3Q1NA

Crystal structure of a galactose mutarotase-like protein (lsei_2598) from lactobacillus casei atcc 334 at 1.61 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
294
structure length
294
Chain Sequence
b'GMITIENSKFKAGIAERGAELQSLVNKADNYEYVWTGDKTFWNRHAPILFPSIGKSNQDQYRLGAKTYPMSQHGFARDYDFDVSDKSDSAVTFTQHQNAETLKKFPFEYTLAVTYMLTDGGLSVHYTVTNDDSKSMPFALGFHPAFNVGLKADGSFDDYDLTVEPLNSPLQRFGIGPVPFRNGDVEDIPGAEGNRLPLTHDLLDGGLVILANSEIAKATLASPHHDHSITLDISDFPYLTIWSPEHKKAPFIAVEPFDGLPDQAGEPTDWYTKLGNTTLSAGANKQLALKVELH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose mutarotase related enzyme
publication title Crystal structure of a galactose mutarotase-like protein (LSEI_2598) from Lactobacillus casei ATCC 334 at 1.61 A resolution
rcsb
source organism Lactobacillus casei
molecule tags Isomerase
total genus 75
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 3q1nA00
4DUWA 3VDAA 2WVXA 1NSMA 3DCDA 4AQ0A 2CIRA 1RWAA 3MV01 1MMUA 1SNZA 4BZGA 1LURA 1F9GA 1PX4A 1NS7A 2D73A 1LF9A 1MN0A 3VDCA 1HM3A 2WVYA 1N7PA 1OJNA 2E22A 1SO0A 2WW2A 1NSVA 1F1SA 2XHNA 1NS4A 1HM2A 1NSRA 3VD5A 4TTGA 1DP0A 2XSGA 2WW1A 1HN0A 1LOHA 1HMUA 1NSSA 1EGUA 2JKEA 1UG9A 4DUXA 1NSZA 2WW0A 2ZXQA 3T0DA 3DECA 2BRPA 1RWHA 2WVZA 3NJVA 1W3YA 5A1AA 3T2OA 1JZ3A 1LF6A 3DYPA 3Q1NA 3CZJA 3VD3A 3MUY1 1YQ2A 1C82A 2X03A 1N7RA 2Q1FA 1MMYA 2WDAA 1NKGA 3T0BA 1JOVA 3MWXA 1J0MA 1K1WA 1N7NA 1RWGA 2BRWA 2WCOA 3T0AA 1NS2A 1MMZA 3DYOA 3I3BA 3IAQA 2CISA 3T2PA 1JYWA 1K1YA 1L7KA 4RNLA 3IAPA 2HTAA 1CB8A 1NS0A 1NSUA 1N7QA 3VDBA 4BZFA 1I8QA 1F4HA 2HTBA 1K1XA 3MUZ1 1JZ8A 1RWFA 1N7OA 2JKAA 3NJXA 1TXKA 1JYXA 1LXMA 4BZHA 2WVXB 1JYVA 1JZ7A 1MMXA 3E1F1 5E1QA 3IMHA 3VD7A 3T09A 3K25A 1OJMA 2E24A 1ULVA 1JYNA 4DUVA 1F4AA 3A24A 2BRVX 3I3EA 3MV11 3BGAA 1JZ2A 1JZ6A 1NSXA 1PX3A 1OJPA 1X1HA 3DYMA 3SEPA 1HMWA 1Z45A 4BZEA 3VD9A 1JZ5A 1HN1A 2WW3A 2ZQ0A 1L7JA 1X1JA 3ECQA 1NS8A 3OBAA 3T2QA 1RWCA 1LXKA 1JZ4A 3OS7A 3OB8A 3J7HA 1J0NA 2JKPA 1X1IA 3WFAA 3VD4A 2WZSA 2CIQA 1RW9A 1YGAA 3T08A 1OJOA 3NREA 3I3DA
chains in the Genus database with same CATH superfamily
4DUWA 2XN1A 1LVNA 2ZL8A 3WA2X 1LURA 1QAFA 3EJUA 3CZSA 1PX4A 2XN0A 2WOHA 2C10A 4BTYA 1MN0A 3VDCA 1D6UA 3AMOA 5JMDA 2WW2A 2XHNA 1F1SA 4EV5A 3EJSA 1HM2A 1SPUA 3MPHA 3VD5A 4TTGA 3RRSA 1IVVA 3W7UA 3S4BA 1W5ZA 1PS3A 2RDYA 4KFDA 2WW0A 3T0DA 1JZ3A 1RKYA 3VD3A 2X03A 1IVUA 2F1AA 3T0BA 3BUBA 4OK2A 1RWGA 3T0AA 3TY1A 2F7OA 1NS2A 3D4ZA 3AFLA 2F7PA 2OQEA 3VSNA 3WIQA 1L7KA 3QDEA 2EADA 3BUIA 3PGBA 2D1WA 4BZFA 2CFGA 3D51A 1TU5A 3IMHA 2EACA 1OJMA 1JYNA 3A24A 5JMFA 3I3EA 3BGAA 1W4NA 1OJPA 3AMOB 3SEPA 1HMWA 1JRQA 3EJTA 4BZEA 4OK4A 3E80A 2WW3A 4NEIA 1L7JA 3ECQA 3OBAA 1LXKA 1WMNA 2CG0A 2CIQA 1OJOA 1R33A 4MMIA 3BUPA 3BVXA 1TQUA 2WVXA 4UFCA 1HXKA 1RWAA 1MMUA 4BZGA 1V7XA 4KTPA 3QFYA 3KN4A 3BUDA 1NS7A 1HM3A 2WVYA 1N7PA 3ACTA 1OJNA 1WMPA 3BVWA 1NSVA 3WVFA 1NS4A 1NSRA 3BVTA 1DP0A 2WW1A 2FYVA 2OOVA 1HMUA 1NSSA 1UG9A 3DX4A 2CWUA 3NJVA 2YX9A 1W3YA 2WYHA 3Q1NA 2OQEC 3D52A 1YQ2A 4FNQA 1JOVA 3EJRA 3MWXA 1AVKA 2WCOA 3I3BA 4FNRA 5CA3A 1JYWA 3BUQA 1R34A 3QFZA 1NS0A 4KTRA 1IQYA 1N7QA 3VDBA 2C11A 1I8QA 1RJOA 1UI7A 1F4HA 3MUZ1 1JZ8A 1RWFA 3WIRA 2JKAA 1JYXA 3AFJA 2WVXB 1JZ7A 1OACA 1W7CA 1ULVA 4DUVA 3CV5A 1F4AA 1HTYA 1QWNA 1A2VA 4FNVA 2WOFA 1IQXA 1JZ2A 2WYIA 1IVXA 3VD9A 3BS6A 1KSIA 4K3AA 1JZ5A 1HN1A 1NS8A 3T2QA 1RWCA 1JZ4A 3OB8A 3DX0A 3J7HA 1IVWA 2JKPA 1X1IA 3WFAA 2WZSA 1RW9A 2CFWA 3NREA 3I3DA 3X3ZA 3K5TA 3D4YA 3BLBA 3X3XA 3NBBA 2WGQA 1SNZA 3EJQA 2YFOA 3CZNA 2D73A 2CWVA 5KBPA 3S4AA 2Y74A 3HIIA 2E22A 3W7SA 4FNUA 1US1A 1D6YA 3LVTA 2PNCA 2OW7A 2XSGA 3MI6A 1HN0A 3DX3A 1LOHA 2F7RA 2E2TA 1EGUA 1NSZA 3QG0A 2ZXQA 3DECA 2BRPA 2WVZA 3DYPA 3BVVA 3S4DA 3BLCA 3RSYA 3MUY1 1N7RA 4BTWA 1NKGA 3D3IA 3X42A 1J0MA 1K1WA 1N7NA 1QAKA 1QWUA 2EABA 3DX1A 1MMZA 1O7DD 1TQWA 2W0QA 2CISA 1WMOA 4RNLA 3VSMA 1EKMA 3HIGA 1NSUA 3ALAA 4KFEA 3N9HA 2OW6A 2HTBA 3X3YA 1K1XA 2EAEA 1N7OA 3NJXA 1AV4A 1H54A 1LXMA 5GW7A 1JYVA 5E1QA 3T09A 2XN2A 3S4CA 2BRVX 1X1HA 3DYMA 4FNPA 1Z45A 3E7JA 2ZQ0A 1W2ZA 2YFNA 3OS7A 1AVLA 1J0NA 3VD4A 2F1BA 4J5TA 3T08A 1PU4A 1W6GA 4OJZA 3VDAA 4KFFA 1NSMA 3DCDA 3BVUA 2CQSA 4AQ0A 2CIRA 3MV01 3W7TA 1F9GA 2FUTA 1TQSA 1TQVA 1TQTA 4EV2A 3DX2A 1LF9A 2WO0A 3T0UA 1SO0A 2E2VA 1V7WA 3A0OA 1D6ZA 3ACSA 2CFDA 2JKEA 2CFLA 1QX1A 2OOVC 4DUXA 2CG1A 3X40A 1W6CA 4FNTA 1RWHA 5A1AA 3LOYA 3T2OA 1LF6A 3CZJA 1C82A 2E2UA 3SXXA 2Q1FA 1MMYA 2WDAA 3DDGA 4FNSA 3DDFA 2BRWA 3D50A 1QALA 1V7VA 3DYOA 3IAQA 3T2PA 2F7QA 1K1YA 1UI8A 2CFKA 1SIHA 3IAPA 2FUQA 2HTAA 1CB8A 4MMHA 2Y73A 3W7XA 2BT3A 1N9EA 3NBJA 1SIIA 1TXKA 3HI7A 4BZHA 3KIIA 2ALWA 1MMXA 2F18A 3E1F1 3VD7A 3K25A 2E24A 3EJPA 4BTXA 4K35A 1DYUA 3MV11 2CQTA 1JZ6A 3SX1A 1PX3A 3W7WA 1X1JA 1IU7A 1HWWA 1YGAA 3X41A 3WA3A 2CWTA 1NSXA
chains in the Genus database with same CATH topology
4OJZA 4DUWA 3VDAA 2WVXA 1NSMA 3DCDA 4AQ0A 2CIRA 1RWAA 3MV01 1MMUA 1SNZA 4BZGA 1LURA 1F9GA 2FUTA 1PX4A 1NS7A 2D73A 1LF9A 1MN0A 3VDCA 1HM3A 2WVYA 1N7PA 1OJNA 2E22A 5JMDA 1SO0A 2WW2A 1NSVA 1F1SA 2XHNA 1NS4A 1HM2A 1NSRA 3A0OA 3VD5A 3WVFA 1DP0A 4TTGA 2XSGA 2WW1A 1HN0A 1LOHA 1HMUA 1NSSA 1EGUA 2JKEA 1UG9A 4DUXA 1NSZA 2WW0A 2ZXQA 3T0DA 3DECA 2BRPA 1RWHA 2WVZA 3NJVA 1W3YA 5A1AA 3T2OA 1JZ3A 1LF6A 3DYPA 3Q1NA 3BLCA 3CZJA 3VD3A 3MUY1 4MMIA 1YQ2A 1C82A 2X03A 1N7RA 2Q1FA 1MMYA 2WDAA 1NKGA 3T0BA 1JOVA 3MWXA 1J0MA 1K1WA 4OK2A 1N7NA 1RWGA 2BRWA 2WCOA 3T0AA 3TY1A 1NS2A 1MMZA 3DYOA 3I3BA 3IAQA 2CISA 3T2PA 3AFLA 1JYWA 1K1YA 3VSNA 1L7KA 4RNLA 3IAPA 2FUQA 2HTAA 1CB8A 4MMHA 1NS0A 3VSMA 1NSUA 1N7QA 3VDBA 4BZFA 1I8QA 1F4HA 2HTBA 1K1XA 3MUZ1 1JZ8A 1RWFA 1N7OA 2JKAA 3NJXA 1TXKA 1JYXA 1LXMA 4BZHA 2WVXB 1JYVA 1JZ7A 1MMXA 3E1F1 5E1QA 3IMHA 3VD7A 3T09A 3K25A 1OJMA 2E24A 1ULVA 1JYNA 4DUVA 1F4AA 3A24A 4FNVA 5JMFA 2BRVX 3I3EA 3MV11 3BGAA 1JZ2A 1JZ6A 1NSXA 1PX3A 1OJPA 1X1HA 3DYMA 3SEPA 1HMWA 1Z45A 3BS6A 3E7JA 4OK4A 4BZEA 3VD9A 3E80A 1JZ5A 1HN1A 2WW3A 2ZQ0A 4NEIA 1L7JA 1X1JA 3ECQA 1NS8A 3OBAA 3T2QA 1RWCA 1LXKA 1JZ4A 3OS7A 3OB8A 3J7HA 1J0NA 2JKPA 1X1IA 3WFAA 3VD4A 2WZSA 4J5TA 2CIQA 1RW9A 1YGAA 3T08A 1OJOA 3NREA 3I3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUW A;  3VDA A;  2WVX A;  1NSM A;  3DCD A;  4AQ0 A;  2CIR A;  1RWA A;  3MV0 1;  1MMU A;  1SNZ A;  4BZG A;  1LUR A;  1F9G A;  1PX4 A;  1NS7 A;  2D73 A;  1LF9 A;  1MN0 A;  3VDC A;  1HM3 A;  2WVY A;  1N7P A;  1OJN A;  2E22 A;  1SO0 A;  2WW2 A;  1NSV A;  1F1S A;  2XHN A;  1NS4 A;  1HM2 A;  1NSR A;  3VD5 A;  4TTG A;  1DP0 A;  2XSG A;  2WW1 A;  1HN0 A;  1LOH A;  1HMU A;  1NSS A;  1EGU A;  2JKE A;  1UG9 A;  4DUX A;  1NSZ A;  2WW0 A;  2ZXQ A;  3T0D A;  3DEC A;  2BRP A;  1RWH A;  2WVZ A;  3NJV A;  1W3Y A;  5A1A A;  3T2O A;  1JZ3 A;  1LF6 A;  3DYP A;  3Q1N A;  3CZJ A;  3VD3 A;  3MUY 1;  1YQ2 A;  1C82 A;  2X03 A;  1N7R A;  2Q1F A;  1MMY A;  2WDA A;  1NKG A;  3T0B A;  1JOV A;  3MWX A;  1J0M A;  1K1W A;  1N7N A;  1RWG A;  2BRW A;  2WCO A;  3T0A A;  1NS2 A;  1MMZ A;  3DYO A;  3I3B A;  3IAQ A;  2CIS A;  3T2P A;  1JYW A;  1K1Y A;  1L7K A;  4RNL A;  3IAP A;  2HTA A;  1CB8 A;  1NS0 A;  1NSU A;  1N7Q A;  3VDB A;  4BZF A;  1I8Q A;  1F4H A;  2HTB A;  1K1X A;  3MUZ 1;  1JZ8 A;  1RWF A;  1N7O A;  2JKA A;  3NJX A;  1TXK A;  1JYX A;  1LXM A;  4BZH A;  2WVX B;  1JYV A;  1JZ7 A;  1MMX A;  3E1F 1;  5E1Q A;  3IMH A;  3VD7 A;  3T09 A;  3K25 A;  1OJM A;  2E24 A;  1ULV A;  1JYN A;  4DUV A;  1F4A A;  3A24 A;  2BRV X;  3I3E A;  3MV1 1;  3BGA A;  1JZ2 A;  1JZ6 A;  1NSX A;  1PX3 A;  1OJP A;  1X1H A;  3DYM A;  3SEP A;  1HMW A;  1Z45 A;  4BZE A;  3VD9 A;  1JZ5 A;  1HN1 A;  2WW3 A;  2ZQ0 A;  1L7J A;  1X1J A;  3ECQ A;  1NS8 A;  3OBA A;  3T2Q A;  1RWC A;  1LXK A;  1JZ4 A;  3OS7 A;  3OB8 A;  3J7H A;  1J0N A;  2JKP A;  1X1I A;  3WFA A;  3VD4 A;  2WZS A;  2CIQ A;  1RW9 A;  1YGA A;  3T08 A;  1OJO A;  3NRE A;  3I3D A; 
#chains in the Genus database with same CATH topology
 4DUW A;  2XN1 A;  1LVN A;  2ZL8 A;  3WA2 X;  1LUR A;  1QAF A;  3EJU A;  3CZS A;  1PX4 A;  2XN0 A;  2WOH A;  2C10 A;  4BTY A;  1MN0 A;  3VDC A;  1D6U A;  3AMO A;  5JMD A;  2WW2 A;  2XHN A;  1F1S A;  4EV5 A;  3EJS A;  1HM2 A;  1SPU A;  3MPH A;  3VD5 A;  4TTG A;  3RRS A;  1IVV A;  3W7U A;  3S4B A;  1W5Z A;  1PS3 A;  2RDY A;  4KFD A;  2WW0 A;  3T0D A;  1JZ3 A;  1RKY A;  3VD3 A;  2X03 A;  1IVU A;  2F1A A;  3T0B A;  3BUB A;  4OK2 A;  1RWG A;  3T0A A;  3TY1 A;  2F7O A;  1NS2 A;  3D4Z A;  3AFL A;  2F7P A;  2OQE A;  3VSN A;  3WIQ A;  1L7K A;  3QDE A;  2EAD A;  3BUI A;  3PGB A;  2D1W A;  4BZF A;  2CFG A;  3D51 A;  1TU5 A;  3IMH A;  2EAC A;  1OJM A;  1JYN A;  3A24 A;  5JMF A;  3I3E A;  3BGA A;  1W4N A;  1OJP A;  3AMO B;  3SEP A;  1HMW A;  1JRQ A;  3EJT A;  4BZE A;  4OK4 A;  3E80 A;  2WW3 A;  4NEI A;  1L7J A;  3ECQ A;  3OBA A;  1LXK A;  1WMN A;  2CG0 A;  2CIQ A;  1OJO A;  1R33 A;  4MMI A;  3BUP A;  3BVX A;  1TQU A;  2WVX A;  4UFC A;  1HXK A;  1RWA A;  1MMU A;  4BZG A;  1V7X A;  4KTP A;  3QFY A;  3KN4 A;  3BUD A;  1NS7 A;  1HM3 A;  2WVY A;  1N7P A;  3ACT A;  1OJN A;  1WMP A;  3BVW A;  1NSV A;  3WVF A;  1NS4 A;  1NSR A;  3BVT A;  1DP0 A;  2WW1 A;  2FYV A;  2OOV A;  1HMU A;  1NSS A;  1UG9 A;  3DX4 A;  2CWU A;  3NJV A;  2YX9 A;  1W3Y A;  2WYH A;  3Q1N A;  2OQE C;  3D52 A;  1YQ2 A;  4FNQ A;  1JOV A;  3EJR A;  3MWX A;  1AVK A;  2WCO A;  3I3B A;  4FNR A;  5CA3 A;  1JYW A;  3BUQ A;  1R34 A;  3QFZ A;  1NS0 A;  4KTR A;  1IQY A;  1N7Q A;  3VDB A;  2C11 A;  1I8Q A;  1RJO A;  1UI7 A;  1F4H A;  3MUZ 1;  1JZ8 A;  1RWF A;  3WIR A;  2JKA A;  1JYX A;  3AFJ A;  2WVX B;  1JZ7 A;  1OAC A;  1W7C A;  1ULV A;  4DUV A;  3CV5 A;  1F4A A;  1HTY A;  1QWN A;  1A2V A;  4FNV A;  2WOF A;  1IQX A;  1JZ2 A;  2WYI A;  1IVX A;  3VD9 A;  3BS6 A;  1KSI A;  4K3A A;  1JZ5 A;  1HN1 A;  1NS8 A;  3T2Q A;  1RWC A;  1JZ4 A;  3OB8 A;  3DX0 A;  3J7H A;  1IVW A;  2JKP A;  1X1I A;  3WFA A;  2WZS A;  1RW9 A;  2CFW A;  3NRE A;  3I3D A;  3X3Z A;  3K5T A;  3D4Y A;  3BLB A;  3X3X A;  3NBB A;  2WGQ A;  1SNZ A;  3EJQ A;  2YFO A;  3CZN A;  2D73 A;  2CWV A;  5KBP A;  3S4A A;  2Y74 A;  3HII A;  2E22 A;  3W7S A;  4FNU A;  1US1 A;  1D6Y A;  3LVT A;  2PNC A;  2OW7 A;  2XSG A;  3MI6 A;  1HN0 A;  3DX3 A;  1LOH A;  2F7R A;  2E2T A;  1EGU A;  1NSZ A;  3QG0 A;  2ZXQ A;  3DEC A;  2BRP A;  2WVZ A;  3DYP A;  3BVV A;  3S4D A;  3BLC A;  3RSY A;  3MUY 1;  1N7R A;  4BTW A;  1NKG A;  3D3I A;  3X42 A;  1J0M A;  1K1W A;  1N7N A;  1QAK A;  1QWU A;  2EAB A;  3DX1 A;  1MMZ A;  1O7D D;  1TQW A;  2W0Q A;  2CIS A;  1WMO A;  4RNL A;  3VSM A;  1EKM A;  3HIG A;  1NSU A;  3ALA A;  4KFE A;  3N9H A;  2OW6 A;  2HTB A;  3X3Y A;  1K1X A;  2EAE A;  1N7O A;  3NJX A;  1AV4 A;  1H54 A;  1LXM A;  5GW7 A;  1JYV A;  5E1Q A;  3T09 A;  2XN2 A;  3S4C A;  2BRV X;  1X1H A;  3DYM A;  4FNP A;  1Z45 A;  3E7J A;  2ZQ0 A;  1W2Z A;  2YFN A;  3OS7 A;  1AVL A;  1J0N A;  3VD4 A;  2F1B A;  4J5T A;  3T08 A;  1PU4 A;  1W6G A;  4OJZ A;  3VDA A;  4KFF A;  1NSM A;  3DCD A;  3BVU A;  2CQS A;  4AQ0 A;  2CIR A;  3MV0 1;  3W7T A;  1F9G A;  2FUT A;  1TQS A;  1TQV A;  1TQT A;  4EV2 A;  3DX2 A;  1LF9 A;  2WO0 A;  3T0U A;  1SO0 A;  2E2V A;  1V7W A;  3A0O A;  1D6Z A;  3ACS A;  2CFD A;  2JKE A;  2CFL A;  1QX1 A;  2OOV C;  4DUX A;  2CG1 A;  3X40 A;  1W6C A;  4FNT A;  1RWH A;  5A1A A;  3LOY A;  3T2O A;  1LF6 A;  3CZJ A;  1C82 A;  2E2U A;  3SXX A;  2Q1F A;  1MMY A;  2WDA A;  3DDG A;  4FNS A;  3DDF A;  2BRW A;  3D50 A;  1QAL A;  1V7V A;  3DYO A;  3IAQ A;  3T2P A;  2F7Q A;  1K1Y A;  1UI8 A;  2CFK A;  1SIH A;  3IAP A;  2FUQ A;  2HTA A;  1CB8 A;  4MMH A;  2Y73 A;  3W7X A;  2BT3 A;  1N9E A;  3NBJ A;  1SII A;  1TXK A;  3HI7 A;  4BZH A;  3KII A;  2ALW A;  1MMX A;  2F18 A;  3E1F 1;  3VD7 A;  3K25 A;  2E24 A;  3EJP A;  4BTX A;  4K35 A;  1DYU A;  3MV1 1;  2CQT A;  1JZ6 A;  3SX1 A;  1PX3 A;  3W7W A;  1X1J A;  1IU7 A;  1HWW A;  1YGA A;  3X41 A;  3WA3 A;  2CWT A;  1NSX A; 
#chains in the Genus database with same CATH homology
 4OJZ A;  4DUW A;  3VDA A;  2WVX A;  1NSM A;  3DCD A;  4AQ0 A;  2CIR A;  1RWA A;  3MV0 1;  1MMU A;  1SNZ A;  4BZG A;  1LUR A;  1F9G A;  2FUT A;  1PX4 A;  1NS7 A;  2D73 A;  1LF9 A;  1MN0 A;  3VDC A;  1HM3 A;  2WVY A;  1N7P A;  1OJN A;  2E22 A;  5JMD A;  1SO0 A;  2WW2 A;  1NSV A;  1F1S A;  2XHN A;  1NS4 A;  1HM2 A;  1NSR A;  3A0O A;  3VD5 A;  3WVF A;  1DP0 A;  4TTG A;  2XSG A;  2WW1 A;  1HN0 A;  1LOH A;  1HMU A;  1NSS A;  1EGU A;  2JKE A;  1UG9 A;  4DUX A;  1NSZ A;  2WW0 A;  2ZXQ A;  3T0D A;  3DEC A;  2BRP A;  1RWH A;  2WVZ A;  3NJV A;  1W3Y A;  5A1A A;  3T2O A;  1JZ3 A;  1LF6 A;  3DYP A;  3Q1N A;  3BLC A;  3CZJ A;  3VD3 A;  3MUY 1;  4MMI A;  1YQ2 A;  1C82 A;  2X03 A;  1N7R A;  2Q1F A;  1MMY A;  2WDA A;  1NKG A;  3T0B A;  1JOV A;  3MWX A;  1J0M A;  1K1W A;  4OK2 A;  1N7N A;  1RWG A;  2BRW A;  2WCO A;  3T0A A;  3TY1 A;  1NS2 A;  1MMZ A;  3DYO A;  3I3B A;  3IAQ A;  2CIS A;  3T2P A;  3AFL A;  1JYW A;  1K1Y A;  3VSN A;  1L7K A;  4RNL A;  3IAP A;  2FUQ A;  2HTA A;  1CB8 A;  4MMH A;  1NS0 A;  3VSM A;  1NSU A;  1N7Q A;  3VDB A;  4BZF A;  1I8Q A;  1F4H A;  2HTB A;  1K1X A;  3MUZ 1;  1JZ8 A;  1RWF A;  1N7O A;  2JKA A;  3NJX A;  1TXK A;  1JYX A;  1LXM A;  4BZH A;  2WVX B;  1JYV A;  1JZ7 A;  1MMX A;  3E1F 1;  5E1Q A;  3IMH A;  3VD7 A;  3T09 A;  3K25 A;  1OJM A;  2E24 A;  1ULV A;  1JYN A;  4DUV A;  1F4A A;  3A24 A;  4FNV A;  5JMF A;  2BRV X;  3I3E A;  3MV1 1;  3BGA A;  1JZ2 A;  1JZ6 A;  1NSX A;  1PX3 A;  1OJP A;  1X1H A;  3DYM A;  3SEP A;  1HMW A;  1Z45 A;  3BS6 A;  3E7J A;  4OK4 A;  4BZE A;  3VD9 A;  3E80 A;  1JZ5 A;  1HN1 A;  2WW3 A;  2ZQ0 A;  4NEI A;  1L7J A;  1X1J A;  3ECQ A;  1NS8 A;  3OBA A;  3T2Q A;  1RWC A;  1LXK A;  1JZ4 A;  3OS7 A;  3OB8 A;  3J7H A;  1J0N A;  2JKP A;  1X1I A;  3WFA A;  3VD4 A;  2WZS A;  4J5T A;  2CIQ A;  1RW9 A;  1YGA A;  3T08 A;  1OJO A;  3NRE A;  3I3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...