3Q1IA

Polo-like kinase i polo-box domain in complex with fmpppmspsm phosphopeptide from tcerg1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
223
structure length
216
Chain Sequence
b'CHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPRLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK1
publication title From crystal packing to molecular recognition: prediction and discovery of a binding site on the surface of polo-like kinase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 73
structure length 216
sequence length 223
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3q1iA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3q1iA01
5DMVC 4X9VA 4HABA 3HIKA 5DMSA 4H71A 4RS6A 5DNJA 4YYPA 3P2ZA 4WHKA 4WHLA 3P34A 4O6WA 3FVHA 4LKLA 1Q4OA 4RCPA 4WHHA 4E67A 3P2WA 1Q4KA 5LHZA 4DFWA 4O56A 3HIHA 3RQ7A 5J19A 2OGQA 4HCOA 4E9CA 2OJXA 3P36A 1UMWA 3C5LA 4X9WA 3BZIA 3Q1IA 3P35A 4E9DA 3P37A 4XB0A 4H5XA 4O9WA 4HY2A 4J7BB 4LKMA 4X9RA 2N19A
chains in the Genus database with same CATH superfamily
3HFDA 5DMVC 5DMSA 4N9JA 4E67A 4NK7A 4LKLA 4DFWA 3GYVA 1E2SP 2IA9A 1F32A 3HIHA 2VKZG 2UV8G 4E9CA 1UMWA 3P36A 1F34B 3LM3A 4N7ZA 2I9ZA 4FDIA 4FDJA 4H71A 4RS6A 3P2ZA 3HMJG 1HDHA 4O6WA 1E33P 4O56A 1A87A 4CYSA 1E2TA 5AJ9A 4X9WA 3Q1IA 3GYWA 4O9WA 1FSUA 2N19A 4X9VA 1N2LA 1AUKA 5DNJA 4YYPA 4WHLA 3FVHA 1Q4OA 4CXUA 1E1ZP 3P2WA 5DAYA 2QZUA 3LXQA 3C5LA 3P35A 3P37A 2I9XA 4CXKA 4HABA 3HIKA 1N2KA 4CYRA 3ED4A 4WHKA 3P34A 4RCPA 4WHHA 1Q4KA 5LHZA 1E3CP 3RQ7A 5J19A 2OGQA 4HCOA 4G7NA 2OJXA 4CXSA 1P49A 3KDRA 2E50A 3BZIA 4NKBA 3FS3A 4E9DA 4XB0A 4H5XA 4HY2A 4J7BB 4LKMA 4X9RA 4N7VA
chains in the Genus database with same CATH topology
5DMVC 4X9VA 4HABA 3HIKA 5DMSA 4H71A 4RS6A 5DNJA 4YYPA 3P2ZA 4WHKA 4WHLA 3P34A 4O6WA 3FVHA 4LKLA 1Q4OA 4RCPA 4WHHA 4E67A 3P2WA 1Q4KA 5LHZA 4DFWA 4O56A 3HIHA 3RQ7A 5J19A 2OGQA 4HCOA 4E9CA 2OJXA 3P36A 1UMWA 3C5LA 4X9WA 3BZIA 3Q1IA 3P35A 4E9DA 3P37A 4XB0A 4H5XA 4O9WA 4HY2A 4J7BB 4LKMA 4X9RA 2N19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DMV C;  4X9V A;  4HAB A;  3HIK A;  5DMS A;  4H71 A;  4RS6 A;  5DNJ A;  4YYP A;  3P2Z A;  4WHK A;  4WHL A;  3P34 A;  4O6W A;  3FVH A;  4LKL A;  1Q4O A;  4RCP A;  4WHH A;  4E67 A;  3P2W A;  1Q4K A;  5LHZ A;  4DFW A;  4O56 A;  3HIH A;  3RQ7 A;  5J19 A;  2OGQ A;  4HCO A;  4E9C A;  2OJX A;  3P36 A;  1UMW A;  3C5L A;  4X9W A;  3BZI A;  3Q1I A;  3P35 A;  4E9D A;  3P37 A;  4XB0 A;  4H5X A;  4O9W A;  4HY2 A;  4J7B B;  4LKM A;  4X9R A;  2N19 A; 
#chains in the Genus database with same CATH topology
 3HFD A;  5DMV C;  5DMS A;  4N9J A;  4E67 A;  4NK7 A;  4LKL A;  4DFW A;  3GYV A;  1E2S P;  2IA9 A;  1F32 A;  3HIH A;  2VKZ G;  2UV8 G;  4E9C A;  1UMW A;  3P36 A;  1F34 B;  3LM3 A;  4N7Z A;  2I9Z A;  4FDI A;  4FDJ A;  4H71 A;  4RS6 A;  3P2Z A;  3HMJ G;  1HDH A;  4O6W A;  1E33 P;  4O56 A;  1A87 A;  4CYS A;  1E2T A;  5AJ9 A;  4X9W A;  3Q1I A;  3GYW A;  4O9W A;  1FSU A;  2N19 A;  4X9V A;  1N2L A;  1AUK A;  5DNJ A;  4YYP A;  4WHL A;  3FVH A;  1Q4O A;  4CXU A;  1E1Z P;  3P2W A;  5DAY A;  2QZU A;  3LXQ A;  3C5L A;  3P35 A;  3P37 A;  2I9X A;  4CXK A;  4HAB A;  3HIK A;  1N2K A;  4CYR A;  3ED4 A;  4WHK A;  3P34 A;  4RCP A;  4WHH A;  1Q4K A;  5LHZ A;  1E3C P;  3RQ7 A;  5J19 A;  2OGQ A;  4HCO A;  4G7N A;  2OJX A;  4CXS A;  1P49 A;  3KDR A;  2E50 A;  3BZI A;  4NKB A;  3FS3 A;  4E9D A;  4XB0 A;  4H5X A;  4HY2 A;  4J7B B;  4LKM A;  4X9R A;  4N7V A; 
#chains in the Genus database with same CATH homology
 5DMV C;  4X9V A;  4HAB A;  3HIK A;  5DMS A;  4H71 A;  4RS6 A;  5DNJ A;  4YYP A;  3P2Z A;  4WHK A;  4WHL A;  3P34 A;  4O6W A;  3FVH A;  4LKL A;  1Q4O A;  4RCP A;  4WHH A;  4E67 A;  3P2W A;  1Q4K A;  5LHZ A;  4DFW A;  4O56 A;  3HIH A;  3RQ7 A;  5J19 A;  2OGQ A;  4HCO A;  4E9C A;  2OJX A;  3P36 A;  1UMW A;  3C5L A;  4X9W A;  3BZI A;  3Q1I A;  3P35 A;  4E9D A;  3P37 A;  4XB0 A;  4H5X A;  4O9W A;  4HY2 A;  4J7B B;  4LKM A;  4X9R A;  2N19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...