3Q1JA

Crystal structure of tudor domain 1 of human phd finger protein 20
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
HPPNRRGISFEVGAQLEARDRLKNWYPAHIEDIDYEEGKVLIHFKRWNHRYDEWFCWDSPYLRPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Tudor domains of human PHF20 reveal novel structural variations on the Royal Family of proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PHD finger protein 20
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2010-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3q1jA00
2BIVA 3S3NA 5KE2A 2EQKA 3DLMA 2WACA 2DAQA 2M16A 3Q1JA 5J39A 3OS1A 3OYEA 4BDZA 3QKJA 3OYJA 3F70A 2O4XB 3MEVA 2MWOA 2GFUA 2P0KA 3MO8A 3NTIA 4BE1A 3META 4N4GA 3LLRA 4BD3A 5CIUA 3OS0A 3OA6A 3L42A 2HQXA 4B9WA 2K3YA 2F5KA 2R5MA 4C5EA 2LVMA 3BDLA 2EQMA 2X4XA 2X4WA 1KHCA 2GF7A 3LYIA 3M9QA 3QIIA 4N4IA 5D6XA 3OYKA 4L59A 3OYHA 5J26A 2X4YA 3OYGA 4E7KA 5KH6A 2G3RA 2R5AA 3LGFA 3UWNA 2CKKA 4E7IA 3NTHA 2M1HA 2IG0A 2E5QA 3MP8A 4IUUA 4UC4A 5D6YA 4CRIA 1WJSA 2JZ2A 2RHUA 3OYBA 2M0OA 4II1A 3O8VA 2LDMA 3FDRA 3OYNA 3OYAA 4BDYA 3ASKA 2K3XA 3EAEA 4QW2A 2RHZA 3H6ZA 4N4HA 3L2UA 2BKDN 3E9FA 4EDUA 4PLLA 2RO0A 4E7HA 4IUTA 4A4FA 4C5HA 3OS2A 3LH0A 2O4XA 2LTOA 1G5VA 3LGLA 1MHNA 3OMGA 2RJDA 5IN1A 4E7LA 1OYXA 3OQ5A 2X35A 3DB4A 5M9OA 3DB3A 4QQDA 2R58A 2QQSA 3QJ6A 2E6NA 4C5IA 3L2QA 2DIQA 3L2WA 1WJQA 2D9TA 5FRMA 3S6WA 3PMIA 3OYFA 2GFAA 2RI5A 4IURA 4A4EA 4BE2A 5IAYA 1RI0A 2EKOA 2QQRA 4A4GA 3MEWA 3P8DA 2DIGA 4NS5A 2RHIA 4Q5WA 2RJFA 2L89A 2YRVA 3ME9A 4QQ6A 4LD6A 3H8ZA 3L2RA 2LCCA 3OMCA 5KCOA 4HCZA 2JTFA 4A4HA 3GOXA 2B8AA 5FROA 4B9XA 4E7JA 5FRNA 3FLGA 4IUPA 3UT1A 2RI3A 3MEAA 4OVAA 5C0MA 1SSFA 3E9GA 4FL6A 2RI2A 3PNWC 3OYCA 3S3MA 1N27A 4PLIA 2L8DA 4GY5A 2XK0A 2MWPA 4IUQA 3OYMA 2EFIA 2HQEA 2RJCA 5KE3A 3CEYA 2EQJA 3SD4A 4QQGA 3OYIA 3NTKA 1WGSA 5D6WA 2L3RA 3OYDA 2RJEA 2BUDA 1OZ2A 3MP1A 3PMTA 4FU6A 4QVZA 3L2VA 3LX7A 3MP6A 4PL6A 3PFSA 2RHYA 3MEUA 4RG2A 3OYLA 1XNIA 2EQUA 2LRQA 2XDPA 3ZEHA 4IKFA 3KUFA 2RHXA 4C5GA 3OB9A 3FC3A 2PQWA 1WJRA 4BACA 1OI1A 3P8HA 4Z02A 4ZTFA 4X34A 1H3ZA 4ZTJA 3C4SA 5KCHA 4BE0A 4IUVA 3S3OA 2VYTA 5C6SA 2R57A 3FEOA 2FHDA 3OY9A 2NLUA 1OZ3A 3QBYA
chains in the Genus database with same CATH superfamily
2KSSA 3QO3A 2C06A 1C6VX 2PZ1A 2LJ1A 1TUCA 3MEVA 2D0QB 2GFUA 2NWMA 2YT6A 3LLRA 4JUVA 1RAEB 3RNJA 3QYGB 1LJOA 3RR6A 5GJWB 4B9WA 4JS4A 1ZSGA 2PU9B 4XQ3A 1RUWA 4F04B 1PKSA 5FWBA 1KHIA 4M77G 4IUUA 1WHGA 3EG9B 1U1SA 2V26A 1HSQA 1VYTA 3EH2A 7AT1B 1M90C 2JS0A 1TU0B 2KDSA 4PK4A 1G5VA 4M7AC 5GANh 2QQSA 4JJDA 1X01A 2MIOA 4LUDA 4A4EA 1ARKA 1TUDA 4DEYA 2CT3A 1E7OA 3MEWA 5KYNA 2EPDA 1JU5C 2CGHA 3NHNA 3CBMA 1JB0E 2DRMA 1M1FA 2OTLT 3PE0A 1Q95G 4E6RA 2HL5C 4DBFA 4X1VA 2EFIA 1BIAA 2LQWA 1KQSS 5GAN3 4OB3B 3VYGA 3MEUA 1OULA 3V8KA 5GANj 2VC8A 2BZXA 1VQOA 1K8AC 2E1HA 2MOXA 5KCHA 3A8OB 1SKUB 4PNOA 4BE0A 2K5FA 1SHFA 3HFOA 4M75B 2RQWA 1VYVA 2FHDA 2QXFA 1QWFA 2CZ7B 1GRIA 1VQLA 1ZA1B 1VQ9T 2DAQA 1N9RA 1VIEA 3CCJQ 1Q82R 2CP7A 4C92G 2QEXT 3CCQA 2RQUA 3OA6A 5IT9E 1Y71A 3ER0A 2LVMA 3QIIA 4BY6C 3EH1A 4N0AC 3CC4T 2COZA 3LGFA 2CKKA 3NTHA 1SG5A 5D6YA 3M4GA 3KBGA 2MF2A 1ZQ1A 4B6MA 2DBKA 2XIDA 4KT0E 2KGTA 2F2XA 5GMKh 3CC4A 1WYXA 2ZPBB 2BZ8A 2RM4A 2ZZDA 1UFFA 2KVQG 3CPWP 3CCLQ 4C0GA 4A4FA 4PJOG 4J9FA 2O4XA 3I56A 4KGZB 3X20B 4ELZC 2L0AA 4MMLA 2OAUA 1UJYA 2X35A 1ZSZB 2DX1A 5ECAA 2XICA 1ZUYA 3QDRB 4J7IA 1PNJA 2JTEA 4IURA 1Q82U 2ROLA 1TUGB 1PHTA 2RJFA 2YRVA 4HT9A 2QG9B 1TSFA 2LCCA 1NPPA 4D8DA 3NGPA 4C8QB 1VQ6Q 1UE9A 3VUBA 3JCMe 1YITA 2K7AA 3EG1A 1BB9A 2DJZA 3U23A 3OYIA 1VQKQ 4M78F 2AT1B 2HQHA 1WA7A 3C94A 3I55A 1UHFA 2J7IA 4F14A 1QVPA 2P0QA 1N8RR 2PTKA 3A5ZB 3GNFB 1H3ZA 5GAMj 2ABLA 3H0HA 2RQTA 2X3XD 1OZ3A 5IHNA 2BIVA 1BI3A 1M1KR 1N8RC 4BDZA 1OU8A 1K9MU 5KYWA 4RTWA 1IB8A 2XU8A 2KMTA 1YI2T 5D7UA 1RAHB 4LDXA 1OX8A 1G8XA 3CCJT 1M2VB 2JM9A 1YJWQ 3G7ZA 2ZCFB 3MKDA 2QA4T 1H92A 2J06A 1FMWA 1CKAA 2M9UA 1IZ6A 4DQ2A 3JCMW 2CSQA 3OYBA 2RN8A 1YJ9A 2VGMA 2HMAA 2LT4A 2RK1A 4M75E 3C0CA 3CXCS 1TOVA 4K11A 2HBPA 3CXCA 3AHUA 5DM7R 1W6XA 4E7HA 2QQ9A 1I1JA 1Q81U 1MMDA 3HHTB 3CPWA 4C5HA 1B07A 3BW1A 2DM1A 2CP5A 2RJDA 3ZFJA 4AFQC 5A0LA 3M0QA 4M75D 3P8BB 4L5GA 2HL3A 3TQ7P 1XJWB 2RI5A 3CMEQ 4MMKA 4EMKB 3CMAT 2G6FX 1WHKA 2GBQA 1VQMA 2COWA 2YHTA 4JRQA 1NEBA 4NL2A 3RBBB 1AHJB 2CP3A 1ZUUA 1KQ2A 5CR2A 1I5OB 5FU7C 1M4ZA 3MJXA 1VQ6T 1UJ0A 1YFNA 2OI3A 1QVGA 1TTHB 1R77A 4HVWA 1QCFA 1NYFA 3RKWA 3OYDA 1M1KC 2V8KA 2NYSA 3G6EQ 1Q81R 4OMPA 2F2VA 3A8MB 4E47A 4JJCA 9ATCB 1G83A 3ULRB 1JXOA 2I2LA 3UDCA 1OI1A 4JPBW 4ZTJA 2B86A 2KNBB 1QWEA 1VIFA 3SHWA 3X28B 2CZ1B 3OY9A 2NLUA 1RAFB 5GAMd 3OSVA 3CD6Q 2KQWA 1X6GA 2M51A 2OTJT 4GBQA 5CQXA 4RTVA 1VQ5T 5A2QE 2HDAA 3M58A 4BD3A 1R0BG 2K3YA 4M7DC 2E70A 3ZBDA 2ED0A 2LX9A 2PUKB 1YJWT 3JB9F 2D6FA 4BY6B 1MUZA 2WSFE 3I55Q 2G3RA 2EYXA 4J9EA 1QCOA 2GGRA 4II1A 4LE9A 3UA6A 4AG2C 4DOWA 1YITQ 1VQ9Q 3H41A 4EMKC 3FB9A 4ELYC 1R0CB 4EMKA 1KIKA 3WVEB 5GAN8 1IREB 4PJNA 1AWXA 2DTOA 3L2WA 1SF9A 2JOYA 4M7DF 3OYFA 3CCVT 1MMNA 2CUBA 2EWNA 4J6XA 5IAYA 1YI2Q 2DNUA 5CKBA 2DIGA 4QVDA 4J9IA 2DF6A 3REAB 2EGAA 3I56Q 5FRNA 1AVZC 2OTLQ 2GCXA 3CCLA 2LP5A 1QW1A 1G3WA 1NLPC 1D3BB 3THKA 2P4RA 4BB7A 4M7AF 2VWFA 1YITT 3URGA 1ABOA 1PSEA 1EIFA 1VQKT 2I0NA 4C92D 1Y0MA 4PJOA 4M77B 3O5ZA 2RH2A 4HVVA 2O31A 3FC3A 2AZVA 4QT7A 3GNGA 4JS5A 4WCIA 4C8QA 3RKXA 2NUTA 5GAMh 2CDTA 1PSFA 5AT1B 2CS7A 1M2VA 5CKHA 5GANd 2HSPA 4JJNK 3NTIA 4RTZA 3KFVA 3HP9A 5CIUA 3L42A 2QA4A 3FIFA 2DXTA 1RACB 3OYHA 1NEGA 2YUQA 3OYGA 2RQRA 2IG0A 2EYYA 1M27C 2OTJA 2RHUA 4CC7A 2LDMA 2DO3A 4ME7A 3EAEA 5J3BA 1ZUKA 4EDUA 2OJ2A 2RO0A 1JJ2A 2EGCA 1JJ2S 1YBYA 2H8HA 2FPFA 1AD5A 1W4SA 2L3QA 2LNHB 5HK0A 2XHCA 2V8JA 4RKUE 3JCMh 2J6KA 4XU3A 2O9VA 1KQ1A 3OMGA 4EMGA 4J7FA 3VUZA 2E6NA 3V7RA 2D9TA 2DBMA 1M3AA 4KUDK 1PRLC 2NUPB 1Q7YC 1F1BB 4JZ3A 5LJ3g 4C92C 3CMET 2VKNA 4NS5A 3EGXB 4AT1B 3OW2A 4LD6A 3HSBA 3OMCA 2KAFA 2DYIA 2DXBA 2AZSA 2RMOA 3TVTA 3G71T 4IUPA 4RTYA 4AG1C 1D0XA 1FX7A 1TS9A 2FPDA 3PNWC 4A53A 3CCMQ 3HFNA 4Z89A 5DY9A 1UTIA 5KE3A 3H9NA 4RUGA 3TCJA 3OBWA 1Q81C 5GMKe 4A63B 3MP6A 3PFSA 4FYYB 2RHYA 1AT1B 1BYMA 1YJNA 5GMKj 2QA4Q 1G3SA 4M75C 3A8HB 4D8KA 3S3OA 4JRKA 1QMCA 2QI2A 2CZ6B 1S72Q 2O88A 1RAGB 2EQKA 4RTXA 1X6OA 1SRLA 3M0RA 3PVLA 2YRDA 3OS0A 3CC2A 2AKKA 3M9QA 4RMOA 2X4WA 4C8QC 2RA2A 1TWBA 2DILA 4DOVA 2NUZA 3SWNA 1WJSA 2FZGB 2J6OA 4XU2A 1AWJA 4JDSA 3LWIA 1RAAB 4PJOF 1CSKA 4C0FA 4MDXA 2K2VA 3JCMc 5CO7A 2QTVA 3A8GB 4KGVB 3J80E 2MI6A 5GAOl 4PFPA 2K79A 4M77C 3VS6A 5GAOq 3REBB 1XTDA 2DKGA 1QKWA 4Z8AA 2XG8D 2DEUA 5IHKA 4N0AA 1OEBA 2YUNA 2EKOA 1N6AA 2LMJA 1VYUA 2SEMA 4J6WA 2H3JA 3ME9A 4FYXB 3I56T 2KRNA 1WXTA 4B9XA 4DBRA 4FYWB 1KFZA 1BK2A 2DEQA 3V8LA 5CQYA 4L6V5 1KC8R 3SD4A 4XU1A 5D6WA 4ZN1A 3M0PA 1FWZA 3OS5A 4LDUA 3OYLA 2BE7D 2EJFA 3VRZA 1VQ7T 1VQ5Q 2HKNA 3G4SQ 2EBPA 1M9SA 2NUTB 4RCCA 1JJ2P 4Y28E 3CD6A 3QBYA 5LJ3h 1V76A 4BI3A 3C12A 4XTWA 2M16A 3CCSQ 2FRWA 3OYEA 1PCXA 2DYBA 3FJ5A 1WHJA 2JMCA 1QP2A 4XTUA 1KJWA 2EIFA 3CCRQ 3CCRA 3JCMb 2GF7A 3TSWA 4A54A 1OX9A 2JUFA 1YIJT 1BU1A 2X4YA 4E7KA 5HKCA 4J9GA 2IVWA 4LD9K 4AFZC 1YCSB 3CBPA 4A4KA 4ZN3A 4YTLA 3VS1A 2K3XA 2HZYA 4C92E 3IQLA 4M77D 4Y91A 3PTAA 4CC3A 1OPLA 1W1FA 1NM7A 2FO0A 2JJ9A 2EW3A 2O2OA 1UHCA 2JXBA 4J83A 4JLGA 1IXDA 2X9HA 4E7ZA 2OX7A 3E19A 1MHNA 3N5BB 1OYXA 1Y7XA 3DB3A 1QQJA 3X25B 3L2QA 1JQQA 1WJQA 5FRMA 1MMAA 1Y96B 5CAIA 2ZPIB 2A08A 3I35A 2EYWA 1VQ4T 1W2BP 2RHIA 4AFUC 3SWNB 4DA4A 2D1XA 1PKTA 5FROA 4FW1A 5I2SA 2RI3A 3VS3A 1WXUA 2QDYB 3CCQT 1MGQA 2GTOA 4EMHA 2XK0A 3JRZA 4LNPA 4CC2A 1LOJA 3CEYA 2L3RA 3PMTA 4QVZA 2DZCA 2KI7A 2KXDA 3OYYA 2AK5A 5LJ3d 1VQ8A 3L2ZA 3QSUA 2F2WA 1PD0A 3EG3A 1KQSA 2W0ZA 4FCYA 3CC2T 5FW9A 5GAN5 2L5QA 1UGPB 1RLQC 1UGRB 2DL5A 2RNAA 4J9CA 3CPWS 4R0KA 4XTZA 1PRMC 4KH1B 3JCMV 2HD0A 4PJOE 2X51A 4F7UB 3BE3A 1GFCA 1KD1C 1K73C 3TEEA 2EQMA 4HKEA 2JTMA 1Q86C 1W2BS 1UGSB 4M7AG 3PGGA 1M1GA 1B34A 4M78G 2JN0A 3SDZA 1VQ4Q 3OYAA 4BDYA 1PC0A 3ASKA 3J81E 1S72A 3VJPA 4JJBA 1K8AR 3MPUB 3QWXX 3G71A 4FSXA 1KC8C 3PIPA 1YJNQ 2VB6A 3EFRA 4M77E 1WZOA 3LGLA 3VV0A 1YJNT 2LQKA 4E2FB 1V29B 4FW2A 3QJ6A 3JCMQ 3GP8A 3X26B 1Q86U 3CBOA 3PVQA 1B3QA 3CCMA 2L89A 4OMMA 3EGUA 1H3HA 4A4HA 1MV0B 3FLGA 2DERA 4OVAA 1FMKA 1NLOC 4MZMA 1M1KU 3CC4Q 1ZA2B 2LQNA 2O9SA 2HEQA 3VS0A 3HRSA 3NTKA 2DMOA 3MP1A 3A98A 1KD1R 2QEXQ 4RG2A 4M7DA 2V1RA 4FYVB 5LJ5g 2IPOB 3KUFA 2KXCA 3M0UA 2RB6A 2PQWA 1WJRA 3TU4K 3HL8A 2V1QA 2DETA 1LCKA 4C0DB 2DXCA 1VQLT 1Z9QA 4M77A 1VQLQ 3HKSA 3Q1JA 5GAOr 2OTJQ 3VS4A 1C0MA 1M8MA 2P0KA 3SFMA 1QVFS 4M7AA 3PT9A 4LDWA 3EGXA 3TREA 3BDUA 1VQOQ 3BDLA 1NJIR 2PVOB 1PD1A 3SWNC 4EPCA 5I21A 1K0XA 2JM8A 2E5QA 5CKEA 5AYFA 4KH0B 4KULA 3MCAB 1TG0A 2HKQB 5CVIA 4QW2A 2E6ZA 4OGEA 2L3PA 5GAOp 1YNZA 1SPKA 8ATCB 4O6JA 1RABB 1XOVA 1FYNA 3TSZA 1M8VA 3BY7A 3LH0A 3RKYA 4C8QE 1IRXA 1Y96A 2FPEA 2Y4XA 1JO8A 4VUBA 2GQVA 1VA7A 2CUDA 2FEIA 1JXMA 4J8OA 1OV3A 3CCST 1NPRA 4KBMB 2JT4A 2LNVA 3QYHB 4A4GA 2CP0A 2E4HA 2ESWA 4QQ6A 5KCOA 3EFOA 4HCZA 2X3WD 2OTLA 4J9DA 4GLMA 3JB9G 2GTJA 5C0MA 3R6NA 2XDBA 3CXCP 4PLIA 5LJ5h 2A36A 3GPLA 1YI2A 2D8JA 2RJCA 5CKFA 2KYBA 3NFCA 4J6YA 1WGSA 3CCEQ 2VVKA 4DBQA 4KGXB 2DL7A 5IH2A 3E1SA 2ECZA 1KQSP 5GJVB 1MMGA 1HJDA 5L23A 1BBZA 2QTXA 3CCUT 4BACA 3VYHB 1B34B 3G71Q 5LJ3f 3EGDA 2ZPFB 3DKMA 4IUVA 5LL6S 1NJIC 1GL5A 5KYYB 4RTUA 3DLMA 2VGNA 4NL3A 2AHJB 3QKJA 1T0HA 4HCBA 2DL4A 4BE1A 3META 1ZSZC 1QVGP 4IIMA 4F7UA 1GBQA 2CH4A 1X6BA 3A8LB 4M4ZA 1VQNA 2EYZA 1UECA 1OQKA 4XTYA 2DE0X 2LX7A 2KEAA 5J26A 2IIMA 2E5KA 2DVJA 3QZ5B 4F16A 3ZL7C 4UC4A 1BIBA 8AT1B 3OSSC 2O01E 4C8QG 3CC7Q 3OW2S 1J3TA 1K76A 2ROTA 1X75C 3J7AF 2MPXC 2ZAEA 3H6ZA 3JB9H 3CD6T 4MZTA 4HCKA 1BI0A 2OAWA 2YUPA 5EG2A 1K73U 2AKLA 4M7DG 4C5IA 1WQWA 2R58A 4WF2A 4LDVA 3RUXA 3G6EA 3S6WA 1YN8A 1PM3A 4GLKA 4XAXB 2KROA 3JAME 1KD1U 1RI0A 4TVRA 1U3OA 2GNCA 4Q5WA 2Y90A 3CPFA 2F69A 4OMFB 4X9DA 5DLOA 1YHQA 2VXEA 3MEAA 1EX4A 1SSFA 5FU7B 2X4JA 3E9GA 2A28A 1I0CA 1VQMQ 4ANJA 3JCMg 2MAMA 4MDWA 5GAMe 1VQMT 3CMEA 1K9MR 2RPNA 1OZ2A 2EAYA 4M78A 3VRYA 2BZYA 1BCOA 1BCMA 1YWPA 2NUPA 1NJIU 4LDYA 4F17A 4Z02A 3VU3C 2YUOA 2QK0A 4C92B 3LWHA 2QQBA 1QVFP 3CCVA 1RLPC 1WLPB 4OMLA 4XU0A 3OYJA 1H641 1PG5B 3CCET 2P0PA 2CT4A 5KYXB 3JB9D 1NG2A 5FU6C 3JCMf 1HD3A 3RIRA 2E3HA 3LYIA 2X4XA 3M0SA 4IIOA 3L1AA 5D6XA 1R8OB 3VS2A 1KC8U 3QWYA 4HVUA 2M1HA 2E64A 1IO6A 1WXBA 2M0OA 4D6WA 3WVDB 5GAMf 2E12A 2L3SA 1SRMA 1X2QA 1I5LA 3G4SA 3JSCA 3OS2A 3RESA 3OBYA 1VQ5A 1Q7YR 2ZGWA 3H0IA 1UG1A 4M7DE 3QDFA 5A0DA 4JRIA 4OMQA 1D1BA 4OMOA 1VQKA 2DK3A 4PFOA 3D7SB 2E41A 1WX6A 4PJJA 1UGQB 1WFWA 1HXDA 1EZZB 1FMVA 2FG0A 4HA8A 1RAIB 2GQIA 1YIJA 1M30A 2M0YA 2YRCA 3M55A 4RG8A 5LJ5f 2J6FA 1YCYA 3NMZC 3VS7A 1WHHA 5GANf 1Y07A 2ZPEB 2J05A 4M7DD 2BUDA 4OGCA 2E10A 2DXUA 2FL7A 2LRQA 3CCRT 2RHXA 2DL3A 1VQNT 5KYWB 1Q7YU 1ZLMA 2WSEE 1QCNA 5GMKl 3HPWA 1NBEB 2QQAA 1D1AA 4FT2A 5KYYA 3NPFA 1I81A 2MMPA 3C95A 4PJOB 5HK3A 1B7TA 1H8KA 4MZPA 3G6ET 3CCVQ 3F70A 2O4XB 1IGUA 3MO8A 4V2SA 5DLQE 5A0GA 5GANg 4AMCA 2F5KA 4KRTA 2R5MA 4OB0B 2VXFA 2YXYA 5GANe 3CCQQ 3H0FA 4OF1A 1SEMA 1YJ9T 1E6GA 1PWTA 4M75F 3O8VA 1RI9A 3EG0A 4XK8E 3M4YA 5IXBA 4N4HA 1Y57A 2FYKA 4IUTA 2HSEB 1VQPA 1S1NA 3BFMA 3X24B 4ZNXA 3CCUA 1HK9A 1ZBXA 5LJ3e 4M78D 2JVVA 1UDLA 3GLXA 1M3BA 2PUOB 5GAOn 2PVDB 3HRTA 3FJPA 2XD0A 1K8AU 2W10A 2DZ9A 2L2PA 2M02A 4ATOA 2COYA 2LQ8A 1X2KA 2YSQA 4FL6A 2DFUA 3S3MA 1N27A 4P5NA 3DLLA 1BKBA 2MK5A 4PKCC 2HQEA 3CC7A 3V7SA 1W70A 2RJEA 4E7SA 1MNEA 2K5IA 3LX7A 2C0OA 4PL6A 2H3EB 2A0FB 2ZPHB 2MCNA 4HCCA 4Z88A 1D0ZA 1VQNQ 1WIEA 3M53A 1FXXA 2VYTA 5C6SA 4C8QF 3G4ST 1N5ZA 5GAN2 4C92A 4XTVA 1D1CA 4IKFA 3KXTA 4PJOD 2DJQA 3V7CA 2WACA 4Y92A 5J39A 4BI8B 1KSWA 3CC7T 3M5AA 3SEMA 2K5LA 4M78B 4JLIA 2K3BA 4M75G 1I07A 4C8QD 2HQXA 1N8RU 4C5EA 2DRKA 3FRNA 1G3YA 1MNDA 4F7UE 1WNLA 4PJLA 3UWNA 1V1CA 2CP6A 3CCEA 3GF5A 6AT1B 3FDRA 1VQ7Q 2RHZA 5GAN6 1AOJA 2HBWA 1O9SA 5KYXA 2QGFB 2XKOC 4NOYA 4WTOB 3JCMd 2XDDA 2LTOA 4C0DC 1YP5A 5IN1A 1UUEA 2ENMA 2YWWA 2CH4W 2DIQA 2YLCA 3VKIA 3I5RA 1ZBJA 2GFAA 1UEBA 3I55T 2FRYA 4FT4A 1SSHA 2QQRA 3QZ9B 4OP0A 1OPKA 3UPUA 4JRPA 1QVFA 2HAXA 3HRUA 2JTFA 3EG2A 2KBTA 1IGQA 2FZKB 2KT1A 1M3CA 1Q82C 1AZEA 4DBHA 5GMKi 1JBMA 1O75A 2QGGA 3EGDB 4LUEA 1JRIA 2MWPA 5I11A 4F7UF 4CC4B 2A3LA 5KYUA 2EQIA 3UF4A 4EIKA 3L2VA 3AT1B 1K4US 1XNIA 2CSIA 5HCKA 4RCBA 1UB4A 2SRCA 1N9SA 1GBRA 4M78C 1QP3A 3QJYA 3CMAA 2EJ9A 1VQ9A 1CKBA 2QASA 5KE2A 2K6DA 2P84A 1WPYA 2HCKA 1E6HA 1WHMA 4N4GA 2C0IA 2MYSA 2QDLA 1KG1A 2JW4A 1IHVA 3CCLT 1JEGA 1NZ9A 3M57A 4N4IA 4OMNA 1VQ8T 4M7AE 1W2BA 2DVEA 1S72T 2DL8A 2K9GA 4PFZA 3OW2P 1ZX6A 2QEXA 3R6OA 3T9NA 3VS5A 5KH6A 2PNIA 4E7IA 2XI9A 4CRIA 1UGVA 4X9CA 2EVRA 2RK2A 1ACMB 2F5TX 2YLBA 2FZCB 2VV5A 1M90R 1VQPT 2FVUA 2V8IA 4FIBA 1K9AA 3I9QA 4J9HA 5IXFA 1QKXA 1I8FA 4BE2A 1AWOA 2KE9A 4RTTA 3M59A 2EJGA 3PIOA 3CCUQ 5GMKm 1TH7A 3M56A 2B8AA 2QYZA 3UT1A 1VQPQ 1K73R 2VASA 1WI7A 3HTRA 2D0NA 2RI2A 3RMSA 1AEYA 1NYGA 2L8DA 4LXCA 1VQ4A 5HY6A 1NE8A 1GCPA 2EQJA 3RERA 2RD1A 4M7DB 1KK7A 2LCSA 5FWCA 4HXJA 2RQVA 3LH5A 1K1ZA 3ZEHA 2QAZA 3M54A 3QG1A 4C5GA 5I22A 2ED1A 5LJ5j 2KRMA 5FLXE 4ZTFA 4X34A 3EHRA 2JS2A 2VUBA 3G1JA 5CKDA 1WHLA 1U06A 1MV3A 1P92A 4M78E 5LJ5e 3A1PA 2XMFA 1YJ9Q 2KR3A 5L8RE 4BUGA 2E3IA 4XTXA 4M7AB 1X27A 5EC7A 2PVGB 1DJ7B 4OB1B 3UATA 1IHWA 4J5YA 1HYOA 1YJWA 1M2OA 4M77F 1YHQT 2D8HA 2LZ6B 4L59A 3LW5E 5LJ3j 2A37A 1VQ8Q 2R5AA 4F7UG 2DD5A 3MP8A 1GCQA 2K4YA 4DEXA 4R55A 3E9FA 2LC4A 4ZGEB 1D09B 2DD4A 1D3BA 3QPHA 1VOMA 2JNGA 2P4TA 2LJ0A 1ZHIA 1YIJQ 5M9OA 3V8JA 1M5Q1 4BI4A 3JCMJ 2DLPA 2E65A 4FM4B 4ZGDB 1T0JA 2BE9B 3EHQA 3P8DA 3EFSA 1T3LA 1VUBA 1VQOT 2KYMA 4C0ZA 1Z9ZA 1VQ6A 4HT8A 1SHGA 4JZ4A 4PJMA 3JCMX 1D0YA 5GAMg 1K0SA 3OYCA 2HNIA 3JB9J 2CREA 3GIBA 3UA7A 3WXMB 4QVCA 3JV3A 3CCMT 3OYMA 1QLYA 3SB2A 2DPPB 1LVKA 2JMAA 1ZSZA 1GFDA 2CP2A 4J9BA 3JCMP 2XDPA 1T3SA 2K57A 1YWOA 2CZ0B 1A0NB 1OU9A 3EG9A 1AZGB 2KT8A 3C4SA 1EFNA 2DA9A 2Y4YA 1RL2A 4FSSA 3M0TA 3MHXA 1QVGS 2AIRB 1ABQA 3CCSA 3S3NA 4OB2B 3OS1A 1BI2A 3RDVA 1X69A 3JB9I 4CI0C 2MWOA 4ZGJB 1U5SA 2BTTA 3CQTA 1X43A 1M90U 2KRSA 2DTIA 3OYNA 1U1TA 4AFSC 2C0TA 1KHCA 3OYKA 2LJ3A 5GAOm 1GCQC 5CK9A 4M75A 3CCJA 5GAN4 2JZ2A 1GXIE 4ORZA 2EGEA 1RADB 1BI1A 3CMAQ 3L2UA 2BKDN 4PLLA 1K9MC 1YHQQ 5GAN7 4KUIA 1WDXA 4E7LA 1XQHA 3OQ5A 1LPLA 2KY9A 3DB4A 3QUIA 4QQDA 5I2MA 2Z0WA 2CYZB 3PMIA 1OOTA 1AWWA 2KK4A 3RMQA 1I4K1 2A7YA 2F1LA 3L2RA 3H8ZA 2DTHA 3QHSA 3GOXA 3INZA 1WQ7A 2LT1A 4C92F 4QKUA 4E7JA 4ESRA 1C1AA 4O5VA 2ZPGB 1G3TA 2YDLA 4GY5A 2LCLA 4IUQA 3QXEB 2EYQA 3GBQA 5FU6B 1Q86R 3EFOB 2FB7A 4QQGA 1G2BA 4PJOC 5LJ5d 4FU6A 1TXQA 5CCAA 2EQUA 3E2UA 4LN2A 3I5SA 2EKHA 3OB9A 2ATCB 1LNXA 3P8HA 3CC2Q 1U8RA 5KYUB 2WSCE 2RF0A 2R57A 4M7AD 3FEOA 1VQ7A 2K2MA 5IHIA 4R56A
chains in the Genus database with same CATH topology
2KSSA 3QO3A 4M77A 5GAMh 3V7CA 3HKSA 2WACA 3Q1JA 5J39A 5GAOr 2C06A 1PSFA 4BI8B 3CC7T 2CS7A 3MEVA 3M5AA 5CKHA 5GANd 2D0QB 2GFUA 2P0KA 3NTIA 3SFMA 4JJNK 2K5LA 3LLRA 1QVFS 4M78B 4JUVA 4M7AA 3QYGB 3PT9A 4JLIA 4LDWA 1LJOA 3HP9A 4M75G 5CIUA 3L42A 4C8QD 2HQXA 4B9WA 2QA4A 4JS4A 3TREA 1N8RU 3BDUA 2PU9B 3BDLA 4XQ3A 3FIFA 4C5EA 3FRNA 2DXTA 1G3YA 2PVOB 3SWNC 4F7UE 3OYHA 1WNLA 4EPCA 5I21A 3OYGA 3UWNA 1KHIA 2IG0A 4IUUA 2E5QA 4M77G 5CKEA 5AYFA 3CCEA 3GF5A 2OTJA 1U1SA 2RHUA 4KULA 3MCAB 5CVIA 2LDMA 3FDRA 2DO3A 4ME7A 3EAEA 5J3BA 4QW2A 2E6ZA 4OGEA 1M90C 2RHZA 4EDUA 2KDSA 2RO0A 5GAN6 5GAOp 1JJ2S 1JJ2A 4PJOD 1O9SA 1YBYA 4O6JA 1W4SA 1XOVA 1M8VA 5HK0A 2XHCA 2V8JA 3BY7A 2XKOC 3LH0A 4NOYA 4RKUE 3RKYA 3JCMh 2LTOA 4C0DC 4XU3A 3JCMd 5IN1A 1KQ1A 3OMGA 4C8QE 2XDDA 4M7AC 4EMGA 5GANh 4J7FA 1Y96A 3VUZA 2Y4XA 4VUBA 2QQSA 2E6NA 2GQVA 3V7RA 2DIQA 2D9TA 2YLCA 4J8OA 3VKIA 2GFAA 1UEBA 1X01A 3I55T 3CCST 4KUDK 4FT4A 1Q7YC 1NPRA 4A4EA 5LJ3g 4KBMB 2LNVA 4C92C 3CMET 3QYHB 2QQRA 3QZ9B 4A4GA 4C8QA 3MEWA 4OP0A 4NS5A 3OW2A 4QQ6A 3UPUA 4LD6A 4JRPA 3HSBA 3OMCA 2CGHA 2KAFA 5KCOA 4HCZA 3HRUA 2HAXA 2JTFA 1QVFA 2DXBA 3CBMA 3G71T 2OTLA 1JB0E 3JB9G 1Q82C 4IUPA 1FX7A 5C0MA 1M1FA 2OTLT 5GMKi 2XDBA 1JBMA 1O75A 3PNWC 4A53A 1JRIA 4PLIA 5LJ5h 3HFNA 5DY9A 3GPLA 2MWPA 1YI2A 2RJCA 2EFIA 1BIAA 5CKFA 4F7UF 2A3LA 5KE3A 3TCJA 3OBWA 3NFCA 4J6YA 1KQSS 1Q81C 1WGSA 5GMKe 3L2VA 5GAN3 4OB3B 3VYGA 3MP6A 3PFSA 2RHYA 3E1SA 3MEUA 1XNIA 3V8KA 5GANj 2VC8A 1BYMA 4RCBA 1UB4A 2QTXA 1N9SA 1VQOA 2E1HA 3CCUT 4BACA 5GMKj 4M78C 1YJNA 1K8AC 1QP3A 3VYHB 5KCHA 1B34B 1G3SA 3A8OB 5LJ3f 2ZPFB 4M75C 4PNOA 3DKMA 2K5FA 3A8HB 4IUVA 5LL6S 4BE0A 3S3OA 1NJIC 3HFOA 4M75B 3QJYA 4JRKA 3CMAA 2FHDA 2QI2A 2CZ6B 2QXFA 2EJ9A 1VQ9A 2CZ7B 5KE2A 1VQLA 2EQKA 3DLMA 1VQ9T 2DAQA 1X6OA 1N9RA 2AHJB 2VGNA 1VIEA 4NL3A 1WPYA 3QKJA 4HCBA 4BE1A 3META 4N4GA 4C92G 4F7UA 2QEXT 3CCQA 3OS0A 3OA6A 5IT9E 3A8LB 3CC2A 1VQNA 1KG1A 1G5VA 1Y71A 3ER0A 2LVMA 3CCLT 3M9QA 4XTYA 2X4WA 4RMOA 3QIIA 1NZ9A 3M57A 4N4IA 4BY6C 1VQ8T 4C8QC 1W2BA 2RA2A 2DVEA 5J26A 1S72T 4N0AC 4M7AE 3CC4T 2QEXA 3R6OA 3T9NA 5KH6A 3LGFA 2CKKA 4DOVA 2XI9A 3NTHA 3QZ5B 3M4GA 4UC4A 1BIBA 5D6YA 4E7IA 3KBGA 2MF2A 3SWNA 4CRIA 1WJSA 1ZQ1A 2O01E 3OSSC 4XU2A 4C8QG 3OW2S 4X9CA 3LWIA 4JDSA 1X75C 2RK2A 2XIDA 4KT0E 5GMKh 3CC4A 3J7AF 2F5TX 4PJOF 2ZPBB 2YLBA 3H6ZA 3JB9H 3CD6T 2RM4A 4MZTA 4C0FA 4MDXA 1BI0A 2K2VA 3JCMc 2ZZDA 5CO7A 2KVQG 3A8GB 4C0GA 4A4FA 3J80E 5EG2A 2MI6A 4PJOG 1K73U 2VV5A 5GAOl 2O4XA 3I56A 4M7DG 3X20B 4ELZC 4MMLA 2OAUA 4M77C 2X35A 1VQPT 4C5IA 1WQWA 2FVUA 2R58A 2V8IA 4WF2A 4FIBA 4LDVA 5GAOq 3RUXA 1XTDA 2DKGA 3G6EA 3S6WA 2XG8D 2XICA 3QDRB 4J7IA 4GLKA 4XAXB 4N0AA 4IURA 1I8FA 4BE2A 1Q82U 3JAME 1KD1U 1RI0A 2EKOA 4TVRA 3M59A 1N6AA 4J6WA 2Y90A 4Q5WA 2H3JA 2RJFA 2YRVA 3ME9A 4HT9A 2EJGA 2LCCA 3CPFA 2F69A 3PIOA 3I56T 4OMFB 1NPPA 5GMKm 1TH7A 3M56A 2B8AA 4X9DA 4B9XA 5DLOA 4C8QB 1YHQA 2VXEA 3UT1A 3MEAA 2DEQA 3V8LA 3VUBA 1SSFA 5FU7B 3JCMe 2X4JA 3E9GA 2RI2A 3RMSA 5CQYA 4L6V5 2L8DA 3JCMg 2MAMA 1YITA 4MDWA 5GAMe 1VQMT 1VQ4A 5HY6A 1NE8A 3CMEA 2EQJA 3SD4A 3RERA 2DJZA 3OYIA 4XU1A 2RD1A 5D6WA 4ZN1A 4M78F 4M7DB 1OZ2A 1FWZA 4C92A 3OS5A 3C94A 2EAYA 3I55A 4M78A 4LDUA 3OYLA 1QVPA 2EJFA 2P0QA 3ZEHA 1VQ7T 3M54A 3QG1A 4C5GA 1NJIU 4LDYA 5LJ5j 3A5ZB 3GNFB 5FLXE 4Z02A 3VU3C 4ZTFA 4X34A 5GAMj 1H3ZA 1YJNT 2VUBA 5CKDA 4C92B 1M9SA 4RCCA 1P92A 4M78E 4Y28E 2QQBA 3LWHA 1OZ3A 5LJ5e 3CD6A 3QBYA 5LJ3h 4BI3A 3CCVA 2BIVA 1BI3A 3C12A 4XTWA 2M16A 5L8RE 4BUGA 3OYEA 4BDZA 1N8RC 4XU0A 1K9MU 3OYJA 1H641 4XTXA 4M7AB 2XU8A 2KMTA 1YI2T 3CCET 2P0PA 4LDXA 2PVGB 3CCJT 1DJ7B 3JB9D 1QP2A 4OB1B 4XTUA 5FU6C 3JCMf 4J5YA 3RIRA 2EIFA 1YJWA 3CCRA 3G7ZA 4M77F 3LYIA 2ZCFB 3JCMb 2X4XA 1YHQT 2GF7A 3L1AA 5D6XA 1R8OB 2QA4T 4L59A 4A54A 1KC8U 3LW5E 5LJ3j 2JUFA 1YIJT 2X4YA 4E7KA 5HKCA 2R5AA 4F7UG 2DD5A 2IVWA 2M1HA 2E64A 1IZ6A 2M9UA 2K4YA 3MP8A 4DQ2A 3JCMW 4LD9K 3CBPA 3OYBA 2M0OA 4D6WA 4A4KA 1YJ9A 2VGMA 3WVDB 4ZN3A 4R55A 2LT4A 4YTLA 5GAMf 2K3XA 2RK1A 4M75E 4C92E 3CXCA 3CXCS 2E12A 2HBPA 3AHUA 5DM7R 4M77D 3E9FA 2LC4A 4Y91A 4ZGEB 3PTAA 1I5LA 4E7HA 2QQ9A 1Q81U 2DD4A 1D3BA 3QPHA 3G4SA 3HHTB 2JNGA 3CPWA 4JLGA 4J83A 3JSCA 2P4TA 4C5HA 3OS2A 3RESA 3E19A 3OBYA 1ZHIA 3BW1A 1MHNA 3N5BB 2RJDA 2ZGWA 3ZFJA 1OYXA 5A0LA 5M9OA 1VQ5A 3V8JA 1Y7XA 3DB3A 3X25B 1M5Q1 4BI4A 3L2QA 4M7DE 4M75D 3JCMJ 1WJQA 3P8BB 5A0DA 5FRMA 4JRIA 1Y96B 4L5GA 1VQKA 2DK3A 5CAIA 2ZPIB 2E41A 2E65A 2RI5A 4FM4B 4ZGDB 4MMKA 4EMKB 3CMAT 3P8DA 1VQ4T 1UGQB 2RHIA 1VQMA 3EFSA 2YHTA 1HXDA 4HA8A 4JRQA 3SWNB 4DA4A 4NL2A 1YIJA 1VUBA 1VQOT 4C0ZA 1AHJB 5FROA 1VQ6A 1KQ2A 4HT8A 5CR2A 5I2SA 5FU7C 2RI3A 1M4ZA 3M55A 1VQ6T 3JCMX 2QDYB 5GAMg 4RG8A 5LJ5f 2HNIA 3OYCA 3CCQT 3JB9J 1MGQA 3GIBA 1YCYA 1QVGA 3WXMB 2XK0A 4EMHA 4QVCA 5GANf 3CCMT 3JRZA 3OYMA 1LOJA 1Y07A 2DPPB 2ZPEB 3CEYA 3SB2A 4M7DD 2L3RA 3RKWA 3PMTA 2BUDA 4QVZA 2DZCA 3OYDA 1M1KC 2V8KA 3OYYA 2E10A 4OGCA 1VQ8A 5LJ3d 2DXUA 3JCMP 2FL7A 3A8MB 3L2ZA 4E47A 2LRQA 2XDPA 3QSUA 4IKFA 1KQSA 2K57A 3CCRT 2RHXA 2CZ0B 3CC2T 1VQNT 2I2LA 3UDCA 1OI1A 1Q7YU 5GAN5 2L5QA 4ZTJA 3C4SA 1UGPB 2WSEE 5GMKl 3HPWA 1UGRB 2Y4YA 1VIFA 1RL2A 2QQAA 4FT2A 3X28B 2CZ1B 3MHXA 3OY9A 2NLUA 1QVGS 1I81A 2MMPA 3CPWS 3CCSA 3S3NA 3C95A 4XTZA 5GAMd 4PJOB 5HK3A 4OB2B 4MZPA 3OSVA 3G6ET 3OS1A 1BI2A 3JCMV 2KQWA 2HD0A 3F70A 4PJOE 2O4XB 4F7UB 3JB9I 5CQXA 4CI0C 2MWOA 2OTJT 1VQ5T 3MO8A 5A2QE 4ZGJB 3M58A 4BD3A 1KD1C 1M90U 4V2SA 5DLQE 5A0GA 5GANg 1K73C 2K3YA 3TEEA 4M7DC 2E70A 2DTIA 2F5KA 1U1TA 2R5MA 2EQMA 4OB0B 2LX9A 1KHCA 2JTMA 2PUKB 2VXFA 4HKEA 5GANe 3OYKA 1YJWT 1Q86C 1W2BS 3JB9F 5GAOm 2D6FA 4BY6B 1UGSB 2WSFE 4OF1A 2G3RA 5CK9A 4M75A 3CCJA 1YJ9T 5GAN4 4M7AG 3PGGA 1M1GA 1B34A 4M75F 2JZ2A 4M78G 2JN0A 4II1A 1GXIE 3SDZA 3O8VA 4XK8E 3OYNA 3OYAA 4DOWA 4BDYA 3ASKA 3J81E 3M4YA 1S72A 3VJPA 1BI1A 4N4HA 3L2UA 2BKDN 4EMKC 4PLLA 3FB9A 4ELYC 2FYKA 1K9MC 4IUTA 3G71A 4FSXA 1VQPA 4EMKA 1KC8C 3WVEB 5GAN8 3PIPA 5GAN7 4M77E 1IREB 3EFRA 3BFMA 4KUIA 3X24B 3LGLA 3VV0A 4E7LA 1XQHA 3CCUA 2LQKA 3DB4A 2KY9A 1HK9A 1V29B 3OQ5A 3QUIA 4QQDA 3QJ6A 5I2MA 3L2WA 3JCMQ 1ZBXA 3GP8A 2CYZB 2JOYA 3X26B 3PMIA 5LJ3e 4M78D 3OYFA 1Q86U 4M7DF 3CCVT 3CBOA 2JVVA 2EWNA 3GLXA 4J6XA 2PUOB 5IAYA 2KK4A 3RMQA 1I4K1 5GAOn 5CKBA 2DIGA 3CCMA 2A7YA 2L89A 3L2RA 4QVDA 2PVDB 3H8ZA 3HRTA 2DTHA 3FJPA 3QHSA 2XD0A 4A4HA 1K8AU 3GOXA 5FRNA 3INZA 1WQ7A 2LT1A 4C92F 4E7JA 2DZ9A 3FLGA 2GCXA 3CCLA 4ATOA 1QW1A 2LQ8A 4OVAA 4O5VA 2ZPGB 4FL6A 1G3TA 1G3WA 3S3MA 1N27A 1D3BB 4P5NA 4MZMA 4GY5A 4BB7A 1M1KU 3DLLA 1BKBA 2LCLA 4IUQA 3QXEB 4PKCC 2EYQA 2HQEA 5FU6B 4M7AF 3CC7A 1YITT 2FB7A 4QQGA 3V7SA 4PJOC 3HRSA 5LJ5d 3NTKA 3URGA 1PSEA 2RJEA 4FU6A 3MP1A 1EIFA 2K5IA 3LX7A 1VQKT 4PL6A 5CCAA 4RG2A 4C92D 4M7DA 2EQUA 5LJ5g 2ZPHB 4PJOA 4M77B 3KUFA 2RH2A 4HCCA 3OB9A 2RB6A 3FC3A 2PQWA 1LNXA 1WJRA 3P8HA 3ZBDA 3HL8A 3TU4K 1U8RA 3M53A 1FXXA 2WSCE 2VYTA 5C6SA 3GNGA 4C8QF 3G4ST 4JS5A 2R57A 4C0DB 4M7AD 2DXCA 3FEOA 1VQ7A 5GAN2 2DTOA 4XTVA 4R56A 1VQLT 3RKXA 3KXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BIV A;  3S3N A;  5KE2 A;  2EQK A;  3DLM A;  2WAC A;  2DAQ A;  2M16 A;  3Q1J A;  5J39 A;  3OS1 A;  3OYE A;  4BDZ A;  3QKJ A;  3OYJ A;  3F70 A;  2O4X B;  3MEV A;  2MWO A;  2GFU A;  2P0K A;  3MO8 A;  3NTI A;  4BE1 A;  3MET A;  4N4G A;  3LLR A;  4BD3 A;  5CIU A;  3OS0 A;  3OA6 A;  3L42 A;  2HQX A;  4B9W A;  2K3Y A;  2F5K A;  2R5M A;  4C5E A;  2LVM A;  3BDL A;  2EQM A;  2X4X A;  2X4W A;  1KHC A;  2GF7 A;  3LYI A;  3M9Q A;  3QII A;  4N4I A;  5D6X A;  3OYK A;  4L59 A;  3OYH A;  5J26 A;  2X4Y A;  3OYG A;  4E7K A;  5KH6 A;  2G3R A;  2R5A A;  3LGF A;  3UWN A;  2CKK A;  4E7I A;  3NTH A;  2M1H A;  2IG0 A;  2E5Q A;  3MP8 A;  4IUU A;  4UC4 A;  5D6Y A;  4CRI A;  1WJS A;  2JZ2 A;  2RHU A;  3OYB A;  2M0O A;  4II1 A;  3O8V A;  2LDM A;  3FDR A;  3OYN A;  3OYA A;  4BDY A;  3ASK A;  2K3X A;  3EAE A;  4QW2 A;  2RHZ A;  3H6Z A;  4N4H A;  3L2U A;  2BKD N;  3E9F A;  4EDU A;  4PLL A;  2RO0 A;  4E7H A;  4IUT A;  4A4F A;  4C5H A;  3OS2 A;  3LH0 A;  2O4X A;  2LTO A;  1G5V A;  3LGL A;  1MHN A;  3OMG A;  2RJD A;  5IN1 A;  4E7L A;  1OYX A;  3OQ5 A;  2X35 A;  3DB4 A;  5M9O A;  3DB3 A;  4QQD A;  2R58 A;  2QQS A;  3QJ6 A;  2E6N A;  4C5I A;  3L2Q A;  2DIQ A;  3L2W A;  1WJQ A;  2D9T A;  5FRM A;  3S6W A;  3PMI A;  3OYF A;  2GFA A;  2RI5 A;  4IUR A;  4A4E A;  4BE2 A;  5IAY A;  1RI0 A;  2EKO A;  2QQR A;  4A4G A;  3MEW A;  3P8D A;  2DIG A;  4NS5 A;  2RHI A;  4Q5W A;  2RJF A;  2L89 A;  2YRV A;  3ME9 A;  4QQ6 A;  4LD6 A;  3H8Z A;  3L2R A;  2LCC A;  3OMC A;  5KCO A;  4HCZ A;  2JTF A;  4A4H A;  3GOX A;  2B8A A;  5FRO A;  4B9X A;  4E7J A;  5FRN A;  3FLG A;  4IUP A;  3UT1 A;  2RI3 A;  3MEA A;  4OVA A;  5C0M A;  1SSF A;  3E9G A;  4FL6 A;  2RI2 A;  3PNW C;  3OYC A;  3S3M A;  1N27 A;  4PLI A;  2L8D A;  4GY5 A;  2XK0 A;  2MWP A;  4IUQ A;  3OYM A;  2EFI A;  2HQE A;  2RJC A;  5KE3 A;  3CEY A;  2EQJ A;  3SD4 A;  4QQG A;  3OYI A;  3NTK A;  1WGS A;  5D6W A;  2L3R A;  3OYD A;  2RJE A;  2BUD A;  1OZ2 A;  3MP1 A;  3PMT A;  4FU6 A;  4QVZ A;  3L2V A;  3LX7 A;  3MP6 A;  4PL6 A;  3PFS A;  2RHY A;  3MEU A;  4RG2 A;  3OYL A;  1XNI A;  2EQU A;  2LRQ A;  2XDP A;  3ZEH A;  4IKF A;  3KUF A;  2RHX A;  4C5G A;  3OB9 A;  3FC3 A;  2PQW A;  1WJR A;  4BAC A;  1OI1 A;  3P8H A;  4Z02 A;  4ZTF A;  4X34 A;  1H3Z A;  4ZTJ A;  3C4S A;  5KCH A;  4BE0 A;  4IUV A;  3S3O A;  2VYT A;  5C6S A;  2R57 A;  3FEO A;  2FHD A;  3OY9 A;  2NLU A;  1OZ3 A;  3QBY A; 
#chains in the Genus database with same CATH topology
 2KSS A;  3QO3 A;  2C06 A;  1C6V X;  2PZ1 A;  2LJ1 A;  1TUC A;  3MEV A;  2D0Q B;  2GFU A;  2NWM A;  2YT6 A;  3LLR A;  4JUV A;  1RAE B;  3RNJ A;  3QYG B;  1LJO A;  3RR6 A;  5GJW B;  4B9W A;  4JS4 A;  1ZSG A;  2PU9 B;  4XQ3 A;  1RUW A;  4F04 B;  1PKS A;  5FWB A;  1KHI A;  4M77 G;  4IUU A;  1WHG A;  3EG9 B;  1U1S A;  2V26 A;  1HSQ A;  1VYT A;  3EH2 A;  7AT1 B;  1M90 C;  2JS0 A;  1TU0 B;  2KDS A;  4PK4 A;  1G5V A;  4M7A C;  5GAN h;  2QQS A;  4JJD A;  1X01 A;  2MIO A;  4LUD A;  4A4E A;  1ARK A;  1TUD A;  4DEY A;  2CT3 A;  1E7O A;  3MEW A;  5KYN A;  2EPD A;  1JU5 C;  2CGH A;  3NHN A;  3CBM A;  1JB0 E;  2DRM A;  1M1F A;  2OTL T;  3PE0 A;  1Q95 G;  4E6R A;  2HL5 C;  4DBF A;  4X1V A;  2EFI A;  1BIA A;  2LQW A;  1KQS S;  5GAN 3;  4OB3 B;  3VYG A;  3MEU A;  1OUL A;  3V8K A;  5GAN j;  2VC8 A;  2BZX A;  1VQO A;  1K8A C;  2E1H A;  2MOX A;  5KCH A;  3A8O B;  1SKU B;  4PNO A;  4BE0 A;  2K5F A;  1SHF A;  3HFO A;  4M75 B;  2RQW A;  1VYV A;  2FHD A;  2QXF A;  1QWF A;  2CZ7 B;  1GRI A;  1VQL A;  1ZA1 B;  1VQ9 T;  2DAQ A;  1N9R A;  1VIE A;  3CCJ Q;  1Q82 R;  2CP7 A;  4C92 G;  2QEX T;  3CCQ A;  2RQU A;  3OA6 A;  5IT9 E;  1Y71 A;  3ER0 A;  2LVM A;  3QII A;  4BY6 C;  3EH1 A;  4N0A C;  3CC4 T;  2COZ A;  3LGF A;  2CKK A;  3NTH A;  1SG5 A;  5D6Y A;  3M4G A;  3KBG A;  2MF2 A;  1ZQ1 A;  4B6M A;  2DBK A;  2XID A;  4KT0 E;  2KGT A;  2F2X A;  5GMK h;  3CC4 A;  1WYX A;  2ZPB B;  2BZ8 A;  2RM4 A;  2ZZD A;  1UFF A;  2KVQ G;  3CPW P;  3CCL Q;  4C0G A;  4A4F A;  4PJO G;  4J9F A;  2O4X A;  3I56 A;  4KGZ B;  3X20 B;  4ELZ C;  2L0A A;  4MML A;  2OAU A;  1UJY A;  2X35 A;  1ZSZ B;  2DX1 A;  5ECA A;  2XIC A;  1ZUY A;  3QDR B;  4J7I A;  1PNJ A;  2JTE A;  4IUR A;  1Q82 U;  2ROL A;  1TUG B;  1PHT A;  2RJF A;  2YRV A;  4HT9 A;  2QG9 B;  1TSF A;  2LCC A;  1NPP A;  4D8D A;  3NGP A;  4C8Q B;  1VQ6 Q;  1UE9 A;  3VUB A;  3JCM e;  1YIT A;  2K7A A;  3EG1 A;  1BB9 A;  2DJZ A;  3U23 A;  3OYI A;  1VQK Q;  4M78 F;  2AT1 B;  2HQH A;  1WA7 A;  3C94 A;  3I55 A;  1UHF A;  2J7I A;  4F14 A;  1QVP A;  2P0Q A;  1N8R R;  2PTK A;  3A5Z B;  3GNF B;  1H3Z A;  5GAM j;  2ABL A;  3H0H A;  2RQT A;  2X3X D;  1OZ3 A;  5IHN A;  2BIV A;  1BI3 A;  1M1K R;  1N8R C;  4BDZ A;  1OU8 A;  1K9M U;  5KYW A;  4RTW A;  1IB8 A;  2XU8 A;  2KMT A;  1YI2 T;  5D7U A;  1RAH B;  4LDX A;  1OX8 A;  1G8X A;  3CCJ T;  1M2V B;  2JM9 A;  1YJW Q;  3G7Z A;  2ZCF B;  3MKD A;  2QA4 T;  1H92 A;  2J06 A;  1FMW A;  1CKA A;  2M9U A;  1IZ6 A;  4DQ2 A;  3JCM W;  2CSQ A;  3OYB A;  2RN8 A;  1YJ9 A;  2VGM A;  2HMA A;  2LT4 A;  2RK1 A;  4M75 E;  3C0C A;  3CXC S;  1TOV A;  4K11 A;  2HBP A;  3CXC A;  3AHU A;  5DM7 R;  1W6X A;  4E7H A;  2QQ9 A;  1I1J A;  1Q81 U;  1MMD A;  3HHT B;  3CPW A;  4C5H A;  1B07 A;  3BW1 A;  2DM1 A;  2CP5 A;  2RJD A;  3ZFJ A;  4AFQ C;  5A0L A;  3M0Q A;  4M75 D;  3P8B B;  4L5G A;  2HL3 A;  3TQ7 P;  1XJW B;  2RI5 A;  3CME Q;  4MMK A;  4EMK B;  3CMA T;  2G6F X;  1WHK A;  2GBQ A;  1VQM A;  2COW A;  2YHT A;  4JRQ A;  1NEB A;  4NL2 A;  3RBB B;  1AHJ B;  2CP3 A;  1ZUU A;  1KQ2 A;  5CR2 A;  1I5O B;  5FU7 C;  1M4Z A;  3MJX A;  1VQ6 T;  1UJ0 A;  1YFN A;  2OI3 A;  1QVG A;  1TTH B;  1R77 A;  4HVW A;  1QCF A;  1NYF A;  3RKW A;  3OYD A;  1M1K C;  2V8K A;  2NYS A;  3G6E Q;  1Q81 R;  4OMP A;  2F2V A;  3A8M B;  4E47 A;  4JJC A;  9ATC B;  1G83 A;  3ULR B;  1JXO A;  2I2L A;  3UDC A;  1OI1 A;  4JPB W;  4ZTJ A;  2B86 A;  2KNB B;  1QWE A;  1VIF A;  3SHW A;  3X28 B;  2CZ1 B;  3OY9 A;  2NLU A;  1RAF B;  5GAM d;  3OSV A;  3CD6 Q;  2KQW A;  1X6G A;  2M51 A;  2OTJ T;  4GBQ A;  5CQX A;  4RTV A;  1VQ5 T;  5A2Q E;  2HDA A;  3M58 A;  4BD3 A;  1R0B G;  2K3Y A;  4M7D C;  2E70 A;  3ZBD A;  2ED0 A;  2LX9 A;  2PUK B;  1YJW T;  3JB9 F;  2D6F A;  4BY6 B;  1MUZ A;  2WSF E;  3I55 Q;  2G3R A;  2EYX A;  4J9E A;  1QCO A;  2GGR A;  4II1 A;  4LE9 A;  3UA6 A;  4AG2 C;  4DOW A;  1YIT Q;  1VQ9 Q;  3H41 A;  4EMK C;  3FB9 A;  4ELY C;  1R0C B;  4EMK A;  1KIK A;  3WVE B;  5GAN 8;  1IRE B;  4PJN A;  1AWX A;  2DTO A;  3L2W A;  1SF9 A;  2JOY A;  4M7D F;  3OYF A;  3CCV T;  1MMN A;  2CUB A;  2EWN A;  4J6X A;  5IAY A;  1YI2 Q;  2DNU A;  5CKB A;  2DIG A;  4QVD A;  4J9I A;  2DF6 A;  3REA B;  2EGA A;  3I56 Q;  5FRN A;  1AVZ C;  2OTL Q;  2GCX A;  3CCL A;  2LP5 A;  1QW1 A;  1G3W A;  1NLP C;  1D3B B;  3THK A;  2P4R A;  4BB7 A;  4M7A F;  2VWF A;  1YIT T;  3URG A;  1ABO A;  1PSE A;  1EIF A;  1VQK T;  2I0N A;  4C92 D;  1Y0M A;  4PJO A;  4M77 B;  3O5Z A;  2RH2 A;  4HVV A;  2O31 A;  3FC3 A;  2AZV A;  4QT7 A;  3GNG A;  4JS5 A;  4WCI A;  4C8Q A;  3RKX A;  2NUT A;  5GAM h;  2CDT A;  1PSF A;  5AT1 B;  2CS7 A;  1M2V A;  5CKH A;  5GAN d;  2HSP A;  4JJN K;  3NTI A;  4RTZ A;  3KFV A;  3HP9 A;  5CIU A;  3L42 A;  2QA4 A;  3FIF A;  2DXT A;  1RAC B;  3OYH A;  1NEG A;  2YUQ A;  3OYG A;  2RQR A;  2IG0 A;  2EYY A;  1M27 C;  2OTJ A;  2RHU A;  4CC7 A;  2LDM A;  2DO3 A;  4ME7 A;  3EAE A;  5J3B A;  1ZUK A;  4EDU A;  2OJ2 A;  2RO0 A;  1JJ2 A;  2EGC A;  1JJ2 S;  1YBY A;  2H8H A;  2FPF A;  1AD5 A;  1W4S A;  2L3Q A;  2LNH B;  5HK0 A;  2XHC A;  2V8J A;  4RKU E;  3JCM h;  2J6K A;  4XU3 A;  2O9V A;  1KQ1 A;  3OMG A;  4EMG A;  4J7F A;  3VUZ A;  2E6N A;  3V7R A;  2D9T A;  2DBM A;  1M3A A;  4KUD K;  1PRL C;  2NUP B;  1Q7Y C;  1F1B B;  4JZ3 A;  5LJ3 g;  4C92 C;  3CME T;  2VKN A;  4NS5 A;  3EGX B;  4AT1 B;  3OW2 A;  4LD6 A;  3HSB A;  3OMC A;  2KAF A;  2DYI A;  2DXB A;  2AZS A;  2RMO A;  3TVT A;  3G71 T;  4IUP A;  4RTY A;  4AG1 C;  1D0X A;  1FX7 A;  1TS9 A;  2FPD A;  3PNW C;  4A53 A;  3CCM Q;  3HFN A;  4Z89 A;  5DY9 A;  1UTI A;  5KE3 A;  3H9N A;  4RUG A;  3TCJ A;  3OBW A;  1Q81 C;  5GMK e;  4A63 B;  3MP6 A;  3PFS A;  4FYY B;  2RHY A;  1AT1 B;  1BYM A;  1YJN A;  5GMK j;  2QA4 Q;  1G3S A;  4M75 C;  3A8H B;  4D8K A;  3S3O A;  4JRK A;  1QMC A;  2QI2 A;  2CZ6 B;  1S72 Q;  2O88 A;  1RAG B;  2EQK A;  4RTX A;  1X6O A;  1SRL A;  3M0R A;  3PVL A;  2YRD A;  3OS0 A;  3CC2 A;  2AKK A;  3M9Q A;  4RMO A;  2X4W A;  4C8Q C;  2RA2 A;  1TWB A;  2DIL A;  4DOV A;  2NUZ A;  3SWN A;  1WJS A;  2FZG B;  2J6O A;  4XU2 A;  1AWJ A;  4JDS A;  3LWI A;  1RAA B;  4PJO F;  1CSK A;  4C0F A;  4MDX A;  2K2V A;  3JCM c;  5CO7 A;  2QTV A;  3A8G B;  4KGV B;  3J80 E;  2MI6 A;  5GAO l;  4PFP A;  2K79 A;  4M77 C;  3VS6 A;  5GAO q;  3REB B;  1XTD A;  2DKG A;  1QKW A;  4Z8A A;  2XG8 D;  2DEU A;  5IHK A;  4N0A A;  1OEB A;  2YUN A;  2EKO A;  1N6A A;  2LMJ A;  1VYU A;  2SEM A;  4J6W A;  2H3J A;  3ME9 A;  4FYX B;  3I56 T;  2KRN A;  1WXT A;  4B9X A;  4DBR A;  4FYW B;  1KFZ A;  1BK2 A;  2DEQ A;  3V8L A;  5CQY A;  4L6V 5;  1KC8 R;  3SD4 A;  4XU1 A;  5D6W A;  4ZN1 A;  3M0P A;  1FWZ A;  3OS5 A;  4LDU A;  3OYL A;  2BE7 D;  2EJF A;  3VRZ A;  1VQ7 T;  1VQ5 Q;  2HKN A;  3G4S Q;  2EBP A;  1M9S A;  2NUT B;  4RCC A;  1JJ2 P;  4Y28 E;  3CD6 A;  3QBY A;  5LJ3 h;  1V76 A;  4BI3 A;  3C12 A;  4XTW A;  2M16 A;  3CCS Q;  2FRW A;  3OYE A;  1PCX A;  2DYB A;  3FJ5 A;  1WHJ A;  2JMC A;  1QP2 A;  4XTU A;  1KJW A;  2EIF A;  3CCR Q;  3CCR A;  3JCM b;  2GF7 A;  3TSW A;  4A54 A;  1OX9 A;  2JUF A;  1YIJ T;  1BU1 A;  2X4Y A;  4E7K A;  5HKC A;  4J9G A;  2IVW A;  4LD9 K;  4AFZ C;  1YCS B;  3CBP A;  4A4K A;  4ZN3 A;  4YTL A;  3VS1 A;  2K3X A;  2HZY A;  4C92 E;  3IQL A;  4M77 D;  4Y91 A;  3PTA A;  4CC3 A;  1OPL A;  1W1F A;  1NM7 A;  2FO0 A;  2JJ9 A;  2EW3 A;  2O2O A;  1UHC A;  2JXB A;  4J83 A;  4JLG A;  1IXD A;  2X9H A;  4E7Z A;  2OX7 A;  3E19 A;  1MHN A;  3N5B B;  1OYX A;  1Y7X A;  3DB3 A;  1QQJ A;  3X25 B;  3L2Q A;  1JQQ A;  1WJQ A;  5FRM A;  1MMA A;  1Y96 B;  5CAI A;  2ZPI B;  2A08 A;  3I35 A;  2EYW A;  1VQ4 T;  1W2B P;  2RHI A;  4AFU C;  3SWN B;  4DA4 A;  2D1X A;  1PKT A;  5FRO A;  4FW1 A;  5I2S A;  2RI3 A;  3VS3 A;  1WXU A;  2QDY B;  3CCQ T;  1MGQ A;  2GTO A;  4EMH A;  2XK0 A;  3JRZ A;  4LNP A;  4CC2 A;  1LOJ A;  3CEY A;  2L3R A;  3PMT A;  4QVZ A;  2DZC A;  2KI7 A;  2KXD A;  3OYY A;  2AK5 A;  5LJ3 d;  1VQ8 A;  3L2Z A;  3QSU A;  2F2W A;  1PD0 A;  3EG3 A;  1KQS A;  2W0Z A;  4FCY A;  3CC2 T;  5FW9 A;  5GAN 5;  2L5Q A;  1UGP B;  1RLQ C;  1UGR B;  2DL5 A;  2RNA A;  4J9C A;  3CPW S;  4R0K A;  4XTZ A;  1PRM C;  4KH1 B;  3JCM V;  2HD0 A;  4PJO E;  2X51 A;  4F7U B;  3BE3 A;  1GFC A;  1KD1 C;  1K73 C;  3TEE A;  2EQM A;  4HKE A;  2JTM A;  1Q86 C;  1W2B S;  1UGS B;  4M7A G;  3PGG A;  1M1G A;  1B34 A;  4M78 G;  2JN0 A;  3SDZ A;  1VQ4 Q;  3OYA A;  4BDY A;  1PC0 A;  3ASK A;  3J81 E;  1S72 A;  3VJP A;  4JJB A;  1K8A R;  3MPU B;  3QWX X;  3G71 A;  4FSX A;  1KC8 C;  3PIP A;  1YJN Q;  2VB6 A;  3EFR A;  4M77 E;  1WZO A;  3LGL A;  3VV0 A;  1YJN T;  2LQK A;  4E2F B;  1V29 B;  4FW2 A;  3QJ6 A;  3JCM Q;  3GP8 A;  3X26 B;  1Q86 U;  3CBO A;  3PVQ A;  1B3Q A;  3CCM A;  2L89 A;  4OMM A;  3EGU A;  1H3H A;  4A4H A;  1MV0 B;  3FLG A;  2DER A;  4OVA A;  1FMK A;  1NLO C;  4MZM A;  1M1K U;  3CC4 Q;  1ZA2 B;  2LQN A;  2O9S A;  2HEQ A;  3VS0 A;  3HRS A;  3NTK A;  2DMO A;  3MP1 A;  3A98 A;  1KD1 R;  2QEX Q;  4RG2 A;  4M7D A;  2V1R A;  4FYV B;  5LJ5 g;  2IPO B;  3KUF A;  2KXC A;  3M0U A;  2RB6 A;  2PQW A;  1WJR A;  3TU4 K;  3HL8 A;  2V1Q A;  2DET A;  1LCK A;  4C0D B;  2DXC A;  1VQL T;  1Z9Q A;  4M77 A;  1VQL Q;  3HKS A;  3Q1J A;  5GAO r;  2OTJ Q;  3VS4 A;  1C0M A;  1M8M A;  2P0K A;  3SFM A;  1QVF S;  4M7A A;  3PT9 A;  4LDW A;  3EGX A;  3TRE A;  3BDU A;  1VQO Q;  3BDL A;  1NJI R;  2PVO B;  1PD1 A;  3SWN C;  4EPC A;  5I21 A;  1K0X A;  2JM8 A;  2E5Q A;  5CKE A;  5AYF A;  4KH0 B;  4KUL A;  3MCA B;  1TG0 A;  2HKQ B;  5CVI A;  4QW2 A;  2E6Z A;  4OGE A;  2L3P A;  5GAO p;  1YNZ A;  1SPK A;  8ATC B;  4O6J A;  1RAB B;  1XOV A;  1FYN A;  3TSZ A;  1M8V A;  3BY7 A;  3LH0 A;  3RKY A;  4C8Q E;  1IRX A;  1Y96 A;  2FPE A;  2Y4X A;  1JO8 A;  4VUB A;  2GQV A;  1VA7 A;  2CUD A;  2FEI A;  1JXM A;  4J8O A;  1OV3 A;  3CCS T;  1NPR A;  4KBM B;  2JT4 A;  2LNV A;  3QYH B;  4A4G A;  2CP0 A;  2E4H A;  2ESW A;  4QQ6 A;  5KCO A;  3EFO A;  4HCZ A;  2X3W D;  2OTL A;  4J9D A;  4GLM A;  3JB9 G;  2GTJ A;  5C0M A;  3R6N A;  2XDB A;  3CXC P;  4PLI A;  5LJ5 h;  2A36 A;  3GPL A;  1YI2 A;  2D8J A;  2RJC A;  5CKF A;  2KYB A;  3NFC A;  4J6Y A;  1WGS A;  3CCE Q;  2VVK A;  4DBQ A;  4KGX B;  2DL7 A;  5IH2 A;  3E1S A;  2ECZ A;  1KQS P;  5GJV B;  1MMG A;  1HJD A;  5L23 A;  1BBZ A;  2QTX A;  3CCU T;  4BAC A;  3VYH B;  1B34 B;  3G71 Q;  5LJ3 f;  3EGD A;  2ZPF B;  3DKM A;  4IUV A;  5LL6 S;  1NJI C;  1GL5 A;  5KYY B;  4RTU A;  3DLM A;  2VGN A;  4NL3 A;  2AHJ B;  3QKJ A;  1T0H A;  4HCB A;  2DL4 A;  4BE1 A;  3MET A;  1ZSZ C;  1QVG P;  4IIM A;  4F7U A;  1GBQ A;  2CH4 A;  1X6B A;  3A8L B;  4M4Z A;  1VQN A;  2EYZ A;  1UEC A;  1OQK A;  4XTY A;  2DE0 X;  2LX7 A;  2KEA A;  5J26 A;  2IIM A;  2E5K A;  2DVJ A;  3QZ5 B;  4F16 A;  3ZL7 C;  4UC4 A;  1BIB A;  8AT1 B;  3OSS C;  2O01 E;  4C8Q G;  3CC7 Q;  3OW2 S;  1J3T A;  1K76 A;  2ROT A;  1X75 C;  3J7A F;  2MPX C;  2ZAE A;  3H6Z A;  3JB9 H;  3CD6 T;  4MZT A;  4HCK A;  1BI0 A;  2OAW A;  2YUP A;  5EG2 A;  1K73 U;  2AKL A;  4M7D G;  4C5I A;  1WQW A;  2R58 A;  4WF2 A;  4LDV A;  3RUX A;  3G6E A;  3S6W A;  1YN8 A;  1PM3 A;  4GLK A;  4XAX B;  2KRO A;  3JAM E;  1KD1 U;  1RI0 A;  4TVR A;  1U3O A;  2GNC A;  4Q5W A;  2Y90 A;  3CPF A;  2F69 A;  4OMF B;  4X9D A;  5DLO A;  1YHQ A;  2VXE A;  3MEA A;  1EX4 A;  1SSF A;  5FU7 B;  2X4J A;  3E9G A;  2A28 A;  1I0C A;  1VQM Q;  4ANJ A;  3JCM g;  2MAM A;  4MDW A;  5GAM e;  1VQM T;  3CME A;  1K9M R;  2RPN A;  1OZ2 A;  2EAY A;  4M78 A;  3VRY A;  2BZY A;  1BCO A;  1BCM A;  1YWP A;  2NUP A;  1NJI U;  4LDY A;  4F17 A;  4Z02 A;  3VU3 C;  2YUO A;  2QK0 A;  4C92 B;  3LWH A;  2QQB A;  1QVF P;  3CCV A;  1RLP C;  1WLP B;  4OML A;  4XU0 A;  3OYJ A;  1H64 1;  1PG5 B;  3CCE T;  2P0P A;  2CT4 A;  5KYX B;  3JB9 D;  1NG2 A;  5FU6 C;  3JCM f;  1HD3 A;  3RIR A;  2E3H A;  3LYI A;  2X4X A;  3M0S A;  4IIO A;  3L1A A;  5D6X A;  1R8O B;  3VS2 A;  1KC8 U;  3QWY A;  4HVU A;  2M1H A;  2E64 A;  1IO6 A;  1WXB A;  2M0O A;  4D6W A;  3WVD B;  5GAM f;  2E12 A;  2L3S A;  1SRM A;  1X2Q A;  1I5L A;  3G4S A;  3JSC A;  3OS2 A;  3RES A;  3OBY A;  1VQ5 A;  1Q7Y R;  2ZGW A;  3H0I A;  1UG1 A;  4M7D E;  3QDF A;  5A0D A;  4JRI A;  4OMQ A;  1D1B A;  4OMO A;  1VQK A;  2DK3 A;  4PFO A;  3D7S B;  2E41 A;  1WX6 A;  4PJJ A;  1UGQ B;  1WFW A;  1HXD A;  1EZZ B;  1FMV A;  2FG0 A;  4HA8 A;  1RAI B;  2GQI A;  1YIJ A;  1M30 A;  2M0Y A;  2YRC A;  3M55 A;  4RG8 A;  5LJ5 f;  2J6F A;  1YCY A;  3NMZ C;  3VS7 A;  1WHH A;  5GAN f;  1Y07 A;  2ZPE B;  2J05 A;  4M7D D;  2BUD A;  4OGC A;  2E10 A;  2DXU A;  2FL7 A;  2LRQ A;  3CCR T;  2RHX A;  2DL3 A;  1VQN T;  5KYW B;  1Q7Y U;  1ZLM A;  2WSE E;  1QCN A;  5GMK l;  3HPW A;  1NBE B;  2QQA A;  1D1A A;  4FT2 A;  5KYY A;  3NPF A;  1I81 A;  2MMP A;  3C95 A;  4PJO B;  5HK3 A;  1B7T A;  1H8K A;  4MZP A;  3G6E T;  3CCV Q;  3F70 A;  2O4X B;  1IGU A;  3MO8 A;  4V2S A;  5DLQ E;  5A0G A;  5GAN g;  4AMC A;  2F5K A;  4KRT A;  2R5M A;  4OB0 B;  2VXF A;  2YXY A;  5GAN e;  3CCQ Q;  3H0F A;  4OF1 A;  1SEM A;  1YJ9 T;  1E6G A;  1PWT A;  4M75 F;  3O8V A;  1RI9 A;  3EG0 A;  4XK8 E;  3M4Y A;  5IXB A;  4N4H A;  1Y57 A;  2FYK A;  4IUT A;  2HSE B;  1VQP A;  1S1N A;  3BFM A;  3X24 B;  4ZNX A;  3CCU A;  1HK9 A;  1ZBX A;  5LJ3 e;  4M78 D;  2JVV A;  1UDL A;  3GLX A;  1M3B A;  2PUO B;  5GAO n;  2PVD B;  3HRT A;  3FJP A;  2XD0 A;  1K8A U;  2W10 A;  2DZ9 A;  2L2P A;  2M02 A;  4ATO A;  2COY A;  2LQ8 A;  1X2K A;  2YSQ A;  4FL6 A;  2DFU A;  3S3M A;  1N27 A;  4P5N A;  3DLL A;  1BKB A;  2MK5 A;  4PKC C;  2HQE A;  3CC7 A;  3V7S A;  1W70 A;  2RJE A;  4E7S A;  1MNE A;  2K5I A;  3LX7 A;  2C0O A;  4PL6 A;  2H3E B;  2A0F B;  2ZPH B;  2MCN A;  4HCC A;  4Z88 A;  1D0Z A;  1VQN Q;  1WIE A;  3M53 A;  1FXX A;  2VYT A;  5C6S A;  4C8Q F;  3G4S T;  1N5Z A;  5GAN 2;  4C92 A;  4XTV A;  1D1C A;  4IKF A;  3KXT A;  4PJO D;  2DJQ A;  3V7C A;  2WAC A;  4Y92 A;  5J39 A;  4BI8 B;  1KSW A;  3CC7 T;  3M5A A;  3SEM A;  2K5L A;  4M78 B;  4JLI A;  2K3B A;  4M75 G;  1I07 A;  4C8Q D;  2HQX A;  1N8R U;  4C5E A;  2DRK A;  3FRN A;  1G3Y A;  1MND A;  4F7U E;  1WNL A;  4PJL A;  3UWN A;  1V1C A;  2CP6 A;  3CCE A;  3GF5 A;  6AT1 B;  3FDR A;  1VQ7 Q;  2RHZ A;  5GAN 6;  1AOJ A;  2HBW A;  1O9S A;  5KYX A;  2QGF B;  2XKO C;  4NOY A;  4WTO B;  3JCM d;  2XDD A;  2LTO A;  4C0D C;  1YP5 A;  5IN1 A;  1UUE A;  2ENM A;  2YWW A;  2CH4 W;  2DIQ A;  2YLC A;  3VKI A;  3I5R A;  1ZBJ A;  2GFA A;  1UEB A;  3I55 T;  2FRY A;  4FT4 A;  1SSH A;  2QQR A;  3QZ9 B;  4OP0 A;  1OPK A;  3UPU A;  4JRP A;  1QVF A;  2HAX A;  3HRU A;  2JTF A;  3EG2 A;  2KBT A;  1IGQ A;  2FZK B;  2KT1 A;  1M3C A;  1Q82 C;  1AZE A;  4DBH A;  5GMK i;  1JBM A;  1O75 A;  2QGG A;  3EGD B;  4LUE A;  1JRI A;  2MWP A;  5I11 A;  4F7U F;  4CC4 B;  2A3L A;  5KYU A;  2EQI A;  3UF4 A;  4EIK A;  3L2V A;  3AT1 B;  1K4U S;  1XNI A;  2CSI A;  5HCK A;  4RCB A;  1UB4 A;  2SRC A;  1N9S A;  1GBR A;  4M78 C;  1QP3 A;  3QJY A;  3CMA A;  2EJ9 A;  1VQ9 A;  1CKB A;  2QAS A;  5KE2 A;  2K6D A;  2P84 A;  1WPY A;  2HCK A;  1E6H A;  1WHM A;  4N4G A;  2C0I A;  2MYS A;  2QDL A;  1KG1 A;  2JW4 A;  1IHV A;  3CCL T;  1JEG A;  1NZ9 A;  3M57 A;  4N4I A;  4OMN A;  1VQ8 T;  4M7A E;  1W2B A;  2DVE A;  1S72 T;  2DL8 A;  2K9G A;  4PFZ A;  3OW2 P;  1ZX6 A;  2QEX A;  3R6O A;  3T9N A;  3VS5 A;  5KH6 A;  2PNI A;  4E7I A;  2XI9 A;  4CRI A;  1UGV A;  4X9C A;  2EVR A;  2RK2 A;  1ACM B;  2F5T X;  2YLB A;  2FZC B;  2VV5 A;  1M90 R;  1VQP T;  2FVU A;  2V8I A;  4FIB A;  1K9A A;  3I9Q A;  4J9H A;  5IXF A;  1QKX A;  1I8F A;  4BE2 A;  1AWO A;  2KE9 A;  4RTT A;  3M59 A;  2EJG A;  3PIO A;  3CCU Q;  5GMK m;  1TH7 A;  3M56 A;  2B8A A;  2QYZ A;  3UT1 A;  1VQP Q;  1K73 R;  2VAS A;  1WI7 A;  3HTR A;  2D0N A;  2RI2 A;  3RMS A;  1AEY A;  1NYG A;  2L8D A;  4LXC A;  1VQ4 A;  5HY6 A;  1NE8 A;  1GCP A;  2EQJ A;  3RER A;  2RD1 A;  4M7D B;  1KK7 A;  2LCS A;  5FWC A;  4HXJ A;  2RQV A;  3LH5 A;  1K1Z A;  3ZEH A;  2QAZ A;  3M54 A;  3QG1 A;  4C5G A;  5I22 A;  2ED1 A;  5LJ5 j;  2KRM A;  5FLX E;  4ZTF A;  4X34 A;  3EHR A;  2JS2 A;  2VUB A;  3G1J A;  5CKD A;  1WHL A;  1U06 A;  1MV3 A;  1P92 A;  4M78 E;  5LJ5 e;  3A1P A;  2XMF A;  1YJ9 Q;  2KR3 A;  5L8R E;  4BUG A;  2E3I A;  4XTX A;  4M7A B;  1X27 A;  5EC7 A;  2PVG B;  1DJ7 B;  4OB1 B;  3UAT A;  1IHW A;  4J5Y A;  1HYO A;  1YJW A;  1M2O A;  4M77 F;  1YHQ T;  2D8H A;  2LZ6 B;  4L59 A;  3LW5 E;  5LJ3 j;  2A37 A;  1VQ8 Q;  2R5A A;  4F7U G;  2DD5 A;  3MP8 A;  1GCQ A;  2K4Y A;  4DEX A;  4R55 A;  3E9F A;  2LC4 A;  4ZGE B;  1D09 B;  2DD4 A;  1D3B A;  3QPH A;  1VOM A;  2JNG A;  2P4T A;  2LJ0 A;  1ZHI A;  1YIJ Q;  5M9O A;  3V8J A;  1M5Q 1;  4BI4 A;  3JCM J;  2DLP A;  2E65 A;  4FM4 B;  4ZGD B;  1T0J A;  2BE9 B;  3EHQ A;  3P8D A;  3EFS A;  1T3L A;  1VUB A;  1VQO T;  2KYM A;  4C0Z A;  1Z9Z A;  1VQ6 A;  4HT8 A;  1SHG A;  4JZ4 A;  4PJM A;  3JCM X;  1D0Y A;  5GAM g;  1K0S A;  3OYC A;  2HNI A;  3JB9 J;  2CRE A;  3GIB A;  3UA7 A;  3WXM B;  4QVC A;  3JV3 A;  3CCM T;  3OYM A;  1QLY A;  3SB2 A;  2DPP B;  1LVK A;  2JMA A;  1ZSZ A;  1GFD A;  2CP2 A;  4J9B A;  3JCM P;  2XDP A;  1T3S A;  2K57 A;  1YWO A;  2CZ0 B;  1A0N B;  1OU9 A;  3EG9 A;  1AZG B;  2KT8 A;  3C4S A;  1EFN A;  2DA9 A;  2Y4Y A;  1RL2 A;  4FSS A;  3M0T A;  3MHX A;  1QVG S;  2AIR B;  1ABQ A;  3CCS A;  3S3N A;  4OB2 B;  3OS1 A;  1BI2 A;  3RDV A;  1X69 A;  3JB9 I;  4CI0 C;  2MWO A;  4ZGJ B;  1U5S A;  2BTT A;  3CQT A;  1X43 A;  1M90 U;  2KRS A;  2DTI A;  3OYN A;  1U1T A;  4AFS C;  2C0T A;  1KHC A;  3OYK A;  2LJ3 A;  5GAO m;  1GCQ C;  5CK9 A;  4M75 A;  3CCJ A;  5GAN 4;  2JZ2 A;  1GXI E;  4ORZ A;  2EGE A;  1RAD B;  1BI1 A;  3CMA Q;  3L2U A;  2BKD N;  4PLL A;  1K9M C;  1YHQ Q;  5GAN 7;  4KUI A;  1WDX A;  4E7L A;  1XQH A;  3OQ5 A;  1LPL A;  2KY9 A;  3DB4 A;  3QUI A;  4QQD A;  5I2M A;  2Z0W A;  2CYZ B;  3PMI A;  1OOT A;  1AWW A;  2KK4 A;  3RMQ A;  1I4K 1;  2A7Y A;  2F1L A;  3L2R A;  3H8Z A;  2DTH A;  3QHS A;  3GOX A;  3INZ A;  1WQ7 A;  2LT1 A;  4C92 F;  4QKU A;  4E7J A;  4ESR A;  1C1A A;  4O5V A;  2ZPG B;  1G3T A;  2YDL A;  4GY5 A;  2LCL A;  4IUQ A;  3QXE B;  2EYQ A;  3GBQ A;  5FU6 B;  1Q86 R;  3EFO B;  2FB7 A;  4QQG A;  1G2B A;  4PJO C;  5LJ5 d;  4FU6 A;  1TXQ A;  5CCA A;  2EQU A;  3E2U A;  4LN2 A;  3I5S A;  2EKH A;  3OB9 A;  2ATC B;  1LNX A;  3P8H A;  3CC2 Q;  1U8R A;  5KYU B;  2WSC E;  2RF0 A;  2R57 A;  4M7A D;  3FEO A;  1VQ7 A;  2K2M A;  5IHI A;  4R56 A; 
#chains in the Genus database with same CATH homology
 2KSS A;  3QO3 A;  4M77 A;  5GAM h;  3V7C A;  3HKS A;  2WAC A;  3Q1J A;  5J39 A;  5GAO r;  2C06 A;  1PSF A;  4BI8 B;  3CC7 T;  2CS7 A;  3MEV A;  3M5A A;  5CKH A;  5GAN d;  2D0Q B;  2GFU A;  2P0K A;  3NTI A;  3SFM A;  4JJN K;  2K5L A;  3LLR A;  1QVF S;  4M78 B;  4JUV A;  4M7A A;  3QYG B;  3PT9 A;  4JLI A;  4LDW A;  1LJO A;  3HP9 A;  4M75 G;  5CIU A;  3L42 A;  4C8Q D;  2HQX A;  4B9W A;  2QA4 A;  4JS4 A;  3TRE A;  1N8R U;  3BDU A;  2PU9 B;  3BDL A;  4XQ3 A;  3FIF A;  4C5E A;  3FRN A;  2DXT A;  1G3Y A;  2PVO B;  3SWN C;  4F7U E;  3OYH A;  1WNL A;  4EPC A;  5I21 A;  3OYG A;  3UWN A;  1KHI A;  2IG0 A;  4IUU A;  2E5Q A;  4M77 G;  5CKE A;  5AYF A;  3CCE A;  3GF5 A;  2OTJ A;  1U1S A;  2RHU A;  4KUL A;  3MCA B;  5CVI A;  2LDM A;  3FDR A;  2DO3 A;  4ME7 A;  3EAE A;  5J3B A;  4QW2 A;  2E6Z A;  4OGE A;  1M90 C;  2RHZ A;  4EDU A;  2KDS A;  2RO0 A;  5GAN 6;  5GAO p;  1JJ2 S;  1JJ2 A;  4PJO D;  1O9S A;  1YBY A;  4O6J A;  1W4S A;  1XOV A;  1M8V A;  5HK0 A;  2XHC A;  2V8J A;  3BY7 A;  2XKO C;  3LH0 A;  4NOY A;  4RKU E;  3RKY A;  3JCM h;  2LTO A;  4C0D C;  4XU3 A;  3JCM d;  5IN1 A;  1KQ1 A;  3OMG A;  4C8Q E;  2XDD A;  4M7A C;  4EMG A;  5GAN h;  4J7F A;  1Y96 A;  3VUZ A;  2Y4X A;  4VUB A;  2QQS A;  2E6N A;  2GQV A;  3V7R A;  2DIQ A;  2D9T A;  2YLC A;  4J8O A;  3VKI A;  2GFA A;  1UEB A;  1X01 A;  3I55 T;  3CCS T;  4KUD K;  4FT4 A;  1Q7Y C;  1NPR A;  4A4E A;  5LJ3 g;  4KBM B;  2LNV A;  4C92 C;  3CME T;  3QYH B;  2QQR A;  3QZ9 B;  4A4G A;  4C8Q A;  3MEW A;  4OP0 A;  4NS5 A;  3OW2 A;  4QQ6 A;  3UPU A;  4LD6 A;  4JRP A;  3HSB A;  3OMC A;  2CGH A;  2KAF A;  5KCO A;  4HCZ A;  3HRU A;  2HAX A;  2JTF A;  1QVF A;  2DXB A;  3CBM A;  3G71 T;  2OTL A;  1JB0 E;  3JB9 G;  1Q82 C;  4IUP A;  1FX7 A;  5C0M A;  1M1F A;  2OTL T;  5GMK i;  2XDB A;  1JBM A;  1O75 A;  3PNW C;  4A53 A;  1JRI A;  4PLI A;  5LJ5 h;  3HFN A;  5DY9 A;  3GPL A;  2MWP A;  1YI2 A;  2RJC A;  2EFI A;  1BIA A;  5CKF A;  4F7U F;  2A3L A;  5KE3 A;  3TCJ A;  3OBW A;  3NFC A;  4J6Y A;  1KQS S;  1Q81 C;  1WGS A;  5GMK e;  3L2V A;  5GAN 3;  4OB3 B;  3VYG A;  3MP6 A;  3PFS A;  2RHY A;  3E1S A;  3MEU A;  1XNI A;  3V8K A;  5GAN j;  2VC8 A;  1BYM A;  4RCB A;  1UB4 A;  2QTX A;  1N9S A;  1VQO A;  2E1H A;  3CCU T;  4BAC A;  5GMK j;  4M78 C;  1YJN A;  1K8A C;  1QP3 A;  3VYH B;  5KCH A;  1B34 B;  1G3S A;  3A8O B;  5LJ3 f;  2ZPF B;  4M75 C;  4PNO A;  3DKM A;  2K5F A;  3A8H B;  4IUV A;  5LL6 S;  4BE0 A;  3S3O A;  1NJI C;  3HFO A;  4M75 B;  3QJY A;  4JRK A;  3CMA A;  2FHD A;  2QI2 A;  2CZ6 B;  2QXF A;  2EJ9 A;  1VQ9 A;  2CZ7 B;  5KE2 A;  1VQL A;  2EQK A;  3DLM A;  1VQ9 T;  2DAQ A;  1X6O A;  1N9R A;  2AHJ B;  2VGN A;  1VIE A;  4NL3 A;  1WPY A;  3QKJ A;  4HCB A;  4BE1 A;  3MET A;  4N4G A;  4C92 G;  4F7U A;  2QEX T;  3CCQ A;  3OS0 A;  3OA6 A;  5IT9 E;  3A8L B;  3CC2 A;  1VQN A;  1KG1 A;  1G5V A;  1Y71 A;  3ER0 A;  2LVM A;  3CCL T;  3M9Q A;  4XTY A;  2X4W A;  4RMO A;  3QII A;  1NZ9 A;  3M57 A;  4N4I A;  4BY6 C;  1VQ8 T;  4C8Q C;  1W2B A;  2RA2 A;  2DVE A;  5J26 A;  1S72 T;  4N0A C;  4M7A E;  3CC4 T;  2QEX A;  3R6O A;  3T9N A;  5KH6 A;  3LGF A;  2CKK A;  4DOV A;  2XI9 A;  3NTH A;  3QZ5 B;  3M4G A;  4UC4 A;  1BIB A;  5D6Y A;  4E7I A;  3KBG A;  2MF2 A;  3SWN A;  4CRI A;  1WJS A;  1ZQ1 A;  2O01 E;  3OSS C;  4XU2 A;  4C8Q G;  3OW2 S;  4X9C A;  3LWI A;  4JDS A;  1X75 C;  2RK2 A;  2XID A;  4KT0 E;  5GMK h;  3CC4 A;  3J7A F;  2F5T X;  4PJO F;  2ZPB B;  2YLB A;  3H6Z A;  3JB9 H;  3CD6 T;  2RM4 A;  4MZT A;  4C0F A;  4MDX A;  1BI0 A;  2K2V A;  3JCM c;  2ZZD A;  5CO7 A;  2KVQ G;  3A8G B;  4C0G A;  4A4F A;  3J80 E;  5EG2 A;  2MI6 A;  4PJO G;  1K73 U;  2VV5 A;  5GAO l;  2O4X A;  3I56 A;  4M7D G;  3X20 B;  4ELZ C;  4MML A;  2OAU A;  4M77 C;  2X35 A;  1VQP T;  4C5I A;  1WQW A;  2FVU A;  2R58 A;  2V8I A;  4WF2 A;  4FIB A;  4LDV A;  5GAO q;  3RUX A;  1XTD A;  2DKG A;  3G6E A;  3S6W A;  2XG8 D;  2XIC A;  3QDR B;  4J7I A;  4GLK A;  4XAX B;  4N0A A;  4IUR A;  1I8F A;  4BE2 A;  1Q82 U;  3JAM E;  1KD1 U;  1RI0 A;  2EKO A;  4TVR A;  3M59 A;  1N6A A;  4J6W A;  2Y90 A;  4Q5W A;  2H3J A;  2RJF A;  2YRV A;  3ME9 A;  4HT9 A;  2EJG A;  2LCC A;  3CPF A;  2F69 A;  3PIO A;  3I56 T;  4OMF B;  1NPP A;  5GMK m;  1TH7 A;  3M56 A;  2B8A A;  4X9D A;  4B9X A;  5DLO A;  4C8Q B;  1YHQ A;  2VXE A;  3UT1 A;  3MEA A;  2DEQ A;  3V8L A;  3VUB A;  1SSF A;  5FU7 B;  3JCM e;  2X4J A;  3E9G A;  2RI2 A;  3RMS A;  5CQY A;  4L6V 5;  2L8D A;  3JCM g;  2MAM A;  1YIT A;  4MDW A;  5GAM e;  1VQM T;  1VQ4 A;  5HY6 A;  1NE8 A;  3CME A;  2EQJ A;  3SD4 A;  3RER A;  2DJZ A;  3OYI A;  4XU1 A;  2RD1 A;  5D6W A;  4ZN1 A;  4M78 F;  4M7D B;  1OZ2 A;  1FWZ A;  4C92 A;  3OS5 A;  3C94 A;  2EAY A;  3I55 A;  4M78 A;  4LDU A;  3OYL A;  1QVP A;  2EJF A;  2P0Q A;  3ZEH A;  1VQ7 T;  3M54 A;  3QG1 A;  4C5G A;  1NJI U;  4LDY A;  5LJ5 j;  3A5Z B;  3GNF B;  5FLX E;  4Z02 A;  3VU3 C;  4ZTF A;  4X34 A;  5GAM j;  1H3Z A;  1YJN T;  2VUB A;  5CKD A;  4C92 B;  1M9S A;  4RCC A;  1P92 A;  4M78 E;  4Y28 E;  2QQB A;  3LWH A;  1OZ3 A;  5LJ5 e;  3CD6 A;  3QBY A;  5LJ3 h;  4BI3 A;  3CCV A;  2BIV A;  1BI3 A;  3C12 A;  4XTW A;  2M16 A;  5L8R E;  4BUG A;  3OYE A;  4BDZ A;  1N8R C;  4XU0 A;  1K9M U;  3OYJ A;  1H64 1;  4XTX A;  4M7A B;  2XU8 A;  2KMT A;  1YI2 T;  3CCE T;  2P0P A;  4LDX A;  2PVG B;  3CCJ T;  1DJ7 B;  3JB9 D;  1QP2 A;  4OB1 B;  4XTU A;  5FU6 C;  3JCM f;  4J5Y A;  3RIR A;  2EIF A;  1YJW A;  3CCR A;  3G7Z A;  4M77 F;  3LYI A;  2ZCF B;  3JCM b;  2X4X A;  1YHQ T;  2GF7 A;  3L1A A;  5D6X A;  1R8O B;  2QA4 T;  4L59 A;  4A54 A;  1KC8 U;  3LW5 E;  5LJ3 j;  2JUF A;  1YIJ T;  2X4Y A;  4E7K A;  5HKC A;  2R5A A;  4F7U G;  2DD5 A;  2IVW A;  2M1H A;  2E64 A;  1IZ6 A;  2M9U A;  2K4Y A;  3MP8 A;  4DQ2 A;  3JCM W;  4LD9 K;  3CBP A;  3OYB A;  2M0O A;  4D6W A;  4A4K A;  1YJ9 A;  2VGM A;  3WVD B;  4ZN3 A;  4R55 A;  2LT4 A;  4YTL A;  5GAM f;  2K3X A;  2RK1 A;  4M75 E;  4C92 E;  3CXC A;  3CXC S;  2E12 A;  2HBP A;  3AHU A;  5DM7 R;  4M77 D;  3E9F A;  2LC4 A;  4Y91 A;  4ZGE B;  3PTA A;  1I5L A;  4E7H A;  2QQ9 A;  1Q81 U;  2DD4 A;  1D3B A;  3QPH A;  3G4S A;  3HHT B;  2JNG A;  3CPW A;  4JLG A;  4J83 A;  3JSC A;  2P4T A;  4C5H A;  3OS2 A;  3RES A;  3E19 A;  3OBY A;  1ZHI A;  3BW1 A;  1MHN A;  3N5B B;  2RJD A;  2ZGW A;  3ZFJ A;  1OYX A;  5A0L A;  5M9O A;  1VQ5 A;  3V8J A;  1Y7X A;  3DB3 A;  3X25 B;  1M5Q 1;  4BI4 A;  3L2Q A;  4M7D E;  4M75 D;  3JCM J;  1WJQ A;  3P8B B;  5A0D A;  5FRM A;  4JRI A;  1Y96 B;  4L5G A;  1VQK A;  2DK3 A;  5CAI A;  2ZPI B;  2E41 A;  2E65 A;  2RI5 A;  4FM4 B;  4ZGD B;  4MMK A;  4EMK B;  3CMA T;  3P8D A;  1VQ4 T;  1UGQ B;  2RHI A;  1VQM A;  3EFS A;  2YHT A;  1HXD A;  4HA8 A;  4JRQ A;  3SWN B;  4DA4 A;  4NL2 A;  1YIJ A;  1VUB A;  1VQO T;  4C0Z A;  1AHJ B;  5FRO A;  1VQ6 A;  1KQ2 A;  4HT8 A;  5CR2 A;  5I2S A;  5FU7 C;  2RI3 A;  1M4Z A;  3M55 A;  1VQ6 T;  3JCM X;  2QDY B;  5GAM g;  4RG8 A;  5LJ5 f;  2HNI A;  3OYC A;  3CCQ T;  3JB9 J;  1MGQ A;  3GIB A;  1YCY A;  1QVG A;  3WXM B;  2XK0 A;  4EMH A;  4QVC A;  5GAN f;  3CCM T;  3JRZ A;  3OYM A;  1LOJ A;  1Y07 A;  2DPP B;  2ZPE B;  3CEY A;  3SB2 A;  4M7D D;  2L3R A;  3RKW A;  3PMT A;  2BUD A;  4QVZ A;  2DZC A;  3OYD A;  1M1K C;  2V8K A;  3OYY A;  2E10 A;  4OGC A;  1VQ8 A;  5LJ3 d;  2DXU A;  3JCM P;  2FL7 A;  3A8M B;  3L2Z A;  4E47 A;  2LRQ A;  2XDP A;  3QSU A;  4IKF A;  1KQS A;  2K57 A;  3CCR T;  2RHX A;  2CZ0 B;  3CC2 T;  1VQN T;  2I2L A;  3UDC A;  1OI1 A;  1Q7Y U;  5GAN 5;  2L5Q A;  4ZTJ A;  3C4S A;  1UGP B;  2WSE E;  5GMK l;  3HPW A;  1UGR B;  2Y4Y A;  1VIF A;  1RL2 A;  2QQA A;  4FT2 A;  3X28 B;  2CZ1 B;  3MHX A;  3OY9 A;  2NLU A;  1QVG S;  1I81 A;  2MMP A;  3CPW S;  3CCS A;  3S3N A;  3C95 A;  4XTZ A;  5GAM d;  4PJO B;  5HK3 A;  4OB2 B;  4MZP A;  3OSV A;  3G6E T;  3OS1 A;  1BI2 A;  3JCM V;  2KQW A;  2HD0 A;  3F70 A;  4PJO E;  2O4X B;  4F7U B;  3JB9 I;  5CQX A;  4CI0 C;  2MWO A;  2OTJ T;  1VQ5 T;  3MO8 A;  5A2Q E;  4ZGJ B;  3M58 A;  4BD3 A;  1KD1 C;  1M90 U;  4V2S A;  5DLQ E;  5A0G A;  5GAN g;  1K73 C;  2K3Y A;  3TEE A;  4M7D C;  2E70 A;  2DTI A;  2F5K A;  1U1T A;  2R5M A;  2EQM A;  4OB0 B;  2LX9 A;  1KHC A;  2JTM A;  2PUK B;  2VXF A;  4HKE A;  5GAN e;  3OYK A;  1YJW T;  1Q86 C;  1W2B S;  3JB9 F;  5GAO m;  2D6F A;  4BY6 B;  1UGS B;  2WSF E;  4OF1 A;  2G3R A;  5CK9 A;  4M75 A;  3CCJ A;  1YJ9 T;  5GAN 4;  4M7A G;  3PGG A;  1M1G A;  1B34 A;  4M75 F;  2JZ2 A;  4M78 G;  2JN0 A;  4II1 A;  1GXI E;  3SDZ A;  3O8V A;  4XK8 E;  3OYN A;  3OYA A;  4DOW A;  4BDY A;  3ASK A;  3J81 E;  3M4Y A;  1S72 A;  3VJP A;  1BI1 A;  4N4H A;  3L2U A;  2BKD N;  4EMK C;  4PLL A;  3FB9 A;  4ELY C;  2FYK A;  1K9M C;  4IUT A;  3G71 A;  4FSX A;  1VQP A;  4EMK A;  1KC8 C;  3WVE B;  5GAN 8;  3PIP A;  5GAN 7;  4M77 E;  1IRE B;  3EFR A;  3BFM A;  4KUI A;  3X24 B;  3LGL A;  3VV0 A;  4E7L A;  1XQH A;  3CCU A;  2LQK A;  3DB4 A;  2KY9 A;  1HK9 A;  1V29 B;  3OQ5 A;  3QUI A;  4QQD A;  3QJ6 A;  5I2M A;  3L2W A;  3JCM Q;  1ZBX A;  3GP8 A;  2CYZ B;  2JOY A;  3X26 B;  3PMI A;  5LJ3 e;  4M78 D;  3OYF A;  1Q86 U;  4M7D F;  3CCV T;  3CBO A;  2JVV A;  2EWN A;  3GLX A;  4J6X A;  2PUO B;  5IAY A;  2KK4 A;  3RMQ A;  1I4K 1;  5GAO n;  5CKB A;  2DIG A;  3CCM A;  2A7Y A;  2L89 A;  3L2R A;  4QVD A;  2PVD B;  3H8Z A;  3HRT A;  2DTH A;  3FJP A;  3QHS A;  2XD0 A;  4A4H A;  1K8A U;  3GOX A;  5FRN A;  3INZ A;  1WQ7 A;  2LT1 A;  4C92 F;  4E7J A;  2DZ9 A;  3FLG A;  2GCX A;  3CCL A;  4ATO A;  1QW1 A;  2LQ8 A;  4OVA A;  4O5V A;  2ZPG B;  4FL6 A;  1G3T A;  1G3W A;  3S3M A;  1N27 A;  1D3B B;  4P5N A;  4MZM A;  4GY5 A;  4BB7 A;  1M1K U;  3DLL A;  1BKB A;  2LCL A;  4IUQ A;  3QXE B;  4PKC C;  2EYQ A;  2HQE A;  5FU6 B;  4M7A F;  3CC7 A;  1YIT T;  2FB7 A;  4QQG A;  3V7S A;  4PJO C;  3HRS A;  5LJ5 d;  3NTK A;  3URG A;  1PSE A;  2RJE A;  4FU6 A;  3MP1 A;  1EIF A;  2K5I A;  3LX7 A;  1VQK T;  4PL6 A;  5CCA A;  4RG2 A;  4C92 D;  4M7D A;  2EQU A;  5LJ5 g;  2ZPH B;  4PJO A;  4M77 B;  3KUF A;  2RH2 A;  4HCC A;  3OB9 A;  2RB6 A;  3FC3 A;  2PQW A;  1LNX A;  1WJR A;  3P8H A;  3ZBD A;  3HL8 A;  3TU4 K;  1U8R A;  3M53 A;  1FXX A;  2WSC E;  2VYT A;  5C6S A;  3GNG A;  4C8Q F;  3G4S T;  4JS5 A;  2R57 A;  4C0D B;  4M7A D;  2DXC A;  3FEO A;  1VQ7 A;  5GAN 2;  2DTO A;  4XTV A;  4R56 A;  1VQL T;  3RKX A;  3KXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...