3Q1IA

Polo-like kinase i polo-box domain in complex with fmpppmspsm phosphopeptide from tcerg1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
223
structure length
216
Chain Sequence
CHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPRLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK1
publication title From crystal packing to molecular recognition: prediction and discovery of a binding site on the surface of polo-like kinase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 73
structure length 216
sequence length 223
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3q1iA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3q1iA01
4XB0A 3P2ZA 4LKLA 3C5LA 5DMSA 4HABA 4E9CA 1Q4KA 4WHKA 4WHHA 4DFWA 3P35A 5DMVC 3P37A 4E67A 4X9WA 4X9RA 3BZIA 4LKMA 4O9WA 3RQ7A 4H71A 2OGQA 4E9DA 5J19A 3HIHA 4WHLA 1UMWA 4YYPA 2N19A 4RS6A 3Q1IA 3P34A 4HY2A 4X9VA 5DNJA 3HIKA 4J7BB 3P2WA 4O6WA 2OJXA 4RCPA 3FVHA 3P36A 4O56A 5LHZA 1Q4OA 4H5XA 4HCOA
chains in the Genus database with same CATH superfamily
3LM3A 3C5LA 4N7ZA 4HABA 3LXQA 5DMVC 1AUKA 3P37A 4E67A 4O9WA 2QZUA 3KDRA 2VKZG 3GYVA 4WHLA 1F34B 3ED4A 4CXSA 2N19A 5AJ9A 1N2KA 1P49A 2I9ZA 3HIKA 3HMJG 4RCPA 4J7BB 3P2WA 3P36A 4G7NA 4HCOA 1HDHA 4XB0A 4LKLA 4CXKA 1Q4KA 4WHKA 2E50A 4X9WA 3GYWA 5DAYA 4H71A 1UMWA 1E2SP 4YYPA 4HY2A 4X9VA 5LHZA 3FS3A 2IA9A 4N9JA 1A87A 1Q4OA 1F32A 4H5XA 1N2LA 4FDJA 5DMSA 4E9CA 4FDIA 4DFWA 2UV8G 3RQ7A 2OGQA 5J19A 4N7VA 1E2TA 4NKBA 4RS6A 4NK7A 4O6WA 1E3CP 2OJXA 3FVHA 4CXUA 1E33P 3P2ZA 4WHHA 3P35A 4CYSA 4X9RA 3BZIA 4LKMA 4E9DA 3HIHA 4CYRA 3Q1IA 3P34A 5DNJA 1FSUA 2I9XA 4O56A 1E1ZP 3HFDA
chains in the Genus database with same CATH topology
4XB0A 3P2ZA 4LKLA 3C5LA 5DMSA 4HABA 4E9CA 1Q4KA 4WHKA 4WHHA 4DFWA 3P35A 5DMVC 3P37A 4E67A 4X9WA 4X9RA 3BZIA 4LKMA 4O9WA 3RQ7A 4H71A 2OGQA 4E9DA 5J19A 3HIHA 4WHLA 1UMWA 4YYPA 2N19A 4RS6A 3Q1IA 3P34A 4HY2A 4X9VA 5DNJA 3HIKA 4J7BB 3P2WA 4O6WA 2OJXA 4RCPA 3FVHA 3P36A 4O56A 5LHZA 1Q4OA 4H5XA 4HCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XB0 A;  3P2Z A;  4LKL A;  3C5L A;  5DMS A;  4HAB A;  4E9C A;  1Q4K A;  4WHK A;  4WHH A;  4DFW A;  3P35 A;  5DMV C;  3P37 A;  4E67 A;  4X9W A;  4X9R A;  3BZI A;  4LKM A;  4O9W A;  3RQ7 A;  4H71 A;  2OGQ A;  4E9D A;  5J19 A;  3HIH A;  4WHL A;  1UMW A;  4YYP A;  2N19 A;  4RS6 A;  3Q1I A;  3P34 A;  4HY2 A;  4X9V A;  5DNJ A;  3HIK A;  4J7B B;  3P2W A;  4O6W A;  2OJX A;  4RCP A;  3FVH A;  3P36 A;  4O56 A;  5LHZ A;  1Q4O A;  4H5X A;  4HCO A; 
#chains in the Genus database with same CATH topology
 3LM3 A;  3C5L A;  4N7Z A;  4HAB A;  3LXQ A;  5DMV C;  1AUK A;  3P37 A;  4E67 A;  4O9W A;  2QZU A;  3KDR A;  2VKZ G;  3GYV A;  4WHL A;  1F34 B;  3ED4 A;  4CXS A;  2N19 A;  5AJ9 A;  1N2K A;  1P49 A;  2I9Z A;  3HIK A;  3HMJ G;  4RCP A;  4J7B B;  3P2W A;  3P36 A;  4G7N A;  4HCO A;  1HDH A;  4XB0 A;  4LKL A;  4CXK A;  1Q4K A;  4WHK A;  2E50 A;  4X9W A;  3GYW A;  5DAY A;  4H71 A;  1UMW A;  1E2S P;  4YYP A;  4HY2 A;  4X9V A;  5LHZ A;  3FS3 A;  2IA9 A;  4N9J A;  1A87 A;  1Q4O A;  1F32 A;  4H5X A;  1N2L A;  4FDJ A;  5DMS A;  4E9C A;  4FDI A;  4DFW A;  2UV8 G;  3RQ7 A;  2OGQ A;  5J19 A;  4N7V A;  1E2T A;  4NKB A;  4RS6 A;  4NK7 A;  4O6W A;  1E3C P;  2OJX A;  3FVH A;  4CXU A;  1E33 P;  3P2Z A;  4WHH A;  3P35 A;  4CYS A;  4X9R A;  3BZI A;  4LKM A;  4E9D A;  3HIH A;  4CYR A;  3Q1I A;  3P34 A;  5DNJ A;  1FSU A;  2I9X A;  4O56 A;  1E1Z P;  3HFD A; 
#chains in the Genus database with same CATH homology
 4XB0 A;  3P2Z A;  4LKL A;  3C5L A;  5DMS A;  4HAB A;  4E9C A;  1Q4K A;  4WHK A;  4WHH A;  4DFW A;  3P35 A;  5DMV C;  3P37 A;  4E67 A;  4X9W A;  4X9R A;  3BZI A;  4LKM A;  4O9W A;  3RQ7 A;  4H71 A;  2OGQ A;  4E9D A;  5J19 A;  3HIH A;  4WHL A;  1UMW A;  4YYP A;  2N19 A;  4RS6 A;  3Q1I A;  3P34 A;  4HY2 A;  4X9V A;  5DNJ A;  3HIK A;  4J7B B;  3P2W A;  4O6W A;  2OJX A;  4RCP A;  3FVH A;  3P36 A;  4O56 A;  5LHZ A;  1Q4O A;  4H5X A;  4HCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...