQDA 3GT6A 4QIRA 4U2YA 5C3IA 1Q94B 1RZ8A 2KHAA 2LOEA 3K7UA 3QBTB 4PW9A 4PP2B 1AO7E 5T1DH 4AIZB 2TRYA 5GXBB 3T4YA 5FDWA 5K9KB 1J05B 4ZMTA 1WA0X 1FYHB 4U6XB 1AR1D 1DVFA 5EFIB 5DMKA 3SCMD 4XAKD 3UG3A 4XCNA 2V3DA 3IJHB 2CKBL 1PX4A 5BMFH 3OAYK 1OLZA 4WKZA 4L1LA 4AJWA 2XWEA 3BD4A 1M05A 3HBGA 2YK1H 5I73C 1YPZE 2AFNA 3DTXA 1OGPA 2DMKA 4M9PA 5D7IA 5CKGA 3TZVA 3H9YA 4ZSOB 1A7NL 1S8DB 2Y2WA 3QJFA 4UUJA 3BXNB 4AQAB 2J8UA 1U8JA 2XWDA 2IH1A 1G1OA 1I9IL 2F1BA 3GJFK 1PD0A 1Y18B 3LS4L 5AW5B 1MJ7L 4AG4L 5KVEL 1CD1B 3IMSA 1P53A 4RGNB 3QQNA 4E9WA 2Z1KA 4E42A 4R9HA 4A68A 4LF3A 4TUOB 2KLTA 2VXSL 4L8SA 3LQAH 3CIQA 3CK0L 5E00A 2VUYA 4UT9H 1CFVH 3NQKA 4K3DL 2YC1B 4O51A 5G5DB 1X5XA 1KGJA 5KS9E 5HGAB 4PRDA 3ARQA 1FNGA 2DB8A 4KKAC 5K93A 1CGVA 2ZOLB 4FZEH 3QI9B 1IC4H 3EYSH 1P6FA 3Q5OA 3B9DA 3QCVL 1JD9A 4UZSA 5IBUB 2DM3A 4P0DA 3BPLC 3T6QC 4L3EB 1UD6A 4TUKL 2IAMC 4RA3A 5ID1A 1ZDSA 1NBCA 5EEZA 2MQGA 3KPPB 2HB0A 3RB5A 2XY2A 1QRNB 5F3HB 3MLTB 4Z77B 5FFLA 2ICWA 2JIXD 3FL7A 4GSRA 1QHQA 1HOCA 3GBMH 1RIUH 3N50A 4F93B 1NCWH 3DURA 3GM8A 4G7SB 5LN8A 1TQBC 3K4AA 3PJNA 3I74A 3QH3A 1HHKA 5TPWH 1BEXA 2EP6A 3ZDYE 5HHNB 4OSUH 5L88H 1F97A 3ASOB 2JELL 4HH9A 3P54A 3C75A 2FWLB 4W9IC 2QSQA 1VZIA 5JW4M 2J44A 2WKLA 1DBKL 4PIBA 3TO4B 3WO4C 1T6WA 1WQVT 1WBYB 4XNDA 2VLME 5F9JA 1XDTT 1U36A 3MOAH 2Q86A 3WLWC 2PWGA 3P2TA 3TIDA 1N0LA 5HSFA 2JIXB 1HC1A 2GSIB 1KCRL 3NJXA 4YHLH 4KUZL 4MMZA 2Q3ZA 2E0PA 1Q9WA 4RMBA 1FWXA 2Z7YA 2XKSA 1PG7X 2A6DB 5DZPA 4WWPA 3W39A 4FNRA 4WWID 5E08L 2NXZC 1Z2KA 2B0SH 4KPHH 4NRXA 5D7EA 5EOQH 4I18C 5EUOB 3HKZA 1MN4A 1GJIA 2J73A 4MFHA 4QRPD 5I1JL 4GW1A 2V6HA 5EN2A 2WN3A 5MERA 1UXSA 3HAEG 4HUWA 3WS6A 1NLDH 1IGTB 1TZAA 4KTGA 5KAQF 1G7HA 3AS2A 4JG5A 1A0QL 3BAKA 5FKPA 4JFEB 3ISRA 5D1ZB 1CDCA 1U8HA 2EJ1A 4FLOA 3ZDYF 4LT7A 1TZ8A 4H8UA 2BHZA 3WO3B 5CSZB 4GRWH 3AG4B 1J9CT 2JCCF 2QBWA 5F97E 4Z18A 3VQLA 3ZTNL 1KV3A 4WKZB 1GZPB 5GQBA 5D5MA 1F58H 1M7UA 4Q9RH 1ZVNA 3HRZC 2DH3A 2RJMA 1H15A 1Q1PA 3R7QA 5CR1A 4KRPB 4KDWA 5AVQB 3WNPA 1AD9A 2YGNA 2EIZA 1A3LL 3VXOA 1ZTXL 4OZFG 35C8H 3E0GA 3SBPA 5E8EB 1G0DA 3ZDYB 1R4XA 2E8ZA 4JM2C 4NQSA 1I8MA 4WFFD 2QVIA 3ABMB 3VRJA 1JFQH 2V3EA 2HFTA 3AREB 4JLRA 4MMXB 4R97C 4KAQL 4UNIA 3TBBA 3D4YA 1OPGL 1RFDH 4JDZA 4KXBA 1IBFA 3EJTA 3MOBH 3ZKSD 2VRQA 1HQ4A 4WI6A 3BUIA 2ZKYA 3ARFB 4P46A 3F84A 1GYVA 4N3TA 3T6XA 3FQXB 3F00A 3H8NA 3FOMB 4FQCH 4U1SA 2EUVA 2YD7A 3PXJA 5DS8A 3CPUA 4OIIL 5E2VL 3G3LA 3WFEL 2X4TA 2YEVB 4BDVB 3S9DB 1L4IA 4ZAKC 2OCJA 4JY6A 1BMZA 5JNYB 2XYCA 3NRPA 5J56B 4OJYA 3TA4D 2B16A 4H25B 1FF5A 4Y7MA 4R2GC 2AABL 2WNXA 5DF0A 3RLSA 2ZCKL 5B1JA 2CCVA 3B7UX 2AJ3A 3L3DB 2EDKA 3VFPA 2F7QA 4APQA 2HLFD 4Z0BH 1TQSA 1U3NA 3K81A 5AZ2L 1U4EA 2F54B 4XCNB 1AANA 3SKJL 1GVIA 4RH4A 2IFFL 3JQOB 2VTFA 4ZOBA 5JPMB 3IMWA 3TGXA 4Y1AD 1NSNH 3O3DB 5T33H 1NFDA 3NSXA 3SCMB 5JR1H 3FO0L 2YMXL 2FIKB 3EJYD 5EBMA 4RMWA 3LNGA 4DCQB 3POCA 3DX2A 5GZNC 1OW0A 1I1AB 1DQDL 2W9DL 4OLXL 2OTUA 4YS4A 4MJHA 5I82A 4YSUA 1SUHA 5FYKH 1CXHA 1DANU 1O6TA 1UACL 5HHQA 4JHZA 4HU2A 3UZQB 3BYYA 1RVFL 4E9QA 4HCRH 2GSGB 3OX8A 1INQA 1WFTA 3TNNB 2IPTH 4BFGA 2XN2A 4RISL 1FNSL 3TXAA 1OGAD 4NO5B 1RZPA 2ENYA 1CDBA 2V2XA 3CCHA 3RVVD 2ED9A 1T2QL 4AV0A 1WLHA 1QHOA 1X5IA 3PGFL 1LMKA 1QMUA 3IPBA 1P4IH 5D7HA 1V3LA 2C9QA 2ZSVA 4PQXA 3V4VA 3O3AA 4NPYA 2I69A 5T1MA 4HMEA 2UYLB 1BP3B 4OD2B 2QPFA 4ACTA 5K39B 1JHKH 4KHXL 2MCPH 1QTPA 1T5XB 1R24B 1R3KB 4XMKL 3WDHA 1QFUH 1BQSA 1TEFA 2JCWA 3NMEA 1T1WA 4G6KH 2YWYA 3LEVL 3RBSA 4JCMA 1RJCA 1KN2H 2EDFA 4KJQD 4PRAA 5TF0A 3CFDA 3O6LL 3RDTA 4TTDD 5JZ7C 2OK0H 1MFNA 3O81A 5ICZA 3S8WA 3L7EA 2IXQA 2YPKA 5JMRA 3ZL2A 4ERSH 4G8FB 4AYBA 2BS71 3D2UB 4LSTH 4Q14A 1HXMB 3NEOA 5I0WA 1YNTF 4WJKB 1NCAL 1M2VA 1JGIA 3GJEA 5CGTA 5D71L 4AZ8B 1OWRM 1FFRA 3CE1A 1B88A 1L9PA 1P9MC 1X5FA 1Z9NA 2OJZH 5D8JL 5F9OL 4BKLA 1CI5A 2VITB 1IEHA 4A6YA 3II3A 4NZRL 1QSED 3GMOB 4R7DA 4AMWA 4I88A 3QUHA 3PWJB 2N7AA 5F7WC 1P6AB 2J8OA 3BLKA 3PAVA 5E7FA 1XF2B 2WINA 3S5ZA 3PQYB 4JN2A 1A65A 3DOHA 3DARA 5F7UA 4OLWH 1RK7A 1I9IH 4MDJB 1OOAA 1YYLH 4HGWA 1W2KT 4G43A 2K8MA 2QGCA 2F8VA 5KAQG 5E9DB 2P42B 1R19A 4RAVB 3ULAB 3TH2T 5FA3A 3K6NA 4HCRA 1B3JA 3G5XA 3L3GB 4NZDA 1WRFA 5I66B 2JB5H 2AEPH 2BWIA 2UXGA 4Q52A 4NUMA 5B3NA 1EK3A 1HESA 1FYTB 3PGCB 4Z7UE 4CMHC 5JW4N 5ISZD 2X6AA 3M6DA 1WISA 3I9AA 3INOA 1FFQA 1PQZA 2Z3FA 1MUJA 2BW5A 4QXTB 3VXMD 4ZX6A 2NZ9D 3EO9H 3NAAL 3QZWA 3AY4C 4DQOH 4RNRA 3FTSA 4FI8A 5B8CA 4AEIL 4K3EL 5DDHA 1AGBA 3QIUC 3HZVB 1ORQB 2AXWA 1I85C 3BD5A 5EZIH 3QJHA 1BVNP 2FQGA 3G5XB 3RL1A 1S9KC 2OTUB 1IE4A 2ADGA 1ONQA 4KKCC 4TV3A 4KHTL 4G9DB 3MGOA 3WEMA 2IDFA 4L8BA 4A2EA 2GI7A 3MC0A 4Y1AB 1KBPA 4BFFA 5EV7A 3UJJL 3QNXA 3VXMA 1NFDB 2DTMH 4DVRL 1R9FA 1ZS8A 4G70B 4EN3A 5DQJA 1T1WB 4MJ5A 5H4YA 2Y7QB 4LB8A 1JWMA 1Y7VA 3VXUE 3RVWC 3CN3A 1JYXA 3MBXL 2JF1A 3OL2A 1AH1A 3ZYZA 3D3VD 1WPCA 3HG1D 3NABL 4JRXB 5CLYA 4YIQA 4QMEA 4ZNEA 3O2DH 5G4NA 4DW2L 2JB6B 4NBZB 4G8FA 3GC3A 4Y19A 1XGRB 4JFDB 5T1JA 3A67H 2ODIA 1CTMA 1UZ8B 1MZZA 3FQWB 2RALA 5CEZH 4NZUH 1EV2E 5DEZA 4PB0L 1YY9C 1NICA 1ZWIB 1GHFL 2H7WA 3A3YB 4NQDA 4XP5L 5HI5C 3MCG1 1MFBL 4FAAB 1S9WA 3PWUB 4FXTA 3E6HA 4IIQA 1B4JH 3RHWF 1CC3A 5GRUH 1Q0XL 5A7BA 2V7HB 1KUMA 4P5TB 2NXZB 2ADIA 1AYRA 3SYCA 3CVCA 1DJZA 3VUAA 5CP3H 3ERXA 2DQEH 4MA8L 2ZP0T 5EUOE 1GYCA 2ZKWA 4LNVA 2HAZA 3FB5B 4IIZA 3HAEB 1BM3H 4J39A 2HJKB 4M29A 5IHHA 3OPZL 4K7PH 4FNLH 5JW4Q 2OSLA 3VD1A 1K5NB 5E5RB 1KTBA 3S96A 3H7BA 5C86A 1EVUA 2FX8L 4DKAA 2WXKA 4JRYE 1UXLA 4PJGA 4F1ZA 2Y4SA 3MR9A 3OAUH 4A63A 3A6BL 2IALB 3PWVA 1KPRA 1HH9B 1JWUB 4OT1L 1S9YA 3NEEA 3CZUB 2CR0A 3A24A 3F64A 4JPVL 4EZLA 4QAWA 1JZGA 2O5ZL 3RBGA 4JFEE 3OVUB 2DEWX 1BXVA 1T5WA 2L3BA 1CXEA 2K0RA 1UA6H 1Q0XH 4JHWH 1CT8A 3L3IA 4N8UA 3PPEA 3DVNB 1IJ9A 2DQFB 3IDIB 2Z31C 2BRRH 1FDLL 2X3AA 4XVOA 3DIFB 1KN4L 3QPQC 4HQQL 3PJSB 1PCXA 5TE7L 2BJMH 4A7SA 4P2QB 3S2CA 5JPMA 5EZPA 2MKWA 1GGBH 3O2DA 1CDGA 3Q8FA 1MCNA 1NGPH 2A6DA 4AQOA 2ZUSA 1H9VA 1HZHL 1Q9WB 2H47C 1OSZA 4UT6H 2MTPA 5MEPB 3WSQL 4AQ1A 4U1NB 5FYJH 4WWNA 3ZKXC 5C07B 4NNYB 1ZANL 2F8OA 4LLDB 2CHWA 3FJTA 4F2FA 3BWZA 4QRSA 2CBPA 3GJFB 4XOAA 3U7YL 5HHOB 3MA9L 4PJBE 4QRRA 2K7QA 3LD8C 3KYOB 4KUZH 4ZOCA 4CKQA 4DVBA 5KN5B 4X5PA 2CXKA 2VLJE 3C6LB 1HHGB 4Z0BL 3V0DA 2EH7H 2PCPB 4G8EB 1HQRA 3F05A 1IFRA 3CFJB 4ZJ9A 3MRMB 1DUZB 1TSHA 2FJHA 5EEWA 1I1YA 2F1AA 1AG6A 2YARA 4EN3C 1JGEA 3W2DL 2EO9A 1AQKH 1USQA 3CZNA 3RTQA 3VXRD 4K8RL 1IT9L 1EFXD 1NOFA 3BIBX 3VFGH 2P5EE 5DA0B 1UCBL 5D7SL 3MRHA 3UC2A 4J8RB 4Y1AE 3CDZB 5I1GH 4GP8B 2A2QT 1A4BA 5E8EA 4XNAA 1TJGL 2CKBA 1X5JA 4LSSL 3U36B 4GXUM 4HFWB 1F1AA 2GBTA 2WIIB 4GG8A 5BRQA 4HKXB 2NZ1A 15C8H 1QKZH 5CSBA 1TDQA 3GSXB 4XPFL 3T0XA 1O6SA 1IZJA 3DOIA 2LVCA 2JCCB 4LOUD 5KVDH 4MNHA 1V10A 2NSQA 1LNUB 3QP3A 4PV8B 4X0NA 3M8OH 3SPJA 4XP1H 35C8L 1MDTA 4B3VA 5JOPE 2AZUA 3LZQA 1RJLB 3O8XC 3OKYA 4LCYB 2OULB 1KACB 1N7ML 5L2KA 4Z7UF 3TWCL 1G9NL 1R3HB 3AM8A 1SPDA 5C0EB 4QY8A 1T20B 4N8CL 4TVPH 1FGNH 2AI0H 2WBJA 3BXNA 1JZEA 1AOZA 5EN2B 4BYHA 4KY1L 3V4PA 2EZ0C 3TEXA 3V0VB 2GJ6E 3QI9D 5I15H 5I8KL 2XWRA 2WKOA 4MXVF 4HGKC 4PV9A 1BQUA 4PBXA 4E41B 3PHAA 3QJUB 1INEH 3AREC 1VRSA 3GD1C 4GP5B 3BPOC 2PXYA 2V5SA 3RWHB 3TYGH 2VSKB 3P9MB 3I9IA 2HUHA 1WAEA 15C8L 1J05A 1ZGLM 3D0VB 4DP5X 1EAQA 5LAPA 2NZ9C 3HFFA 3S3CB 3LRLA 2JVUA 3U48A 2FJGB 5ENWB 2EE6A 4IU2B 2WZPD 1JV5A 4YSQA 4HWEL 2ZOOA 4PRID 5F7EH 4HLZG 2B39A 3MRRA 4J3OG 3MRIB 4PJIA 5IHWA 4XX1E 5DXWA 3VTTA 4BXVA 4F9LA 3FNKA 1YYCA 2RB8A 4EI5A 4ES9A 3QNFA 3F85A 3GZQA 4WEBL 3CFMA 3NT0A 2V9RA 1E0OB 1PZBA 4Z77A 4R0LC 2X6CA 1QRNA 4AQ1C 4ZDHB 2R1WA 1VFAB 5EU6D 1VCAA 3T5WA 4LSRH 1GYUA 4F2MB 2GITA 1ITBB 1BBDL 1FL6A 3OMZA 2Y6SD 3QUKB 5INCB 1MHEA 2E9IA 1YPZF 3DTUB 3Q2CA 2FBOJ 4NFCA 4WRLA 2BNUB 4WJ5B 2VC2L 4TVPD 2APWA 4BHUA 2JB5L 4YSAA 3TVMC 1J5CA 3JV4A 2KH2B 3QJFB 4NQEE 4X2UA 5KYNA 5IMKA 3P4OB 1DSFH 4XB3A 1S8DA 3CV5A 4TKWA 1ZT4A 1J1PH 1U8MB 3WGVB 3LJ3A 4ZS7H 3KGRA 3FB7A 4JHAH 4XH2B 5AVRB 3WY2A 3CDFA 3IN0A 2NW3A 1EXGA 2OXHA 3U79A 5BZZA 4J3VA 4UIMA 4G1EA 1UG9A 1OT2A 4U05A 2BOCB 2BNUA 5FYLL 1HK6A 2X9XA 1D6VH 4E42B 5CJ5A 1OPGH 4WTZG 1CUOA 3GMNB 3V5KA 2VW7A 5EC2A 5IB2A 1SVBA 2FE0A 3VVWA 4JG9A 3KNBA 1T7WA 3N3EA 3N9GH 4Z7QB 3IVKB 4GUQA 3FKUS 3BIKB 1JMZA 4HUUB 2J6EA 1WS7A 1NAML 1OGTA 1SN5A 3RWIA 3L9EA 3VI4A 2JH2A 4R8WL 4M02A 1JCKA 3WL9B 1HXYA 2FH6A 5D4IA 3HBZA 1WA2X 3TN0D 3GKWL 1V7MH 1XGZA 3N0AA 4PJHA 3UBXB 1J1PL 3MMEA 3DX9B 4JY5H 4GQZA 2X4RA 5L2JB 3ZZSA 3CZKA 2CIKA 3MJWA 5K1NA 5DMGC 2OL3L 3MROA 4I48B 1J10A 2GABA 1DQTA 2ZWSA 4OCYL 1GPOH 1Z66A 1ZCRA 3GIZL 3CDCA 1I1FA 3DBSA 4UTBH 2A6KB 4PJ9A 1BIHA 1SXCA 5AQ0A 5AB1A 1RHHA 2IH3A 4PJFF 5BO1L 1ET5A 1A6UL 2GEQA 1P1ZB 4V11A 1II4E 1N8OE 4OGAD 4OBSA 3TU6A 3SGKC 3EYFA 2KLSA 4Q6KA 5JIDA 1T2XA 4D3CL 5BUAA 1VSCA 1FVDA 1YYLL 2CGRH 5DLMH 4LASL 5AOLA 2ZZUT 4A6YH 1N5YL 2VDMB 1I4FB 1FL6B 5E5MA 4QJ4B 3LS5H 3MRJB 4RWYL 4XNMB 1D2PA 1KC5L 3QQ4B 2GT9A 3LQZB 3VG0H 2OYLA 2XVGA 5FWRA 4DZ8A 2BIIA 1HL5A 2A9NL 4M5ZL 4YE4L 5B1BB 2Z91A 4I0KA 3VFNB 5KSBE 3EO1B 4ZK8A 4JS7A 1BX2A 3FTXA 4UAHA 1OWWA 3P0YH 4LDLB 4ALAL 5L4MA 4CBPA 4PJIB 1KG0A 3BH4A 1QNIA 4NN7B 1I7RB 5D1QE 2Z9TA 1MFAL 3ZTEA 4CVZB 3WTTA 4Y16D 5AOIA 1DBML 4PJDA 1E7UA 3IWUA 1U8NB 2MCG1 3MKGA 5AVTB 3WUWB 3NA9L 5ECJE 3W5MA 3AROA 1K4CA 2LV4A 2Q2LA 4MJ4A 3KPRD 1SXZA 1UJ3B 5H94B 3UG5A 1AACA 4HVBA 2ZOUA 3NJGA 1NDMA 4OM0H 1YEKL 1WFUA 2CUAA 3S5YA 2O5ZH 5LWYH 2F08A 1FQ9C 3JWOH 2WXNA 3KVDD 1YEDA 1CE6A 2UXTA 4KRPD 5GGRA 4WU7A 1P7QA 4ADGA 2CHXA 4ODVL 3IDJA 4U6TA 4IIQC 4U1MA 5CZRA 2HRGA 2MNWA 3O6LH 1TJMA 5C0BB 3WIIH 1C5DA 2IWFA 3VG0L 5DUBB 1JXJA 3V0VA 4NWTL 5IWLA 1I3RB 1K9TA 3ZYJA 32C2B 1YMME 1QI5A 2BIOA 3TTYA 5KYXB 1NH6A 1FO0A 5LGHH 1IC0A 2FWUA 4X0KB 3HR6A 3QJQB 3VA6A 1NUDA 3EXJA 4FZEL 3BD3A 4KKLC 2Q8BL 1NFDF 1J9QA 4PPTA 5F96L 1OAJA 2VLRE 2OYKA 4FXKC 2P8MA 3FULA 3W3BA 5FYJU 5GGSB 3FTGA 3M1CA 1EXHA 3UGEA 2C5DC 3EFOA 1H8SA 3ZE0E 2Y5QA 4QF1B 1JL8A 1TNNA 4OLWL 2P5PA 4GG8B 1KELH 2QT6A 5HGDA 3W2DH 3DSNB 3LH2L 4K7FB 3CFCH 5JUEH 3V6OC 2AXGB 2I9TA 4F8TA 2FHFA 1KIRA 4JPSA 3V4UH 3WY1A 5IM7A 1P5VB 1R3IL 2YXWA 5EIQA 3RWFA 5JW3L 3QJTB 3IWVA 1NANH 3V7AG 4UT9A 5I1CL 5SWZD 1E65A 5T1KD 1WZ1H 2Q10A 2J1KA 1F8TH 3C8KB 1Z7JA 1HEJC 2WUCL 4P23A 3GUTB 4PGZA 4KNSA 1BWMA 4BWWA 4KO6A 3HG1B 2EDXA 4N9GB 4HBQA 4HHGA 3N5AA 3JT2A 4X8JB 2G4GA 2AEQH 3QXWA 5EOCJ 3MNWB 2EVHA 3OGOE 3KS0H 2XV3A 2DI9A 4X42A 2IPKB 3AWFA 2J6EL 4PRPD 4MZ3A 4WO0A 1A4CA 2OX5B 4JJ5A 4BZ1L 1DL7L 1DUYB 2W5PA 4P2OB 3F01A 1GY2A 4HS3B 1QSVA 3FN0H 1WT5A 5D2LA 3T6ZA 2W59A 3KHOA 1XB6A 3ESOA 3D4ZA 5C07A 1WZAA 3CFCL 4P99A 4LCWB 2X2JA 5IHLB 1O5DT 5KVEH 3CDYA 4U1NA 3DO7A 3D3VA 4L8DB 1AGCA 2CWRA 1WEJH 4PJEE 4AKQA 3MBXH 2ZCHH 1TTRA 3TJPA 2LT9A 4TPRL 4D9QD 4Q0XH 2IGFL 3RTQC 3RYMA 5J89A 1EEYA 4WW1B 2IAMD 1O9ZA 1CK0H 3G6JA 4FJYA 4F8NA 2PYED 2ITDA 3TURA 1JZ3A 1IGMH 3ZSSA 2CLZB 1N6QH 1OTUC 3VFRA 12E8L 2EIJB 1I8UA 1HKLH 4GXUN 4BH7B 3K2MC 3CNKA 3S3PA 2VB5A 3BPOB 1U0QA 2G3NA 3FCSB 1HH9A 1UB6A 2UZIH 3GBLA 4TQHA 4XP5H 3S48A 3MYZA 3MR9B 2NY1B 2R7EA 3UTOA 1DL7H 4AQEA 5AVYB 1AO7B 4V1DD 2FR4A 1P5VA 4P4KA 2DRUA 3ZKXB 3NTCH 4GJTB 2AXGA 1PY0A 4DOHE 5MENA 5E8PB 5MENE 5HGDB 2E7HA 4B5ZA 4Y4HA 5E56A 4JGUA 1MY7A 1BEYH 2NXYC 3ZE2E 3MQIA 5I1KH 4KMQA 4G11A 3IM1A 3MV01 2ZG2A 5I0XA 4G7YL 3AUVA 4QWWC 5C97A 5E8DL 1M3JA 3DGGA 4XN8A 4EVNB 5FGSA 2XWTB 4FL4C 2O61B 3FF7A 1BJMA 3O0RH 1L7TL 5BZDB 1JDCA 1FFOA 3NP4A 3CN4A 3CHOA 3U4EB 2BP0A 4NIKB 2AQRA 3QRBA 3QUZB 3VFTB 4IDLA 5EIIB 4JJ5B 5KYXA 4FCAA 1XCXA 3G5YA 3P9LA 3GZOA 3KYMB 3KEDA 5HHME 1AHKA 2J8UE 3BPNC 5BS0E 1OAXL 4XP4H 3FQTA 4WQOA 3L3GA 2RAMA 4OGXL 1E8XA 3RNKB 5IREA 2MNJB 3QXVA 1XGRA 1XL4A 2DYPD 1S9XA 3ZQ9A 4C4UA 1GA2A 2JJTA 4N3UA 4WHTB 1ZV5A 1BOGA 1W16A 2XZQL 3MJGX 5GGVL 3WXWH 3IETB 1DCEA 4FKEA 1B0GA 1HILA 2RHEA 5KZCB 1ZHKA 5E8DH 3RWGB 4HG4K 5FM5O 3BE1H 2OSXA 2A6IA 2CE6A 2MQ3A 3GMOA 2FGWL 4OZGB 2MCMA 3WKML 1CTOA 3UAAA 4HWBA 3ULVE 4JREC 3FFDA 5CEYA 3JUZA 1AY1L 3BKJH 5TQ2H 4OVUA 4Y5YA 4J27A 4GS7C 2BNQE 4YDIL 4GG6B 4NUPA 1N59A 1TPXB 1VB9A 2JQZA 5CJ8A 5DRWA 1CBVH 4XN1A 3M1BA 5D6DC 2FL5B 1CF1A 5TQ0L 3AQZA 5EEYA 5D93C 2GYSA 3WNLA 1ETJA 4HIXL 5EO0B 2XQYK 1U2CA 4ZW8A 3B9KC 2RA1A 4NQVA 3R0MA 5JYMA 3CXFA 3BFOA 4JR9L 4QOKA 3GTTA 3L5WB 3NIFF 2WXMA 5EZIL 1MI5B 2TRHA 4FTVA 4ABUA 5EWIL 3WHE0 1IFGA 1FI8C 2EICA 3EO0B 2VSMB 1WBXB 3NCMA 4JO3L 4WJG3 3S4SG 1AP2A 1MFCH 1PEZA 3E2HC 4GRLA 4RBPH 4E9SA 3N43F 1FC1A 3ETBF 5MEQB 3B43A 4ZMNA 2BW4A 3FO9A 4XOCA 3HI5L 3NZ8B 4KZCA 1YEDB 3QSKB 5FM8A 4MD0A 1JV2A 3UAJA 2Q2EB 1ERNA 3II1A 3CXDL 1IL1B 4XPFH 2BZ7A 4S1DD 5JDSA 4GKSA 5I19H 3QUZD 2P8LB 2YGVA 2ZYSA 5DZOA 3WS3A 1QD0A 5LDSA 2J5WA 4TVSa 1BFOA 3BN3B 2YA2A 2APSA 3EYOB 1MCWW 1EMTL 3DGDA 5TFSL 2ZXBA 5I8CB 4R7DB 5DUJA 1EDYA 3DX6B 1AQDB 4PLKD 5CP7B 2AJYH 2WTRB 4FQJH 5KVEE 3L81A 1ANUA 4LSVH 1U42A 3DHPA 4NAMA 1U2YA 3MAWA 1VFUA 4CVZA 1NL0H 3FB6A 3FO1B 4HJGA 3RIFF 4CMMA 3MO1A 1N10A 2WJ7A 2AVFA 2JNZA 2KQNA 4PJAA 3DXAB 4S1QL 4OH2A 5K59F 4Z7AA 4PGCB 2FT7A 4AV5A 5D72H 1A22B 1J48A 1Q0EA 4HWNA 1VZGA 2QV4A 5EU5A 1G6RA 3AB0B 1P7BA 5F7MC 5HYJE 4KKRA 2AHIA 4XVUC 4PRIE 1AKJA 4P46C 1IBGL 3IJ9A 4OZHE 2W88A 5C8JA 2A9CA 3HZKB 4DGIH 2GK0A 2GTWB 3RVUD 3SJVD 5FHAL 3R19A 1THCA 4ODTL 1AIZA 1OHQA 2C3HA 1MHHB 4R8WH 1MH5B 2C1OA 1AXTL 3GZKA 1MKFA 5FKAB 4HV8A 1N19A 4ZUSB 3QAZB 2R8SH 3CXDH 1LYQA 4MJID 2QTEA 1LLAA 2IH3B 5EZLB 4ODUB 1XF5B 1UM4H 1EMTH 5IMKB 3NG5A 4WFFE 3ZOAA 2RR3A 1RMFL 2WO3B 1CB4A 4WEUD 4XPAH 4HXBL 2PPEA 3L2NA 3WLBB 4PB9L 5CINH 3P11H 3L2MA 1DLFL 3MRGA 5JA8B 5J1AA 2YXVA 2XA8L 4XB8A 3D48R 4L05A 1SFDA 5BPPA 4I9WE 2ZPKL 1BMGA 4HC1A 4GMSL 2VM3A 1JE6A 1BLIA 1FIGL 1FVEB 1N2RA 4KHXH 5DK2A 5B38G 4R96B 4OJDH 4OZ4B 4IBYA 3AITA 1LWHA 5IUSA 4XN9A 3RWIB 1KGXA 3QG7L 4X9YA 3RZWA 2G3XA 2ZKMX 4AH2B 2QTVA 1MLBB 3RGVB 2FVNA 1HT6A 1QI4A 1W72A 3UIYA 5J1SC 3MNVA 5SX4I 3V5HB 2PW1B 2N4IA 4OGQC 5KBLA 2WVSA 3PDOB 1KXVA 1WK0A 5EU7E 4B7IA 2CO6A 1IGJA 5F7DA 2AK4D 4WUKL 4XCCL 2JI1A 2P80A 2BX5A 2KERA 3FU9A 3P9MA 2CKBH 3LKRB 3RWHA 3A6OA 4KMLB 3ZTJG 3NFPA 4GSDL 1ZHLB 1YY8A 2F18A 3O11A 4X98A 1DANT 3MUHL 4G8IA 3L3DA 4R7VA 1A4JB 1PLGL 5AW3B 3H9HA 2R4RL 4FXKA 2E6JA 3ML9A 2BHYA 4M61A 3MUZ1 4ZPVB 4NM8L 2WLLA 5GPRA 3DYMA 3U30C 3UP1A 4CGUB 1KT2A 5C09B 1NC4D 1T1ZB 4P2OC 5FO9B 1WEJL 5IVNA 4A7UA 4OIFA 2VERA 4DN3H 3OXSB 3PAZA 4G6JL 1KEGH 2IH9A 3CXHK 3VFOA 1CK0L 1B4LA 2J2ZA 4WNJA 1FE8L 3BVNB 3GLAA 1JK9A 3OKDA 2DJMA 4WFEE 2WKOF 3IEAA 5HI3D 3BP5A 5CEZL 3D4GA 5IJVA 1XCQB 2QPUA 1VGKB 3X14B 1JGUL 2A4ZA 2G5BA 3EJJX 3TV8A 3CDZA 3D52A 1AJ7H 5GS1C 1E2VA 3CU7A 1Z9SB 1I8IA 3KXFD 1GCYA 5E6UB 3IMTA 5D2NB 1WFMA 5C0IB 4M6NL 1TVBB 2NYKA 3NTCL 3TJHC 1N0XL 3CAFA 3KXFA 1UENA 2K45A 3GM0A 3HUJF 4OUUB 5IJCC 5JUEL 1SMDA 1MFDH 1UA3A 3Q6GH 5E2UH 4L8CB 4PBVC 3B1UA 3FF8A 3U9UA 1F2QA 3LXCA 5CMAB 1QLEL 2P5WA 4ZUUB 2BSED 1GGBL 4W9HC 3UPAA 5AW9B 5HVFB 4NO3A 1AE6H 4X83A 2WYZA 1F8TL 2WLIB 4QY8B 2CA4A 4JKNA 4P9MH 5J0BA 5JA9A 2FX8H 3D39E 1A1MA 1AGDA 3T8XA 2F53A 3GSOB 3VG9C 3WY4A 4B0MM 4F37F 2P1YA 1IMHC 2M1KA 1RZ7L 5E00B 3RDTD 1YEJH 2TSBA 3U9PH 1NM4A 4G5ZL 2X6VA 2E7LA 4JPWH 1O9VA 4Q4EA 2XZAL 4P2QA 5DUML 3AAZB 3F6JA 4I1RA 2DW5A 3UTSD 3FRPG 1T1ZA 3O9WC 2NUPB 4AC2A 3IGAB 4S0TD 5D70L 3AUWB 4EZMA 2FJFA 2WLLB 3WENA 4Y1SA 1DN0B 2CIIA 4WW2C 5KWYC 4KKPA 2QZ5A 3AG1B 3WIIL 3HS9A 4XCEA 2W81C 2GK2A 2XZQH 3I6KB 4AYID 5ACZA 4DO6A 2EH8H 2MH4A 3QWRA 4CVWA 5H2BA 2ILLA 3T2NH 4JDVB 1CLVA 4G6ML 4WWKA 1EEQA 1R75A 1QFWL 3L54A 4FQXA 2IIJA 2E3VA 3AXLA 4NHCL 3IS0X 1IGYA 4XPBH 3S96B 4BQ6A 3KLHD 1K5NA 3CMOH 4XB7A 2OSLB 4M6OH 2NYZA 1A6WH 2PW2A 3LNHA 4NKQB 4TLSA 1YY9D 2ESVE 3QPXH 4ZTPH 2HVKB 2GUOA 2Y7MA 2NNAB 4PP2A 5E1IA 4Y4KC 4XBMA 4XI5C 3CFIC 1U58B 3SY0A 4C4KO 4IBLT 3DPDA 1AQ8A 2Y6SC 1FNEB 2UX7A 7FABL 5BZXA 1YMHA 2EIEA 1K4DB 1JPFB 3PWNA 4AGLA 3V4UL 4B96A 1OD9A 2CBOA 4R0LB 1FVEA 1N2RB 3CSGA 3KPOA 5EOTB 3LQAC 1YO4A 4ZNEE 1CE1H 2Q8AH 1ML0A 1SF5A 2GBUA 3QIBD 2NY1C 3MRNB 4WTQA 1Z9PA 3AACA 1EH9A 2D7QA 1HINH 2AK4E 2EILB 4TTDC 4YC2B 1ZOXA 5JZ7D 5PCYA 3UYRH 2R9HD 3NJVA 1MIEH 5LXVA 2YBRA 2J55A 3HCVB 5ERWB 3WD5L 2EDTA 1MCHA 2XZCL 1SDYA 3NCBB 3NUKA 5DSCA 5DEFB 4DTGH 3ARZA 4FQLL 5C0CB 3V9EA 2PETA 3LEXB 3QFGA 2QSVA 4G6AD 4JRXA 3D9AH 2VLLA 4LKXA 4LPTA 4X98B 2GY7B 3QJRB 1K6QH 1B4TA 4HV8B 2OSWA 4QDGA 3SDXE 4KDVA 4FFZA 4PH8A 1MHHA 1TO5A 4OF3A 5KSAC 1ESOA 1Q9KB 2K78A 3NPSC 4G71B 4TQ8A 3QIBB 4PUBH 4XMLH 3FQUA 2Q76A 1QLRB 2JTYA 5LGYA 2V5RA 1EVTC 4KNUA 4Z7VF 4R7XA 2CUIA 1RUQL 3TT3L 3X11B 4ODWB 3S34L 2OJ1A 5EMYA 1FV1A 2ARWA 4HEME 3BPNB 2Q8AL 3OJVC 1IKFL 1FPTH 3SDCB 5C0GA 5TDOB 1WC7B 3D18B 3JZ7A 1INEL 5CUSL 5E94B 1J5OL 1GS6X 2ADIB 3A0OA 3O8XD 3I75B 4XP9L 3VD0A 2DLFH 4PJXF 4R7NB 1C16A 1MQKL 4KQ3H 2X0WA 1FLRH 4HKJB 4R96A 1AQDA 1QNZL 4XMVA 4A66A 1YZZA 1FFPB 1D5RA 4LOUC 4HOZA 4TSBL 2I9LA 3BFQG 3LKNA 4JK0D 4LAJH 2IMMA 2QVTA 5TQ0H 3SGEH 2WN2A 4N28A 3P0YL 1AZCA 5D6DA 3VAEA 4ALAH 4LCCA 2R51A 3STLA 2ICWJ 3HB3D 3PGFH 4H88L 4HX1B 4IJ3B 3QHFL 4HXBH 3FCTB 4XWGL 1S7QA 5C07E 1NGYB 2UY7A 3P4MB 2EDLA 1G1KA 2HYMA 3D85D 1FGNL 1S7SB 1R33A 1FGVH 2AI0L 1BEYL 3J8F7 4MQSB 4V1DB 2X40A 3WFDH 4JW3A 3WJJA 1A6TA 3QJVB 3DX4A 5FV1L 3NRQA 2AITA 4XI5D 4P2RD 2MJWA 3LY6A 4UM9A 1KULA 2B1AH 2XICA 3BSZA 4GKOA 2YWZA 4JE4B 3IFLL 2X88A 4KITB 1LO0H 3DJTA 3FHEA 4K5MA 3BO8B 4XPGL 4QRRE 1WIOA 3DV4B 3K46A 4WNQA 1TQWA 5I5RA 1OY3B 2GTZB 1HXMA 1VFBA 2K7PA 4XC3L 2BVPB 3FUJA 1NLBH 3GSNL 5CN1A 1GIGL 1KB9K 1SLXA 3ILPA 3SKUD 4XMWA 4F7PA 2YLHA 3DXAE 1XXFC 2PP9A 4PJAB 1EHLL 1BQHB 1QFHA 3FU5A 4CDHA