3Q1NA

Crystal structure of a galactose mutarotase-like protein (lsei_2598) from lactobacillus casei atcc 334 at 1.61 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
294
structure length
294
Chain Sequence
GMITIENSKFKAGIAERGAELQSLVNKADNYEYVWTGDKTFWNRHAPILFPSIGKSNQDQYRLGAKTYPMSQHGFARDYDFDVSDKSDSAVTFTQHQNAETLKKFPFEYTLAVTYMLTDGGLSVHYTVTNDDSKSMPFALGFHPAFNVGLKADGSFDDYDLTVEPLNSPLQRFGIGPVPFRNGDVEDIPGAEGNRLPLTHDLLDGGLVILANSEIAKATLASPHHDHSITLDISDFPYLTIWSPEHKKAPFIAVEPFDGLPDQAGEPTDWYTKLGNTTLSAGANKQLALKVELH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a galactose mutarotase-like protein (LSEI_2598) from Lactobacillus casei ATCC 334 at 1.61 A resolution
rcsb
source organism Lactobacillus casei
molecule tags Isomerase
molecule keywords Galactose mutarotase related enzyme
total genus 75
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 3q1nA00
1K1WA 3K25A 1J0NA 4TTGA 3SEPA 4DUWA 2ZQ0A 2WVXB 1YQ2A 1L7KA 3ECQA 1X1JA 3Q1NA 3T08A 1RWAA 3VDCA 3T2PA 2E22A 3J7HA 1F1SA 3VD3A 3MV01 1JZ5A 1L7JA 3CZJA 1PX4A 3WFAA 1RW9A 1F4AA 5A1AA 2WDAA 1EGUA 1NSXA 1NSSA 3BGAA 4BZEA 3DYMA 1SNZA 1C82A 1Z45A 2XHNA 4DUXA 1OJMA 1I8QA 3IMHA 3MV11 1RWGA 3T0DA 1HMWA 1NS2A 4BZGA 1YGAA 1N7PA 1N7OA 1MMUA 1OJOA 3DCDA 1W3YA 3T0BA 1F9GA 2X03A 1NKGA 1HN1A 1MMZA 1OJPA 1LF9A 3MUY1 1LXKA 1NS0A 1NSZA 4RNLA 1N7QA 1N7RA 1UG9A 2WW1A 1ULVA 3IAPA 5E1QA 3NJVA 2HTAA 2JKPA 3I3DA 1RWHA 3VD4A 1NS7A 1JYNA 3MUZ1 2CISA 3VD7A 2XSGA 2WVYA 1LURA 3VD5A 1NSUA 2JKAA 1K1XA 1LOHA 2Q1FA 1JZ2A 1RWFA 2WW0A 1F4HA 1JZ8A 1NS8A 4BZFA 4DUVA 2WW2A 3OS7A 1X1IA 1MMYA 1JOVA 3I3BA 3VDBA 2WVXA 1OJNA 2BRWA 3DYOA 1MMXA 3MWXA 2D73A 1SO0A 2ZXQA 1NSVA 1K1YA 1N7NA 1JZ6A 3IAQA 1HN0A 1JYVA 4BZHA 1DP0A 3OBAA 2WCOA 3NREA 4AQ0A 2E24A 1J0MA 1PX3A 3T09A 1JZ4A 1NS4A 3OB8A 2CIQA 3T2OA 1NSMA 1MN0A 3E1F1 2HTBA 2CIRA 3T2QA 1JZ7A 1NSRA 2BRVX 1JZ3A 1TXKA 2JKEA 3DYPA 3A24A 1JYWA 2WZSA 2WW3A 3DECA 1JYXA 2BRPA 1X1HA 1CB8A 1HM3A 1HM2A 3VDAA 3I3EA 1LF6A 1RWCA 3T0AA 1LXMA 1HMUA 3VD9A 3NJXA 2WVZA
chains in the Genus database with same CATH superfamily
3BVUA 3W7UA 1J0NA 3SEPA 4J5TA 3X3YA 1LVNA 1D6UA 3ECQA 1X1JA 3Q1NA 1TU5A 2D1WA 3EJTA 1R34A 1L7JA 1PX4A 5A1AA 2WYIA 3MI6A 1NSSA 1PU4A 1W6GA 3D52A 2XHNA 3DDGA 1AV4A 3EJSA 3DDFA 1OJMA 1RWGA 4KFDA 2Y74A 4BTWA 2WO0A 1IQYA 1OJOA 3DCDA 1TQTA 3T0BA 1HN1A 1LXKA 1N7RA 5E1QA 1R33A 1QWNA 2CWVA 1OACA 3D4YA 3CZSA 2XSGA 2WVYA 3EJPA 2JKAA 3SX1A 5JMFA 5JMDA 2Q1FA 3ACTA 3BUQA 3BVXA 1RWFA 2WW0A 1JZ8A 2FUTA 2YX9A 1TQUA 3BUDA 2WW2A 2Y73A 2BRWA 4K3AA 1SO0A 1TQWA 1K1YA 4K35A 1N7NA 3BS6A 1JYVA 2XN1A 3DX3A 1W6CA 1QAKA 1W7CA 1NS4A 2CIQA 4KFEA 1MN0A 2C11A 4FNRA 2HTBA 3T2QA 1IVXA 4MMIA 1SPUA 2JKEA 3DYPA 3A24A 2WZSA 2WW3A 2BRPA 3EJUA 1X1HA 4MMHA 1HM3A 2OOVC 3BUIA 2EACA 1AVKA 1K1WA 3K25A 1WMPA 4TTGA 3LOYA 2ZQ0A 3VDCA 1RWAA 3QDEA 4BTXA 3VD3A 2EADA 1RW9A 1EGUA 2E2UA 3DYMA 1SNZA 3DX2A 3E80A 1HTYA 3KN4A 1Z45A 2F18A 1SIIA 3ACSA 3IMHA 4OK4A 4BTYA 1HMWA 1NS2A 4BZGA 1YGAA 1N7OA 3CV5A 1F9GA 2CQSA 1NKGA 1LF9A 1RKYA 1NS0A 3WVFA 3AMOB 3VSMA 5CA3A 1N7QA 3HIIA 2WW1A 1PS3A 2E2TA 3ALAA 2JKPA 1HXKA 2CISA 3RSYA 1D6YA 3AFLA 3DX4A 3VD5A 1NSUA 1K1XA 3WA3A 1F4HA 4KTPA 1NS8A 4BZFA 4DUVA 2YFOA 3OS7A 1JOVA 3I3BA 3EJQA 1US1A 1OJNA 2CFDA 1TQVA 2D73A 3D51A 1NSVA 3X41A 3IAQA 4NEIA 3KIIA 3S4BA 1J0MA 3T2OA 2CG0A 1NSMA 3E1F1 4FNPA 2F7PA 3N9HA 2BRVX 1JZ3A 1TXKA 1TQSA 1JYWA 3BUBA 2ALWA 1V7VA 4EV5A 1RWCA 1HMUA 2F7RA 3VSNA 1KSIA 3VD9A 3NJXA 1V7XA 3CZNA 1H54A 4FNTA 3QFZA 3K5TA 4DUWA 1SIHA 3DX1A 2WVXB 4FNQA 3HI7A 2PNCA 1AVLA 1UI8A 3T08A 2E22A 4KFFA 3J7HA 1F1SA 3MV01 3RRSA 1JZ5A 3CZJA 2W0QA 1F4AA 2CFGA 3EJRA 3QG0A 3WA2X 1NSXA 4BZEA 4FNVA 2FYVA 2OQEC 5KBPA 1QALA 3W7TA 3LVTA 1N7PA 2X03A 1OJPA 3D50A 2WOFA 1O7DD 1UG9A 3X3XA 1ULVA 3NJVA 1DYUA 3VD4A 1RWHA 3MUZ1 2F1AA 4FNSA 3D3IA 1RJOA 1HWWA 1LOHA 3W7XA 2CWTA 4UFCA 1X1IA 1MMYA 1IVUA 1MMXA 3MWXA 2ZXQA 1JZ6A 3X42A 2WYHA 4BZHA 3OBAA 3NREA 3NBBA 2E24A 3A0OA 3QFYA 1QWUA 3T09A 3NBJA 1JZ7A 1NSRA 1W2ZA 3DECA 1IVWA 1CB8A 3VDAA 1EKMA 3S4DA 1IU7A 1YQ2A 1L7KA 2EAEA 2ZL8A 1JRQA 3T2PA 3BVTA 3BLBA 3WFAA 3HIGA 2WDAA 3MPHA 3BLCA 2EABA 3BGAA 4EV2A 3WIRA 1W4NA 5GW7A 3T0UA 4OK2A 1C82A 2YFNA 2CFKA 3E7JA 4DUXA 1I8QA 1W5ZA 3X40A 3AMOA 3MV11 3T0DA 3S4AA 1QAFA 2XN0A 1UI7A 1MMUA 3AFJA 1W3YA 1V7WA 2OW6A 1MMZA 3MUY1 1NSZA 3PGBA 2FUQA 4RNLA 2F1BA 3IAPA 2C10A 2OOVA 2HTAA 4FNUA 2WGQA 2RDYA 3I3DA 3D4ZA 1NS7A 3SXXA 1JYNA 3VD7A 1LURA 3DX0A 1JZ2A 3WIQA 2CWUA 2CFLA 2CQTA 3VDBA 3W7WA 2WVXA 2XN2A 2E2VA 3DYOA 1QX1A 1D6ZA 1HN0A 1DP0A 2OW7A 4OJZA 2WCOA 2OQEA 4AQ0A 1PX3A 2CFWA 1JZ4A 1WMNA 3OB8A 3S4CA 2CIRA 3X3ZA 2F7OA 3BUPA 2BT3A 3BVVA 1JYXA 3TY1A 1A2VA 3W7SA 1IQXA 4KTRA 1HM2A 1WMOA 3I3EA 1LF6A 2F7QA 3BVWA 3T0AA 1LXMA 2WOHA 1IVVA 1N9EA 2WVZA 2CG1A
chains in the Genus database with same CATH topology
1K1WA 3K25A 1J0NA 4TTGA 3SEPA 4J5TA 4DUWA 2ZQ0A 2WVXB 1YQ2A 1L7KA 3ECQA 1X1JA 3Q1NA 3T08A 1RWAA 3VDCA 3T2PA 2E22A 3J7HA 1F1SA 3VD3A 3MV01 1JZ5A 1L7JA 3CZJA 1PX4A 3WFAA 1RW9A 1F4AA 5A1AA 2WDAA 1EGUA 3BLCA 1NSXA 1NSSA 3BGAA 4BZEA 4FNVA 3DYMA 1SNZA 4OK2A 3E80A 1C82A 1Z45A 2XHNA 3E7JA 4DUXA 1OJMA 1I8QA 3IMHA 4OK4A 3MV11 1RWGA 3T0DA 1HMWA 1NS2A 4BZGA 1YGAA 1N7PA 1N7OA 1MMUA 1OJOA 3DCDA 1W3YA 3T0BA 1F9GA 2X03A 1NKGA 1HN1A 1MMZA 1OJPA 1LF9A 3MUY1 1LXKA 1NS0A 3WVFA 1NSZA 2FUQA 4RNLA 3VSMA 1N7QA 1N7RA 1UG9A 2WW1A 1ULVA 3IAPA 5E1QA 3NJVA 2HTAA 2JKPA 3I3DA 1RWHA 3VD4A 1NS7A 1JYNA 3MUZ1 2CISA 3VD7A 2XSGA 2WVYA 3AFLA 1LURA 3VD5A 1NSUA 2JKAA 5JMFA 5JMDA 1K1XA 1LOHA 2Q1FA 1JZ2A 1RWFA 2WW0A 1F4HA 1JZ8A 2FUTA 1NS8A 4BZFA 4DUVA 2WW2A 3OS7A 1X1IA 1MMYA 1JOVA 3I3BA 3VDBA 2WVXA 1OJNA 2BRWA 3DYOA 1MMXA 3MWXA 2D73A 1SO0A 2ZXQA 1NSVA 1K1YA 1N7NA 3BS6A 1JZ6A 3IAQA 1HN0A 1JYVA 4NEIA 4BZHA 1DP0A 4OJZA 3OBAA 2WCOA 3NREA 4AQ0A 2E24A 1J0MA 1PX3A 3A0OA 3T09A 1JZ4A 1NS4A 3OB8A 2CIQA 3T2OA 1NSMA 1MN0A 3E1F1 2HTBA 2CIRA 3T2QA 1JZ7A 4MMIA 1NSRA 2BRVX 1JZ3A 1TXKA 2JKEA 3DYPA 3A24A 1JYWA 2WZSA 2WW3A 3DECA 1JYXA 3TY1A 2BRPA 1X1HA 1CB8A 4MMHA 1HM3A 1HM2A 3VDAA 3I3EA 1LF6A 1RWCA 3T0AA 1LXMA 1HMUA 3VSNA 3VD9A 3NJXA 2WVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K1W A;  3K25 A;  1J0N A;  4TTG A;  3SEP A;  4DUW A;  2ZQ0 A;  2WVX B;  1YQ2 A;  1L7K A;  3ECQ A;  1X1J A;  3Q1N A;  3T08 A;  1RWA A;  3VDC A;  3T2P A;  2E22 A;  3J7H A;  1F1S A;  3VD3 A;  3MV0 1;  1JZ5 A;  1L7J A;  3CZJ A;  1PX4 A;  3WFA A;  1RW9 A;  1F4A A;  5A1A A;  2WDA A;  1EGU A;  1NSX A;  1NSS A;  3BGA A;  4BZE A;  3DYM A;  1SNZ A;  1C82 A;  1Z45 A;  2XHN A;  4DUX A;  1OJM A;  1I8Q A;  3IMH A;  3MV1 1;  1RWG A;  3T0D A;  1HMW A;  1NS2 A;  4BZG A;  1YGA A;  1N7P A;  1N7O A;  1MMU A;  1OJO A;  3DCD A;  1W3Y A;  3T0B A;  1F9G A;  2X03 A;  1NKG A;  1HN1 A;  1MMZ A;  1OJP A;  1LF9 A;  3MUY 1;  1LXK A;  1NS0 A;  1NSZ A;  4RNL A;  1N7Q A;  1N7R A;  1UG9 A;  2WW1 A;  1ULV A;  3IAP A;  5E1Q A;  3NJV A;  2HTA A;  2JKP A;  3I3D A;  1RWH A;  3VD4 A;  1NS7 A;  1JYN A;  3MUZ 1;  2CIS A;  3VD7 A;  2XSG A;  2WVY A;  1LUR A;  3VD5 A;  1NSU A;  2JKA A;  1K1X A;  1LOH A;  2Q1F A;  1JZ2 A;  1RWF A;  2WW0 A;  1F4H A;  1JZ8 A;  1NS8 A;  4BZF A;  4DUV A;  2WW2 A;  3OS7 A;  1X1I A;  1MMY A;  1JOV A;  3I3B A;  3VDB A;  2WVX A;  1OJN A;  2BRW A;  3DYO A;  1MMX A;  3MWX A;  2D73 A;  1SO0 A;  2ZXQ A;  1NSV A;  1K1Y A;  1N7N A;  1JZ6 A;  3IAQ A;  1HN0 A;  1JYV A;  4BZH A;  1DP0 A;  3OBA A;  2WCO A;  3NRE A;  4AQ0 A;  2E24 A;  1J0M A;  1PX3 A;  3T09 A;  1JZ4 A;  1NS4 A;  3OB8 A;  2CIQ A;  3T2O A;  1NSM A;  1MN0 A;  3E1F 1;  2HTB A;  2CIR A;  3T2Q A;  1JZ7 A;  1NSR A;  2BRV X;  1JZ3 A;  1TXK A;  2JKE A;  3DYP A;  3A24 A;  1JYW A;  2WZS A;  2WW3 A;  3DEC A;  1JYX A;  2BRP A;  1X1H A;  1CB8 A;  1HM3 A;  1HM2 A;  3VDA A;  3I3E A;  1LF6 A;  1RWC A;  3T0A A;  1LXM A;  1HMU A;  3VD9 A;  3NJX A;  2WVZ A; 
#chains in the Genus database with same CATH topology
 3BVU A;  3W7U A;  1J0N A;  3SEP A;  4J5T A;  3X3Y A;  1LVN A;  1D6U A;  3ECQ A;  1X1J A;  3Q1N A;  1TU5 A;  2D1W A;  3EJT A;  1R34 A;  1L7J A;  1PX4 A;  5A1A A;  2WYI A;  3MI6 A;  1NSS A;  1PU4 A;  1W6G A;  3D52 A;  2XHN A;  3DDG A;  1AV4 A;  3EJS A;  3DDF A;  1OJM A;  1RWG A;  4KFD A;  2Y74 A;  4BTW A;  2WO0 A;  1IQY A;  1OJO A;  3DCD A;  1TQT A;  3T0B A;  1HN1 A;  1LXK A;  1N7R A;  5E1Q A;  1R33 A;  1QWN A;  2CWV A;  1OAC A;  3D4Y A;  3CZS A;  2XSG A;  2WVY A;  3EJP A;  2JKA A;  3SX1 A;  5JMF A;  5JMD A;  2Q1F A;  3ACT A;  3BUQ A;  3BVX A;  1RWF A;  2WW0 A;  1JZ8 A;  2FUT A;  2YX9 A;  1TQU A;  3BUD A;  2WW2 A;  2Y73 A;  2BRW A;  4K3A A;  1SO0 A;  1TQW A;  1K1Y A;  4K35 A;  1N7N A;  3BS6 A;  1JYV A;  2XN1 A;  3DX3 A;  1W6C A;  1QAK A;  1W7C A;  1NS4 A;  2CIQ A;  4KFE A;  1MN0 A;  2C11 A;  4FNR A;  2HTB A;  3T2Q A;  1IVX A;  4MMI A;  1SPU A;  2JKE A;  3DYP A;  3A24 A;  2WZS A;  2WW3 A;  2BRP A;  3EJU A;  1X1H A;  4MMH A;  1HM3 A;  2OOV C;  3BUI A;  2EAC A;  1AVK A;  1K1W A;  3K25 A;  1WMP A;  4TTG A;  3LOY A;  2ZQ0 A;  3VDC A;  1RWA A;  3QDE A;  4BTX A;  3VD3 A;  2EAD A;  1RW9 A;  1EGU A;  2E2U A;  3DYM A;  1SNZ A;  3DX2 A;  3E80 A;  1HTY A;  3KN4 A;  1Z45 A;  2F18 A;  1SII A;  3ACS A;  3IMH A;  4OK4 A;  4BTY A;  1HMW A;  1NS2 A;  4BZG A;  1YGA A;  1N7O A;  3CV5 A;  1F9G A;  2CQS A;  1NKG A;  1LF9 A;  1RKY A;  1NS0 A;  3WVF A;  3AMO B;  3VSM A;  5CA3 A;  1N7Q A;  3HII A;  2WW1 A;  1PS3 A;  2E2T A;  3ALA A;  2JKP A;  1HXK A;  2CIS A;  3RSY A;  1D6Y A;  3AFL A;  3DX4 A;  3VD5 A;  1NSU A;  1K1X A;  3WA3 A;  1F4H A;  4KTP A;  1NS8 A;  4BZF A;  4DUV A;  2YFO A;  3OS7 A;  1JOV A;  3I3B A;  3EJQ A;  1US1 A;  1OJN A;  2CFD A;  1TQV A;  2D73 A;  3D51 A;  1NSV A;  3X41 A;  3IAQ A;  4NEI A;  3KII A;  3S4B A;  1J0M A;  3T2O A;  2CG0 A;  1NSM A;  3E1F 1;  4FNP A;  2F7P A;  3N9H A;  2BRV X;  1JZ3 A;  1TXK A;  1TQS A;  1JYW A;  3BUB A;  2ALW A;  1V7V A;  4EV5 A;  1RWC A;  1HMU A;  2F7R A;  3VSN A;  1KSI A;  3VD9 A;  3NJX A;  1V7X A;  3CZN A;  1H54 A;  4FNT A;  3QFZ A;  3K5T A;  4DUW A;  1SIH A;  3DX1 A;  2WVX B;  4FNQ A;  3HI7 A;  2PNC A;  1AVL A;  1UI8 A;  3T08 A;  2E22 A;  4KFF A;  3J7H A;  1F1S A;  3MV0 1;  3RRS A;  1JZ5 A;  3CZJ A;  2W0Q A;  1F4A A;  2CFG A;  3EJR A;  3QG0 A;  3WA2 X;  1NSX A;  4BZE A;  4FNV A;  2FYV A;  2OQE C;  5KBP A;  1QAL A;  3W7T A;  3LVT A;  1N7P A;  2X03 A;  1OJP A;  3D50 A;  2WOF A;  1O7D D;  1UG9 A;  3X3X A;  1ULV A;  3NJV A;  1DYU A;  3VD4 A;  1RWH A;  3MUZ 1;  2F1A A;  4FNS A;  3D3I A;  1RJO A;  1HWW A;  1LOH A;  3W7X A;  2CWT A;  4UFC A;  1X1I A;  1MMY A;  1IVU A;  1MMX A;  3MWX A;  2ZXQ A;  1JZ6 A;  3X42 A;  2WYH A;  4BZH A;  3OBA A;  3NRE A;  3NBB A;  2E24 A;  3A0O A;  3QFY A;  1QWU A;  3T09 A;  3NBJ A;  1JZ7 A;  1NSR A;  1W2Z A;  3DEC A;  1IVW A;  1CB8 A;  3VDA A;  1EKM A;  3S4D A;  1IU7 A;  1YQ2 A;  1L7K A;  2EAE A;  2ZL8 A;  1JRQ A;  3T2P A;  3BVT A;  3BLB A;  3WFA A;  3HIG A;  2WDA A;  3MPH A;  3BLC A;  2EAB A;  3BGA A;  4EV2 A;  3WIR A;  1W4N A;  5GW7 A;  3T0U A;  4OK2 A;  1C82 A;  2YFN A;  2CFK A;  3E7J A;  4DUX A;  1I8Q A;  1W5Z A;  3X40 A;  3AMO A;  3MV1 1;  3T0D A;  3S4A A;  1QAF A;  2XN0 A;  1UI7 A;  1MMU A;  3AFJ A;  1W3Y A;  1V7W A;  2OW6 A;  1MMZ A;  3MUY 1;  1NSZ A;  3PGB A;  2FUQ A;  4RNL A;  2F1B A;  3IAP A;  2C10 A;  2OOV A;  2HTA A;  4FNU A;  2WGQ A;  2RDY A;  3I3D A;  3D4Z A;  1NS7 A;  3SXX A;  1JYN A;  3VD7 A;  1LUR A;  3DX0 A;  1JZ2 A;  3WIQ A;  2CWU A;  2CFL A;  2CQT A;  3VDB A;  3W7W A;  2WVX A;  2XN2 A;  2E2V A;  3DYO A;  1QX1 A;  1D6Z A;  1HN0 A;  1DP0 A;  2OW7 A;  4OJZ A;  2WCO A;  2OQE A;  4AQ0 A;  1PX3 A;  2CFW A;  1JZ4 A;  1WMN A;  3OB8 A;  3S4C A;  2CIR A;  3X3Z A;  2F7O A;  3BUP A;  2BT3 A;  3BVV A;  1JYX A;  3TY1 A;  1A2V A;  3W7S A;  1IQX A;  4KTR A;  1HM2 A;  1WMO A;  3I3E A;  1LF6 A;  2F7Q A;  3BVW A;  3T0A A;  1LXM A;  2WOH A;  1IVV A;  1N9E A;  2WVZ A;  2CG1 A; 
#chains in the Genus database with same CATH homology
 1K1W A;  3K25 A;  1J0N A;  4TTG A;  3SEP A;  4J5T A;  4DUW A;  2ZQ0 A;  2WVX B;  1YQ2 A;  1L7K A;  3ECQ A;  1X1J A;  3Q1N A;  3T08 A;  1RWA A;  3VDC A;  3T2P A;  2E22 A;  3J7H A;  1F1S A;  3VD3 A;  3MV0 1;  1JZ5 A;  1L7J A;  3CZJ A;  1PX4 A;  3WFA A;  1RW9 A;  1F4A A;  5A1A A;  2WDA A;  1EGU A;  3BLC A;  1NSX A;  1NSS A;  3BGA A;  4BZE A;  4FNV A;  3DYM A;  1SNZ A;  4OK2 A;  3E80 A;  1C82 A;  1Z45 A;  2XHN A;  3E7J A;  4DUX A;  1OJM A;  1I8Q A;  3IMH A;  4OK4 A;  3MV1 1;  1RWG A;  3T0D A;  1HMW A;  1NS2 A;  4BZG A;  1YGA A;  1N7P A;  1N7O A;  1MMU A;  1OJO A;  3DCD A;  1W3Y A;  3T0B A;  1F9G A;  2X03 A;  1NKG A;  1HN1 A;  1MMZ A;  1OJP A;  1LF9 A;  3MUY 1;  1LXK A;  1NS0 A;  3WVF A;  1NSZ A;  2FUQ A;  4RNL A;  3VSM A;  1N7Q A;  1N7R A;  1UG9 A;  2WW1 A;  1ULV A;  3IAP A;  5E1Q A;  3NJV A;  2HTA A;  2JKP A;  3I3D A;  1RWH A;  3VD4 A;  1NS7 A;  1JYN A;  3MUZ 1;  2CIS A;  3VD7 A;  2XSG A;  2WVY A;  3AFL A;  1LUR A;  3VD5 A;  1NSU A;  2JKA A;  5JMF A;  5JMD A;  1K1X A;  1LOH A;  2Q1F A;  1JZ2 A;  1RWF A;  2WW0 A;  1F4H A;  1JZ8 A;  2FUT A;  1NS8 A;  4BZF A;  4DUV A;  2WW2 A;  3OS7 A;  1X1I A;  1MMY A;  1JOV A;  3I3B A;  3VDB A;  2WVX A;  1OJN A;  2BRW A;  3DYO A;  1MMX A;  3MWX A;  2D73 A;  1SO0 A;  2ZXQ A;  1NSV A;  1K1Y A;  1N7N A;  3BS6 A;  1JZ6 A;  3IAQ A;  1HN0 A;  1JYV A;  4NEI A;  4BZH A;  1DP0 A;  4OJZ A;  3OBA A;  2WCO A;  3NRE A;  4AQ0 A;  2E24 A;  1J0M A;  1PX3 A;  3A0O A;  3T09 A;  1JZ4 A;  1NS4 A;  3OB8 A;  2CIQ A;  3T2O A;  1NSM A;  1MN0 A;  3E1F 1;  2HTB A;  2CIR A;  3T2Q A;  1JZ7 A;  4MMI A;  1NSR A;  2BRV X;  1JZ3 A;  1TXK A;  2JKE A;  3DYP A;  3A24 A;  1JYW A;  2WZS A;  2WW3 A;  3DEC A;  1JYX A;  3TY1 A;  2BRP A;  1X1H A;  1CB8 A;  4MMH A;  1HM3 A;  1HM2 A;  3VDA A;  3I3E A;  1LF6 A;  1RWC A;  3T0A A;  1LXM A;  1HMU A;  3VSN A;  3VD9 A;  3NJX A;  2WVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...