3Q1EA

Crystal structure of y116t/i16a double mutant of 5-hydroxyisourate hydrolase in complex with t4
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
SPLSTHVLNAAQGVPGANMTIVLHRLDPVSSAWNILTTGITNDDGRCPGLITKENFIAGVYKMRFETGKYWDALGETCFYPYVEIVFTITNTSQHYHVPLLLSRFSYSTTRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-hydroxyisourate hydrolase
publication title Probing the Evolution of Hydroxyisourate Hydrolase into Transthyretin through Active-Site Redesign
doi rcsb
source organism Danio rerio
molecule tags Hydrolase
total genus 26
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3q1eA00
4WNJA 1GKEA 1TTBA 1IIKA 1DVTA 4HIQA 3IMRA 4ABVA 1DVXA 1E5AA 2H0JA 3KGSA 2B9AA 3D2TA 5AYTA 2G4EA 3SSGA 5IHHA 3NG5A 4Y9FA 2QGDA 3GRBA 1SN2A 3DK0A 3KGUA 3ESNA 5AKTA 2G5UA 4WNSA 4TLUA 3M1OA 4AC2A 3FC8A 1QWHA 3CN2A 2B15A 5L4FA 3CFQA 1TZ8A 3GRGA 2QPFA 4PM1A 3U2JA 4PWFA 5FO2A 3NEOA 4PVLA 4DEWA 5AKSA 4Y9EA 5JIQA 1THCA 1F41A 2F8IA 2FLMA 3A4FA 3CFMA 2B14A 3NESA 4HJSA 4IKIA 2TRHA 3IMVA 4TQPA 4Y9GA 5HJGA 3GPSA 3FCBA 1BZEA 1ETB1 3GS4A 4IKJA 4TNGA 1ZD6A 1TYRA 3IWVA 4D7BA 4TLTA 4IKKA 3P3UA 4TL4A 3I9AA 1TFPA 4DERA 3P3SA 1E3FA 2H0FA 4QRFA 3HJ0A 5FW7A 3IMWA 4TQ8A 2GABA 4Y9BA 1IIIA 3CN3A 5CLXA 4FI8A 5JIMA 5JIDA 5DWPA 3GS0A 1DVZA 4TQIA 2IGLA 1U21A 3TCTA 5EZPA 3IMUA 3NEXA 1SN5A 1DVYA 2TRYA 5CN3A 1TLMA 5FW6A 3U2IA 4MRBA 4ABWA 1Z7JA 4PMEA 4HJUA 3P3RA 2G4GA 2G3XA 1TTCA 2ROXA 1TT6A 2WQAA 3A4EA 3I9PA 4TLSA 5AL8A 3CN1A 5EN3A 4I85A 4PWJA 1Y1DA 1SN0A 3DJTA 4FI7A 4N86A 1OO2A 1ICTA 4ACTA 5FW8A 1TTAA 4DEUA 4PVMA 3BT0A 1X7TA 1BZDA 3GS7A 4HISA 4Y9CA 5CR1A 4DESA 5E23A 3CBRA 4TLKA 3DGDA 2QELA 3ESPA 4L1SA 1BM7A 1ZCRA 4WO0A 2B16A 5L4JA 4DETA 1RLBA 1IE4A 4ABQA 3KGTA 3OZLA 4PWKA 5AKVA 1FH2A 1KGIA 3I9IA 3D7PA 4PMFA 4FI6A 5CNHA 4KY2A 2QGBA 4N87A 3DJRA 1TSHA 4IK6A 5K1NA 2H1XA 3CXFA 3B56A 3IWUA 2G9KA 4QYAA 2ROYA 4YDNA 2PABA 3CFNA 3DK2A 4ANKA 5E4OA 3DJSA 2GPZA 3BSZA 2FBRA 1DVQA 2QGEA 3TFBA 5DEJA 4PWEA 1ETA1 4YDMA 5K1JA 2G2NA 5BOJA 4QXVA 4AC4A 1IJNA 2H0EA 2H4EA 2NOYA 2F7IA 3ESOA 3DIDA 3GLZA 3OZKA 4Q14A 3IMSA 4L1TA 5CLZA 3IMTA 3A4DA 4TNEA 4ABUA 1THAA 4N85A 5CM1A 1DVUA 2G2PA 4PVNA 4PWGA 2B77A 1SOKA 4PWIA 5E4AA 4IK7A 1FHNA 1GKOA 5TTRA 3DO4A 4TKWA 1E4HA 3NEEA 1G1OA 5L4IA 1SOQA 3CFTA 4MRCA 1BMZA 3P3TA 5AL0A 1X7SA 3W3BA 1BZ8A 4TNFA 5A6IA 3DJZA 3IPBA 3IPEA 3Q1EA 5L4MA 1QABA 1TTRA 3CN0A 1DVSA 4HJTA 4IIZA 1KGJA 2QGCA 3CN4A 4I89A 4I87A 5CLYA 4IKLA 2H6UA 4TM9A 1F86A 4MASA 3QVAA 2G3ZA 4PWHA 4TQHA 4TL5A
chains in the Genus database with same CATH superfamily
3NBNA 1OM9A 2E5EA 3UZEC 5F7UA 3P0YH 2V17L 4K5LA 5IG7B 3MV01 3TNNB 1OGAA 1YY9C 3D6GA 4ISVB 3LIZL 3UZQB 3BZ5A 4FULA 4WWPA 4Y9FA 4PRNA 3RGVB 5C6PB 3TCLB 4BSWA 2P49B 4O02B 5I73B 4XMVA 3K81A 4QRRA 3VFPB 1GSKA 4TLUA 1QFUL 3SDAC 2NY5C 3HNSL 4QIRA 3CSGA 4TVPE 5D72L 3MX0A 4QHLA 2G5BA 3EYQC 4JDVB 3AS0A 5CIPA 4PVLA 4KRPB 5EU5B 4AUUA 3C2AL 5I19L 2AEOA 3T8XB 3EH2A 2OMNA 2AZUA 2A9AA 3OKKB 4K9EH 1CF8H 4FL4C 4LLQA 4RISH 5DEGB 1TJHH 1WA0X 1X5MA 4ZUWA 4NKOA 3QZPA 3S3SA 4FNUA 25C8H 5ANMB 1XGZA 5C0FA 2LE9A 3UG5A 4UIMB 1GC1H 1MI5E 4I2XE 5DUBB 5FDWB 3TJHD 4CW1B 1ZEAL 3FQUB 5T1JA 3VVWA 2AABH 2XN1A 3GHBH 2F8VA 4WU5A 4YO0A 3VWKA 4L8DB 1CD0A 4N9GA 4PJAB 3NFPB 1AGCA 2FX8H 2Y2WA 5DZNA 5I15H 2YD1A 4BXSV 1FRGH 3CXHK 4WEUD 3QUML 4R9HA 2I07A 5CCJA 4ZNCD 3D0AA 1QVOA 4RRPM 1JBJA 4NFDA 5CEZH 3NZ8B 4BZ2H 2E27L 4NSKA 1DJSA 1PFOA 1J9CT 1URZA 2PR4L 3D1MC 5I75C 5C0GA 1KGWA 3UX9B 2Y7NA 2XWEA 1LQBC 3NIFB 3N3EA 4FLRA 4KO9A 1MF2L 3N43F 2R0KH 4MA7L 4AZUA 4D0CA 1QR1B 4FTVD 2E4TA 2VNCA 3V5KB 2VZSA 1MFUA 2WP3O 5BV7B 4PSRA 5IQLA 3KW8A 4CMMA 2ZCHH 2X38A 3D0LA 4L0PB 3U6XA 3C6LB 2L0DA 1I8KA 2E0PA 5J9PB 4H40A 2WQXA 1TKWB 2V9QA 1L4IA 1A7OH 2J8HA 4PB0H 4LSTL 1S7QA 4RMUA 1IU1A 2R2BA 1S7TA 5D71L 5GGQH 1FBIL 2D8KA 3IRPX 2HPTA 4F5CA 1HEHC 5CEXB 1EHLL 4NCC2 3FQTB 3CC5A 1VF5C 2EYTA 1OF2A 3NJIA 1U33A 2YKLL 5E0FA 4ZFZB 4TQHA 4ZAKC 5I0ZA 2VLJB 5T1KB 3GSXB 4Z76A 4L4TE 1TJGL 3WTSA 1SMDA 1PU0A 2NQ3A 3LKQA 1F58H 1EO7A 4YBHA 4PJ7F 5K1VA 4WNSA 4U1JB 1R34A 1EAPB 4KK9C 3CLEL 1J0HA 2FX9H 2ZP9A 2DWTA 3EJJX 2CMRH 3JYBA 5MEOA 4ZODA 2DH3A 1A6WL 1I3RB 5FFLA 2FQGA 4XXCC 1AIFA 2F8IA 1LP9A 2AF2A 3FL7A 2P5WD 2XYBA 5E6YA 5B3NA 3OMAB 4G7VH 5FLUA 2HP4A 1GGBH 1PCSA 4J2XA 3MNDA 1MFEL 1CS6A 1LE9B 3BKCH 3CDFA 2WIIA 5FW7A 3T2PA 2W9EL 3SYCA 3BD3A 3BHBB 1FV1A 4HJ1A 2N0MA 4MCMA 1NIEA 3WFDH 4MNHA 3TCTA 2ERJB 2W07A 2BVQB 1AHMA 1G7HA 3R4RA 1SEQH 4J8QA 1K2DB 1ZHBB 3DDFA 3B7TA 2JKSA 6PCYA 4XCYA 2CJTA 1A14H 3MNZA 4Z23A 3ZE1F 2WCGA 5J6GA 1V10A 1SJEA 3I50H 1JP5A 1KY7A 1TF4A 4M48L 4ODSH 2PW2B 5HDWA 1VZHA 3F6LA 1JRHH 1JPST 2UV3A 3Q2NA 4NWUH 5GS0C 5I30H 1BEYL 1ZV2A 1ZT4B 1DUYA 3S3DB 5CJXA 4NHUA 3UMTA 3W11C 3T4YB 4EI6A 1ODUA 5MEQA 2EDYA 5F88B 4UDTA 2FX7L 2ED8A 4EN3C 5I17A 5LGHL 3II3A 5EEXA 4UILH 3L17A 1KTBA 4LSVL 3IDNB 4XNQA 4XC3H 5L4IA 2EDFA 5LGKA 4KMTH 4Q14A 3TTYA 2X6VA 1J18A 5C8JA 2P5WA 4WTQA 3JV5A 3S36X 3ET9F 4PJGB 4MQSB 1A22B 1X5KA 1KELL 4F92B 1RURL 4O9HL 3GB7A 3P2BA 4NUGH 4R2GB 4TKWA 2MCG1 3LSOB 3D05A 3MACH 1YN6B 2B08A 2I60L 2WWNA 3JWNH 2K9FB 1JGUL 4PLOB 3L1GA 3EJUA 4N2KA 4OCYH 4U7MA 5C0CE 3ZTJH 3RIAK 1JOIA 5IW3A 1MCNA 3FSVA 5F8QC 3KL5A 3L4WA 1HINL 2OZ4H 2YAEA 1MVYA 4MD4B 1OTSC 4V2BA 5CO1A 5ABDE 3OR6A 2AXFA 1EANA 2QGDA 4B0MM 3WU1A 4KJQC 4PB9L 2O26U 5HDOA 3SE9L 3OAZH 5C71A 1KYOK 1LEGB 3VXRB 2D73A 5GRZA 5DZOA 3EDJA 3NIGF 2IPTL 1BMWA 5D7IA 4ANWA 4HJGB 3TYGH 5L8JB 3P4LA 2D7QA 2EKJA 2JVUA 4IIQB 1JI2A 2IXQA 3IMVA 3GBML 5BUPA 3QEHA 5F8RC 1XR8B 3HHMA 3OTTA 5EIIG 3AMLA 4NC1E 2ZOOA 6FABH 3EJPA 4RFNB 1MJUH 1M05A 1JZDC 1ZT1A 3H56A 1T04B 4LARH 4ZUUB 3KZ8A 1ETZA 2EABA 5AVSB 1MW0A 4PGCA 1SHWA 4A55A 3T71A 1T6VN 1IGTA 4HYTB 1CLCA 4BM7A 5FUCC 4BK5A 2YWZA 3ZL4H 1PX4A 4MRBA 4S1SH 1E6OL 1CLZH 1HN1A 3Q44A 3BC9A 4X0NA 2VL5B 4G8AC 4JMNA 1D7FA 5FM5O 4U1SB 3LQMA 3VG0L 4JPWL 2Z3FA 5LAXB 4AEHH 1OF0A 1YYCA 4L4JA 1Q0EA 4E0RA 4JO2H 3WO4C 2QELA 1DBAH 1RIHL 4JFDB 3HZMB 3V4UL 4CBZA 4PS4L 1X4ZA 3CFIC 1ADQL 1Q0XL 5JDJA 5IHZA 3MLWL 4LOUC 4K94H 5A6MA 1W0VB 2Q8BL 2JJUA 2Y5TB 5BQ7B 3EO9H 5FYJD 4UQ2A 3CFNA 5IMOA 4HU8A 5DFWH 1MWAH 2PP9A 4LVHB 4HF5L 1PLBA 1RVFL 4UMGA 4BH8A 4JZOB 3PV6A 1I9JH 1P7KA 3UZEA 5HY9B 2VLMD 4TSAL 3MJ9L 5HDRA 1BW8A 1LNUB 3EYOA 3O3BB 4ZPVB 2FYVA 3RIAF 4BQ6A 4XXDB 3SDDA 2WANA 4J3OC 1H3GA 5FUZH 4PWIA 2F54B 4LVEA 1FZJA 4MYPA 5KTEL 1T5WB 2ETWA 3II2A 4Y5VC 3MMEB 1NCUA 3Q8EA 4OZIA 1Q9WA 1DQDH 3EGSB 4OQTH 3V6ZB 4R4FL 1VEOA 2DI7A 5JXEC 2QKIA 4Z18A 3ZIYA 5IVZA 1U3HB 1KT2B 5CJQH 5FA4A 1F6LL 2FL5A 1FNSL 2ZUWA 1L5GB 3QUXB 4GG6F 1N8ZA 1E30A 2ZUSA 2NZIA 4LFHG 3S88L 5EUKB 3A23A 2YAQA 3ZHLA 4M6NL 1GOGA 4NGHL 2Z34A 4NKDB 1P4LA 5IREA 1T7ZA 1V7ML 1UYWL 4AENB 3KW7A 4TYUA 4HCRH 4HS6A 1IGJB 1HWHB 2AQ1A 4ZAKD 3WHXB 4FHKA 5FS5A 2HFGH 4QOKD 1PNCA 1HILB 3H6JA 4FG6C 2IG2L 3QWOB 4UBDC 4EIBA 1QP1A 3BXNB 3TN0D 3TH3T 3UGXA 4HC1L 4KRNA 5AB1A 5HYSB 3LDBC 1IEBB 4TNVK 5D2NB 4KK9D 5M94B 1OOAA 3UAAA 4MJID 1EGJH 4XAWH 2ZQKA 2Q1EA 3H0TB 3TS8A 4LSSH 3U4BH 1BGXL 2XVBA 4EPSA 1INDH 1U21A 3ULVH 1NFAA 4MCZB 3QJHA 3E2HB 1CE1H 4XP5H 3MRKB 3BDYL 1PDKA 5DEFA 1C9SA 1KJ3H 3QCUH 3CH8A 4PY7A 5KANG 3ULUL 3JTSA 1IAKB 4PJ5A 4JGUA 3HS0A 2RCSH 1N0LB 4DEUA 4ZSOA 1RK0A 3IN0A 5B38A 4CADB 2PWEA 4J3VA 3MV7B 4HS8L 3QCTL 2CU9A 3TV3H 1NPNA 5IBUB 4KZDH 3IDUA 5IP4A 2VDNH 2V9RA 3DXAE 4RGNC 4TNWF 4HCGA 1PL3A 2YQ3A 1RJYB 4EJ1C 3JWDH 5D5MB 1DBJH 3HFML 3LRSA 4D3CL 2GPZA 4HLZG 1N0XH 5DHVA 3WFEL 3QO1A 4KHXH 3RAJL 2NYYC 1QLEB 2CLZA 2EKSA 2G2NA 3LRHA 4NQEE 3KPTA 4LCWE 2GK0A 1T0NB 4MVBD 2EDMA 5I0VA 3MRBB 4LCIL 4QOKA 2Q9OA 4JFQB 5ICYB 3GJEA 5C0IB 4KNUA 3TN0A 3W11D 3L9BA 4JHWH 4PJAF 4LSQH 3RDJA 1I1YB 4JFVA 5CS7A 1X9UA 4S1RL 2V9TA 3VFGL 3MRLA 1EHAA 4RZCB 4OZ4A 3P3YA 4HS3A 4LL1A 2C3WA 5KJRL 1EZSA 5F0JB 5INDB 1AHWA 2JCCF 2RIKA 1VACA 1GY2A 3GSNB 1Q9OA 4NUPA 5I8KH 2COVD 3H4HA 3KWWA 1NINA 4NN7C 2C9QA 2I69A 3MBXH 5DGRA 2WUBL 5GGRY 2V2TB 1GTNA 2NY4D 3NIDB 2J21A 1OHZA 2P44B 5F1SA 5K5YA 1TLKA 1S3KL 4HUCA 1KB5B 4LP5A 4TNVF 2G75B 3VQMA 3BD4A 5GS2H 2J5WA 1E5CA 4DP7X 1ZE3C 4QRBA 2WVUA 1S9VA 4FRWA 1S9YA 1H8NA 4HQQL 4LCVA 4ZTPL 5AVVB 1NGXB 1S46A 3GMOA 5ILTL 3GPSA 1BD2E 4P2OC 1BJ8A 4AEIH 5GISL 1WITA 2D7TL 4ZFOA 2HJFB 3QXAB 3UP6A 4JKPH 1FORL 3ZK0A 2CO7B 5CWSB 4ORGA 1BV8A 1UHVA 1HNFA 2GFBA 3JBG7 3KH3A 1YUKB 2FEEL 3M86A 4PP1C 1F00I 2XJKA 2VSDA 4YDKH 5T33H 4LO9A 4ODVH 1G9HA 2JB6A 5BW7A 1OK8A 2EIJB 2ICEB 2VDOH 3MUGA 1TZHB 3KHOA 3NTCL 3UADA 4K7FB 1CG9A 1JGVH 4NO0D 2IANE 2PYED 4HXAL 4I5BB 3VVVA 2IDTA 1WBYA 2NLJB 1JDDA 1XDTT 2XVKA 4D0DA 3P30H 3B7SA 2UWEA 4BFKA 6PAZA 4PD4K 2A74C 1YO4A 5IB2B 3BWUF 4HBCL 5EF0A 4EOWL 4XNZC 5FO7A 4BWUA 3S3BB 4GIPD 4YGAB 4XO9A 4QTFA 1JHTA 2NY1B 3JUZA 1E42A 1IC5L 4HGMA 3HZ3A 4JPVH 4JZJC 1G1CA 2CHNA 3B2MA 1G9MC 2W0LA 4IRJC 1OAQL 4GOSA 4BELD 1NFDB 1JRHI 1HQ4B 4P5TC 5D70H 4GQQA 4UOW0 4DKAA 4EIZC 3BH8B 3FTWA 3X2QB 1W15A 3F84A 4PI0A 2DL9A 4XOAA 1FO0H 5HHNA 5K1JA 3TO2B 5CBEB 3T0EE 5CU9A 1GCFA 3TFKC 1BVZA 2UY7A 3DIDA 4URKA 3S7GA 4PPTA 3WNOA 4A7QA 2WMPA 2X2IA 4X9BA 2YC1B 5BUGA 1R3IH 5TFSL 1AGFA 4KQ3H 1BG9A 2HMIC 4AYDC 3U83A 4KHTH 2A1WL 4ZX4A 2DQHH 3GEWB 1DVFB 3QRFM 4CSPA 3DTDA 2A73B 1ZV9A 2WUCH 4GFTB 3WFHB 1R1CA 1ED3B 2B4CH 2YUXA 3GQFA 3QW9A 5AOIA 1IARB 2OR7A 3V4PA 3L5XL 5EFIB 3BAEH 2R2HB 4NO0A 4C58B 1MG2C 2PYEA 3KD4A 4NQUA 3V6OC 5I6LA 4M5TA 2F15A 2QMKA 4S0TD 1O9WA 4PGEB 3ZO9A 2H8PB 1LDSA 4Y4KB 1IV8A 5FV2A 4L5FE 1CL7I 4N90E 3VYOA 1VERA 4IOSD 1DQQA 1W0WB 4ZO6A 4B9ZA 5JXED 4DQOL 3R06A 5LQBL 4X5PA 3AGVA 1RHHA 5GHWH 3LKRA 4NQDB 2QR0A 4KJWC 3GS4A 4ERSH 5EULV 3AJ7A 5GS3A 4ZYKA 5AUMB 4AYGA 2D2CC 4DGVL 4PJGF 2P7TB 2X4UB 2DI9A 1YNKH 1CLOH 2NY2C 3RX7A 3FCGA 3ZTNL 3O8XB 4PJ7E 4XNMB 1S5HA 2IQ9H 1IUZA 1QHQA 1WHPA 2DRUA 2M8XA 3CTTA 1O7VA 1FAIL 1USZA 5D4QA 2MNWA 1U6AH 3LHPL 3N6YA 3KXFE 2WQAA 3DV6A 4FG6D 4UBDD 3LZFL 2CR3A 4ZX6A 4XCFL 4HWBH 2X2YA 4PR5A 3CSFA 2J4WL 3BH9A 1J0JA 4HEMA 3CBRA 5I9QB 1WIPA 4GQZA 2ZP0T 5FKPA 4PRPB 1BOGA 1F02I 5E2JA 3P9LA 1I1FA 5CHNA 1GHFH 2A99A 1OB1B 1TO4A 3TBWB 4Z7WE 2IGFL 1OWRM 1WGVA 2C3VB 3PHQA 5DUJA 3DJRA 1OPOA 2XXMB 1OZUA 3MKGA 4KO5A 3IMBA 1NBQA 2M1KA 2FGZA 4Y5VA 4AM0A 4FQ2H 5K59E 4ZXBC 4IOSA 4R96B 3K71A 3BPLB 1YJDH 3D39E 1MHEA 3PNWA 5JXEA 3BEWB 1YNLL 2B7DT 4JRLA 4W6WB 4Z7UA 2MMXA 3LNFA 2ZSVB 1JN6A 2XPZA 3FT3A 2JLLA 2WO3B 4JN1L 2X7LA 4MD0B 4YSAA 3L16A 4RGND 2W60B 1NWOA 2G60H 2QBWA 4EDWL 4JFXB 4FNSA 4JCWA 4EO5A 4E5XB 4EIGB 1UB5A 2L7JA 5JOEA 3C60B 2WQSA 4MA8L 4NQXA 3VH8A 3DJ9A 3ECQA 3Q1SL 5DVMA 5BJTA 1HCZA 4XVUC 1L9PA 3BUIA 4NJ9L 4TM9A 4MWFA 5C7ZA 1VFBA 1X5XA 2XT1B 4ZW3A 2BHUA 2W8CA 3VFTB 2BVPA 1OAXL 4PH8A 4JHBA 5HJ3B 4EQ3A 2UXTA 2Y0SA 1K5NA 5T5FL 5JYMA 1IBHA 2QADB 4K07A 4WUKL 4NI3A 3US0A 1QSEE 3DSNB 3ELAT 3FOLA 3IDGA 1H15A 1LTXA 2K7QA 1A66A 2L04A 3EGDB 4Q9RH 3IDJA 4I0KA 2CXGA 1ZDQA 1Y7VA 3KPQB 1DUZB 5FYKH 3SDCD 1GJUA 3FU7B 2DLGA 3ECWA 5DHYA 4IU3B 2OBGA 3RY4A 4HZ1A 4R5TA 3SQRA 4ZD3H 1BFOA 1ZGLA 5EEWA 4HKBA 1UZGA 2Z8RA 5DMIH 5AZ2L 1E4JA 3TBYA 4F8PA 1OANA 1LEIA 3TJEH 2YJLA 4ODWB 2JK5B 5IFHH 1MCRA 5I1KH 1E9OB 4MXQC 3RVWD 1E4KC 1NAML 4NC2B 2NY5L 1NSNH 1U4FA 5C0BD 3TEWA 1C8QA 1G7JA 1FH5L 3DSFL 3T6QC 1SN5A 3NJKA 5SWSB 5CD5C 2D03H 5EN2A 2YAMA 1Z7JA 1CFVL 1NMBH 3P3RA 3P4MB 3ZO0A 4F2MA 3I9PA 1LXMA 4H1LB 4NOFA 1Q9LB 3L2LA 4EDXB 1JYWA 1AGDB 4XO8A 1KBGL 3MLYL 1BYOA 1KY6A 4ADIA 5FHAH 4PVMA 1R3KA 5C09B 3RZCC 4G6KH 3TNMA 3GI8L 5L7XL 5I8EA 1D7CA 1WE5A 5AW0B 5IEHB 4HUNB 4PQXA 3WIHH 5C7XH 2H3NA 3DYMA 1F1GA 1J10A 2ZUYA 2BERA 5FKAB 4F33A 2XUWA 2F2HA 4HGKC 1B4JH 2WBWB 5EZOL 4P5MB 1KCSL 2R4RL 2O5ZL 2YFNA 3ABLB 1U2HA 3PABB 1M3IA 4YC2B 5E99H 1B4RA 1U95A 5FYJL 5JOFB 2OMVB 3OZ9H 3FH7A 3FT2B 4Y16C 4YDZA 4MZIA 1FZMA 3SDCA 1XSJA 2VJXA 4JM0A 4HPHA 2EVJA 4LLVB 4X4YA 1THAA 4JDTL 1HKLL 3V5HA 1FG2B 2A6JB 4FFZH 3WUWG 3W5MA 4P23C 4GW5A 2BOBA 2VERA 4GMSL 4P5TD 5GJSL 5IMKA 4G8GD 4R5XA 3DOIA 3WSQH 4NQCB 5F9JB 3X17A 4H25A 5C0BA 1TVDA 2KMWA 5TE7H 2BSSB 5ALCL 3B43A 1W72H 5CJOL 3A6BH 3TFKD 5F44A 4HGWA 4IRZH 1AXIB 3O9WC 2Z4TA 3GLDA 2VDKB 4Y2OB 4X7SH 4HBQA 1M2VA 4JN2A 4M62L 2WN2A 3JSSA 4FXKC 3WMQA 1FL3B 4ODTH 2HMID 4WFHE 3POCA 4HD9A 1ZPLA 3CU1A 1F4YH 4JQIH 1DSWA 3CZKA 4JZNA 4QF1A 5CJ8A 2I9LA 3EOTL 1P0SE 4HHWA 4LGSB 2QPFA 5D5MF 3VA2C 4EXPX 4HWZA 4JREB 2ORBH 3A4FA 3CFMA 4OGXH 2OSWA 1LILA 4IMKA 3VGFA 2B3IA 2HKHH 2XLLA 4G83A 3DECA 4U3CA 3T09A 1UXSB 3BAXA 2EDDA 4K3JH 1ECZA 4LRNL 3HG1E 3ZKXB 4MJJA 1A4CA 4X0KB 4GG6E 1M42A 4ZMVA 1MCKA 3UTPE 3VI4B 4NBZB 4NERA 4TQEH 4C4UA 3LYRA 4YE4H 4L4VB 4FMVA 4JZJA 3VFRA 3C6EA 2BP5M 2VSKB 1MZZA 3I6KA 4F27A 3D4ZA 1TT6A 4L3EE 5D96B 3FO9A 1UKSA 4LHUD 4DOHB 2F68X 1IM3D 4P5TA 4X8CA 5FOBB 4N25A 1XF3A 5IM7B 3MLRL 3OKNA 3OAUL 4HIJB 3F6IA 2TSBA 1A7QH 4QMEA 2VMFA 2DI8A 3NYKA 2J25A 3C09B 3RTQB 1KLUA 1V7NH 2VZOA 4XRCB 1DQLH 3NIDF 3IJYB 2R8SH 4JM4L 1JPSH 4NZTL 5FA3B 5BUAA 3GMNB 4LDLB 1CXIA 1U8LB 4DKEL 2N7BA 1B2YA 1CYXA 2EEBA 1MIEL 4PGZA 1XF2A 1DE4B 1AXSA 1MCPH 3WHE0 1R75A 1NKGA 2Z64C 4FMKA 1Y6NR 4ZFOL 1I1AB 3QZOA 3WBDA 5DJ8B 4GUOA 1Q9KA 3V6OA 3HI1B 3TESA 2WLIB 2X4OB 1YYML 4L29B 2D7NA 3VTMA 3O6LL 5GS0L 1QRNB 3MI6A 2Z91A 3NACL 2WQRA 4YBLC 4G9FE 2QZ5A 1F13A 1JF1B 2EEDA 1RIUH 1D5MA 3APDA 4ZXBD 5TE6L 3V5DB 3PWUA 4NO3A 3U0PB 2ZF9A 5D1ZC 4WV1C 2F5BH 2BX5A 2JQAA 5F9OH 3PQYD 4Z78A 4HUVB 5I71C 4ZNEA 4I89A 1Q4NX 3AQZA 3ECVA 2JV6A 3AB0C 3BX7C 3QQ4B 3QZLA 1M56B 5JW4Q 4LHUA 1BP3B 1IM3A 3JWNC 3QEGL 4K3GA 5IHBA 2DM4A 4Z8FL 4OM0H 4PLNC 5IMLB 1B88A 3BN9C 4F7EA 4UUJA 1ZKAA 4PRHB 2WSDA 4A38A 1RZFL 4XVUD 1KJVA 3CNKA 4Z0XA 1KGCD 1NFDF 5DI8B 2V5RA 1I3VA 3FB5A 2Z7WA 4XN9A 5BS0D 4J3TA 3S3CB 1X4YA 4U0RB 4IBYA 5FECB 3DX7B 2VO8A 4JKMA 3FMGH 4FQLL 2JCCE 4WVRA 3EF7A 3AWFA 5I1EL 4JO4L 1FGVL 2WYZA 1A7PL 2XCMC 3PHOB 2WLYA 2H9GA 1HNGA 5ICZA 2IADA 1E5ZA 3MLZL 2YQ2A 2EDKA 1IC0A 1W2KT 3IFOB 3MROB 3E6FA 5AD0B 4CKQA 2YARA 1RZPA 3V4PL 2H7WA 4ZXBA 1ESOA 1Z1WA 4IOIB 4JE4B 3BZEA 3WS6C 4FZEH 1U8CA 2ZP8A 3HHSA 4D9RE 3RVUC 3VFMB 3Q8CA 4C56D 3PQYA 2CKBB 1N6VA 3BGFC 1SXBA 2OA9A 5D6CB 3GSRA 4M61B 2FZ3B 2ZOLA 3MLTB 2V4LA 5BRZE 5CD5D 2GTWA 3S35X 3U2SB 1KXQE 5DRZB 4MA1B 4P46B 2Y1AA 2GI7A 5CMAA 2CCWA 3S35L 2KLTA 4G8IB 5FYLE 5L2KD 4Q6KA 2XQBH 5PAZA 3CH1B 4FFVC 2VZ1A 2XZCH 4QY8B 2AJVH 3GMMA 3ILDA 3RZCD 4KGJA 1PEWA 1AKJD 1GS7A 4W9LC 1H3XA 1D5IH 3L8QA 1YEIL 5CINL 4WAFA 5DQDH 2XWBB 3CDZA 3GRWH 3WEXB 5BS0A 5DMKB 5KSVA 4KTGA 5DVKA 3GYRA 2YLKA 4M03A 1SYVB 3UTSE 4F8NA 32C2B 3NSFA 1E27A 2FEJA 3CDGB 4G6MH 4XOBA 3ZL1A 4CVUA 2AMUA 4FE9A 2AQSA 3DVNA 3NDYE 1ROWA 4BRJA 5ACLA 1T1YB 1ZLSL 1K8IB 5DRWA 3H2PA 5CBAA 5BZWA 2P8PA 4LP4A 4E9QA 4P5KB 1KIRA 2DMCA 1AXTL 5IIEB 2JJSC 1UM4L 1CGYA 2HG5A 4JAMB 3RWGB 4X5XB 1F56A 4JFYB 4BUQA 3L2NA 4P23D 5IW6A 1E9QA 4C56A 4PYHA 4X99A 2GITA 2DJUA 3FTXA 2E9IA 5FHBL 3T2OA 3UOAB 3UYPB 3WY2A 5KYNA 2H2SC 4PS8A 1UACL 5F7LB 4LPWA 3REWA 2E6QA 3KPOB 2XKSA 5FV1L 2ADJA 5EB9A 2VN4A 3FT4B 3ROOB 5GZOC 5JPMB 3WDJA 3G08A 4AQAA 3ARYA 2PLTA 4LMQI 3EFOA 5B7MA 1IAOB 4JO1L 2Y1ZA 4N2IA 5L2KA 2BNQB 3VXMB 3QNXB 5HHVH 4ONOA 1QO3B 5KYXB 1IQWL 1KWKA 3MKKA 2A9NL 4KK8D 4F3FA 3F5WB 1AKJA 3OWEA 3RZCA 1QTYT 4ZQTA 4PCKA 5D9SB 5F1NA 1IBFA 4GO9A 1JK9A 3RVXC 3DBXA 3MZTA 3RU8L 3QFJA 3VDAA 4ZMPA 1KBVA 4QRSB 4FXGC 5JZ7D 5EF1A 3FN0H 1OGAB 4U6XA 1IGMH 1SDDA 2BRRH 3FUMA 3J8F7 4PRNB 1WAAE 4BSWB 2VC2L 2EE9A 2IALB 2XYCA 3MO1A 4XC1L 4A2EA 2G9HB 4N6RA 5A40E 1P2CA 1JXKA 4JNXA 4LT7A 5JHAA 3V0WH 4X4ZA 1A3RL 2VR8A 2BIIA 1MRDH 3B2XA 1A7NH 3R1GL 4N2HA 3VRIA 1MKFA 2BSTA 1G9EA 1U8IB 3SY6A 2KS0A 4LLQB 3DIFB 4BK4A 1A9VA 1JVLA 4OZFA 5DGQA 3H54A 4ZUWB 4NKOB 3RJQB 1SF3A 4GAJH 3L1OH 4G43A 5I18L 2GTZB 3CXFA 3FPXA 1N7ML 3QUYB 5C0FB 4LQFL 4GRLC 5FXCH 3G04A 4YO0B 1DJYA 3VWKB 1QSFB 4JFZH 3P9MB 2NY6C 3ERXA 1AGCB 3EO0A 2E7LC 3B2UD 1VLXA 3D5OF 5FO8A 4Q2ZA 3WLWC 1DQIA 5DD3H 4B50A 5L6YH 4KTEH 2I07B 3BWAA 4Y4HC 5D7LE 4FYTA 3MRQA 1CR9H 3OAWA 2OL3L 4MX7A 3EZJB 4HJEA 1LO3L 2VL4A 1QVOB 3KBFA 1D9KD 3UAJC 3IB4A 5DXWA 3M1CA 2W9DH 2BLFA 4I2XA 4P4KD 4LU5L 5FGRA 1CTOA 4ZUSA 1PY0A 3BAWA 3HC3L 2BNRE 2WPGA 5C0GB 4KAQL 4K71B 1RD6A 4FDWA 1CYGA 3WTXA 2WTRB 3DROA 2JKIS 1ND0A 5AVRB 4OV5A 4D0CB 1JWMA 4OGYH 3Q9QA 4L4TD 2O5YL 1JPTL 3HA0A 4CMMB 1SDAB 1AQ8A 3OG4B 3D0LB 4KK5D 1VESA 1GIGL 5HDBE 1I8KB 3BKML 4N2EA 2OPCA 1BVKA 1F90L 1UXLA 1PG7H 3RWEA 3V6BR 1JZ8A 3FUDA 4X5WA 3FBQA 4WWOA 3D4YA 1ZVSA 3OPZH 4YX2L 1KFAL 1HHIB 2R9HC 2C5DC 3HJEA 3WD5L 4PRBA 3PDOB 3BN9D 1BJMA 1LL1A 1NEZG 3MRIA 3P0VH 2FCBA 3CC5B 3HLKA 1WUNT 2EYTB 1OF2B 5H37H 2Y1YA 5D7SH 2CIKA 2GC4C 3C9NA 1NWPA 5CEZE 4GSDL 1IMHC 3PGFL 4I0PC 4FI8A 3QXDA 4I9WE 5C0EA 4OI8A 4AIXA 1T20A 4Y5XC 4U1LB 3TONA 4Z76B 3ULSB 5F9AC 1HHGB 4JR9H 4A37A 2F74B 4KH2A 4YSDA 3WDHA 1D9KA 3E38A 4WKXA 2WZ6A 3RKDC 4LK4A 4P4KA 1CGXA 1YY8A 5DHEA 2JTDA 3RE0A 2AAAA 5MEOB 2Y3AA 3TU6A 2OYKA 2X42A 2PWGA 2X4QA 2XTJB 5IHWA 2IBGA 1B3IA 1EXUA 3HC4H 1LP9B 1BM7A 5KEZA 2H1PL 2WNKA 3FQRA 3BVUA 1QMUA 1RZ7H 1ACXA 1G84A 1SJHB 3HN3A 4L4TA 3QH3B 5EU6E 2WIIB 4J8RA 2FWOA 1WC7A 4X4ME 1R3LA 3SDXE 5C2BL 1BF8A 4N2CA 3SBWC 3RVUD 4K5MA 4WV1A 1NGPL 5CKAA 2QGEA 4JG1L 4JFHE 4C4KT 2W07B 3STZA 3CFEB 3BRFA 1G7HB 4DO4A 1VAHA 4OZHE 1N5AA 4NJAH 3ZE0B 1ZIAA 4KVNL 1F5WA 3QCVL 4XCYB 3MNZB 4N8CH 2WXFA 2DQEH 2DQUL 3Q5YA 4DGIL 4FAAB 5J6GB 3VI4F 2JELH 1SJEB 4HOWA 1YYLL 1NGWA 3QQ3A 1SY6L 2E8ZA 4FFVD 1G9ML 5DJZA 3O4LB 1MCWW 4OF6A 4D9LH 5I1GH 4YXKL 1QTSA 1UH3A 4KY1L 1RIVL 3WJMB 5E9DB 4BWTA 4F9LC 5FF6A 6CGTA 1NUGA 1DUYB 1E5YA 5MENE 4NHUB 3WLBA 1LWRA 1VPOL 3NAAH 5MEQB 4W9HC 5I23A 4UDTB 4N0YL 2VN7A 1C5BH 5HD8C 2ATAA 3D2UD 3MAWA 4XNQB 1YLBB 3UL4A 3ULUH 1KIUA 4PJXA 3OJDB 4G11A 4OH2A 5C8JB 2P5WB 1GGCL 4UTBH 2B1HH 1LE5A 4RA0C 5J11C 3X1EA 5JIQA 3MJ7A 2X1WL 1XT5A 4GRWB 4YHIA 2Q8AL 5AVWB 1A6AA 1GYUA 3LVTA 4PJBF 1RK1A 3D34A 2VM9A 3WOVA 1DBKH 1UH4A 1NCCH 2N1TE 1IVLA 3HMXL 5C07B 1TEFA 2DQDH 2O5XL 1EXGA 4AKOA 2VUOA 5CCKL 3CMGA 1YQVL 3DVGA 2YA2A 3TOPA 4ZFGH 4TUUA 4P06A 3TA3B 3CC1A 2UVFA 4A04A 1E6JL 4BJLA 5GZOD 1MIML 2JCWA 2AXFB 1HEZA 3MUZ1 4IBWA 4OZGB 3CDYA 2EH8L 2EIDA 4AQ8A 4ABWA 5KUMA 2G4GA 3HAEH 3OL2A 4L0YA 3H2QA 1AY1H 5LGJA 3VMPA 2XIDA 1RZJH 2WZPD 3DIVA 3RVVC 4X6EB 3DKHA 4WEEA 5FYJU 1NPUA 5D7IB 4LLWA 4E42A 4P59H 5KS9F 1U30A 4JQVC 4D9QD 5C0CA 2IXQB 3U36A 1KDJA 1KEGL 3QEHB 1AG6A 1TFHA 1QKZH 1TCRA 1LO5A 4HK0A 1V3KA 2XVLA 4P3CH 1CWVA 3UBHA 5BVJA 3TC9A 3MV9E 3D2UA 3PWPE 5GRXG 3AUVA 1M05B 1JFHA 1K4DB 3O6KL 1QQDB 1ZT1B 4KJPC 3KR3H 5IROC 1ETZB 4KO6A 5E5LA 4PGCB 3SPCA 3L2MA 4QGYA 1IGTB 4I8DA 5JPNC 3GHPA 2IWEA 2BDNL 2JJSA 3ALPA 1J9RA 2YZ1A 4TSCH 5HHME 4NP9A 3GEFA 3L08A 1YJDC 2OP4L 4LGPB 5JA8B 2F9BT 3BRGC 4GRLD 4Y5YC 2AITA 2IJ0C 1BYNA 2XXFA 1JV2A 3V9CA 4WHYG 4G7SB 2YRLA 3KBHE 3FQ4A 1XSKA 1FLRH 5DUPH 5EOCH 4LQ1A 2Y69B 1BIIA 4LAQL 2NY6D 3RNKB 2FIRT 5GZOA 2Z1PA 3Q6FA 4DPBX 4L8CA 2ZXGA 5IHZB 1OQOA 3VTTA 4B9YA 3HG5A 3WLWD 4AGNA 3A67L 5F7FA 4RETB 1E43A 4JDEA 2WZPA 5IMOB 1OLLA 1I4FA 5TH2A 3BO8A 3ZHDA 4EBQH 4YHZL 3BSGA 2VM3A 3UAJD 1M6OA 4Y2LA 4BH8B 3FTUA 4QPEA 3D07A 2Z4QA 3PV6B 4DPAX 1P7KB 5DJ0A 4BFIA 1KXVA 3EYOB 1HH6A 1X5FA 2FT7A 3SDDB 1WZ1L 1JUFB 1XCXA 5E4EC 3VXUD 2LHAA 4X6BB 3ATEA 4PCTA 5H4YA 1QLEH 1EHKB 1E5UI 4H8WC 5B39G 4OZIB 3EBGA 1Q9WB 3ZHFA 3FU5A 1TFPA 1OSYA 4FA7B 3Q2VA 3KYMA 2QKIB 3GJFH 1RMFH 4GSXA 5IVZB 4JLRA 1W8EA 4G72B 2Y24A 4NQQA 4ALAH 2FL5B 1C12A 5SWQB 5BOZG 3Q48A 1N8ZB 3L5WA 2GSMB 3WIIH 5FW6A 3QFGA 3JV0A 4MDIA 4GRLA 2V3DA 1T89C 5C08D 4GT0A 3BEVA 4OJFL 1ZJAA 4CRPA 4K8RC 1TZOA 3I9GL 4K3HA 4OD3L 1P4LB 1U42A 5KJ4A 5EIIA 4XVJL 2X6BA 5KSUA 4X7TA 3UH8A 2CBTA 4M93B 3IU4H 2E7LA 4I0PD 1XGQA 3MODH 4HS6B 5BO1L 1MVUA 4ODHL 3ZDYB 2H2PC 2OMYA 3FW6A 5JOPD 4JHVA 3TBBA 4PMFA 5JW5B 1GC1L 1KB5H 3DXAD 3KPLA 1WBXB 5AZEH 4JW3A 2BSCA 2EACA 2AABL 2OJZL 3GHBL 3NZHL 4LPVA 3WJLA 1XHHA 1NBVH 1NEPA 3OKLA 2EIEA 2D9QB 4LSUH 3F83A 3S37X 4OKDA 2FX8L 3GK8L 5HGDA 1ID2A 3BCDA 5F9WC 3QJHB 1TTUA 2YS4A 2F7IA 5JW4M 3S37L 2RAMA 3BVNA 1PDKB 4FFWC 5DEFB 4NQED 4LCWD 4M6MH 5I6PA 3QQ9C 3SKOA 3HC0B 2V3FA 3BPOB 4QRAA 3JTSB 3WL9A 4C57C 4PJ5B 1UG9A 3HS0B 4ZG1A 1C5CL 4ZSOB 3IETA 2ZPKH 1RK0B 5A7EA 5B38B 2YXVA 3W3BA 4NRZA 1SUHA 1VJSA 3NGBB 1L9QA 1Y6MR 2Y07L 4E9WA 2MQCA 4W81A 3NRQA 1IBDA 3OXRB 5BPPA 3ME0A 1BMGA 1IB5A 1MFAL 4PWHA 3O0RH 4QTIL 1TVHB 2R0KL 5C08A 3BZDA 4X9HA 2PWFA 1OP3H 2YPKA 1H19A 2YN5A 2DQTH 1AKPA 3H42H 2HFEA 2VH5L 3ESMA 1F42A 3B9AA 4NCC1 2CLZB 3GHEL 5CAYB 1ERNA 3EFFA 4I0PA 4RA3A 1UWGL 1UURA 2EINB 5LBSH 1DCEA 1A7OL 3J07A 4QOKB 4PB0L 4PWFA 1S4IA 3D69A 3ULVE 3GJEB 3DETD 1TU2B 1H8LA 3RFRA 3TN0B 2R7EA 4CNIA 4Y9GA 2CHXA 3D06A 3DXAA 3K6OA 3RUGF 3T77A 1ZLUH 3MCKB 5HD8D 3MRLB 4UV4L 2HX9A 3P11L 2VQ4A 3SKUD 2X6CA 2OZNA 4P57A 4B9PA 1Q1JL 2UZIH 2CBPA 2QFRA 2P8LA 4HS3B 5C3TA 1PLCA 1RAMA 1AHWB 5GRWA 1CGSL 1VACB 1XZWA 3LZQA 5B1JC 4NQEA 1Q9OB 4LCWA 4APQC 2R69H 4X42A 4Z3GA 3TEXA 3KWWB 3ZMNA 4X7DC 4P9MH 1HCYA 4RBPK 3I6LE 1QBML 3SBWA 1I7RA 2CK0L 4LSPH 3CXDL 4EEEA 5AW6B 3EJRA 4UYQA 2QSCH 3BSHA 2J8OA 3WMPA 1UZ8A 1S9VB 5CLWA 4IJ3B 5EZIH 4QXTA 5A2LH 3SB3A 3GMOB 1XSOA 1IAMA 4G7VL 4M4RA 5A2KH 1U8PA 4ZFOB 3EZ8A 1PQZA 3G6AB 3WTUA 1MDTA 4ORGB 4XCEA 5C0AE 2GFBB 2DYSB 3RVVD 3WFCL 1KTRL 3QWQB 2VQ1A 3PGCA 2PXYB 3N1GC 5K9JH 3QJFA 1MZYA 1SXAA 1TEGA 3K1KC 3LZPA 4UT7H 2WD0A 2ZKHH 5HVFB 2H41A 1SEQL 2JB6B 4J12A 4F15B 1OVZA 1BLNB 3SEPA 4L0ZA 2E7MA 5SWQA 3T0ED 1CG9B 1XB6A 3VWJC 5FCUH 4XB8A 3PYCA 1WBYB 4D0DB 3BP6B 1GW6A 4ICWA 3CVHA 1BMZA 2GBAA 4JRYD 3EJCA 4KJPD 5IROD 5TDNB 3VXPA 5FO7B 4YUEH 1IEHA 1CN4A 2OSLB 3NCJL 1JHTB 1MJ7H 1KIQA 3HR6A 2HB0A 4B97A 5HPMA 4JDZB 4XWOD 2A4CA 4CSTA 3I84A 1J5DA 3LNHA 4U6HA 3TVMC 2NY4B 4XPFL 3IMRA 3D3VE 1QACA 4XBMA 2YUVA 3F7YA 1BQHG 1LP9F 2IANA 3ABMB 2X9YA 3BZ4A 3JV6A 1V3LA 2MJWA 4QI3A 5DC0A 1EZVY 1FJ1A 5HHNB 3QSKB 2ZAHA 2V8MA 1IC7L 2ZX6A 2UY7B 4KI1A 5DMGC 1D7DA 5DT1H 1C08A 1IGFH 3N0PB 1N70A 1AGFB 4Y7OC 1AANA 2RACA 4JRFA 2FDBP 3GPEA 5F2FA 4F8QA 3MACL 2VSCA 1KFGA 2CDFA 5IWLC 1L9NA 2CO4A 2F7PA 1IKNC 1PZ5A 2XKNA 1N26A 3T0BA 4OCYL 3V4PB 3LMJL 4LRIC 1DDHA 2WINA 2Z0BA 4NO0B 3C87A 3T0EA 4IDJL 1P6WA 4KKRA 3NUKA 3T9WA 3BIAX 3FFDA 1HE8A 1JS4A 1MEXL 2BY0A 2V17H 3W1ZA 4DKTA 3D0VA 3N1QC 5LG6A 3LIZH 1LQSR 3RVTC 1F6AA 4TLSA 3FU3A 4XOEA 5IROA 2UX6A 4YFLI 2XKUA 3WN6A 4KDTC 3W81A 4N0UE 2XWZA 1QFUH 5TF0A 4PI2A 2BIQA 2N7AA 3NSJA 4KZ0A 2O4EA 3R06B 1OEZW 5D72H 3LRKA 1RHHB 4L1SA 5I19H 3ZVVA 2QR0B 3C2AH 4DW2L 3W39B 5HPOA 4QJ5B 4P2RE 2Z1KA 2KDYA 3QJQB 4YHNB 1ZA3A 4Y5YA 2RD0A 3JVFC 2ZNWA 5K9KA 2CHZA 4K8RD 1NMAL 4W4OC 3NVQA 3RGVC 3BP5A 2B0SH 1JF6A 1FDLL 5CCGE 4GRWF 3DURA 4LOFA 1ZEAH 2Z8VC 3P54A 4UAHA 3D39D 5F0LB 1ITCA 2FJSA 4GSQA 1CLZL 2H2PD 4KRPC 1UA6H 1EK3A 2A9DA 1BZ7A 4DP1X 4LLUA 1G7QA 4G1EA 3RY6C 4UTAH 4AEHL 3QUMH 1ZVYA 2YEZA 4UV7L 4XMTA 5E2WL 3U7AA 1V27A 1GS8A 3BH9B 5EEZA 2AJSL 4OZGF 2Q86B 5E2TH 4E9LA 5IQOA 2UZYA 3B4NA 5FKPB 1BOGB 3D33A 3IPEA 4ZJ9A 3WEMA 4U3XA 1FYHB 3P9LB 3CN0A 12E8H 2AEIT 4BFJA 4PJ7A 3L81A 4JGMA 5ESQB 4K94L 2OXHA 3PHQB 4FFWD 3EO9L 4OFIA 3QQ9D 2PR4H 2YXMA 5MI0C 4GUPA 4A68A 4AM0B 5D7IF 4DF9A 1GZHA 3P1VA 4JEGB 5IHHA 3QC5X 4YSSA 3K71B 1GY1A 1VADA 1MF2H 3QYMA 4BSVB 3ESNA 3PNWB 4MA7H 1WP6A 2DMBA 1P7QD 1QSED 1DHKA 3FC8A 4Z7UB 1JN6B 1NC4A 1U93A 3FT3B 2BZ7A 5F7EH 3V0AC 3ZUCA 2X7LB 2EC8A 2OXGA 3HNVL 5K69A 1KYUA 3BZFA 3LHAA 4I7ZC 3QJRB 1T89A 1BZQK 3ZDWA 2A9BA 1ES0A 2WK2A 3BVWA 1BYPA 3SGDH 4LSTH 1DQDL 1H6EA 2WXPA 4NQXB 3VH8B 5BJTB 5A7BA 1KEML 4AV0A 4ZMTA 3LPGA 3FTSA 2VABA 3UROR 4B9FA 3D39A 1MNNA 1EHLH 1DO5A 4MHHI 4R6UA 3GC3A 3AY2A 4MWFB 5BV7C 4OLWH 5CJQL 5HI5C 4N1EA 3QFDB 1ZLVK 2BVPB 2NCMA 2KLRA 3C6LC 2YKLH 1VSCA 1Y6KR 3S8GB 1VA9A 3MRMA 1CLYL 1K5NB 1JIBA 3LDBB 5HYJE 2KKQA 4ZFFA 1TJGH 4KFMA 3EDDA 3VQLA 5SWZE 4M5YH 3IDGB 3MLSL 1H15B 2FJGA 4S0HA 1WEJH 3IDJB 1TZIA 4OCSL 3V55A 1N5YL 1VGKB 3CLEH 2MWCA 3PJSA 4HCRL 1X7QA 4JL1A 1G9NH 3DPDA 1JPEA 2MPVA 4PJBE 1CQYA 5DHYB 2HFGL 3DHPA 2XFGB 4APQD 1ZGLB 5IEKA 1A6WH 1BFOB 2HWZH 3Q3GA 3TL5A 4NX0A 3BVXA 4HKBB 1FYTE 4J23A 4WGKA 4XP1L 4HVBA 2XI9A 1PYWA 1ZWIA 2AJ3A 4LP8A 7TAAA 1EGJL 1P7QA 1DEDA 3PUUA 4W6YB 1QSEA 3AM8C 3ARBB 1PS3A 2W9EH 1B6UA 1OPGL 2A83A 4J39A 3ARFD 1H6TA 1A2YB 2FWLB 3QCUL 1O6VA 4F2FA 1BQUA 1D5BB 4QRTB 1QI4A 2XN9E 4PN6A 1HL8A 5KS9E 2ARJA 2ZYRA 5E4AA 1AVAA 2WSKA 4LCYA 1G4MA 3U4KA 2GBTA 3TNMB 4ZW5A 5IFAL 5I8EB 1HIML 2J7LA 3CHQA 4LMQE 4M48H 1AP2A 4KZDL 2H3NB 5J3HC 1XWVA 2ZKXA 3PUCA 2KUTA 1UEMA 3Q2WA 4HUUA 4F33B 2PYFA 2X5PA 2WXIA 1BXUA 5FYKE 2X9ZA 2ERJC 1BEYH 3GTNA 4AEFA 3U0TA 2IOMA 3CIAA 1SXNA 2WBKA 3BGMA 5E8PA 5ESAA 5IB5B 4PHXA 2F19L 2FX7H 2Y7MA 2X3CA 3SDCB 4ENZA 5LGHH 4AYMC 1JNHA 2H3XC 2WXOA 4X4YB 4LSVH 1QFWL 3V5HB 2VR9A 1PD0A 4J3BA 4OU3A 4X6DB 2NUTA 1MCIA 5IR1A 4PHZA 5L9DH 5CZXC 3MJ8B 4LSQL 3TVMD 3ZHNA 3NESA 5SV4A 4GW5B 2BOBB 4HH8A 3UJTL 5IMKB 1SM3H 4HFUL 4CN1A 1OE3A 4D7BA 2CCLA 3LRGA 4H25B 2I60H 3D30A 2VN3A 2EDJA 4KVCL 5CCHE 1JGDA 2YD2A 3ARFA 4WNQA 2W0FB 4X4XA 4HGWB 5DMGD 1JGUH 4M00A 5HHXL 3B6SA 3VFNA 2X0VA 2WWOA 1M2VB 2B2XH 3UZVA 4HKJA 1A6VL 2W80C 4UNVA 2UXVA 4OCXH 1EJOL 1HINH 3KYKL 5KN5A 1WWAX 4ZMAT 3FZUC 4OF7A 3A4AA 4YJZL 4QF1B 4QXUH 4R2GC 5E6RB 2I9LB 4PB9H 2ZWSA 2ZXAA 1SXZA 4CC0A 3SE9H 1FF5A 4U31A 4QXGL 2X05A 3QIUC 1W6WA 4UQ3A 5IHLB 4E36A 2LU3A 4YHYB 1OWWA 4NO2A 4XMXA 1DQML 2ZWKA 2IPTH 4R7DB 1KN2L 1JE6A 4FYSA 3QPQC 4RMBA 2UUDK 1TZGL 3GBMH 4GEIA 4LKXA 3RVTD 4KROB 2FQDA 3V8OA 4M8VA 4M8UA 1OD7A 3T5WA 3EDKA 4YDKL 3M07A 5T33L 3CZEA 4ODVL 2H32A 3TEZA 1JCKA 2WOBA 5IT2L 4ZMXA 5DF0A 5GRVK 3MXWL 4JZJB 1IJNA 2VDOL 3N2JA 3T2NL 3TVMA 3I6KB 1JZJA 4F24A 3FO9B 5E1HB 1A3QA 4P5TB 4IIQC 3BESR 3F7QA 1E6OH 1XF3B 5DVLA 4AVIA 2ODIA 3LNEA 1T6BX 3NEEA 3B3IB 3RGVD 3ZDXF 1BF5A 5BXFA 1UJ3A 2VDQL 3HG1A 3IEAA 3WE6A 5C0JB 1KLUB 2EDXA 3MRDA 2RQEA 1I8AA 4RFNC 5KBNC 1RU9L 1X5ZA 4DNLA 4GG6A 1C7TA 3GJFK 1RIHH 3V4UH 2X53A 5E70A 1CCZA 2G3NA 4KRPD 4PS4H 5IWLA 3EH5B 1ADQH 3L4UA 5ANHA 1Q0XH 1X9QA 3QULA 3WUWA 4L3EA 2Q8BH 4QLRA 5IJDC 1HAUA 3QORA 1XBRA 1NGQH 1FNGA 1YEDA 2OMTA 4KVPA 1MCEA 3R4DA 4HF5H 3UC2A 3GXDA 1Q9KB 1RVFH 2ZUTA 1KTDB 2Q7NA 5CJ5A 2OYMA 1I8MB 4OF5A 1NGZA 2Z91B 4TSAH 2PCFA 4YXLL 1F41A 4J2QA 2A9ML 2Y23A 1QBLL 4MB5A 4KHTL 2K3HA 2Y36H 3H53A 3PWUB 4NO3B 3VXOA 1OV8A 5KTEH 3BH4A 3UTQA 3BAIA 4PCYA 5KBPA 1E5BA 1M7UA 1CIDA 1I82A 1IGCH 1KJ2A 2BMKA 2E7HA 3WTVA 1O9ZA 4LVHC 2ICWA 3QPKA 3BAEL 1UD2A 4R4FH 3CVHL 4KJYA 2WLZA 5D1QE 4H2CA 4LL9A 4OJYA 2DIAA 2R83A 1IM3B 2O6CA 5IG7A 1N2RA 3CLWA 4ISVA 4XI5C 3P4NA 3RGVA 4F7EB 1S2EA 1XD0A 2QHRL 4UUJB 4HG4K 4AY0A 3S88H 3L4ZA 2R1YB 4WQOA 1EX0A 5D6DC 4M6NH 4HZAA 5FW8A 5HHOE 4KKAC 1KJVB 4AVHA 3RUGE 3BT0A 4Y1SA 3LKSA 4Z0XB 3U82B 4AYFB 3IGUA 5HI5D 3C2SA 1UYWH 1RUAL 5JUEH 5GHWL 2LU4A 3FB5B 5L4JA 3LVEA 3C6LD 4G8EA 4I13B 3RY6A 3GBLA 4LZKA 2I32A 5DEGA 4ENEC 5BRZD 4N87A 4N3UA 3BVVA 2BFVL 2A0LD 1ZHNA 2IG2H 2YKKA 3OQRA 3QUXC 4WI7A 5DJCB 4ZUTA 2HVJA 2ROYA 1OP3K 1OGPA 1UENA 4HC1H 5DUBA 1KTCA 3Q8BA 5D7EA 4CW1A 5ABZA 4XNAA 2BVUA 4PIBA 1T7XA 4XMZA 5JW4N 2WO2B 2JF1A 2IADB 1BGXH 4Q8BA 1S5IL 3BDXA 2WIMA 3E6FB 3EBAA 2YAOA 5ADOL 3VM5A 1LMIA 2JWYA 4AT6A 4HWBL 4MAYA 3BZEB 3BDYH 3HHSB 4IK7A 3WKML 3MTXA 3PQYB 2VXVL 3Q2LA 1UWFA 4QO1A 4RZKA 3UTSD 4BGLA 2JCCA 3LRLA 3P4OB 3E7JA 2EUVA 3GSRB 3NZ8A 5D2NC 2IIJA 2ZOLB 3VUAA 1FZKA 2OMZB 3I75B 4NZRL 2UVEA 3F7RA 3KAAA 4HS8H 2OTWA 3GI9L 1U8HB 2H6UA 5IK3A 5I6NA 5CMAB 2X4PB 1IFHL 3GSWA 4Y19E 3QXUA 2HVKA 3E2HC 5CIPH 2ILLA 1YJDL 1PIFA 4YHLH 5DMJB 4D3CH 3WFEH 5EU4A 3RAJH 5D1XE 2OYLA 4EXKA 4IMLA 3CDZB 5KSVB 3C6LA 1AS6A 4NNPL 5BS0B 2PW1A 4OR1A 1YN7A 3HMWH 3L45A 3AT0A 5BRZA 3ZGIA 4LCIH 1O6TA 1KXQA 4CC1A 3FCBA 5DJYB 4C4BA 3SQOL 4NZFA 2VZTA 3KWUA 4XN4A 2ENQA 3DVNB 3NN8A 3ZE2B 3VFGH 2DD8L 3MHZA 4S1RH 2XWJA 2NXYB 4KBPA 5DRWB 1IKFL 5CBAB 5BZWB 2P8PB 1IGYA 2MFNA 1KIRB 1KPUB 3PP3K 2AERT 2DS4A 4KTDL 4PJFF 1A6UL 5CZXD 5ISZE 5IW6B 4GKLA 4Y7MA 1E9QB 2B3RA 3H4FA 4KDWA 4X99B 1Z5LA 2GITB 2ZCKH 3AM8A 3UTSA 3GSOA 4Q9RL 5BMFH 1JZ2A 2WUBH 4H8WL 4TSBL 4YWGL 3REWB 5E0QA 4WFGE 1R3JA 2FD6L 4AMWA 2ADJB 1S3KH 1UKQA 2Z92A 3C75A 1Z9SB 3ZQ9A 1OCOB 4S10A 3G08B 4AQAB 3U1SL 5LUMA 1EJ8A 4ZD3L 3ZU8A 3EFOB 5B21A 4QKXB 4ZDHA 2RJMA 5L2KB 1OSZA 4Z7UF 2FE0A 4HQQH 4ZTPH 2NY0B 4ZO8A 4F3FB 1J86A 3TJEL 1AKJB 1XH1A 2HFTA 2WXMA 3KJ6L 1XH3A 3A6CH 3QGVA 5F1NB 2G9KA 4R2GD 5GISH 5I1KL 2CPCA 5IFHL 1XEUA 2M26A 3QFJB 3PXLA 1FORH 4K8RL 1HU8A 4N4YB 3T4AA 4L3AA 3QIUD 1A64A 2ATKB 4IQHA 5JLZA 2NY7H 2D03L 4W9GC 1CFSB 5BOJA 1CDBA 3F12A 1CDUA 3HHRB 4JVUA 1IC1A 3QO0A 4KI5E 2BVQA 3MGOB 1MFMA 2VZ3A 4XBPB 1EAJA 3AG2B 4D94A 5CM1A 3QPQD 3MO1B 1I3UA 1JTTA 2J55A 3GSUA 3NTCH 4L8SA 1P2CB 4N6RB 4NZJA 4PWGA 3KBEA 2E76C 4HXAH 4G6KL 5ADPL 5D7LD 3VW3L 2QVIA 4MS6A 3MOBL 3S5LG 2N01B 3IXTA 3ETTA 2PW2A 4X5LA 4Z6AT 4BGDA 2YSSA 1JXDA 3O45A 4OZFB 4EOWH 1B4JL 4HIPA 3TA4D 2BNRD 4LSRL 4G43B 1QEXA 2C9UA 1AZNA 1PKQE 1IC5H 1P4IL 1WAAA 3G04B 3GBNL 3QUKB 4OTXL 4AV5A 2ICEC 4QHNA 3T4YA 1CTNA 2VDPB 1HESA 1GOFA 3QNFA 1OAQH 3GM8A 3QYCA 4JUTA 4PGJA 2PUQT 4FC3E 4Q2ZB 5FO8B 2EH7L 3B2PA 2RR3A 4RFEA 1BXVA 1G1KA 1RI8A 1VEMA 2BCKA 4KU1A 1OE2A 2IBBA 4FFZL 5T3XE 1I9RL 1YSOA 3BWAB 3N04A 3MRQB 1WPCA 5SX4H 2NY1C 3LXAA 5TFSH 4NFBA 3FF8A 3QUZC 1MI5B 4I2XB 3NP4A 5EUOE 4UOQA 5HGAB 4ZUSB 1MFVA 3QIUA 1HDMA 4OCMC 1CDCA 4PU2A 5AAMC 3VD7A 4RNRA 5J56B 4UQCA 4B9KC 2A1WH 2X44D 3MBEC 1CF1A 3DROB 4X7SL 5CEZD 1GRWA 1ND0B 1RSFA 1OL0A 4I9WD 5C97A 4OV5B 3N1MC 3QZMA 1JWMB 1OOWA 3LRMA 5J13B 1XZ0A 2BW4A 3JT2A 4JQIL 5D7LA 2C1OA 3SGKA 4W93A 1ZLWH 1BSIA 1Z5YD 4E2OA 3KYNA 3EFDL 3UJIL 4DESA 2ORBL 3K2KA 2BNRA 1R6VA 5T3ZL 2AMGA 1ZVSB 5E1QA 4DQOH 2WJ7A 4KKBD 4DVBA 1U3JA 3DRTA 4XO4A 1E8WA 5GGSA 4PRBB 1CBJA 3T04D 2IWKA 4K3JL 2CBMA 2OS7A 4HSAC 1GGIL 4XI5D 5F1OB 3RLSA 3JZYA 3MRIB 3GLAA 1T83C 3TPUA 4X6DF 2CDGB 5EH1A 4XAKE 2QVFB 3C9NB 3JXAA 4DGVH 5C0EB 4KKAD 1UGNA 2VJ8A 4YE4L 2CGRL 8CGTA 4HV8A 1T04A 4PJIE 3S5ZA 2Z8SA 4NAMA 1INQA 4JFHD 3ZTNH 3CHSA 4WLCA 3U1QA 1E67A 4ELDA 3WIFA 1D9KB 1FAIH 3AG1B 5I6OA 3I3BA 1CICD 3LHPH 3MRRA 4P4KB 2BP3A 2DQFA 2VRAA 2FB4L 5F97E 1YY8B 3Q8FA 3LZFH 3QUXD 4HUXB 4OT1H 4ZX5A 3BUDA 3X3FL 2QMJA 5G2NA 4XCFH 1U9KA 5FM4A 3VU1A 1EXUB 3LPOA 2J4WH 4J27A 2R8SL 2WB1A 3FQRB 4BZ2A 3BCFA 3W57A 2Y7OA 1CLVA 4WHTB 3QJXA 3O8XC 3QVAA 4L4TB 2XTLA 2BHFA 3ECBA 3UAEA 2MQ0A 2RBLA 4J8RB 1ROCA 2IGFH 2HLEB 1WC7B 2W91A 1R3LB 1C16B 1X5LA 5J7CC 1Q90A 1R0AH 2X88A 3BUYA 3STZB 1T2XA 2PPCA 3RIFF 4UOZA 4N0CC 1N5AB 2QZQA 2MPAH 1YNLH 3OJ2C 3UEZA 2R2EB 3PPEA 5I9QC 1BG1A 2NDFA 2UXGA 4QD2E 4CN4A 2QQQA 5EZLA 3O3BA 4JN1H 3GNML 1RIUL 1NGWB 3QQ3B 2DQGL 3L3DA 3ZYOA 4EDWH 1AZCA 5EU6A 1PGRB 5F72S 3MMEA 5F9OL 5DFVD 1UQSA 4M29A 5FF6B 4JFWA 4MA8H 1ZMYA 3BPLC 3B37A 3Q1SH 4IHOA 3WLBB 2VT0A 4BFFA 1LO0H 4WK4B 2VLKE 2BZCA 1CICA 1R17A 4F91B 4OM0L 3X12A 4YSPA 4DVRL 1MELA 1X5YA 2WLLB 3QUXA 4MJ6A 3WAKA 3QG6A 4WO4B 5I74B 2ZD0A 1FFRA 1DJIA 1KIUB 4JG0L 5A3IC 1NEZA 3L1FA 4LIQL 4LVOC 1TTAA 1PLAA 1BZDA 4HIHB 3E8UL 5M95B 3O81A 3MJ7B 2WTPA 3L9RA 1SLXA 3QWNA 1MFBH 1ZCRA 3AVEA 4YHIB 1HYSC 1JPGA 1IGJA 4HOXA 1A6AB 2C9PA 1VIWA 3OZLA 5MENA 4ETQA 1QUNA 3SGJC 4ZMYA 2BJMH 5IJKC 2NX5E 1RL1A 3HAEG 1XGRA 3VXTA 5AZ2H 2QADC 3MV9D 3DVGB 5D2NA 2IGTA 5I0WA 2KZBA 1WFOA 1F18A 1NAMH 4XN8A 1HEZB 5EO9A 2NY5H 5IOPB 2BC4A 5D93C 4MCZA 1FH5H 2ICES 2YN3A 1B0GA 4M7ZB 4DUVA 4FZEL 1CFVH 1CK0H 2KZWA 1CGVA 4TOYL 5HHMD 4CC4A 5J4MA 1IAKA 2F8OA 1TYJA 2YGPA 2R51A 4LLWB 1T7VA 4E42B 4E41E 1KBGH 1OAZL 3MLYH 5C0CB 4MZ2A 2QQNL 3ZDZF 5BQDA 2XU9A 5CFAA 4KV5F 3ULUE 4MCYA 4O02L 1EMTL 2KERA 3GI8H 2F1BA 1QHPA 2IF7A 3U36B 1MNUH 3SYOA 5L7XH 4LEOB 4AG4L 3CN4A 1EQWA 3BFQG 4HK0B 1LO5B 5DO8A 4FHJA 4NENA 2EE6A 3D2UB 1RJYA 1HC1A 2XZCL 3SPIA 1TIUA 1KCSH 2R4RH 2O5ZH 2VTFA 5T5NF 2ZKMX 4Q6YA 4XZUB 5LDSA 1PZAA 2J1XA 2ZOTA 3BLPX 4XCCL 1D5IL 5FYJH 3SY0A 2GSGA 1EERB 3OC5A 2VDRB 2J5LB 3MBWB 3GRWL 5TGBA 1OK0A 3HOGA 4QWWC 3S5YA 4HPOL 1NGYB 3ZDXE 3MRBA 4JFQA 3DRQB 4JDTH 4LPTA 1P4BH 4G6ML 3V0GA 4YDJA 5H94B 2D31A 5IW1A 3MV9A 5KBKA 3PWPA 5JTWA 1I1YA 2Q3ZA 3BWSA 4FNPA 4GMSH 2ZX5A 3I9AA 1TDQA 5GJSH 5IVXE 1DN0A 1EIBA 2XBZA 4ZK8A 5CJOH 3LXBA 3FBKA 3S48A 1TQWA 1WA2X 3EJZC 4JDEB 4AQ1A 2AK1H 1U41A 2CJSA 3GSNA 1I4FB 2VDLB 2D4DA 5GZNC 1TLMA 5I8CA 3BO8B 3GZPA 4M62H 2OZ4A 1O7DC 4MHHG 1IAIM 1P1ZA 5CN1A 1DYZA 3QUZD 3OB8A 2O6EA 2Z4QB 4DZBA 2V2TA 1FVDA 4BFIB 1JGIA 2YEVB 1HH6B 3ZX1A 1DSYA 3MBED 3EOTH 3UBXI 3Q6GL 2APBA 4GB9A 2X2HA 1WS8A 4N2LA 5DHVH 5BV7L 3UYRL 1Z32X 3FB7B 4ABQA 5C9JA 5HHVL 4EZJA 3LB6D 4OGQC 4UQEA 1OZTG 5AOLA 3CFJB 1G9NC 1EJ6A 3ZZSA 5KVDL 3KYMB 2HJFA 1HZLA 4LRNH 3AW5A 4JLRB 3CG8A 1C12B 4H0GA 3FB8A 3HCVA 3R18A 2ESVE 4GMTL 4N8UA 4F37K 2HKAA 3BEVB 2AQRA 1YG9A 2ICEA 1TZHA 4HH9A 2G2PA 3T8MA 1JL8A 4K7FA 2FEEI 5EIIB 1F3DH 4IBZA 4X7TB 3V0WL 3IKCB 5EBWB 2XX1A 3ECUA 2YUZA 1MRDL 1A7NL 4YK4B 2KL6A 3MLRH 3OAUH 1KBWA 3AXLA 5IB2A 4APXA 3ZKXC 1MVUB 3DMMB 3CSPA 2JKTM 1RERA 2OMYB 4LBAA 4POYA 3KGRA 3JWOC 1I85C 2DWXA 4JM4H 2VKXA 1RUMH 3HKZA 4GKSA 4F20A 3KPLB 3ARSA 1JDCA 1F3JB 1NUNB 3QUZA 2H0JA 3N50A 4NQDD 3QQXA 3SQBA 4DKEH 3OKLB 4JFZL 1MIEH 5D96C 5AAMA 2XC8A 3IBOA 1QD0A 2AAVA 4M7KL 1F4HA 3MBEA 4Y89A 3RX8A 2B1AL 4GAFB 2VAJA 2DTSA 2X70B 5DDHB 1MN4A 4DZ8A 3BVNB 4B60A 3HVNA 1F0LA 2GY7B 5L6YL 3SGEH 4Z95L 3C09C 3O8XD 4H8QA 3RTQC 3SKOB 1CR9L 3CX2A 3HZYA 3WL9B 5EWIL 2FSEA 3T6XA 1YYMH 3S34H 2YC1A 3O6LH 3OJVC 4TQPA 5GS0H 5GGUA 1OARL 3NACH 1ETB1 3KEHA 2AW2A 4GFXA 4NRZB 3VD9A 3K6SA 4QYOB 2F58L 4N8PA 1V3JA 2LLNA 4FNTA 4YBQC 3HE7C 5TE6H 2IPKA 1SPDA 2F53E 3ME0B 5SX4I 5GXBB 4N0CD 5HHPA 1NM9A 2A73A 4QHKI 4OQTA 2ALWA 3LIUA 1ED3A 1I1AC 4AMXA 4OGYL 2YPKB 5EFIA 4U33A 2X1XR 3MRFB 3T0VA 1MPAH 2HFEB 4HIXH 3ZXAC 1NCGA 2DEYX 1B0WA 1YC7A 3QEGH 1SZNA 3CN1A 4I0PB 5AOJA 5B39A 4Z8FH 5TPWL 4A2MA 1UXMA 5AENA 4F80A 2QQLL 1A65A 4PJCE 4Z7AA 5I66A 1RHFA 3VFOA 1RZFH 3OPZL 2R7EB 5JR1L 4RESB 1BWWA 4EQ2A 1KV7A 3NFNA 3DXAB 3T77B 3HE6A 2Z0UA 5HI4D 2IOOA 3B1TA 5CJBA 2GK2A 4OF3A 4F37F 3P0VL 4P57B 2J88L 3VFVA 3CZFA 5AUMA 1KLFB 2PABA 5DURB 3D87B 5A3ID 2X4UA 4PJFE 2GB2A 5C0AD 3TH4T 4DP9X 2AEQL 5HYEA 4NQEB 4KOBA 4LCWB 4RFOL 5DEJA 5I1EH 2HH0L 2ZNXA 1FGVH 4JR9L 1A7PH 3MCG1 3O8XA 2AZAA 2E56A 1HYSD 2FLBT 2JJVA 1TJIL 2PPAA 1OP9A 1TQTA 3MLZH 2E8YA 2P26A 4F93B 3LQAC 3ARWA 2X09A 1UZ6F 3EJYC 4U3HA 1ZSDA 3B83A 3L3OB 1TETL 4K3EL 3UG4A 2AK4E 3V4PH 1FNFA 2H6PA 4U0RC 2QADD 4DGUA 4X50A 4OCNC 4QXTB 1ADWA 3F7VA 4QHMA 1MAML 4MNQE 3KWVA 4M4RB 2O61A 1U8PB 1IFGA 2H47C 4I87A 1I7ZA 4BUGA 3KL3A 2VO5A 1PQZB 2CH8A 3BOVA 1OB1A 5E08H 3ZBMA 1S7WA 2C3VA 2WBXA 2APSA 4ABVA 5I6KA 3O3UN 2VQ1B 2VLLB 2AKRA 2YSTA 3PGCB 3FONB 3ULAB 3QJFB 2A7BA 3S35H 5DJDB 1MAKA 1ZS8B 1GGTA 5TDOA 3EYVA 4NJAL 1H5BB 1NCDH 1G7LB 2L7EA 3S4SB 5LN8A 5DR5H 3NH7L 3DUSA 2VLRB 5HSFA 2VM4A 3ZOAA 1YEIH 2CUHA 4N8CL 5CINH 1U58B 5IQ7L 3UDWC 2WXQA 5E00A 4HJ0C 4LLAA 4TPRL 3BSZL 1BD2B 5HDQH 4AYSA 4XP9H 5HVHB 3BFOA 2FT8A 2W60A 2NW3A 1EO8L 4FG2A 4MA1C 4P46C 4Y8DC 4WHDA 1HOCB 4D9LL 5I1GL 3VXPB 5C0AA 5BOPA 4E5XA 3LAFA 3RQ3A 1J8HE 3FAWA 4ELKB 1KIQB 3ILQC 4JKKA 5HPMB 1NIAA 4EUPH 1L3WA 4U6HB 3N44B 4UMSA 3VFWA 3SGJA 1DO6A 4HJJH 2IANB 1P53A 1HAWA 1AXTH 4WJG3 4AK2A 3WKYA 5F3BA 1UM4H 3FUJA 2EO7A 1FJ1B 4OCLC 3QPXL 3LH2L 4J3OH 2CALA 4LNVA 1PX8A 3DSNA 3BP7B 5FAAA 2WVSA 4I3SL 1JERA 3WO3B 1OD9A 5FHBH 4HKZA 2LR4A 5CR1A 2ZKYA 3P2DA 5I1JL 1CDYA 1VZIA 3KPQA 4AZ8A 1OGTB 3EJZD 2CDFB 2Y6TE 4IU3A 5GZND 3U0WH 2XKNB 3TCXA 2VB5A 1MCWM 3D3VA 4P2RD 1HOEA 4IK6A 1TSHA 2OMXA 4JO1H 4IW4C 2FECL 1IQWH 4ZFGL 2A9NH 2ZJSL 4XHQA 2JK5A 3T0EB 4N28A 5B7FA 1DVQA 1FE8L 3CXHJ 5J8OA 4Y2DA 3RU8H 3IGFA 4RIRA 4OJEH 2ZOWA 3FFDB 2WWMC 3VXSE 1XVSA 3D0VB 1IKOP 1F6AB 5JPMC 3TEYA 2HAZA 3PCYA 2VC2H 3QJUB 3OAYH 1HYRC 4XC1H 1L7IH 4P59L 5JQIB 2FNWA 3U30B 1LO4L 3OB0H 3ML9A 3NSYA 4X6CE 2VRQA 3IPBA 3VGDA 2J72A 3R1GH 4FYRA 5IEHA 5BZDA 1QKZL 1B2WH 5CKGA 1ZA3B 1MRCL 5FKAA 5D4IA 4MJ5B 2EDNA 2AJZA 4BEIA 3DUUA 2QV4A 1DVXA 3BP5B 3L3HA 4N0RA 5I18H 3FPYA 4J3WA 4LQFH 3DURB 2K6ZA 1ZGLM 4JRXE 5JOFA 4XPAH 2OMVA 4WJ5A 3FT2A 3ISWA 3M7FB 2AQNA 1MLCA 3NJXA 4W9DC 1FO0A 4TSCL 4CVWA 2N56A 1BZ7B 4LLUB 1UT1A 2GCYA 5GZNA 4G1EB 2BP8A 3FTYA 4P2RA 1S7UB 2GJZA 2HUEA 4Z0BH 4A6YA 1YZZA 4A63A 1BF2A 1BQHA 4LLDB 2VISA 4G59C 1LO3H 2UZYB 3K0WA 5EOCL 3QUYC 4L2YA 4J1UA 5GSVB 5ID0A 5EBMA 1ZV5A 5JIHA 4PJ7B 4MA3B 5ALBH 4LU5H 5E4EB 1K72A 2O93L 2OXHB 1YMME 2BSSA 3HC3H 1OTUC 4M9PA 2YGNA 4KAQH 1AR2A 1RZGA 3KXFB 4Y2OA 4B9CA 3EJQA 1JHKH 1VADB 1VFMA 3MOAL 4V33A 5F6HI 3TT1L 2GEQA 2ZWNA 2OFQA 2W59A 4H8UA 1YEHL 3B9VA 1JPTH 1HS6A 4YGVA 3MDJA 5SWZD 3DJTA 1NC4B 1U93B 3HE7D 1E28A 3VFSA 3MGTA 1GIGH 4UINL 2OXGB 3BKMH 2DM3A 1X7TA 2L7QA 3BVDB 5DD5H 3BZFB 5GGVY 1AD9B 4GKZA 1F90H 3A21A 4NBXB 4NO5A 1I1AD 1N59A 3MUHL 4Z7WB 1ES0B 4DPRA 3SKNA 4K71C 1QLEL 4YX2H 1KFAH 2PF6A 1JHLL 1QRND 1XXDC 3JTBA 3V7AE 3TF4A 4FFTA 5ECGA 4OUUA 3RFZA 3D39B 3IU3B 4BD4A 1IJ9A 2UZXA 4YOKA 4GSDH 3UTOA 3PGFH 3VI4A 1WG3A 3FQNA 5T5NG 3MRMB 5FEBA 2GJPA 4DAGL 4LGRB 4Q89A 4ZFFB 5CLZA 1MOEA 2ADGA 3OMNB 2YD0A 5CXPA 2CE6A 3FT9A 1DVUA 3IDXL 3KJ4B 4KC3B 1HH9A 4O4YL 3SJVE 1DFBL 3WEOA 1TZIB 1KGUA 3GSNL 4PP2B 1HCFX 2XN9D 4BUHA 1G1OA 5IM7A 1X7QB 3GMLA 3V52H 1RJCA 4S1DD 3V95A 2C1PA 2R15A 3MNMA 1OT1A 4H26A 4TNFA 3PGDB 5IEKB 1DCLA 3Q3GB 1J5CA 3T1FA 3VX0A 5JW4R 2H1PH 2YD5A 3IJYA 5FA3A 1KB5L 4YZWA 1PYWB 1ZWIB 5FYKD 4LSDA 4MZRA 2R0ZL 3LX9A 3EJYD 3OR7A 1P7QB 1U8LA 1XF4A 4U05A 3ZQWA 1NBVL 1QSEB 3KG5A 5AYTA 5SWZA 4HSCX 4ICXA 3HE7A 1VCBC 2X1OA 3ALWA 3QJSB 1YPZE 3BPCA 2A83B 4MNGE 5SX5H 4JG1H 3CQQA 3MN8A 1I1AA 5CD3A 4M6ML 4PJBA 2XTJC 3RTLA 3O3EB 4B5EA 3AXHA 3HI1A 4L48A 5I76A 2WLIA 2ARJB 3V0IA 4I1PA 3ZDZE 4PIRF 4R90L 1QRNA 1HXMA 1J1OH 2YQGA 1IBZA 1E0OB 1DANU 4FHBD 4DGIH 2CBOA 1JF1A 1Z0NA 4N68A 2OMWA 5AW2B 4IBVA 1QATA 1IO4C 1AP2B 3SGEI 3V4LA 3GIVA 5JO5B 3V9EA 4ES8A 2DQMA 1G9MH 1NIBA 2DEXX 4KX8A 1QOKA 4OGAC 3FH8A 2PYFB 1RIVH 4KKLC 3O0RL 3CN3A 4Z7VE 4LDEB 3U0TB 2XY2A 4EKXA 4IRSA 3TURA 1MFCH 1NDGA 3M1BA 4HJ0D 3WFBL 1E2ZA 3H8NA 2DIEA 5IESL 4WEBL 3SDYH 5E8PB 1ASQA 5ESAB 1MG3C 4YFDB 1VPOH 3FTGA 2XN9A 2O6FA 4P46D 3ZKMC 5KS9A 4N0YH 2DPKA 2FBJL 3HVDA 1ZAGA 1JNHB 3ILQD 2OTUB 1T03H 2LAGB 3ALXA 5IR1B 5E6SB 4K3DL 1GGCH 1ZHLB 5DI8A 1R33A 2EVIA 1Y07A 4Z7QE 5AKVA 1UCBL 2W65B 4OY9A 2WXNA 3ZMEA 2UZIL 4AJ0A 4UQDA 1J05A 4YVNA 5D8JH 3VD3A 3BIBX 4QYAA 5K39A 4WNQB 3ARFB 1I8UA 4X4XB 4P07A 4G7YH 3VFNB 1EBAA 2NNRA 2E75C 3B6SB 5CCKH 2O5XH 2FBRA 4AH2B 1KSRA 1YQVH 3UZVB 3C6SA 4HKJB 5IJVA 1OM3L 1DLHB 5IVNA 5K9QI 2V2WB 1E6JH 1MIMH 1GGYA 2EH8H 2R4SL 1SDYA 3LNIA 5AD0A 5AALA 2PO6B 3M45A 4NXSA 4BFGA 4UANA 2Z65C 1JPFA 4LASH 3LH8A 4JJHA 4U1HB 4NPYB 3KPRE 3S96B 4NO2B 3B5TA 2D0HA 2NYKA 3GKWH 5D6CA 3HUJE 3UDWA 5KSBF 3GSQA 2WWMD 4NOBA 3E3QE 3WIHA 4XBEL 3TA3C 1LK2B 4LKXB 5TF1L 1KEGH 3MU3A 4H4NA 1DJXA 2BS8A 1INEL 4W9JC 1XTMA 1QHOA 3GMQA 2IDFA 3VXMD 4URTB 2H32B 3CH1A 3O6KH 4O5LL 5I5IA 5EMYA 3MXVL 3R19A 3PHSA 2BSED 3AC0A 5FCUL 3T65B 5D7JB 2NTFA 3MRJA 2ZIDA 3NA4A 2BDNH 2K8QA 1S7XA 1OGAD 2VDMB 3BMVA 1WF5A 2OP4H 1UJ3B 3H3KA 32C2A 1OAKL 2DM2A 3HG1B 5GGTA 2F5AL 3ZZ1A 5JDSA 3H6AA 1TVBA 4YLQT 4GG6B 2DF3A 2GVYA 1PMYA 1YEWA 2JNZA 3KM2A 1SFDA 3IMWA 4BHUI 3L4XA 2JTYA 4N0FB 1K8IA 3KLHC 4GIOA 1DQVA 1W72A 4Q52A 1AIZA 2AGJL 2CO1A 3TPKA 3WI9A 1P9MC 3QULB 4IRZA 5D1QD 4L3EB 2YR3A 4ZS6C 4PTUB 1IM9D 1SUJA 3A67H 4FYQA 4L1BA 3QORB 5DWUH 4KNQA 4Y88A 4X5XA 3UIZA 1FNGB 1YEDB 2OMTB 2LTQB 3U6XS 1B6DA 3QUYD 2OYPA 1JZ3A 5DT1L 3JVGA 2C7FA 3NJNA 1QSFD 1JCVA 1NGZB 5HHOD 2ZZUT 2PCFB 2N1KA 3DPBA 1OTUD 3ILPA 1AZVA 3ROOA 5JPMA 2FYYB 4XXWC 1WZ1H 3BE1L 3CHPA 1IQDA 3VXOB 2GUOA 4KUZL 5KG9A 4L05A 3UTQB 1G0YR 3VXMA 2KZ1B 3VCLA 3SYPA 5KYXA 1F97A 1KJ2B 2BMKB 2BSEA 2MKWA 4GKNA 2YRZA 4KJYB 2IH1B 5I26A 5B1CA 1KYFA 1N2RB 2CIIA 3MLVL 3V2AR 3WMSA 4EF3A 1U8OB 3P4NB 4G9FB 3SDDC 2UXFA 5HYFA 1KN4L 2R29A 1NICA 2BHYA 2IALA 3IXAA 3KNBB 5D7KE 4OJFH 3N44F 2G9HA 3EHBD 4F8TA 3I9GH 1AGBA 3LKSB 4OD3H 2CM6A 4LEEA 1IZKA 2QQKL 4XVJH 1XBDA 5CGYD 3MZGB 3GD1C 3NQIA 4G8EB 5C1MB 2QKIC 1A7RL 1U8IA 4FQJH 4H5SA 1HXYA 5D1QA 3DIFA 1UOVA 4ODHH 5BO1H 4OLXL 5GQBA 1IM9A 1J8KA 7FABL 1ZHNB 3KPNA 4BWWA 3IDMA 4ZUTB 4F7KA 2B0SL 2HVJB 3LZRA 2Q87A 3ZHKA 4BCZA 2IC2A 4FP8H 2GTZA 1LK3L 3QUYA 2EDOA 5DC9B 5A16A 1KCVL 2OJZH 1OAUL 3CPLA 3NZHH 4UIKL 1BJ1J 3ARGD 5DQJA 1QSFA 1M7DB 2RTTA 5HHOA 1D7BA 3P9MA 2VR5A 1M6UA 1UZ6E 3RUGA 5JHLA 2XIBA 5MI0B 1UA6L 3GK8H 4M93C 5D1XD 1QBBA 5AOZA 2APFA 3BQUC 3L4VA 4AT6B 4UTAL 1PAMA 4MAYB 3S37H 5IF0A 1TQVA 1MY5A 4PYGA 3VB8A 3UTTE 1BXAA 2QL1A 2V7NB 1FNLA 3DX9A 4QO1B 2QVKA 1WIUA 3AADB 4IKJA 2J1KA 2JCCB 5E2TL 1MWOA 3NP3A 1C5CH 1FZKB 12E8L 4LXFA 4ONHA 2OTWB 1T0OA 1CC3A 3BLKA 2Y07H 4G3YH 5IK3B 2XTJD 1GH7A 2JKWA 3GSWB 5BVPL 1RLWA 2HVKB 2WTRA 1J1PL 3IMUA 1PZCA 1MFAH 3QEQE 4QTIH 4NS0A 5F7YC 3N41B 2ZXDA 5ISZD 1PZSA 1GTFA 3BPOC 4QLWA 3QG7H 5EU4B 5A2BA 2VWEC 4KZEH 2VH5H 3HS0C 2VN6A 4LHJB 5F7EL 4IMLB 1NC2B 2C8NA 2P5EE 3GHEH 4OGAD 2PW1B 1Q1PA 1AH1A 5I2IA 1UWGH 4WSGA 4XPHL 1YN7B 4X2UA 4EI5D 2DQJL 2BY2A 3NGBC 4JM2A 4KKLD 4WFGD 4DP4X 3EXJA 1T2JA 1IZJA 5BRZB 4YLCA 4M7LL 3AWEA 5EORL 1JF5A 2VMCA 4JO8A 5DZPA 5AQ0A 1HHIA 3PE9A 1CFNA 3VGEA 3UBXG 3ZKMD 3NN8B 3VNZA 4JPKH 3J2PA 3PDOA 4AJWA 5K1NA 2XWJB 3ARGA 4PJDF 4UV4H 3MJ6A 2X6MA 2WC7A 1IGYB 2Y7QA 3P11H 4OLWL 4XB3A 4ANKA 1Q1JH 5HHQA 1JFQH 4PTTA 5IMMB 5D1XA 4YQXL 3O4LD 2CUAA 1CGSH 1XXFC 4QRRE 2VR7A 4U1LA 3ULSA