3Q1SH

Hiv-1 neutralizing antibody z13e1 in complex with epitope display protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
225
structure length
211
Chain Sequence
EVQLLESGPGLLKPSETLSLTCTVSGGSMINYYWSWIRQPPGERPQWLGHIIYGGTTKYNPSLESRITISRDISKNQFSLRLNSVTAADTAIYYCARVAIGVSGFLNYYYYMDVWGSGTAVTVSSASTKGPSVFPLATSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design of a Protein Immunogen that Displays an HIV-1 gp41 Neutralizing Epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/cytokine
molecule keywords Z13e1 Fab light chain
total genus 39
structure length 211
sequence length 225
ec nomenclature
pdb deposition date 2010-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q1sH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q1sH01
3JTTA 3C5ZA 1L6ZA 2VZ1A 2AEPL 1ITCA 3ZL4L 1DEEA 1NFIB 1FFQA 4CU6A 4RGMB 4HJGA 1ZK9A 3DLQR 2RIKA 3V4UL 3P11H 4Z7NE 4RBPK 1X5ZA 3L6FA 2VQ1B 1L0XA 2ICWA 4BH7B 1UB5A 4Z0XB 5EORH 4JHAL 5HHPA 3SY0A 5GGRY 2DI7A 1WFUA 2BSRA 3ROOB 3VXOA 1NDGA 1FGVH 4L3EB 5J11B 3GNML 4W4OA 1IGCH 3O2DL 4LLUA 5JPNB 4XC1H 2DLFL 3M17B 4JDTH 4PJAF 5BCAA 2ZNWA 1O5DT 1UB5B 3QXVA 3FO2B 4JZOA 2Z8VC 1KTDB 4NUGH 3BQUC 1KIPA 3UPRA 4ZSOA 1CXIA 4FG6C 3X3GH 4LRNL 3NCBB 4NNPL 5FECB 2BSRB 3NPSC 2HMIC 3PHQA 4GXVL 2J5LB 4QTHA 1MFNA 3CSBA 3HHRB 1JNNH 1AGBB 4S1SL 2VZ3A 2ZOKB 4HULB 3L95A 1L6XA 5FUZL 2DJUA 4XVUD 1HEZB 1MRDL 2FZ3A 5MENE 2APWA 3RI5K 3CJJA 4M6NH 4UV4H 1NGZA 3HNVH 3F12B 2CD0A 5I1JL 2R8SH 3DROA 5EIQA 3BQUD 3DGGA 5I75C 1DQTA 1OAQL 5D7LD 3UTTA 4GUPA 3HMXH 4EQ2A 2FIKB 2APTA 1CFTB 5E2VL 1JZ4A 3F6IA 3S37L 2H32A 1TVHA 4R9HA 4PJXF 1F5WA 2FATL 4YBQC 2F54A 4L4TE 4RAUB 4X6DA 5FECA 3IYLW 1KACB 1TVBA 3NCJH 3BESR 5E5RB 3VGDA 1D5XA 5ICXA 1WWCA 1QBLH 4IDLA 1Q0YH 1WSST 1W72A 2W91A 4KTDL 3IDYB 4Z7OE 4QOKE 2IAMD 4P57A 3PXHA 4IOSD 2VUOA 3VD7A 1E28B 2VDOL 3QDJB 5A2FA 1JV5B 1MRFH 1OF2B 3EJYC 3VRIB 4WTXA 5CD5D 3CFEA 5DJ6A 4Z0BH 2DAVA 2Y06H 2GITA 3C2AH 4F7PA 3HI1A 4JLRB 2QL1A 1V3KA 4P57B 4RZCA 3FOLA 2VE6B 4WW2A 1I85A 3TO4D 4FZEH 1C12A 5DS8B 5HPMA 4NOFA 1JI2A 3QHFL 4OLEA 4YHKL 3FQNB 4IOFC 1XGQA 2H26A 1OM3H 3Q1SL 3G5ZB 5J12C 1BVKA 3P30L 4RMQA 3HB3C 4ZUUB 3IDNB 1INQA 2H32H 1AQDA 5HDBF 3VFSB 3MLVH 1HH9B 1FO0L 5GRVL 5A2KH 3C8KA 4PJIB 1ZT4A 1YN7B 1XGQB 2GCYA 2N1KA 4OF5A 2NTFA 5DMJB 4MCZA 1NCTA 1GCFA 3D9AL 2DN7A 2BSSB 3QUZD 3O9WA 5FK9B 5L0QC 3TEUA 3WNKA 4KRPD 2DM7A 5FGCE 2VLJB 4Z8FL 5EZLA 4X4YB 3HC0A 1BP3B 3V7AG 1GZPB 5KAQF 5IIEA 3E8UH 1FC1A 4KI5F 4QKXB 3HG1D 4PJAE 3GKWL 1XAUA 1NFDE 2F54E 5JORA 1T80A 1Y6NR 1F45A 5KS9B 1KXTB 1KLGB 5SWZE 4HPYL 1FFRA 1ACYH 2YHGA 3NCYP 1YMHB 5EU6D 1LQSR 4NHUB 4NQDE 1FVEA 2QJDA 2EDJA 3QUMH 1QEWB 4PV9A 2WNGA 2WM0A 3BW9B 1AO7B 3BWAB 2IQAB 1FL5B 3IETB 5CEZD 4Q6IA 1I1CA 3AU1B 1RIVH 3W0WA 3RKDC 1IFHH 1CICD 5LKNA 5IWLA 4Y5XB 4X4MA 5C7XL 5KSBB 1CXKA 3LCYA 4M7ZC 3WFHB 5GGVY 3O6FA 3P0GB 4WGVB 3RWJA 2GSGA 3LPWA 4WFGE 3OKKB 4NWUL 3IF1B 4G8IB 1A2YB 4MA7H 4JAMB 4RMUA 3MJ9L 1UJ3A 5D7KE 4PJAB 3MUGA 4GSDL 3MCKB 1KCKA 2VMFA 4Z9KB 2EKSA 1UC6A 3WLWC 1TENA 5K9JH 5EFIA 4FQLL 2DQJH 4BQ9A 4M7LH 3NZHH 3O6KL 3CVIL 5DDHB 4X7CC 1NGWA 5HYJB 1ZLVH 3ZZ1A 1R3JB 5F89B 1RUPH 3SDXA 5L2JA 4L1HA 1WLHA 2I27N 3ZYIA 1PZ5A 1CU4L 2J6EL 4APQC 4G8IA 5A40E 5GRJL 2P8PA 3CXDL 5ERWB 1D9KD 4DKEH 1QLEH 4WWID 2YR3A 1NKRA 1I8MB 5J13B 4EQ3A 3O8XB 3SE9H 3QHZL 1WZLA 5DK2B 1R5VA 1IKNA 5KSBA 1LDSA 1CK0L 5D7JD 2BRRL 2VR5A 5D5MF 3U0WL 3ARPA 5JXEC 2PXYD 4RA0C 2CDGB 3QDME 1RPQA 5FGSA 1WBYA 25C8L 3MO1B 1EHLH 3NIDF 5J06A 4G8EB 1MCCA 1DE4B 4E5XA 5FYJL 3BSZH 3K8KA 5HI3D 2MQ3A 4DJMA 3RWGB 5EWIL 2Q20A 3RDTC 2E27L 3O2VH 4I2XE 2HAZA 2NY4C 1G6RH 3BUTA 1YPZB 3B5TA 3BKJH 2ICCA 4ZSOE 2E7LA 1UWXK 3OZ9L 5SWSD 5HHNA 1JPFA 4LEXL 3I75B 1DBML 4HK0B 4ZAKB 3X3GL 1PYWA 1TJHH 5HDBE 1PJ9A 3A67L 1CDHA 3H3BC 5A2JH 1R3LA 2X4QB 2YC1B 1ZE3C 4ENED 4DCQB 5TE6L 4UDTB 4JN1L 3ECBA 1DP0A 2AJZB 4PD4J 2YKLH 4KRNA 5CLTA 4UINL 5CILL 3FN0H 3U46B 4I3SH 1E6OL 3PWPE 1GC1L 1A7NH 1CVSC 4XCCL 1F90L 1A9EB 5C0DB 4Z8FH 3RDTB 5LG1A 1S7QB 4GMTH 3GMNB 3LH2L 3TA3A 2LTQC 2D2OA 1J7VR 1I7UB 1WZ1H 4L4JA 2MHAA 3D39B 4NPYA 4OQTL 4HEPG 4NZUL 3G5ZA 4TVSa 1F58L 3GK8L 4RWHA 1JNLL 5E56A 2Y5TA 3IDNA 4OFPA 5JIKA 1BZ9A 3MNWB 2HRPH 3VFPB 5E7BA 4H8WC 3TYFB 4JFDA 4ZYKA 3HRZB 3V6BR 4RIRB 1WAAF 2VH5L 1XF2A 1F4WL 2LE9A 1HE7A 4LLWA 2HFGH 3PNWB 1M71A 1K8IA 4XMLL 4PJIF 4OGYH 3LKQB 3ULUF 1ZOXA 4YBHA 5HYFA 5DVMA 1Q1JL 5EN2B 2A9NL 3TFKC 2E3VA 1QFHA 3TYFA 4LNVA 5EZIH 3QUZB 3L7EA 3G6JB 3TVMC 3VFRB 4R0LB 2V7NB 4EDWL 3NPZB 4M62L 5SX4I 3SBWC 4H26B 3PNWA 5DS8A 3ALWA 3GHEH 4I9WE 3SE9L 3CGTA 3T2PA 5DJZA 2M26A 4XXDA 5EPMA 1X6NA 4HIIB 1RURL 3FO0L 3KPRE 1A21A 2F8VA 4HPOH 4X6FA 5DJXA 1AC6A 5E6ZA 5TE7L 3WE6A 3L3HB 5DLMH 4HW6A 1T89C 1W72H 1XF1A 4U3CA 4RQQA 3OG6B 4NQDD 2ZP0T 4MAYC 1AY1H 5DMIL 1IKNC 2CLZB 3S96A 5TH2B 1HH9A 3HRZA 1E6JH 1DSFL 1H3PL 4G9FE 1YN7A 4KVCL 5C0NC 2DTML 4MNGA 2EXYD 5KOVC 5D7JC 2IMNA 5CUSH 1XF3B 2Y06L 4NWUH 4J6RL 4N8VA 3MUHL 5FGRA 3RKPA 3WNLA 2IAMA 2VIRA 4IIQC 4DEPC 4OLYH 4UT6L 3G6JE 5M94B 2BXYA 3L3OB 3OV6A 1FLRL 4Y8AA 5GPRA 3RVUC 3S5LG 2YD2A 1CLZL 4MNQB 1U8QA 2HTLC 3MJ6A 4JM2F 4WHCA 5DSCA 1RZKL 4YDJB 4JFZL 5BQ7A 3MLRH 3CLFL 3RVWD 1MCHA 4OCRH 3MBXH 2IAMB 4MYWB 4DZ8B 5I9QB 2F53E 5F9WB 4G42B 5IOPB 1BBJB 3WFCL 1JN6A 4HG4K 3OJ2C 4NNYA 1KCRH 2OL3H 3IDMA 4P3CH 4RRPG 5IHLB 5F9WC 4Y4FA 5CZKA 1NEUA 4PJ9A 4K7PX 5CGYC 2K9UA 3Q1SH 5E2UH 2EDWA 3SY0B 1JNLH 4OCLC 2GJ6E 2JJVA 2UV3A 2IPTH 5JNYB 3GMMA 3BQUB 2OSLA 5HGGS 3H7BB 2GIYA 5BVPH 4U7KA 3NCFB 5IB3B 5EO1A 1VKXA 2P7TA 4ALAH 4PY7B 2OCFD 1HCFX 4Y4FB 4P3DB 1KCLA 1KCUL 1CDUA 5BV7C 4KZDL 1QLFB 3V6ZB 3LB6D 4ONHB 5E2TL 3WIHL 5EFIB 3MLZL 3K8LA 4FZ8H 3VCLA 1T04B 4WW2F 4ZFFA 5J7CC 3OAYK 3SE8L 4XP9H 1NFIA 3N1PC 1TQCC 4HUKB 1CDYA 4HFUH 3VXSE 2X89D 3SQBA 2E9JA 3KWWB 4GKZB 3WHXB 3BO8A 3CDYA 1FNAA 1DBBL 1YEFL 1EVUA 2FX9L 3Q2CA 1BMGA 4LLAA 1JWSA 4AEHH 4R2GB 2WUCL 3MV01 1HYRC 3EYFA 5DJ0A 1E4XH 3I84A 4MXWH 5IG7A 1D9KA 2RCSH 2YPLE 3T77B 1E4KC 4HJJL 1JZ3A 4L3ED 3LQAL 3OXSA 3K7UA 3G6AB 5DRWB 3O2DA 3X11A 1EEUA 3IRPX 3TLRA 3UZVB 1ZS8B 2X4UA 4NN5C 4L8DA 4W81A 4JZOB 2J88H 3RWEA 4CGTA 1CL7I 4DQOH 4FQHA 3QEQB 3PL6D 3V8OA 3GSNA 1EGJH 1EO5A 1JNHB 4UZGA 1NAKL 2B5IB 4WIQA 2IADB 3GJFH 5L7XH 1MOEA 3EJYD 4QLRA 4JLRA 5JR1L 1ZS8A 2A73B 1IVLA 1ZHBA 3OKOB 1A4KA 1MCEA 1NDMB 1FVCB 1A6WH 1W0WA 2VXUL 4JPKH 3BO8B 5HVFB 5KVGL 1AY1L 1FNEA 3ME0A 4NQVA 5D7IB 5DMIH 3CXDH 1OSZA 3AY4C 5HGBB 3BT2H 1ORQB 4BFIA 2DM3A 1IBGL 1JNHA 2VC2L 4PRID 1AJ7H 5CCKH 4DVRL 4MB3A 2MCPL 3BMVA 5A2IH 2AJSH 5E8EB 3L7EB 3EYVA 3QQNA 4QHKJ 1INQB 1FNLA 4EI5C 2ZOKA 2C4FT 5CLWA 4YDIL 2HP4A 3MRJB 1M7IA 1S9VB 3VXSD 4ACPA 1ES0A 5F7FA 3BYYA 4OIIH 2QBWA 3PWJB 5T1LD 1SJHB 2HKFL 4LL9A 2WBJC 5HSFA 3TH3T 4WI8A 3DPBA 4C56A 2BMKB 2RCSL 3VFPA 3QNYB 4QGYA 4ZYKB 3WCYA 3RGVD 3B2VH 4U4BA 3NA4A 1N8ZA 3U79A 5D5MB 5ANMA 4UNUA 1HHKB 3V0AC 1AGFA 4KKLC 4WI7A 4I5BA 4JFDD 3BH9B 5HGDA 3EOYG 1TVBB 4LBEA 3QUYB 4YHZH 1NJ9A 1U8NB 3U36A 4WHYG 2RHEA 1Z0NA 5EUKB 3VI3F 4PJFF 1BFTA 3JV4A 4JY6B 3W11D 3HC0B 3AGVA 2WBJD 5F6IB 3QIBB 3MZTA 1T1YA 4U6HA 5ID1B 5FKAA 2YD4A 1MVUA 5KW9L 1HK6A 4MDIA 1C5DA 5J13C 4F80A 1UYWH 1XGYL 5GS1B 2DQTH 2X10A 3SGDH 1JPST 4NGHH 2WIIB 5HJ3B 4AIZB 4EUPB 5IGXL 3SDYL 4OKDA 1I8IA 3O4OC 3H42H 5I74B 1OAYH 2NR6C 2Q86B 4LCUB 2J4WL 4YX2L 4PJ9B 3PXJA 3SO3B 5EOCL 1U6AH 3AB0B 3D18A 1P7KA 5AWNL 1A6WL 1CFQA 3ARFD 2XZAH 4XP5L 4C57C 2PO6D 3OKMA 4MMZC 3QG6A 2Q86A 4PB0L 4P49A 5T5FH 5J6HB 3FQWA 5C0RH 1GGCL 5DHXB 4I3GA 2DQHH 3MGTA 4JY5L 5CJXA 4ZUTA 2F5AL 3H9YA 1MJJB 3RAJH 2DRUA 1RURH 5IROA 3QA3A 4MVBD 5E1HB 1X5XA 2HLFD 35C8H 2ZZUT 4E41D 1VFUA 4HV8A 1IEHA 2ZG3A 5ICZB 1MCBA 4M62H 1R0AH 1UCBL 4DN4H 1IQDB 4MXWL 3L3OA 3RVUD 4LSPL 1S5IH 4PGDA 4AEFA 5I17B 3I6LE 3AS3A 1C08B 5JOFA 5GS0D 1OCWL 1WF5A 5INDA 4XAWL 5ELIA 43C9B 2R2HA 3ESVF 4BM7A 1QVOB 4Y4FD 3RFZC 5F1NA 3VFWB 4HPYH 2ZCLH 1LP9F 5AYUL 1NGYA 2OMNA 4HWNA 3KPQB 3TH4T 4E0RB 3RWHA 4BSVA 4FQ1L 4Z7VE 1BGXH 2EXWC 2UY7A 3H9SD 4K55A 5LAXB 1N5AB 5J89A 5E2VH 5L2KD 2IG2H 3T4AB 4HSQA 3IFPB 1DQDH 1A0QL 2W9DH 3VD3A 5IW3A 43C9A 1ZSDB 2QKIA 4JKKA 5D8JL 4MDJA 1QVOA 3PWLB 4HZLA 4NQEE 4NQCB 1BPVA 5HI4C 3HRPA 2G75A 1CD1A 1CR9L 1P9MA 1IAIL 1G6RB 3N50A 4N1EA 3RDTA 3CDFA 1AR1C 5FYKD 3UDWC 4P4KB 4J1UB 3QEHA 4WHTA 4JFPA 1CFVL 4YHYC 2EDDA 1EFQA 1QSVA 3BP5A 5F7UA 2H9GB 5C08E 2ADJA 3TZVA 2HG5B 3D69B 1X5JA 1ITBB 3L5XH 4K3JH 4N68A 4MNQD 5DDHA 2VXQL 4XPBL 1M1SA 3WNOA 2J8UF 5E8DL 4X9FA 4ZO6A 5DUBA 3WDIA 4KUCD 5MENB 4DW2L 1EJOH 3CCHB 5ICYB 2GK0A 1S7QA 1DE4A 3RL1A 5H35B 5DUMH 5IUSA 4ZTOH 5TQ0H 3F5WB 4IS6A 3D0LB 4JR9L 4NOBA 4OB5H 4ZFOL 2VR9A 1NANH 1QSEE 3L1OL 3U1SH 1EMTH 1AKJD 5KW9H 3C09C 3STLA 4B7IA 4Q2ZA 2ZKHL 4MJ2A 3M8OL 1MELA 1OTUD 1J5OL 1PQZB 3DROB 1JHKH 4OCWH 4H0IA 4TRPH 5JUEH 1IGYA 4F8QA 4D0BB 5BV7H 5HDQH 4CW1A 3O4LD 5CEXB 2EDEA 3F7YB 1SEBA 3P4NB 1EAPA 2PW2A 2XIDA 4YHZL 4TSBH 4FFWD 2DDQH 5C0ND 4U6YB 1OM3L 4AG4L 3UJTH 5EUKA 4N9GB 5CEXA 1AJ7L 4OZ4B 4F15B 4G9DA 4D9QE 4M43H 4U6HB 5ID1A 4P5TD 4K07A 3I9GL 4TOYH 4HC1H 5DJZB 5DVOA 1TDQA 1DBKH 3OPZL 3SDAC 5EU5B 2DQJL 1UJ3C 2VN4A 4I3RH 3MBEA 5J9PA 4JY4B 1WWWX 5DWUL 2VLRB 4FQQA 4QCIB 2FEEI 4JRXD 3PG2A 1MPAL 1YECL 3ARBB 1TPXB 4G6KL 3WYRA 2X6MA 1RK1B 2C3GA 4N9OB 2VITA 4IHOA 43CAB 4R0LC 3NCJL 4PYHA 2JK5B 2VLJE 4X9IA 1P4BH 2GTZB 4YIQA 4PRPE 4QRQA 5AYQA 3R0MA 5E8NA 1PBYA 1ACZA 4FQQB 4O58L 3MGAA 3H7LA 4O2CB 3QB7C 1AQDB 1K4CA 4R0LA 5A16B 1D6EB 5FXCH 1JGVL 1JWUB 4BJLA 3R06A 3ZTNH 2WINA 3JWNC 4X7EC 4PJBE 4FP8H 1F13A 3DX6B 1S7XA 1Q9WA 2DYPD 4PG2A 1U3ZA 1AE6L 3MLYH 3U7WL 2MMXA 3GMQA 3C87A 3H8NA 3BH8A 5I1HL 2B1HL 2BRQA 2NYYD 4X4XA 4KVNL 3VGAC 1MRDH 4XGZB 3TZVC 1ZANH 1VKXB 1B0GA 3KYMB 4YPGA 2IH3B 3LN5B 3QH3B 3G6DH 5SWSB 1IJ9A 3ALPA 4MGXA 1EVTC 4RFNB 2ESVE 1KYOJ 1KG0B 5DVLA 2JK5A 1TTGA 2NW3B 4JFHE 1VGKA 2HH0H 3MXVL 3MRNB 1ACYL 1QQDB 3RUGB 3DO3A 4L4VD 4R7NB 2PTTB 3EO1B 1FNSH 3QIUD 1P7QA 4PJ5E 2X70A 3OAZK 5EZLB 1TCRA 2QSCL 1T6WA 3FQWB 4NRYB 5GS0C 3ARBC 3MRHA 5LGHH 3X14A 4H88L 5FYLH 3ARUA 4DAGH 2BVEA 5T3XD 2FL5B 1IGTB 4KK9C 3VXQA 5BV7B 4N1HB 4NQCA 4HKZA 5LJYH 4O2FB 1D9KB 4WWKA 1XMWA 4HH9B 3VG9B 4X6CF 5EOQH 4JFYB 4P2OD 4P5KA 3NIDE 1A1MA 2I26N 3HI5L 3S88L 3GMRB 2GW5A 3MGOB 3TV3L 1D5IH 2DLEA 4K7PL 1R6VA 3H3PH 3NCYS 5IW1A 5HDOA 4XXCA 3PWNA 1A0QH 2VB5A 3GJFA 4NKMB 3ZKNC 3KG5A 4NN5B 4HHAB 2IG2L 4CNIB 1SEQL 2WV3A 2R2HB 1FDLL 1RZFH 4JFYA 4PRNB 2J8UB 1LO2H 4Z7QE 4S1DD 4R7NA 3QNZA 2YN3A 4JVPA 4I0PD 2CUMA 2IQ9L 1A7OH 4Q6YA 3E2HC 1BIIB 8FABA 3T4AA 1FPTH 4WO4B 1T7ZA 1PG7X 3NN8A 4Q0XH 3MCKA 5K9JL 5E24E 5KAQG 4GRWH 1J11A 5IQ9A 2IJ0C 2Z92B 3WFDH 3GSNB 4NQSA 5FAAA 1ED3A 1CLZH 3CX2A 4F9LA 4XP6L 4C54A 2C1OA 1U58A 2DL2A 1PZ5B 4O02L 2QSQA 4GG8B 2CDFA 1T5WB 3ARED 3MGOA 4CMHB 4XNXH 1BF8A 4LFHD 2A1WH 3T8XA 5D71H 3FTGB 3TVMA 3M07A 2W9EL 3QYCA 2HG5A 4WEBH 5ACZB 1FSKC 2XTJC 5CMAB 5BS0E 1CGTA 1MFBL 5IG7B 3T2OA 2D31B 4R2GC 3LQAC 3W9EA 5HHNB 5TE4L 5DD6B 1KIRB 1CD9B 1F8TH 3KYNB 2AK4B 5D1XB 2BNRD 1R3LB 2X4QA 5D7LE 1EGJA 3F5WA 1GJIA 4AYFA 4NZRL 3MRJA 2VZVA 4NUJA 4LDLB 3C5JA 4J3TA 2Z35A 5CZXD 1NGZB 2UZYB 5F9JA 1YPZA 1IILE 2DQCL 3DGGB 3OKNA 1SJEA 4RFEB 5DRWA 1A9EA 3AB0C 5FHAH 1MQ8A 2V5RA 5IV2A 3EYOB 2K7QA 4TNVK 4JFED 2FJHA 5AD0B 5ICYA 2FO4A 4HDIB 5C0BD 3V95A 2W9LA 2NNAA 4E41E 5CZXC 3GJEA 5SWZD 3RHWF 4GAYA 1U8LB 4EI5B 5FDWA 1I9IH 3IFNL 4WFFE 1KB5A 3CLFH 4PJEB 2PYEA 2E7CA 2H2SD 1DL7H 2FRGP 5B38G 3OB8A 3VJ6B 1RQ5A 1S3KL 4TULH 3W81A 4KQ3L 4N8VG 4AK1A 4GW1A 2ESVD 2BHYA 2OP4H 5FV1L 3MROB 1JWUA 4XMKL 1P2CB 5I1AB 3C5ZC 3QI9D 1YJDH 2A6KA 1M05A 4P2RA 2ZSVA 2OBGA 1U36A 2G5BB 3DNKA 3QEUA 3TYGL 2HJKA 1QSEA 3WIFB 1FGVL 1I9RH 2ZOLB 4QWWD 4Y2DC 1G9NL 5AZ2L 5J12B 4RZCB 4LHQB 4KH2A 5DMGC 2Y4SA 3R8QA 3LRGA 3V79C 1MFBH 3BWAA 4ZUSB 4PJGE 3LB6C 3UJJH 1X9QA 5L0QB 3QFJE 3NAAL 1FYHB 4XPGH 4OLUH 5FCUL 2W60A 1D7FA 3C8HA 1XF2B 3F62A 2D3VA 3RJQB 2HLAA 43CAA 4L8SA 3KJ4C 4HKJA 1YECH 1VA9A 1QA9A 3MV9A 4R96B 4CDHA 5I1HH 1GZQA 1W0VA 3O8XC 5AUMB 4KAQH 3F65A 3CFJA 3OG4B 4FA8A 4AL8L 1S7UA 1U3YA 4L29B 1U95B 4NWTH 3WD5H 3DSFL 1RUAL 1CGYA 2C3VA 2WLZA 3RTQA 3B8SA 5FDYA 4M93B 4PPTA 3ZLQC 4X5WB 5H94A 1G7IB 4ZQKB 3QUXA 1I3UA 5J6HA 1ZWIB 5EH1A 4NN6B 4KMTH 5SX5H 3L5WB 2AV1A 4MA1C 5KSVA 2QTEA 4QGTA 4MXQC 4ZUTB 4OIAA 5CSGA 3ZSSA 1WT5C 2DQFB 3HMXL 1G9NC 3SKJL 2YD9A 5F71A 2YXFA 5C71A 3KPPA 3O6KH 4WRLA 2M1KA 2P5WD 2Y6SC 5H94B 4NFDA 1ZLSH 3V0WL 3G6JF 4P2QE 3V5HB 3RWDA 4CNIA 4CVWA 2R0ZL 5I75B 1F02I 3DETD 3O6MH 4K7PY 4Y5XC 2VRAA 4XVUC 5INDB 4ODXB 1C5DB 4CU7A 2WWMC 1XCTA 1R5WA 5TF0A 1IGJB 3VFWA 4Q9CA 3C09B 3VW3H 1WV7T 4U0RB 3P9MA 3FHAA 4EOWH 2LVCA 4MNHB 2X5PA 4NRYA 3U0TA 5HPOA 1AXIB 2IFFL 4PUBL 5LAXA 3FO1B 5HYJE 2R0KH 5KVDH 1CZ8H 5LBSH 3UO1H 4DOHE 2KDGA 1I9EA 1FBIL 3MXWH 3QA3B 1BZ7B 1TNMA 4JPVH 5EDXA 3T1FB 4AEIL 1U58B 4HV8B 3OKDB 1WCQA 1LNUB 4MWFB 5GHWL 3U2SB 2D7MA 2CMRL 3DSNA 2DYPB 1OL0A 3BKJL 1RU9L 3UMTA 2PTVA 5T3XL 1F3JB 1X6LA 2JJWA 3OR7B 4OIIL 4U1GB 1NGWB 4OD3L 1A6AB 4ZODA 3EYSL 4JM2B 1JMXA 4MJ5B 1EEZA 1NC2B 1GGYA 5BO1L 3V5KB 5GJTH 4J3OC 5GGVL 2I25N 4UIMA 1XGPA 4RAVA 1QKZL 3MLXH 4I2XB 1ZGLB 5DR5H 4NUJB 2B0SL 1E27A 3SOBH 2BVPB 5JOFB 4PJ7B 3MJGX 1YEDA 5E9DB 1VFAB 4UTAH 5B38B 4DK6A 4NJAL 1A7PH 4S1QH 2NY1D 4DKAA 4HJ0C 2VXUH 4UIMB 1P4BL 2C7UB 4MXVF 1IKFL 1D6VL 4L8CB 3NABL 3LKRB 3VWKA 2EO1A 4Z18A 2OZ4H 3KWWA 3NTCL 5AAMA 3FTGA 3TVMB 4QXTA 4IJ3C 1ZHKB 1SVCP 3DX8B 3Q6GL 5CJOL 3WSQL 1VDGA 5IHUL 1VFAA 3MJ9H 4QF1B 3PWUA 1UCBH 4HKBB 2IADA 3PWLA 4DN4L 1TLKA 4H0HB 4IRJC 3C2AL 1OT1A 5J1AA 3BHBA 4LVOB 3EO9L 4DGIL 1DBJL 1T03H 5CSZB 4P99A 4XXCC 2FYYB 1F3DH 4LU5H 4KDVA 3BJ91 3LQAH 1JTTA 2BP3A 4OFVA 2QADC 3QULA 4W6XB 1CU4H 3MCLH 2W38A 5D72L 3SGKC 4MJIA 4FQJL 3QPQD 4N8CL 4ZUVB 4U1KB 3U9PL 1F11A 3P4LA 3OKNB 4P5MB 4HUWA 1U9KA 4KJPD 5B38A 3LEYH 3OAUL 2H3NA 2BSED 2CLZA 1N4XH 3VWJB 3A6CH 4ERSL 4GUPB 4L8SC 3THMH 3O6FD 4YJZL 3LDBC 4V1DD 5EUOB 3ROLA 1AD9A 2F53D 1AXTL 2V9RA 5LGJA 1QA9B 1YUHB 3QIWB 4U1KA 5JHLH 1YQ2A 1HHIA 4P2QD 2UUDK 1MHHA 1DLHB 4JY5H 4K7PH 3KLDA 1M6OA 4D0BA 3RWIA 4QHLB 2AEQL 5FO7A 5EUOA 3ROLB 3ZKMC 1BAFH 2GAZB 4FRWA 1MCWM 4U6VH 1LEGB 1NFDA 1U2CA 1OTUC 3GEWB 2NY3C 4Y4FC 4OIBA 2BSTA 1FGNH 4NO2B 3CDGB 2Q3ZA 3FCTB 2FB4H 4FTVD 3DO7A 2X89A 3F58L 4GQ9L 3DX9B 2Y7QA 1QQDA 5D6DC 3RUGA 2IH1B 3GSRA 1UM6L 5IJVB 2X70B 3TT3L 3X13B 1I4FA 3SQOH 1NGPH 4ZO7A 3MRLA 4POUB 4NC1E 4JDZA 5CJ8A 2PXYA 3VDBA 2YA1A 1HHKA 4CJ0A 4DKFH 4XP4L 1CDCA 1WBXB 4R96A 5IT2L 2NW3A 3PABA 2R69H 3KXFD 1MF2H 3RUGE 3U9UB 5CP7B 1BM3L 2H6PA 1A6VL 1WEJH 4OD3H 4WU5A 3TO2A 2A9ML 5A3IC 1XGUA 4K9EH 12E8H 4BK5A 5IEHB 3QWOA 1HI6A 3MLUH 4FQXD 3VGBA 1FAIL 3L3DA 5D1ZD 1UKQA 3MNZB 5FGBA 4HC1A 2VZSA 4L8SB 1OD9A 4X80L 2R1XA 4N0UE 2VIRB 4UT9H 2ZSWB 4ODTH 4XBEH 5IMMA 1AH1A 2DI9A 4LF3A 1YJDC 1CF8L 1XGUB 3CFJB 3N1MC 3G5YB 4KKBC 2IQAA 1C5BL 2W0KA 3JVGC 4JRYB 4MXVE 2J1KA 4GXUN 4YHPA 1J0ZA 3L3GB 3DRQB 3DXAA 5DJCB 3L3JB 5MHSD 4XX1G 2IAND 2PO6B 5I1GL 2NY5H 3X12A 1R5WB 1JCKA 1M4KA 4F3FA 2HVKB 4GBXC 4U1NA 2OM5A 1MRFL 4NP4L 2GSIA 4OLXH 5D96C 5JW3H 3VDCA 3LMJH 5GS0L 5IBLC 1QBAA 3TT1H 3K80A 5KSAB 4PV8A 2EEAA 4HF5H 3FMGH 3K8MA 5EBLA 5T1KB 2WAHA 3O2WH 1MCLA 4Y1AB 3LQZA 3V4PH 1OTSD 4YDKL 4K94H 3GUTB 5HHMB 3S7GA 4OF8A 2EYTB 1IL1A 2XN9A 1IC5H 1T1XA 1I7TB 3EOAB 1A2YA 2V7HB 1RIUL 4NQEB 3BZDA 3MRHB 3C5JB 5F1KC 2YPLB 4HWZA 5E8OB 3HAEB 2XOTA 3GMLA 4M3KB 5EA0L 1I1AD 1FAIH 4OUUB 4I18A 1P4IL 3PJSA 4PJCB 3T1FA 4PLJD 3Q0HA 4WUUD 4JPWH 5BS0A 4L3EE 4GMTL 4RAVB 5EU4B 4WO4A 3P4MB 1E6OH 2VL5B 4UU9B 3RWGA 1S9WA 5E2WL 3V4VL 2Z92A 3T0VA 3UJJL 4ONOA 3DUUB 2HJFA 5IMKB 3O41B 5DJ8A 3EZ8A 3RL2B 5TQ0L 4ZTOL 2JELL 3V6OC 1YNTB 1XGTB 1XIWA 4PLOB 2GK0B 4BK4A 1T7YA 2CDEB 2O5YH 4DCQA 1ZGLA 4YBQD 1CZ8L 5GIRA 2A0LD 4OGZA 4WHDA 1KEGH 4O9HL 2BX5A 1E4JA 3QEUB 1JGLH 3H6JA 4R90L 4UT7L 3NCCB 5MI0B 1QHPA 4M7JH 1A64A 3WFBH 4BZYA 2GFBA 3GRWL 2XWJA 5IB5B 3HB3D 3TWCL 4U6XA 3UZQA 3KJ6L 3SE3A 3JTSB 3V4UH 2W60B 4C59B 3I85A 3ZE2E 2IPUK 4QWWC 2PW2B 1MLCA 5C09E 4OQTA 1NLDL 5I8OH 4O5LL 3MLRL 4YHNB 2ZSVB 4U6YA 5C0CD 4F58H 3KJ4B 4RFEA 4O00A 1PQZA 1YMMB 5HJ3A 2PW1A 3KLAB 4MA1B 1KB5H 4IRZL 2DTMH 3HN3A 4RFOH 1C12B 4ODHH 4J8RB 4U1JA 1DEDA 3MA9L 3QEQD 4KI1A 4QO1A 4ODWB 4TNWK 1T5XB 1CE6A 2VDLL 5C9JB 5DQJA 4X0KB 1LEKA 3TNMB 4OF7A 4JKPL 4OSUL 3DIFA 4EBQL 5I8EA 3ZE1E 4HLZG 4GRLC 2CXKA 5KTEL 3FQXA 5F9JB 3EOBA 2IFGA 4C83A 5FO9B 4H0GA 2ARJQ 4X6BB 3NACH 2B2XH 1P2CA 1XGRB 5GSVA 4U1HB 1NCAL 3QRGL 4U6XB 4I0PC 2AV7B 1DBJH 3FN9A 4JFHD 1CD8A 4OF6A 4RGNB 1A6TB 2A77H 1F00I 1A6ZB 2IALA 2UVEA 5JW3L 1Z3GL 1FORH 1U8HB 4MCYB 1NUNB 5GJSH 4L1DA 5T33H 5IB2A 1MAKA 1YN6B 1VB9A 5GS3A 4WENB 3W5NA 3MV9E 5EC2A 4RA3A 1CFBA 3UTSE 3WNNA 2GHWB 4H25B 3INUH 1IGIH 5HY9B 3VXMB 4N0RA 4YGAB 3ILPA 4YZFF 5T3ZD 3B9KB 2G5BA 1FQ9C 3D6GA 2EDQA 5IQ7H 5F1NB 1E4WH 3D85D 1FV1A 3Q3GA 1MQKH 3AREC 3ILQC 3O3AB 3EBAA 4O2CA 2R8SL 5JW4M 5TH2A 2HMID 2FDBP 3QDGA 4CVZA 2DLGA 4MD5A 1J1PH 2OLDA 4KZDH 4FQCL 1A6TA 3SDXE 4M93C 1LO5A 4ALAL 4U1SB 1SJXA 4KC3B 2N4IA 4FQXA 5DD0H 2JF1A 4CVXA 1Q9OB 3EFFA 3FB5B 4LPWA 3OKDA 2C3VB 1AHWC 1CTOA 4TQEL 1N26A 3TBYA 4FQXC 4W70A 2YPLA 4ZTPL 5EIIB 2FBJH 3HUJB 4IMKC 1FN4A 4FQ2L 1JGDB 1P9MC 3SDAD 4A6YA 4U31A 1F58H 3GK8H 3QCVL 4OI9A 3SDXB 1FO0B 5DJDA 5L2JB 2KUTA 1YEEL 2FB4L 3MJ8A 4XVJH 1BD2E 4P5TA 4Q74A 5JW5B 5KJRL 3HCVB 4P4RB 2XQBL 3LZFH 4IS6B 2ARJA 4Y4KB 2EXYC 3FFCA 2WWKO 4KK8C 1EDQA 5DI8A 5IESH 4EI6A 4IRSD 2YWYA 3BXNB 4KKCC 1RJZB 2B1AH 3WIIH 3FT4B 5DJDB 1JZ7A 3OJMB 3OB0K 1YEDB 4KGJA 5CSBA 2ED8A 3M1BB 2NXZB 2FJFB 4NYLB 3KPOB 3B9DA 3MLTB 5HD8D 1HSAB 1HQRA 1NGXA 1BREA 1CFSB 1O0VA 4LFHG 4YHMH 2YSSA 3IKKA 5BJTA 1EX0A 4NBXB 2YUVA 5E8OA 1DDHA 4HBQA 3MV8B 1NCDH 4JZJA 5I8KH 1EEZB 3GSWA 2BK8A 4ZFFB 4MD0A 5H2BA 3LIZL 3NZHL 4PB9L 4P4KA 1DZBA 4JZJC 3WL9B 1FDLH 1S78D 3NVQA 2CXGA 1UFUA 5C6TH 5D5ME 2Z93B 4KK5D 2GT9A 2VL5A 4LDOB 1QRKA 2F58L 4FQHB 4ELMF 4LCYB 3FB8B 1WQVT 4L8BB 4AT6B 3HMWL 2AXFB 4KHTH 4KGLA 3GHBH 2HJFB 4OGXH 5DRXB 5I1LA 2HN7A 4NQSB 4XWGL 2VLRA 3T77A 5L8KB 5EBWA 1J86A 4KJYB 3M1BA 2AK4A 5BZWB 3E3QE 1EA9C 1E4KA 3LKRA 1X44A 5C09B 4HUVB 5DRNB 1RK1A 4KK6C 3DVNA 4XPAL 1AQKL 5D6CB 4I4WA 2GAZA 1F6FB 4IRJA 1EEQA 4YXHL 2ERJB 1ORSB 4QHKI 5CFHA 2QSCH 1KGCD 2DQUL 4JDVA 5IK3A 2KBGA 3UTSD 1CFNA 1HHIB 1TTFA 1F6AB 1LE9B 3WO4C 3QZWA 4HT1H 4LP5A 4UOW1 1I9JH 4CKVX 2BJML 3I2CH 2PYFA 4HZAA 4S2SA 2F5BH 5D9SA 4Y19A 2J12B 3AMLA 4XP9L 3P3YA 4PBWD 4B5EA 5D7IA 1IM3A 4F58L 2BNUA 4ENEC 1TNNA 4NGHL 4MAYB 4DVBB 4HJ0D 2NY1B 4KK6D 4LCIH 2DWEB 4OT1L 4J3VA 1I8KB 3BRDA 2XYCA 4YDLC 4TUOB 2VOTA 4XCNB 1CICC 3NIFF 1SJEB 2P45B 3CFDA 3TJHD 3RU8L 3ARVA 3GSOB 4HMDA 4F33B 4M8VA 5DD3H 1TPXC 4Y5VC 1JFQH 3BEWB 3DVNB 3G5VB 5D6CA 3BKYL 2FO4B 2NW2A 4HDIA 4HIEB 5HI4D 5LGJB 1TJGL 2ICES 2ADIB 1D3CA 4B7LA 2P4AB 4KK8D 4QRPD 1U8IA 1MQKL 1GGUA 4QYOA 3BPOC 3AS1A 5JQ6L 5JTWA 1M7DB 1BVKB 2BVOB 3LVEA 5I8CA 4UTBH 2XXCB 1Q72H 3CFKB 4P9HC 2G2RA 2R4RH 4AEIH 5JPMA 4NCC2 5L88L 3C6LB 2EXWD 2VERN 3VG9C 4OZHB 4JPIA 2YPKB 4K7FA 4NJ9L 1NC4D 5FKAB 4Y19B 3K3QA 4RMTA 4PJDF 3L5IA 1UQSA 5D93B 4OKVA 3E6FB 1AQKH 2W9EH 1NUDA 3FN3A 5KS9F 4PLNC 3GB7B 4L29A 1Q9KA 2DKSA 3VD5A 5HYJD 4LF3B 3GSQA 1S7WA 4H5SB 1AD0A 2AV7A 2XN9E 1KENH 3MLPA 2BCKA 4Z7VB 5EIIA 3MLVL 2E8ZA 4X6EB 5JXED 3ORJA 3QXDA 1CG9A 3OAUH 2BNQB 3HUJF 2B4CL 5D2NB 2F74B 3U4EB 5I8CB 5INCB 5JLZB 4KXZH 2OJEA 1WIUA 4PS4L 1JL8A 4POZD 1B4JL 4L9LA 5KBNC 3UP1A 4PJHB 4ODHL 4JANB 3OJDA 4PFEA 4WNQA 2ZUQC 1FG2B 1W72L 2P42B 5CJQL 5FUOH 1FH5L 1ZWIA 4G6JL 1NAMA 4DUVA 5DYOB 4ZO8A 3MYJA 1MWAB 4Z0BL 3GMLB 3R1GH 3JBG7 4Y4HA 4D9LL 2KL6A 2BDNH 4N8PA 2NR6D 3IS0X 4BYHA 5D2NE 3LDBB 1J5OH 2P48B 4PRBB 3ZDYE 2EYTA 3S4SG 1GOHA 4JGUA 1GGCH 3C9NB 3SCMD 4NO0D 4NJ9H 4MXQD 4OT1H 3TA3D 3BIBX 4Z78B 3SDXF 1BWMA 1X5YA 1BQUA 2D03H 4KRPB 1ZTXL 2AQ1A 3QO1B 2CIIB 2VTFA 4PRBA 4E0RA 3I2CL 2CDEA 4G6FD 4PJHE 1JYNA 1YEKL 3WS3B 1FG2A 3PE9A 4FXKB 1QYGH 2KPNA 4M7KL 3UO1L 3F7RA 5GRUL 3HAEG 3PGFH 3D2UD 5I1IL 3EO0B 1HQ4A 2EO9A 2B20A 3QNZB 2EDOA 2HYMA 5FYJD 2X4UB 2BOCB 1L7IL 4J1UA 5DMGD 5IVXF 3WN5C 2CMRH 4PYGA 4GFTB 2VDNL 2IAMC 5K59F 4LMQE 4LSVH 5C0FA 3A6BL 1N7MH 5FDWB 2ZCKL 1K4DB 3ARGD 4WFED 3AROA 1DDHB 5BVPL 5DF0A 3VA2C 3DYMA 1ZHLB 3MFFB 5F3HA 3U7YL 5AYUH 3I75A 4HK0A 2Z8WC 3WJJA 5C6TL 4OZGE 3ZO0A 3QJHB 1HH6A 4RGOH 1CT8B 1BJ1J 5D9SB 4YO0A 3VWKB 2YC1A 3ZKQD 4EI5D 3MLTA 5IB4B 4JM4H 2QQQA 5A43C 5HVGB 4IIQA 3SDAA 1FL6A 3RY6A 4OCSH 3QDJD 4JFEB 3NA9H 4CADB 2P24B 2D31A 1RUKL 1RIHH 4JO3H 3STLB 3HI1B 3L9RA 5DQDH 1HXYB 3VXUA 3WD5L 4HWUA 3ARGC 4HWEH 4QHMB 2RFXB 4LNRB 2XA8H 4HUXB 3BIAX 1JPTL 1UA6H 3HMWH 1V7MH 4KHTL 5C09A 3CCHA 2ID5A 4XNYH 5K9OB 1WVZA 3FFCD 1T83A 1T7XA 4KTYA 1V7NH 3PL6A 1T2JA 5DWUH 2JIXA 1NMCC 4HKJB 2HT4C 4YC2C 5FB8B 3U6RB 2IALB 2AK4D 4URTB 1INDH 1M7DA 2HFTA 2P5EB 3C5SB 3V0VB 3D39E 1H8NA 5I18L 4AT6A 1KPVB 5K59E 3PL6C 4PGEB 1WJ3A 1MCPL 3I50H 3WDJA 1YDPB 1I3VA 3P0VH 5F6IC 3WFEL 2CRMA 1U8MA 5GRJH 2VISA 4X6BA 1U8JB 3A6CL 4RRPA 4XP1H 2ADGA 4F57L 2XWTA 3QUXB 1X3DA 3HE6D 5ALBL 4TUKH 3VI4E 2OZ4A 3LEVH 2VXVH 5KSVB 4DVBA 1KOAA 4FQJH 5CD3B 1OGTA 5GGSB 3RRQA 4M48H 1C7SA 1X5IA 2W0LA 1N3NB 5FOBA 3Q3GB 1F42A 3GSQB 1KGCE 3VFRA 5MI0C 4HXBL 3FFDA 4YE4H 3T0EB 3VFGH 3ZKXC 4K8RC 3MRIA 4CVZB 4CN4A 1RVFH 5C07A 5C9JA 4K2UH 4GKSA 1MCQA 1FCCA 2ADIA 4ZNEE 4NCC1 3QCTH 4I0PB 3UCRA 3HZYB 1U8PB 3ALXA 3FRUB 3QG7H 2A9NH 3RVVC 3B9KA 1GHFL 2VSCA 3DO7B 3FJTA 4OZHF 1MCDA 2R29H 3DVIA 4AIZA 4EUPA 4NZJA 4ZUSA 5C9KA 4QCIA 5KZCD 4XMLH 2UWEA 5D1ZC 3LRSB 4S0SD 2Z31B 4LCUA 5CIPH 1N59B 4RDQF 4HCRH 1QFWM 1CIDA 4MQ7A 3BPCA 5CEZL 5BVJA 3WXWH 1V3MA 3PP3K 4WWKC 2X1PA 5LXGH 2CLRA 4LAQH 2DBJA 4K8RH 4X6DE 3VI3E 5EUOF 4WU7B 1RFDH 5ENWA 2YD7A 2BSTB 3QWRA 4RMVA 3CFKA 1FFPB 3ARFA 3NCMA 4CDGC 3MXVH 4CVXB 1QKZH 4Y19D 5TE4H 1IC4L 3BKYH 1N59A 2WIMA 1ZLVK 1RZKH 2EKSB 3RPIA 4MSWA 5FA3A 3BZFA 2EIZB 2X42A 4Q9RL 5DHVH 5F96H 3IXTA 1QG3A 1A6PA 4Y2DB 3OKEA 4LKCA 4KTEL 4JHWH 1H9VA 5C0CE 4L4VB 2OJZL 2HFEA 5GRXG 4LCIL 4JO4L 5KSUB 3WKML 3WLBA 2OXGA 4QRPB 4XPTH 1OTSC 3DGCR 4JKLA 3U4BL 4J3WA 2YUZA 1P4IH 2FWOA 3QQ4B 4Y0GA 2WMPA 3VH8A 4ZPVB 3HLAB 2R15A 1A3RL 5J6GB 2F54D 3STZB 3MYJB 4KY1L 1K8DA 5JZ7D 3UDWA 1M7XA 3MODL 4JFOB 3BDYL 5INCA 4NDMA 2LTQB 1KTRL 5DHYA 3KLHC 1F6LL 3KPMB 5DVNA 2ZG2A 3VU2A 1F4AA 1ZHNB 2NY4B 1B6UA 5F7YC 3RNKA 1JRHH 4QXTB 3BZFB 5C3LD 1IGFL 1KENL 1MWAL 4ZNEA 2E9BA 4ONFL 2EDFA 4HLZH 1ZT1B 4MJ6B 4XBGB 4N0UB 2FL5A 5IWLC 1MWAA 3LOWA 4JGMA 4NHCL 3RZCB 3H9HA 4OZGA 3RNQB 4OM0L 3BHBB 3KPSA 3Q6GH 4K3DL 3K4AA 2XFXA 4WJ5A 5KVEL 1IC5L 5D7KD 8FABB 4E5XB 2YPVH 3VGFA 5DQDL 4Y16B 2VDKL 1OWRM 1BVLB 2J6EH 4EN3C 4XP1L 4H88H 3U46A 1JGEB 3ARBD 5HHXL 3H2WA 4XVTH 1Q9LB 4OZFG 4ZAKA 1CF8H 2HN7B 2FJFA 4NYLA 1EK3A 5ESQA 2R1YA 3UYRH 4YHIA 2AQ3A 4J4PD 4I2XA 1QO3A 4FABL 5JW5A 3D39A 4JREC 2VLLB 4NPYB 1EHXA 1ZA6A 3O9WC 1BD2D 4FZ8L 2DQTL 1FFOA 1KNOB 2EDNA 15C8L 2VQTA 4NQEA 4D0CB 5KG9A 2R2BA 3QDHA 1J88A 3TWCH 3QIWA 4PJHF 2AGJH 1Q9LA 4P2YA 4XWOC 1AIFA 5E00B 3T3PE 2BVQA 3NFNB 5BW7A 1AP2A 2ATKA 1I1RA 3IDJB 4G6AC 2XZCL 4FXLA 5D7SL 1W0WB 4GAJH 1HHJA 4OCSL 3MRFA 5HVHB 4OZIF 4AQOA 1OB1B 5F9OH 1LEIB 1JV5A 2Y07L 4XNQB 4HIXH 3QSKB 1NBVL 1NBZA 5TDNB 2P5WA 1QPPA 4Y5VB 1PKOA 4P46D 1IAII 4YAQA 1W2KT 4NUGL 1UXWB 5GGQH 1XT5A 4H8WH 4NM4H 3V5DA 5HYQA 3UROR 3VXRA 1G9ML 5MEQA 1YEKH 3OGCA 4QHUB 4J3XA 4LLVA 3EOTH 4Y4KD 2VXQH 3GSRB 3KYAA 1JYWA 5C0AD 5E4EC 1KJ2A 4HUMB 1XGTA 3SDCC 2AJUL 3P0YH 1ZA6B 1RZJH 1H3UA 4OLZL 1CICA 3CZFB 1JWMA 1TMCB 5D6DA 2DWDA 2GEEA 3AY4A 4HS8L 1RZGB 2P24A 3IAQA 4QXUH 3IJSA 1UZ6F 5HI3C 4U1LB 3CAFA 2IPKB 1B2WH 3HZVB 3SDCD 5B22A 4UDUA 1FIGL 5I1AA 1JK8B 3QFJA 5HGHB 2EYRA 1M05B 4L5FL 4GXUM 4M5ZH 1HIMH 3RA7H 3EFDH 4Z7NF 1G7JB 5FKPA 4XCFH 4N8VB 1NFDF 5I19L 2I9LB 1CCZA 5IK3B 1ZV5A 3OGOE 1MHHB 5C3TA 1N3NA 3HZVA 1WBZA 1W72B 2AJYL 1WIOA 3OHXB 2H1PH 3ZHDA 5BZDA 2EECA 1KN2H 4YHLL 3AXLA 1U8QB 4JANA 3QDJA 4KI5D 1OPGL 4M00A 3TT1L 4TSCH 5T1MB 3VFMA 1J8HD 2BNQE 4JM2C 4QEGA 1OARH 5BRZE 4NN7B 4DEPB 5JZ7C 1S7VB 1NKOA 4CMMB 2E9WA 4QOKA 5CJ5A 4D3CL 2X9XA 2VLKD 4JRXA 4YXKL 1FRGH 3AS2A 3UJIL 2I9TA 3OPZH 3VXMD 3PWPA 2ZJSH 4OCXL 5SV4A 4Y88A 4TRPL 3BE1L 3VA6A 1GPOL 2F9BT 1J0JA 2C3XA 4LSRL 1JJUA 2NXYB 4MQTB 2Z31A 1D5MA 3HLAA 5EZOH 3LN4B 3UC0H 1OSPL 4LQFL 3NACL 4M1CC 3C60A 4XHJC 3NCEB 4Z78A 3KPRA 4ZNCD 4N1CA 4WUUE 5ALCH 4MD4A 1U8KB 1MHEB 5SWQB 2AABL 1RUPL 5DHYB 4NKOB 4P46B 3QO1A 1IC7L 2DIBA 1ZLWK 1HILB 4RGND 2Q6WB 4KMQA 1JF6A 3BD5A 4F9PA 1OLLA 2P47B 1T4KA 5FA3B 4J12A 4R6UA 2E6JA 2OTUB 3MUGB 5D96B 3H42L 1U8KA 1YYLL 3JV0A 1J1XH 4OGAD 1RV6X 3U4BH 4BFBD 4NQCE 2CIKB 2XZQL 1KFAH 3KHOA 3NZ8A 2XQBH 5CJOH 4P5KB 3W0WD 1K2DB 1SYVA 2KQMA 5JW4N 2BFVL 4JHWL 3UBXI 1ZEAL 1JZ6A 5DUML 2ZUSA 1RJCA 1RIVL 4FMFA 2NX5D 3BDBA 4ONHA 5C0FB 1ZT7A 4UU9A 3G04B 3L1OH 2EIZA 3QPXL 1A7PL 3PV7A 2COQA 5B39A 3NZ8B 5HHME 5C0CB 4FABH 3L5XL 4PJ7F 3TN0A 2OJEB 5I6XB 1FVEB 4HGWB 3AM8A 1S9XB 1DBMH 4BZ1H 1YNTA 2VO5A 2YD8A 2RAMA 4OZGF 4OV5A 1DQJB 2IBZX 3WV0A 2LQRA 3CVHL 1FZJA 4QNPE 4D8PB 1JVKA 2VN7A 3DMMB 1WWBX 1ZT1A 3HPLB 4PGZA 4CN1A 2OX5A 1PX4A 5F96L 5DEZA 1AI1H 4ZS6D 3MOBL 3NFNA 3RZCD 4CAGA 1ZKAA 3QAZB 3TBTB 2RFXA 2M8XA 4JB9L 4LNRA 5D1QC 1UCTA 3OQ3B 4Y5YB 1VEPA 2JCCB 1KPRB 1PVHA 1T5WA 5I9QC 5JDJA 4EDXA 4FQ1H 1T89A 3JV6B 3HCVA 3MPCA 3BISA 4Z7UE 3C9NA 4RAUA 1BVLA 2XG5A 4D9RD 5E4IA 5CUSL 3EGSB 3ARDC 4U7MA 2FSEB 1IGIL 4NQDA 5CEZE 2ITDB 3TO4C 3UTTB 3V5KA 1K3ZA 2P8PB 1REIA 3QO0B 1XGPB 4ODWA 4JQIH 3KYOA 4UTAL 1OHQA 5JHDB 1P5UA 5L9DH 2VAJA 3VG0L 2EH8L 4LCWA 1NCDL 4MA7L 3GBNH 1I3GH 3CXHK 2H2SC 3ZDXF 5IP4A 5J1AB 4NQED 3S5LA 4Y2DD 3V0WH 4P59L 3KDMB 1KPRA 5I0DA 1AGFB 1U8JA 4KPHH 1TZGH 2F5AH 4NM8H 2XPGA 3RAJL 2FLBT 1OP3H 5ID0B 3IDYC 1UM5L 3VGHA 5I1EL 4Y1AD 2QQLL 4JDVB 2NY5L 4LRIA 3SE4C 1KEMH 2OYPA 1QFWL 3ULVF 4OGYL 2PF6A 4HH8A 1S7RB 4AMKL 3IDIA 4RSVA 1AGCA 1YEHL 2LAGB 3PL6B 1CTNA 1S7TB 3CLEH 3I6LD 4JQVA 2I5YH 4ODVH 1MFDH 4YHML 3QIUA 4BSWB 4I4WB 5F6HJ 4DN3L 4GKSB 2V5YA 5C0EA 2X1WL 4LLQB 5GGVH 5KZCB 1BQHB 1X5KA 3QDGE 3QP3A 1UH3A 2IGFL 1QSED 2R0LL 4LGPB 4TSBL 1OGAD 5FA4A 2DQGL 1KB9J 2X7LB 2EDKA 1U8OB 2UVFA 3N06B 4W6WB 5TGBA 5JOPD 4HWBA 2XTJE 4XNZC 5DHVA 4R2GD 4F7EA 4JRYD 4XCCH 2D0GA 5LVEA 4HIEA 1NFDB 1I8LA 3U0PA 3FFCE 4MB5A 1T1WB 1P7HL 3W39A 1FC2D 3CDGA 2R69L 4MJ4A 5I1DA 1YMHA 2BJMH 4PRDA 3ZL4H 1SYSB 1I8KA 4PJBF 3PGFL 5TGBB 3OX8B 1G9MH 2Y72A 3JZ7A 3BEVA 1I7RB 4HS3A 5HTSA 2V2XA 3QUXD 4OD1H 3KR3L 5F21B 1RIUH 5CP3A 5CIPA 4JFFD 1A1NA 5C0EB 1OAXH 1G6RL 5I76A 4I77L 4X7SL 4TSAH 3NGBC 4NO3B 4WI3A 3LKOA 1NMBL 2V5SA 4PG9A 4XRCB 4G42A 1NSNL 1XR9B 5JR1H 1QFUH 3UTQB 2O5XL 1Z9MA 5K9QI 1PDKA 1ZT7B 3CH1B 4BH7A 2WK2A 5DGQA 3VXMA 4RWYL 3FFCB 2LU3A 2BRRH 1CQYA 1J18A 2MKWA 5GZND 1I3GL 2GKIA 3KPTA 4QHNB 3BP7A 4QRTB 1G7LB 4YHLH 3WBDA 3DX7B 2VAAA 5ICZA 1DQJA 2OK0L 1FZKA 2AJYH 4MQXD 5E7FA 4MQ7B 3ETBF 2IWGA 5FM8A 2IC2A 3BP4B 3KVQA 3O81A 4Z0XA 3MV8A 4AG4H 4HZLB 1IE5A 2QEJA 4WWKB 3RY6C 4YPJA 4Z7WE 4JG1L 5KANG 3WJLC 2V2WA 1F3DJ 5SWQA 2F53B 1OAQH 3LPGA 1HINH 4GG6E 5CEYA 3MRGA 5I1JH 2FR4B 4HPOL 1PKQE 2OP4L 3N0PB 5FYKL 1N5AA 4KK9D 4TVPD 3LV3A 3TP4A 3G04A 3MLUL 3FO2A 3EJZC 3IKCB 5F9DC 5H37G 1FL3A 3BPLB 3PIQA 3MRCA 5I15H 5E2TH 2BC4B 2CO7B 3ZYOA 4Z7VF 5GISH 1G9MC 1NEZA 1CXHA 4HX1A 2CK0L 3ZT7A 4NQDB 3MQIA 1RZJL 4X7TB 4ZUWA 2OQJA 4M5YL 4PJXA 4KJYA 3BPLC 4XI5D 4K3EL 2IBZY 4LK4A 1MCWW 2PR4L 1YY9C 4HK3J 5ESQB 1BLNB 4Z7UA 1QRNA 3LV3B 1JZ2A 1TVHB 3TN0C 3BP5B 4HQQL 5DZLA 4Z76B 4OGAC 4LRNH 4R90H 4M7KH 1LO0L 3DMMA 2BVPA 2FCBA 1NEZB 1R3IL 4WGWB 3VFTA 5DMKA 4P2CG 3SE8H 4GW5B 3I02B 4LGSB 2D7TH 3ZYJA 1Z5LA 2X4RB 5ETUA 3TVMD 3TJHC 3TA3B 4C58B 3IXAB 1JE6A 1HHGA 4O5LH 4NO0B 1MFEL 1JF5A 3UTZB 3KPSE 2V7HA 2AJXL 2P43B 2D4DA 4GMSL 2R0WL 3WHE1 4XNQA 4BFIB 1I1FB 3B6SA 5DXWA 3VCLB 2DM2A 2UZIL 4PGCA 4MD0B 3GI8H 5IMKA 2LFGA 2Q8AL 1FE8H 4Z6AT 4LSTL 1KT2A 4FNLH 3IFLL 4MA8L 4EIGB 1RZ8A 1AGCB 4R97B 1ONQA 3DV6A 4QY8A 3T08A 4O02H 3CVHH 2CR6A 3QNXB 4ZOEA 3U30B 5F97E 1CQKA 3ZSTA 3MR9A 3MRRA 4IIQB 1JWSB 1MJ7L 5CEZH 1A1OA 2NZ9D 3RTQD 1RULH 3TPUA 4Y8DC 3F12A 3MV11 1QFPA 1NCCH 4JM2D 1F11B 4F7TB 4D9RE 3T1WA 5HYEA 1NCUA 4ODUA 3CIQA 3E0GA 4RMWA 1CLYL 4H26A 1F4XL 1INEH 4WTZG 2BNQD 1Z2KA 4IDJH 3E6HB 1CT8A 3VRLF 1IAOA 1FORL 4NHCH 5EPMB 1OP3K 4UNVA 5A2LH 5J1SC 2WANA 3BD4A 1WICA 5JHDE 1SEQH 4P59H 5FF6A 2WWMD 2GI7A 2YK1H 2VDRH 5GIRB 2MPAL 1FLRH 3NIGF 4PRDB 3C60C 2EE2A 4PJFE 1CN4A 1ND0B 4PJEE 4U05A 3U0WH 3CMGA 5FYKH 2XQYG 2VLJA 1UKTA 3KLSA 4X9GA 3K2UH 1KJ2B 3LKPB 3EDJA 2M2DA 5C70A 1WK0A 1RSFA 2AI0L 4MNGB 4TN9A 4KTDH 3MLSH 5CIPB 3D25B 1QNZL 1KUMA 2R56L 3DURA 1KYOK 3RGVA 4AM0B 5TDNA 1U92A 4CMMA 4PP2B 5GQBA 3WS6A 5ICXB 3F7VB 2V6HA 3AC0A 5MEQB 2IPUG 4PJIE 5EOCH 1AO7A 3GSOA 4PJ5B 1I8IB 2V2TB 1YEIL 4YDJA 1INDL 1MI5A 5L7XL 1M7IB 1S9VA 3BJLA 3REWA 3D2UA 3HZYA 1SQ2N 2EDLA 1X4XA 5T1DL 5FHBL 3VFNB 3GMQB 1KCSH 4MAUL 4NIKB 4HWEL 4NNYB 4ZFOB 1L7TH 1F90H 3ET9F 1QFUL 2EE3A 4UDUB 2RR3A 5GSVB 3WLWD 3ZTJG 3TM6A 4OLUL 1Q1JH 1I3RB 3BP4A 4ELKA 5ISZD 4RISL 5DURD 1SBBA 1A7RH 3MNZA 5CWSB 3AU1A 2QQNL 1VCAA 4HKZB 4PTUA 4U33A 3LN9A 4OTXL 3WEXB 1YNLL 3BQUA 4XVJL 5CBAA 1HDMA 1MCNA 4NZUH 4YEEA 5ITBH 4OZFB 4KUCF 3VFSA 1BBDL 1GAFH 2CGRH 2VZTA 2V17L 3FONA 5C0GA 2AERT 1UKSA 5GZOD 3LN4A 1MCIA 2RJMA 1TETH 3QXDB 2XY1A 4ZTPH 4PGBA 4N90E 5DEGB 3BGMA 5HHPB 2E27H 3EJZD 3O2VL 1AC0A 4TQEH 3BPCB 2HKHL 4GRLD 2PO6A 3VXOB 1MLBB 1ZGLM 2XTLA 2PCPB 3EFFB 1MVFA 3LKOB 4R8WL 1OY3B 5IT2H 1IAIH 1VADB 3O4LA 3QI9B 4CBPA 4DUXA 2A6DB 1NANI 3OKLB 2UUDH 3A67H 4FQCH 3RPIB 3O8XA 3B3IA 1BQLL 4YUEL 2PETA 2CIKA 3VXPA 1DBKL 1UG9A 4XPBH 3EW3B 3B9AA 4YNYB 4KJWC 3TF7C 5CZVL 2C1OB 5DTFA 2J8HA 3CLEL 5MEOA 1KXQE 2YRZA 3MV8D 1DANU 3VW3L 3BT2L 2WBJA 5C0BB 2R56H 4EZMA 1BX2A 5D7SH 4XAWH 4DWHA 3B3IB 4F9LC 4ZPVA 5MP6H 4FQLH 2HT2C 4ESKA 4M5YH 2FHBA 2NXZD 1FIEA 2DQIH 2BHZA 5E5MB 3WMSA 4JCLA 3GHBL 4QTHB 5E1AA 5GGTA 3MYZA 4OAWB 3O11B 5FYKE 5D7JA 2LV4A 5MENA 4QY8B 3QHZH 4YHOH 4OM0H 1DQDL 1NL0H 2XFXB 3SPVA 1DVFA 3RL1B 1NCWL 3BPNC 3CPLB 3UYRL 1V3LA 2R1WA 3N9GL 4WI6A 2ZUUA 2X4OB 3BDYH 3MJ7B 2K1MA 4EVNA 3I6GA 3O4OB 1VGEH 3O41A 4XMPL 1R3JA 1WIPA 4OB5L 5F89A 3NTCH 1KJMB 4HEME 1OWWA 4D94A 2X1XR 1L9NA 3HG1A 4GSDH 1CDJA 1SY6A 3LS5L 3FB7A 1S7TA 1NQBA 1NLBL 2JB6A 5C6WH 2DICA 1UACL 3T3PF 3C08H 4LCWE 2FD6L 3DX8A 4OZIB 5LQBH 2XKSA 2FHFA 2R2BB 4WUKH 2AVGA 4K3JL 5TE7H 4DGIH 4P23B 1U93A 2E6PA 3DUSB 3K46A 1RUML 3G5XA 5FCSH 4WO4D 2VZUA 3ARDB 4QRRA 4Q9RH 2ED9A 3KXFA 3BVNA 2FNBA 4M8QB 5T5FL 5I0ZA 3BKCH 4KKAD 1QO3B 5EO9B 5GS2H 2ZG1A 4JR9H 5JHDA 1I9RL 2VLLA 3RIFK 4KKLD 4Y19E 2DJ4A 5E6IA 2WP3O 3QUML 5BMFL 3BD3A 2XWBA 1N0LA 3QUXC 5AZEH 1QSEB 3WIFA 2DLTA 1U93B 2R4SH 1MCJA 2ICWI 2DMKA 2R23A 5J9PB 5FO8A 4QHUA 2BY3A 1KT2B 3F58H 3J7HA 2VH5H 5ILTH 5H35A 1CLCA 1KBGH 1EUUA 3S36L 2Y23A 2EDBA 4X7FC 1JYXA 1J0IA 3AS0A 1JZ8A 1VFMA 2AJZA 2DLFH 1A3QA 2C9AA 3O45A 3FRPG 4LPTA 1MCSA 4PRHA 4XHQA 4FNLL 5GJTL 4PY8I 1VEMA 3V52L 3MBXL 3JWOH 1IAIM 4LDEB 1IGYB 3PP3H 5IIEB 4QHLA 3CFBA 2BFVH 4YZFE 4HGKC 2LVEA 5IVZA 3QIUB 4HWBH 1OAUH 4W4NA 2AK1H 1ZT4B 4BUHA 1EAPB 4S1DC 2HA1A 2XNAA 1AXTH 3K81A 3FN0L 4UT6H 5E6YA 3T0EE 3TZVD 3ZDZF 1OOAA 1YA5A 4XH2A 3WO3B 3X3FL 2YKLL 4WO4C 2XTJD 1QEWA 2O61B 1H3GA 1T0NB 3MCG1 3LS4L 1I1YA 1G9EA 1A9BA 4GAGH 1QBBA 3K1DA 4XXDB 4OCYL 3PQYA 4KHXL 4N0YH 2UYLA 5ALCL 1U8IB 1PSKH 4AH2A 3PABB 5CINL 4IOIA 3H7BA 3K2UL 3EO9H 3HMXA 1VADA 3G08A 4WDIA 1BFOA 3BEVB 1DBAL 2APVA 2I60H 1GPOH 4XC3L 1AD0B 1SY6H 4WI5A 5I73B 1QACA 1XCQB 1CGUA 5D2LA 4N0CD 5IHUH 4JQXC 1B3JA 5CWSA 3H3PL 3MGTB 4MA3A 4YR6A 2FEDD 1IC1A 2GJJA 4XHJD 5E4EB 3EZJB 4OM1L 2PTUA 4Z7WB 1VESA 4LVHC 3KPNB 2GSGB 4V2CB 1RIHL 2D7PA 4JO3L 4X5XA 4PJ5D 4HH9A 1KC5L 4PREA 3LAFA 4I0KA 4M7JL 3WFBL 4P0DA 2HFGL 1MJUL 1NAMH 3O4LE 2IANA 3GRWA 1CLOL 3D1MC 1KIPB 2QHLA 4WY7L 2FATH 4DZBA 1EO8L 2N56A 1C5BH 3RWFA 4JM4L 1DBBH 1R24B 3AFLA 3QUMA 3DVFA 3LMJL 5GS0H 5JLZA 4MQSB 3AAZB 2FLRT 2OQJB 4OLXL 2NX5B 4P5TB 1DJSA 1HHHB 2SEBA 3A6BH 3MFGB 1SMAA 2VXSH 4P9HL 5AEAA 5CGYD 5IVXB 3EDKA 1EERB 2A74B 3PDOA 5HHOD 3W0WB 4P2OA 4MA3B 4YR6B 1R5VB 2O5XH 5BV7L 3TA3C 3B6SB 5F7NC 1LD9B 1JGLL 3TO4A 4GXVH 3TFKD 1EV2E 1JPFB 1TXKA 1I1AB 4FFZH 1KJMA 3KGRA 1LDPH 4U7SA 4PJDB 5EU7E 3CUPA 2ATKB 2ADFL 1A4KB 3QXTA 4YLQT 4ZXBC 3W9DA 4L8CA 3BZEA 1OAXL 2YPLD 1B0RB 4PJCF 3MRFB 4EKXA 1WFOA 3O4LB 3QI9A 5JMRA 4GG6F 5HI5D 3ECBB 5I74C 1G0YR 4CJ1A 1WZKA 1CE1L 5J0BA 3GO1H 1YEHH 3QEQA 5CBEA 1LO4H 5C07D 1T3FB 3QUKA 2DB8A 4PJ8D 2CRIA 4YNYA 5F9OL 5CSZA 3QPXH 4YDKH 3DI2B 3WFCH 2Z91A 2ITCB 2CSPA 3I6KA 3QEQE 2CIIA 5D1XA 1RAMA 4CL7A 4LP4A 4JN2A 3SJVE 3O9WD 1N6QL 5IR1A 4R4BB 2D7NA 4HF5L 4YXLH 3T0AA 2VDPH 1LILA 4KPHL 4NM8L 5MEND 2FO1A 2C3HA 3QWQB 4L4TA 1A7BA 5L2KE 2OS7A 1MPAH 4WEBL 5I1KH 2YUWA 3LY6A 4M6OL 2R0LH 2ZUVA 5E8EA 1CXLA 3KHQA 3SGKA 5IQ7L 2A6IB 4WFHD 4WUKL 5I1GH 3HKFA 5DRZA 4GQPH 7FABL 1LP9E 4IRJD 3ZE0F 3D3VB 1JHLL 3LS5H 1BFVL 4NQCD 2EE6A 3LD8B 4R4FL 3OF6D 3RY4A 1Y18B 1MCPH 3I50L 1HOCB 1LK3H 1U8NA 5IW6B 1ZHBB 3HA0A 3RVXD 4Y4KC 2X4TB 2XWJB 3HR5B 3MUY1 4JY6A 4MNGE 4HFUL 5I71C 2W65A 3QISA 3MRRB 4EN3B 3N9GH 4LLWB 4PJIA 1T7WA 3IFOB 2A2QT 4RGMC 4DTGH 3SDCB 2NTFB 5F8QC 4PJ8C 2A77L 3CC5A 4D9LH 5E08L 5KVMC 5EZJA 4MAYA 5T3XE 2XA8L 2ATPB 3GMOB 1KF9B 5HGDB 3R1GL 1RY7B 4FFWC 1T0NA 2WIIA 1DN0B 2B2XL 2H41A 2L4OA 4KHXH 4N0YL 4WI2A 3X13A 2EH8H 2OI9B 2XICA 3O3UN 2PYED 3L3IB 1QBMH 4P46C 1QFOA 3EAKA 5C0AB 5K9OA 1AR1D 1MFCL 4I1NB 4E41B 2V2TA 1B4JH 3CFIC 3CX5K 3WJJC 3WEXA 3Q5YA 1KBGL 1FZOB 1H5BB 4RFOL 4KZEL 5IM7A 4XZUB 5MEPB 5FK9A 2VE6A 3CXHJ 2CUHA 2Q6WA 4XPFH 4D2NA 3BN3B 5F1IA 1IARB 3VGAB 1JP5A 5F3BB 1EJ6A 1TQCB 4KJQC 1FE8L 4G3YL 2IF7A 3O3DA 4JFDE 5EZIL 1WC7B 2XXMB 4PJEA 5HYSA 1UYWL 1XGYH 4NN7C 5F1SA 2HFFB 3NFPB 4JKMA 5JDSB 4OBSA 4FQIL 2BMKA 2JJTC 4AENA 1N6QH 1RUMH 3EDFA 3VD9A 1CBVL 3QIWC 1XZ0A 2D4FA 3LN5A 3QH3A 3P4OB 5JIPA 2JJSA 4MQXC 1F97A 3DRQA 3DXAB 4W4OC 3RX7A 1GGIL 2FGWH 3FOMA 3D25A 2JJTA 2ZUYA 4Y2OA 3SJVD 1FP5A 5I17A 1AFVH 1IM9A 1JBJA 5KN5A 2X4PB 4KROB 5C6PB 3L3HA 3GIZL 4KV5F 2P1YA 1Q8MA 1BBJA 4Y16D 3GMRA 1TJGH 5KSBE 4LEXH 4PRPD 1BOYA 2WBJB 1B88A 4K3EH 1PKQA 1GIGH 5ADPH 4GAJL 4HIJB 1X5FA 4PJBA 3GJFB 3TJEL 4K8RD 4JO1H 4J2XA 3EYSH 4MHHI 3L7FB 1IGTA 3CSGA 4MD4B 3QCTL 5FYJH 2HFEB 4LHUA 2J8UE 4H1LG 5HYJA 2NX5E 4Y4HD 5T3XH 5FUCE 1G1YA 3TBTA 2NY3B 3GFUA 4JVWA 3RI5F 2BOBB 3FQUB 4ETQB 1ZVYA 3L5HA 4GKZA 1R3HA 1FJ1A 4CUCA 1OGAB 5IFHL 3RWHB 4PJBB 4CU8A 1OP9A 3DXAE 3ESUF 2DMBA 4ERSH 3I3EA 1QLFA 3V6ZA 1JMZA 1H3PH 4HT1L 5HDLA 4MVBC 5KN5B 1WFTA 4XNZB 5AAWA 4LCCB 32C2B 5GRZA 5D1QA 4DKEL 3VXNA 4N0FA 1FZMB 5T1LB 3EHBD 5I8KL 5DK0A 1IKFH 1D6VH 4O58H 4LSPH 3X11B 3I9GH 3O11A 3LSOB 3MRMA 4F57H 2B4CH 1ZVSB 1FJ1B 1KPUB 1SMOA 4TYUA 3PQYD 1UWEH 2X40A 3L6FB 3EFDL 2MKLC 3QEHB 3MREB 3OR6B 1C08A 5EBMA 4APQA 5L2KA 2H9GA 4P3WA 1LD9A 4KRPC 1HZHH 1RUAH 4CMHC 2R0ZH 1LVEA 3HG1E 5DR5L 4OQTH 1T21B 4X7TA 2VABA 4QXUL 1FCGA 4PJDA 4AY0A 2XY2A 3KPSB 1JI1A 5BO1H 4XP5H 4GG8A 2EIEA 3WIIL 1H8SA 4TOYL 4PJAA 1JHKL 2JB6B 4OCWL 4JFFE 1WITA 4GG6A 3J8F7 3FO1A 3RJDA 4M43L 3IJHA 4U3XA 3LIZH 1JUFA 3MODH 3LZFL 1LE5A 5IBUB 5IFAH 1T04A 2X9YA 1G6RA 1RUQL 1X5LA 4KDWA 4BKLB 3NMEA 1TQBB 1S7RA 5D7LA 1IZKA 4JRWA 4QOKD 3UTTD 5BXFB 2DDQL 3I6KB 2VLKA 4UT9L 4OQ1A 4ORGA 1TZIB 1U8LA 4QT5A 4TUJA 4WJ5B 2MOVA 3IFPA 5E8DH 1ES0B 1KIQA 2Q7YA 5DK2A 3HS0A 3VMNA 1OAKH 4WV1B 3RQ3A 1BQHA 1BOGB 1I7ZB 4HFWA 1F3RB 4LLYB 5IBUG 3OKYA 4J7RA 1NC2A 9CGTA 3VXUB 1NBYA 2EC8A 3G6JA 1MY5A 3ZTJH 1EMTL 2A6KB 3QUYC 4YDVA 4HLJA 4U0QB 1O7SA 4PLJC 3T0ED 4JFPB 1VACA 2C26A 1Y6MR 1MLCB 1MI5E 4ZO9A 3IJHB 3PQYE 4FFYH 3QUYA 3VXTA 1I9JL 5EO0A 1YNLH 1B4RA 2FH8A 4L4TB 2R39A 1FG9C 3QZWB 4ODUB 1IC7H 2CLVA 4JCMA 5GXBB 4HUUB 4KROD 4EEEA 3MROA 5C8JB 3KDMA 1CLOH 1AP2B 4MJID 5FYJE 5ESAA 1N8ZB 1Z0MA 3DMMC 4S2SB 5F7HA 5LWYH 2GCYB 4P3CL 1FNEB 4NQVB 1YY8A 4P9MH 3DXAD 2XWBB 1XEDA 2GTWA 5IF0A 3E2HB 5IVNA 1GYAA 1TTUA 5EZJB 2VYRE 4PRIE 4K3DH 1RHFA 3MLSL 1MCOL 1J05B 1NUGA 1QHOA 1UWXH 1F2QA 1DN0A 3DRTA 4G6KH 4YBLB 1S5IL 4XAKD 1NAKH 1X4YA 1BHGA 5C0DA 1C1EL 2IH3A 4MB4A 3SKUD 4DK3A 4UQ2A 4LKXB 4XAKE 4YXKH 5T1DH 1EAJA 4GT7A 5HPMB 3QQ3A 3NH7H 4HAGA 4I18C 1DQQA 3HZKB 1S9YB 1A4JA 5IMLB 2OXHA 4KJWD 1DLFH 2DI8A 1U92B 2ZCLL 4H1LB 3MRPA 1RK0B 2ATPA 3GMOA 1RMFL 3QUZA 5JPMB 4I8DA 1ND0A 3EO1A 4ZG1A 3U9PH 5T3ZE 3VWKD 3LKPA 1I1AC 5I19H 1DQQB 1OT2A 3HZKA 5SWSA 4PTTA 2YPVL 3QXUA 3LHPH 3GSXA 1RULL 4MNQA 4X6FB 5DJXB 2DQDH 2OK0H 2CJUH 2HTKC 2YXMA 1Q9OA 4ZD3L 1IGJA 1FZOA 1H5BA 1LO2L 5TF1L 5F72S 1T03L 5JUEL 1KTLA 1CFQB 4X98B 3MMEA 2VR4A 4MNHA 2Q8AH 3D48R 2ZCHL 3MLZH 3MRQB 1K6QL 5SWZB 3V5HA 1XF4B 2VXTH 4EDWH 4NKDA 3IKCA 1B0WA 1DUZA 4WW1B 2ORBH 2DM4A 2VZOA 3D2UB 5HVWA 4XH2B 3CMOL 4IMLB 3D5OF 4OJFL 5E8NB 5KS9E 1KEGL 4UOW0 1YEFH 5CAYB 1HILA 1MREH 4GRWF 3UTQA 3MRQA 5EULV 5E2UL 4IMKA 1BJ1H 4P4RA 3WHXA 4G6FB 3BKMH 2YMXL 1NCCL 3RVWC 2FX7L 2OL3A 2WQ8A 3DV4B 4KZEH 4HIXL 2GJ6D 1UM4H 3DYPA 1BVZA 4PRPA 2OL3L 2EH7H 5KS9A 1T3FA 4JQVC 4YHKH 4X99B 4X4XB 3BP7B 1RI8A 4QRTA 4M6NL 4RNRA 2P49B 4UV4L 5DGRA 5AZEL 5DD1L 4Y1AA 3GNMH 3IFNH 3S3SA 3TV3H 3IDMB 3RU8H 1LNUA 2CDFB 1KIUA 3RWEB 1RZIB 5F7EH 3FONB 3SGJC 1B0RA 3HC3H 4K2UL 3AREB 4FXGA 5DI8B 5E2WH 3MRBB 4NC1C 2QR0B 1PG7H 3VXNB 1MIML 5LGHL 3HI6L 1QFWI 5EO1B 3CK0H 2QADB 4WFHE 4PJ8B 3A0OA 4M48L 5ACLA 5GZOC 4ISVA 4Y89A 1QYGL 1P6FA 2R2EB 5BS0B 4NZDA 5EU7C 5EA0H 5JO5B 1DANT 3RVXC 1IM9D 1WGOA 2XZZA 5TPWH 4YQXL 3T65A 5DO2C 5DRXA 1JIBA 4XMPH 2NY6B 1A7OL 3AUVA 4ISVB 5HHVH 3QG7L 2X4TA 4N5UA 3PUCA 3HR6A 4XNXL 1MJ8H 5ISZE 3RY5A 3VRJA 4M61B 4ZSOB 4IEFB 3AREA 4FXGB 4K71B 3HNVL 4PV8B 2P8LB 5HHQB 3MJ7A 3C6LC 2FH6A 1RJLB 5DJ6B 3I02A 2NMSA 1QBLL 1LP9A 2GY7B 2J3SA 4M6MH 5A3ID 5BZWA 5DQ9B 3SGDI 3NA9L 1DUYB 4PBVC 5JO5A 3M17A 1K8IB 2Q7NA 4WHTB 4LQ1A 4X9HA 4J4PC 1IRAY 3S37H 3C6LD 5DLML 1EXUA 1IAKB 1KB5L 4IRZH 1BOGA 4YHNA 4LSQL 3PWJA 3L9RB 2ZOLA 4YFLF 5HYQB 4JQXA 4ZUUA 4HUWB 3VXRD 1HSBB 2QV2A 4BELD 1AR2A 2W1NA 3ARDA 4QRRB 1W0YT 3IDXH 1IGCL 2H32B 3DHJA 1J1OL 1SY6L 2OJZH 4JN2B 3P4MA 5ACMA 4FFZL 3V7MA 2NY7L 3IAGC 1DBAH 4HIIA 1A6VH 1EHNA 1WEJL 4E41A 5JIIA 3JVGA 4UDTA 1CGSH 2AKRB 1JPTH 1UA6L 4PJGB 1FAKT 3SE3C 1MHCA 1TIUA 3PWVA 5HXMA 5C0AE 5B3JF 1PSKL 2NY4D 3EYVB 2YD6A 1HKLL 3SDDB 1NDMA 1SM3H 2ERJC 3GO1L 2MJWA 4L3CA 1A47A 4GAYB 4UQ3B 4G6AD 4JPVL 1ORQA 2F54B 2X1QA 4UBDC 1H8OA 4PRHB 4X9BA 5CP7A 3GJFK 3T04D 1RUQH 2VJXA 2PXYC 3TIDA 3MNVA 5D70H 2ZUXA 1YMME 1CD0A 4M7LT 2Q87A 4UQ2B 5IJVA 4JHAH 2DJSA 4Z7VA 4OFDA 1N7ML 3HC3L 4LSTH 5H37H 1ZVHA 3BGMB 3KLHD 5EIVA 1PZUB 3SDDC 2DQGH 4KK5C 1HN1A 4JRXB 4DZ8A 2MQCA 4M1DH 2H8PB 5CGTA 2YD5A 1T2QL 1I8LC 4C56B 4G9FB 1FVDA 2YEZA 3WFZA 4K23L 3SDDA 1CGVA 1Q9KB 1B0GB 4ODVL 3ZT6A 4X4ZA 1PKQB 5JHLL 1RHHB 1IBGH 4KXZI 5IFAL 5E95B 5EC1A 1EFXA 2P8MB 4DN3H 1EZVX 4O2EB 3TCLB 2VWEC 3TBVB 2R4SL 4K94L 4N8CH 2Z9TA 5I1DB 3T2NL 5F7WC 4GLRI 3GSNL 3KYKL 5I1EH 1CXEA 4F37K 4P3DA 3OX8A 1OD7A 2HLFC 1KEML 1XCQA 3FOMB 1XFPA 3CH1A 3MA7B 4WEUD 5KSAA 2X4SA 2W9DL 1G7PA 5DZNA 4IMLA 1S78C 3WXVL 3MACH 35C8L 4Y1AE 3SKNB 3S35L 3MSPA 1QLEL 2NQCA 3BW9A 3OSKA 4P23D 5FCUH 1K2DA 1SYVB 4ZXBD 4KWUA 3TBWB 1PFCA 3P9LA 4MWFA 2OZ4L 4WTZA 1DVFB 1X5HA 1VEOA 1G9NH 5AZ2H 5IW1B 4WFGD 3DETC 5HY9A 3WSQH 3KS0J 5EC1B 3WDHA 4OCNC 3QUZC 2G9HB 4O2EA 3V7AE 3P73A 4M7LL 1LE5B 3DOSA 4LIQE 5D2LE 1OAZL 1EBAA 4X99A 2OR7A 5F7KC 2BOBA 5A1AA 4IOFD 5LWYL 4G7VL 1R3HB 1T66C 4DW2H 3GUTA 1A22B 4MLSA 4PJXE 5J57B 3BUYA 1G7LA 3HI6H 3K1KC 4XNUH 4JJ5A 5FM4A 1ZHNA 3DHMA 3T8XB 4ZFGL 1L9MA 3EOAA 4G8EA 1TCRB 3BAEL 1QPXA 4Q58C 4GG6B 4BH8A 1HWHB 1DCLA 1LO3H 2B4CC 1CBVH 1GOGA 2WSKA 3CU7A 2WP3T 1CFVH 4LLYA 3BRFA 3RWFB 3RZCA 4UILH 5IESL 1MF2L 4I18B 4L3EA 1MHPH 4NZTH 3OKOA 5E0QA 4BSVB 5I30H 3BVNB 3MRGB 1MFEH 3NPSB 3HNSH 1WZMA 3H9SB 2DLHA 1UZ8A 5E6IB 3IDGA 2FIRT 1P53A 1UM6H 4NKIL 1S8DB 1LO4L 4P5MA 2CDGA 4FQ2H 4WV1C 4X8XA 4H8WL 4NM4L 5C0IB 2O5ZH 4AIXA 3IXAA 5JW4R 1LMKA 1TJHL 5KOMC 3QXAB 1V8HA 4EOWL 2NY2D 3LQMA 2HVJA 5IKCA 5C86A 4M61A 3MXWL 2GUOA 3BIKB 4R4NC 3T0WA 2AK4E 4R8WH 2ADFH 4ODSH 3N85L 3FRPA 5LBSL 4KROC 4RISH 3I6GB 1SM3L 3B43A 1J8HA 5DD0L 1RJLA 1GGBL 4LPVA 3VXTB 4GW1B 3BFOA 2A1WL 3QNYA 3BSZL 3T0XA 3FAXA 1CDGA 3MUJA 1F6AA 1LE9A 4QHMA 2VDMH 5E6IC 1JZ5A 3FL7A 4HG4J 3QNXA 5TQ2L 5FYLD 5JXAH 1T5XA 4DUWA 1J8HE 1WT5A 4XNUL 1OSZB 5HGBA 1KIQB 2Q7YB 4BQBA 2VITB 4IHOB 2XNAB 3BH9A 4K3HA 4DGVH 4JG0L 5E2JA 3ARZA 4KVCH 3EKCA 2P5EA 3C5SA 4MZ2A 3ZTNL 4G43B 3BGFB 5E9DA 3WUZA 3LEYL 4G8FA 1MFCH 1LK3L 4WEMB 4JY4A 3GSNH 3KYKH 2HRLA 4YXHH 5GGTL 3CFDB 1QOKA 4EN3A 3CH8A 3GSUA 3SO3C 5GRWA 1DUYA 3D0VA 2B5IC 1OQOA 1UH2A 2MSPA 5B8CB 1IGML 1CXFA 2A38A 3QQ9D 4OLWH 4X6DB 3P2TA 5GGSA 3S34H 4N9GA 3DBXB 5CJXC 5FO9A 4C83B 2A83B 5BOZG 4G8GD 3FB6B 4QRRE 1OPGH 3GSUB 3EYOA 1OP5H 2C4XA 3JWOC 4UQ3A 3P4NA 4N5EC 2N7AA 1UWEL 5B8CA 1QR1A 1Q9WB 4KI5E 3MV9B 2AJUH 3P0YL 5CKGA 5GGUA 4NN6C 4PB9H 3UBXA 1IFHL 1T7VA 2A83A 1MHCB 4S1QL 1FYTA 5BRZD 5CZVH 3AMKA 3ZHLA 1U6AL 5B8CC 3UTOA 1QNZH 1U2HA 4JFDB 1D5ZA 4FTVA 2EIBA 5ESAB 1T0MB 2PKDA 4YQXH 3TYGH 5JQ6H 3MOQA 4NQXB 2WW8A 1DN2A 5IB1B 2GTWB 1S9KC 4XC1L 2H26B 2Q1EA 3UBXB 4ODXA 3NFPA 5JDSA 3T0EC 3ZKXB 3JWDC 1BIHA 1XCTB 2MPAH 2VDPL 2YK1L 4U1MB 4WVRA 3RHWK 5GS1A 5JNYA 5HDQL 4XRCA 3G6DL 2RBLA 12E8L 3P9LB 3QQ4A 4YK4C 4S1RL 2ICEB 5EOTB 1EH9A 3W2DH 1SBSH 1JGUH 1OW0A 4M1GH 4R3SB 4FOMA 5F1IB 4M4PA 3QIBA 2OR8A 3ARSA 4YHPB 4KUZH 5SX4H 1JGDA 3B83A 3P73B 1AE6H 2X4PA 3OKEB 4LKCB 3BH8B 2DLIA 4IOIB 5JQHC