3Q26A

Cyrstal structure of human alpha-synuclein (10-42) fused to maltose binding protein (mbp)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
403
structure length
395
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSKAEKTKQGVAEAAGKTKEGVLYVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of segments of alpha-synuclein fused to maltose-binding protein suggest intermediate states during amyloid formation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein, protein fibril
molecule keywords Maltose-binding periplasmic protein/alpha-synuclein chimeric
total genus 130
structure length 395
sequence length 403
ec nomenclature
pdb deposition date 2010-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3q26A00
1A8FA 4QFNA 2O69A 1SW5A 3CI8A 2THIA 1Y3QA 3FXQA 4FEBA 4FATA 3N6TA 2PYYA 3GBAA 1ELJA 3HPIA 4YKIA 1R6ZA 1N04A 2DS9A 4OFLA 4PFTA 3IO6A 3T9VA 5AA2D 3FIRA 3S9EA 1GVCA 1Q1KA 2VD2A 3E9XA 3TQWA 1H44A 4G8MA 5LOMA 2Q88A 5AA3A 5HPQA 1PBQA 4FIMA 5DYHA 1R9QA 4GWOA 5DEXA 5I84A 1SYHA 3OMBA 2ALUA 4H6DA 3TZAA 4YB6A 2O68A 2RCBA 3LR1A 3HCQA 1FTOA 1P99A 2QSXA 3FXUA 2ZNSA 3C35A 3PPNA 3CIJA 1HSEA 4RNSA 1YAEA 2AL4A 5I2KA 3TTRA 4OERA 4IGRA 4KD5A 2REJA 2Q2AA 3CVGA 4R6HA 1XHYA 5AA2B 3FJMA 3K4UA 3RY3A 5A5XB 4HS7A 5TPAA 1MY4A 2I4CA 1LB9A 3DP6A 4MLQA 5TP9A 1BKAA 2Q89A 4N07A 3SEVA 3TTMA 4DE8A 5ICTA 1LFIA 2Q8JA 1JVYA 1I6QA 1SD3A 1SVXB 2FYIA 3IOWA 3TKDA 4ESWA 3MWBA 4DCXA 3TTNA 4DLDA 1CE2A 2UVIA 2XX7A 3CSBA 1O63A 2ESNA 1M5EA 2XXXA 3C32A 2GH9A 3K00A 3N5LA 1YCJA 3VDFA 1XVYA 3QSLA 2GRVA 3O6HA 2NUVA 2R6GE 3Q25A 4IB2A 4NMYA 2XHDA 1B52A 2H98A 4GF8A 4ZDMA 4BDOA 4DXCA 3H03A 3BFUA 3TDJA 5ITPA 5KCJB 3FVNA 3TTKA 4BDRA 3MPLA 1US5A 1JEVA 3FZVA 3M3FA 3OEKA 2DXRA 5H8QB 3T66A 3LBSA 4OFOA 4F3GA 5AA4A 3O97A 4I1DA 3EN3A 1WDNA 3OELA 5L9SA 5DTBA 3OO7A 1ANFA 3PPPA 2AYSA 3KG2A 4ZEFA 3MC2A 1EZ9A 4R2FA 1J1NA 1O64A 1EU8A 1SDXA 4NF8A 4ZEBA 3V83A 4JB7A 1USYE 3U8QA 3QYTA 5H8FB 1OQGA 1FCKA 3R6UA 2RKMA 2Z8FA 2F7CA 2DVCA 3MAMA 3DM0A 2IEEA 2B65A 2Z22A 1MXUA 4H65A 1IXIA 4OEVA 4MF3A 4XKQA 3B6WA 4TLLB 1Z7ME 4O3AA 2UYEA 3EF7A 3FASA 4JWOA 1IZ1A 4LONB 1MG1A 4OETA 2B3BA 4PFUA 5I59A 5FTHA 3MZ9A 3VVDA 4HTGA 2OZZA 3TEPA 1UTHB 3VLVA 4POWA 4JSDA 2HZLA 3PMXA 5F7VA 4OWDA 1B0HA 4YICA 4ZE8A 2VP1A 4EUOA 2ZYOA 3MVXA 3B6TA 1B3LA 2I4BA 3PUYE 1DMBA 1BP5A 1M5DA 4ZZAA 3MP6A 1NH8A 1QKBA 3GBBA 3MQ9A 4MH5A 3TYHA 4DDDA 5L9MA 2CMOA 1F9BA 2QS4A 1PC3A 3MW0A 4NF6B 1FTLA 1QUKA 2O7IA 3MP1A 4ZE9A 1IEJA 1FQCA 4U23A 1B46A 1Y20A 3H6UA 5HM4B 3JZJA 3G3JA 4QFOA 1NFTA 3KOTA 4RK2A 2VHAA 4YKJA 1A40A 2UVGA 2DWJA 1AMFA 2NWJA 4EF2A 1LAXA 2DWAA 5CBRA 2XXTA 1QUIA 1B1HA 2ANJA 3K6WA 3KSJA 4OENA 3SETA 1B9JA 3FATA 1FQEA 3I5OA 4QFPA 4C1TA 1EZPA 2RC7A 2R71A 5I57B 2HAVA 1NNFA 2QMWA 1LLSA 3SEYA 1A7LA 2PMSA 1JVXA 4LATA 4R74A 5ITOA 3SEXA 3TUSA 2I48A 2I6EA 3SEWA 3VXCA 1EH3A 4P0GA 3OO8A 2WKYA 4EQ9A 1MPDA 5KCJA 3IOVA 3VXBA 1ZIUA 5FHOA 1AH5A 2A5TA 4JWXA 4PETA 4YB5A 5L8DA 1PB8A 2V84A 1UIUA 1FQFA 4H5GA 4ZZEA 4IGTA 4DZ1A 4M1VA 3UORA 2F7BA 1URDA 4ISUA 4I9DA 1N0TA 1N7WA 2Y7RA 3OO9A 1HSJA 4G68B 3KOSA 2V25A 2X26A 1IXGA 1M5BA 2UYFA 2RCAA 4TOZA 3GZGA 4R73A 2P1SA 3EPEA 3O2AA 4NWCA 5CMCA 5H8NA 2RC9A 1H3DA 3IX1A 3FVKA 1B7ZA 3MP8A 4HCYA 2G93A 4QSCA 4U2RA 5DT6A 1T0KA 3T93B 1MPCA 3OSQA 4FJPA 1R1NA 4G68A 1POTA 2H4IA 2QS2A 4OXVA 4F1UA 4RJZA 4NF4B 3R26A 1MPBA 1I69A 1NNPA 2ZYMA 4LZ7A 1XS5A 2XXWA 5F1QA 4F31B 2OBGA 2QS1A 3FXRA 1NH7A 4PFWA 3VLUA 1S50A 4H0WA 4O3CA 2ZMBA 3TMGA 4GL8A 1YPNA 3L6GA 4NEDA 4AB5A 3SESA 1IIWA 2DWHA 1MXXA 3IB2A 4FEDA 2DE3A 1FTKA 2I58A 4KCCA 4XKNA 1H76A 2F6GA 3B7DA 4ZEIA 3TTLA 3UA8A 1D4NA 3IL1B 2DQVA 1NMUA 2PT1A 2Y7PA 3CSGA 3MVYA 3QIMA 4RXLA 3CFZA 4EXKA 4JBZA 2W7YA 5CC2A 1IXHA 2Q2CA 4G2ZA 5HBCA 2I3WA 3QXMA 4MLVA 3FV2A 1N3XA 4Z0IA 3EQ1A 2Z8EA 3TCHA 4C1UA 4IO6A 4ESXA 3C36A 1LFGA 1TT1A 1SYIA 1ZBMA 2A5SA 3G3IA 4OESA 3M3KA 3RTWB 5BUUA 5DEXB 4KR5A 3CR9A 1MY1A 2RC8A 1US4A 4KI0E 2XXVA 1UTBA 1JETA 1NL5A 1Y9UA 3A3UA 4R75A 5EYFA 2YJPA 1CB6A 4KYEA 4OQOA 2HZKA 3PMWA 4RA1A 1UIVA 3UIFA 4JWYA 2DWIA 2Y7KA 1Y1MA 3ECRA 3LC8A 1URGA 3O28A 1VFDA 3T22A 4LA9A 3OENA 3OOAA 4F39A 4F3SA 4NTLA 4R6YA 3FD3A 1BLFA 3G3KA 1M5CA 4IO7A 1I6AA 5AA2A 3K02A 5FTIA 3FGSA 2QL3A 3OEMA 4MBPA 4OHNA 1MQIA 3KBRA 4FAJA 2V3TA 1GGGA 1IXCA 1NKXA 1JEUA 2DOJA 4X9TA 5CI5A 1B4HA 2F7AA 3K2DA 3DELB 4NE4A 5K2YA 2X7QA 1FW0A 4OMBA 1Y1ZA 1II5A 3DLNA 4RK9A 1B3FA 3G7WA 3RT6B 1O7TA 3V89B 4ZECA 5ICQA 2UVJA 4KHZE 3PV0E 3HSTA 3LSWA 1D9YA 5H8NB 1AL3A 2M8CA 4QRZA 3RPWA 4LP2B 1XVXA 3MPKA 4OTEA 1LBBA 1B51A 1FQAA 4LUBA 3EHUA 3IJXB 3KFMA 5TU0A 1S9TA 4G8HA 2CZLA 2XD2A 4BLAA 4U22A 3ZS6A 2I0BA 2O7UA 3N26A 5I2KB 3U72A 1TWYA 1LCFA 2HAUA 4R6KA 3H6WA 4U4SA 4YKPA 3WAFA 1IQ7A 4LZ8A 1HSLA 3IR1A 4P0IA 1QULA 2E1SA 4L17A 2QJEA 4Z7EA 4N13A 4I62A 3MVWA 4GIZA 2AIXA 1MM6A 1N76A 3AXFA 1RKMA 4P11A 5H8HA 3W9VA 4F3PA 1FQDA 1POY1 5I58A 3VV5A 4YKKA 1P1QA 3PGFA 2OK2A 2H5YA 2XXIA 3N6UA 1XC1A 2H9BA 2F8DA 3ODBA 1YTVA 3HHFA 3Q26A 5FHNA 4FORA 2I0CA 2GFEA 4LQ5A 5EHMA 4KYDA 3RUMA 1JW1A 4QSEA 3V8XB 2DP8A 2DXYA 3U92A 3FVGA 2O1LA 3BKIB 3M8UA 5A5XA 5IAIA 1SW1A 2XX8A 3C33A 3LUYA 4F1YA 1VE4A 4NWDA 1QKAA 2E0SA 1ATGA 1MQJA 1N7XA 2P2AA 2HCAA 2NOOA 3A09A 1UQWA 3LSLA 1OVTA 4FECA 1TXFA 2REGA 4GD5A 4IY6A 1A8EA 1MY2A 1LAHE 2GHBA 3K6XA 4KPTA 4OYVA 3IO4A 4G4PA 2PVUA 3MZ1A 4LZ5A 5B70A 5J1DA 1WVJA 1IUDA 1XT8A 2VGQA 1B7HA 3FJ7A 3H6VA 3PMVA 4G68C 3TPAA 5I57A 3G3FA 2YPNA 1H43A 4GRKA 3S9MC 2UVHA 3RT8A 4AQ4A 1MM7A 3GXAA 4NF6A 3H7MA 3K0VA 5ELVA 5I2NB 2RINA 4Q30B 1B5JA 3T9XB 1GTKA 2D21A 4ELOA 4BDNA 4E0WA 3KN3A 3TQLA 5B7DA 1D3KA 2O84X 5DVJA 2OLBA 1B2HA 3O29A 4XIGQ 2H99A 3KZGA 1TFDA 1VR5A 4KQPA 3IK6B 4IO3A 3TCGA 2PBWA 4XKPA 3IOTA 4F3BA 4DXUA 3CFXA 3VLWA 2ONSA 4U1OA 2Z23A 4LVQA 1S7YA 4H8JA 1NNKA 1SW4A 3PUZE 4WXJA 1M5FA 3I3VA 1FQBA 1PB7A 3F11A 1URSA 4GXSB 5CMMA 4HW8A 3QUFA 3RNNA 3B6QA 2OWSA 5AE4A 2F78A 4QFKA 4DIGA 4R9FA 3G3GA 4FE8A 2F5XA 3OO6A 4KYSA 4GL0A 3Q29A 2NVUB 3R7XA 1P1UA 1MXWA 2GHAA 3H6TA 2PT2A 2QRYA 4G77A 4GFRA 4Q0CA 3BBRA 1LFHA 2HFBA 4IY5A 1OMPA 5AA1A 3VE1B 1OIBA 4ZS9A 3S2VA 2R9JA 3H3GA 5H8FA 3IJOB 2HXWA 3ILTB 3PD8A 5CRYA 3N94A 3W9WA 3K6VA 3MZBA 4ELRA 4ZEDA 1A99A 5H8HB 3ZKLA 3S4UA 3UGWA 4N6PA 4M4GA 3U1OA 2OWTA 1B5HA 1P1NA 1B40A 5BWJA 4BDLA 3MJNA 3PD9A 3RLFE 4EF1A 1B58A 3K01A 3DP8A 2HEUA 1BIYA 2ZYKA 4ELQA 4ELPA 1RYXA 1UTHA 2FA7A 1NNTA 1QW0A 3DP4A 3O6IA 3PUVE 1Y3NA 4GOTA 3FVOA 4HCWA 5FHMA 2OJTA 4YB7A 1WODA 5K2XA 3QAXA 3U93A 1N3WA 1EZOA 1SW2A 3O9PA 1DPPA 3O66A 3EHTA 3KJ7A 4E0XA 4F2OA 1H45A 1BTJA 1Y4TA 2QMXA 1QVSA 4YMAA 4THIA 3PPRA 2I49A 3S9NC 2Y7WA 1A54A 1AIVA 5I56A 5I59B 3T96B 1Z7NE 1XOCA 2X7PA 2DE2A 3MVZA 1OQHA 3OXNA 1SI0A 3S9LC 3A3CA 3TAJA 3KSXA 4NF4A 4LQ2A 4OVJA 4Q8RA 3TELA 5DVIA 3QUJA 4XTCQ 3OSRA 4QF9A 5I56B 4U1ZA 4Q5TA 4F22A 2D5WA 2KLFA 1MXYA 2UXAA 4RPOA 3SERA 3T9HB 3M3LA 1SI1A 3JYRA 1B3EA 1MQDA 2ZNTA 3KJTA 4XKRA 3RGYA 2XX9A 2XXQA 4X1DA 3TODA 3E4RA 3FJGA 1B05A 4KCDA 2ZNUA 2XXRA 3HV1A 3CG1A 3IB1A 1PEBA 3KEIA 4U4XA 3SKPA 4TQUQ 3UN6A 1B0LA 1GR2A 3PPOA 1JNFA 1MY3A 1PB9A 4GVOA 3IOUA 4RPNA 4QHQA 3C31A 3H06B 4O3BA 4PE5B 2G29A 4JDFA 4U21A 3VVFA 4F29A 3VFJA 2VD3A 2DYXA 4UA8A 3IB0A 3ZSFA 2BJJX 4F1VA 4PFYA 3MUQA 3LSXA 1MRPA 4NF5A 1AOVA 1ZTYA 1ZKBA 4YZZA 4DXBA 1PBPA 1ZMGA 3I6VA 4EDPA 2B3FA 1LGBC 3IORA 1GV8A 4POXA 2F35A 5CM6A 2Z8DA 3K1NA 4MFIA 5L9OA 3Q28A 4PQJA 1OLAA 4EQBA 4H5FA 1FTJA 2XD3A 3PU5A 4EXLA 3LSFB 1MDQA 3QK6A 5KZTA 1JW5A 3O6GA 3RQTA 2XXYA 1B3HA 1DPEA 3E13X 4NF5B 2DVZA 1MY0A 3H4ZA 2ZYNA 3VVEA 3BFTA 1VFEA 3KGCA 3T9UA 4X1BA 5H8SA 4IO4A 5CMBA 1N84A 4WKMA 3ONMA 2AL5A 3SDFA 1KWHA 5CBSA 4QFLA 1LBCA 2YLNA 1B6HA 4WEDA 1P1WA 4GXAA 1SQYA 2O6AA 2I3VA 2XXUA 3HHGA 1MQGA 4JXIA 1JQFA 4QSDA 4R9GA 1FTMA 3HO7A 1QUJA 1DOTA 1L5TA 2RF1A 3PPQA 5JTYB 1Y3PA 1DSNA 2H25A 4DCYA 2A5TB 4AB6A 5M2VA 3W15C 5TP9B 1B32A 5KDTB 5ISUA 3L6HA 5CMKA 1QJMA 1PDAA 1ZU0A 2OCUA 3D4CA 1B5IA 4BDMA 1SBPA 5DVFA 2ONKE 2DSFA 4ND9A 4BDQA 1MXVA 2F97A 1ZLQA 1DTZA 5I58B 2V3UA 4UACA 3OD7A 3K1MA 1USYH 4OEUA 3IAZA 2Y7IA 3ILUB 2IA4A 1Q35A 2XXPA 4H67A 4F18A 5I2NA 2Y84A 4TLMB 5KDTA 1OVBA 3ZKKA 3EHSA 2F34A 2F6PA 2V93A 3HN0A 3Q27A 1LAFE 4ONYA 3C34A 4G8NA 5H8QA 5EHSA 5AA4B 1VSOA 3D4GA 3TCFA 1ZJLA 1MDP1 3JV9A 4OZ9A 2ABHA 1D9VA 3PUXE 4R72A 3K6UA 3G3HA 4GQOA 1RYOA 2O51A 3PUWE 1B3GA 4OFJA 5JEIA 2P0SA 4IO2A 1LCTA 1B1XA 1A55A 4EQ7A 1MS7A 5TPAB 1IITA 2XXHA 3CFLA 4XXUA 2LAOA 3GLBA 4RYAA 1JW4A 3USDA 2F36A 3THIA 1LB8A 4F19A 1MQHA 1MH3A 2DE4A 3C4MA 3FUZA 4IO5A 4PP0A 4X48A 3U94A 3UK4A 1OLCA 3WAEA 1Y4CA 1I6BA 1LSTA 2ONRA 3SEUA 2QS3A 1B4ZA 4WEPA 1LAGE 3P7IA 4K3FA 3KN8A 4H1XA 1R9LA 1DTGA 2HQ0A 2NXOA 3KN7A 4KFQA 2V3QA 2D3IA 3MBPA 4ECFA 3CG3A 2QPQA 2Q9TA 2VOZA 1UTBB 1MXZA 3E3KA 3RN8A 3CRBA 1P1OA 4R2BA 3V5AA 5JK4A 4H8IA 2O1MA 4YAHX 3K1PA 4RY1A 4YMBA 3FV1A 5IKBA 4F2QA 1MH4A 4GLIA 4YU0A 4C0RA 2FNCA 2ZXTA 3C9HA 3RTFB 1TFAA 4JSOA 4NF8B 4ZEKA 5JTYA 3UP9A 3TFLA 1B7UA 2PX1A 4I8CA
chains in the Genus database with same CATH superfamily
1SW5A 3MYUA 2THIA 3FXQA 4FEBA 3IO6A 5AA2D 3S9EA 3ISPA 1Q1KA 1H44A 5LOMA 5HPQA 4FIMA 5DYHA 5DEXA 3OMBA 2ALUA 4P56A 4YB6A 2ZNSA 1HSEA 4RNSA 4OERA 4KD5A 4N6KA 1XHYA 1K9ZA 4HS7A 5TPAA 2I4CA 1LB9A 3DP6A 4MLQA 2Q89A 1JVYA 2F3DA 3IOWA 3TTNA 4DLDA 2UVIA 2XX7A 3CSBA 3N5LA 3VDFA 4NMYA 4OVRA 3O6HA 2R6GE 3Q25A 1B52A 3FVNA 4MCOA 3FZVA 3OEKA 3M3FA 5H8QB 3LBSA 4OFOA 3PPPA 4ZEFA 4PGNA 1EU8A 4NF8A 3V83A 4JB7A 3U8QA 5H8FB 2Z8FA 5ET8A 2B65A 1MXUA 1Z7ME 4O3AA 4JWOA 1IZ1A 1MG1A 5I59A 4HTGA 2HZLA 4YICA 2ZYOA 3PUYE 1DMBA 1BP5A 1M5DA 1QKBA 4MH5A 4DDDA 3MQ9A 2CMOA 1PC3A 1FTLA 1QUKA 2O7IA 2XWVA 4N17A 1IEJA 2FHYA 3H6UA 5HM4B 1NFTA 4RK2A 5CBRA 1EZPA 3FATA 2RC7A 2R71A 2HAVA 4H46A 1LLSA 2PMSA 2WEFA 3VXCA 5KCJA 3VXBA 1ZIUA 5FHOA 4JWXA 4PETA 5L8DA 2V84A 4ISUA 1HSJA 3GZGA 1H3DA 4HCYA 4U2RA 2G93A 2CZKA 1K9YA 3KBZA 4NF4B 1MPBA 2ZYMA 4LZ7A 1XS5A 2QS1A 1NH7A 1G0IA 1S50A 4O3CA 2ZMBA 1NI9A 3L6GA 4NEDA 4O7IA 1MXXA 4XKNA 2I58A 3CSGA 3CFZA 4JBZA 1IXHA 3FV2A 4C1UA 3TCHA 3EQ1A 5DEXB 4ZEKA 2XXKA 3A3UA 4F1VA 1CB6A 2HZKA 3PMWA 1UIVA 3ECRA 2Y7KA 3LC8A 1VFDA 4LA9A 4F3SA 2P3VA 5FTIA 2QL3A 1LBVA 1MQIA 4FAJA 2WYPA 3KC1A 1FW0A 1Y1ZA 1B3FA 3G7WA 3RT6B 4ZECA 5H8NB 1AL3A 3RPWA 1NV1A 4PDHA 5TU0A 2I0BA 5I2KB 1LCFA 4R6KA 4U4SA 4MNIA 1HSLA 3IR1A 4NAPA 4I62A 4GIZA 1MM6A 4N8GA 4F3PA 4YKKA 1XC1A 2H9BA 3ODBA 1YTVA 4LQ5A 2DXYA 2WYKA 3C33A 1FPGA 4NWDA 2E0SA 3LSLA 1FJ6A 2REGA 4OYVA 4PDDA 4KPTA 2PVUA 3MZ1A 1XT8A 1IUDA 3PMVA 1B7HA 5I57A 1H43A 3S9MC 3RT8A 3GXAA 4Q30B 3T9XB 4N8YA 3IFCA 5B7DA 3O29A 1FTAA 2H99A 3KZGA 4KQPA 3TCGA 4IO3A 3IOTA 4F3BA 3CFXA 4H8JA 3PUZE 3F11A 4GXSB 5CMMA 3RNNA 5AE4A 2NVUB 1MXWA 3H6TA 4Q0CA 2PT2A 3BBRA 5ET7A 1OIBA 1JP4A 3H3GA 4MEVA 3W9WA 4ZEDA 3S4UA 1EYJA 4QXDA 1B58A 4EF1A 3DP8A 1BIYA 4ELQA 4ELPA 1UTHA 3O6IA 4HCWA 3PUVE 1Y3NA 3FVOA 2P3NA 5K2XA 1N3WA 1EZOA 3EHTA 1BTJA 2B4LA 3PPRA 3E78A 5I59B 4GX4A 1Z7NE 1OQHA 3S9LC 3TAJA 4NF4A 4XTCQ 4U1ZA 3SERA 4RPOA 2Y5LA 3JYRA 3E4RA 3CG1A 4TQUQ 4I3EA 4RPNA 3H06B 3VVFA 2VD3A 4PFYA 3LSXA 1ZTYA 3I6VA 5CM6A 4PQJA 1OLAA 4EQBA 3QK6A 5KZTA 3O6GA 2XXYA 1B3HA 5T3JA 4PFRA 3BFTA 3KGCA 5CMBA 3ONMA 5EQ9A 2YLNA 4R9GA 2I3VA 4JXIA 3HO7A 1L5TA 3LV0A 5JTYB 1Y3PA 4OA4A 2H25A 3W15C 5ISUA 1PDAA 1YZ0A 5DVFA 1ZLQA 5I58B 4UACA 4OEUA 1USYH 3IAZA 5KDTA 2F6PA 4QBAA 4G8NA 5H8QA 5EHSA 4NQ8A 2ABHA 4R72A 1NUYA 1RYOA 2O51A 4OFJA 2XWIA 1A55A 5TPAB 3CFLA 1YYZA 3USDA 1MH3A 3C4MA 4IO5A 1OLCA 3WAEA 1LSTA 1B4ZA 4WEPA 1LAGE 3P7IA 3KN8A 3KN7A 2BJIA 4ECFA 2Q9TA 2VOZA 3RN8A 1FPEA 2XWKA 4H8IA 4PAIA 3K1PA 4RY1A 3FV1A 4F2QA 1MH4A 4GLIA 5JTYA 3TFLA 1B7UA 2PX1A 1A8FA 3GBAA 1ELJA 5J16A 4PFTA 4OFLA 2VD2A 3E9XA 3TQWA 2PCRA 4HE1A 4GWOA 4GWSA 2RCBA 3LR1A 3SEXA 3S2VA 1FTOA 2QSXA 4F1YA 5A5XA 3CIJA 1VDWA 1RDYA 3FXBA 4R6HA 5AA2B 3RY3A 3SEVA 4DE8A 4MHFA 1LFIA 1SD3A 1I6QA 4ESWA 3MWBA 5IGAA 1CE2A 2VT5A 3C32A 4IB2A 2XHDA 2H98A 3H03A 3TDJA 3TTKA 2L5VA 4GBVA 4OVTA 4BDRA 1FPDA 1WDNA 4PFIA 3OO7A 1ANFA 3RPLB 5I5PA 4P1LA 1J1NA 1SDXA 4ZEBA 1USYE 4PCDA 2DVCA 2Z22A 1IXIA 1EYIA 4OEVA 4XKQA 3B6WA 1YXIA 4N15A 2UYEA 3EF7A 3FASA 4OETA 2B3BA 4POWA 1B0HA 1IMDA 2I4BA 3MP6A 3GBBA 5L9MA 4ZE9A 2QS4A 4NF6B 3JZJA 4QFOA 2NWJA 4EF2A 2UVGA 1AMFA 2DWAA 2ANJA 4C1TA 5I57B 2QMWA 4OVQA 5ITOA 3TUSA 2QVUA 1MPDA 3IOVA 4YB5A 1PB8A 4H5GA 1FQFA 4IGTA 4DZ1A 2F7BA 1IMBA 1URDA 3OO9A 4G68B 2V25A 4TOZA 1M5BA 3LUZA 4R73A 5CMCA 4FBPA 2RC9A 3FVKA 4QSCA 1MPCA 4FJPA 1POTA 2QS2A 1I69A 2XXWA 1FBCA 4H0WA 1IIWA 2DWHA 3IB2A 4DI4B 2DE3A 4GWUA 1D4NA 2Y7PA 3QIMA 4RXLA 4EXKA 1NV3A 4G2ZA 2CEXA 4MLVA 4Z0IA 1N3XA 4IO6A 4DXCA 1D9QA 1TT1A 2A5SA 4HE0A 1MY1A 2RC8A 1JETA 1NL5A 1Y9UA 1DBZA 2YJPA 4OQOA 2DWIA 3FGSA 1IXCA 1NKXA 2DOJA 3FBPA 1B4HA 2F7AA 2HXRA 4NE4A 3V89B 3SZPA 1O7TA 4MJOA 4LP2B 1XVXA 3KFMA 2XD2A 4BLAA 3ZS6A 3N26A 1TWYA 2HAUA 3H6WA 4YKPA 3WAFA 4LZ8A 4P0IA 4N6DA 4N13A 3GYYA 1N76A 1P1QA 3PGFA 2OK2A 3TTLA 3RUMA 4QSEA 3U92A 3FVGA 2XX8A 1VE4A 3NOHA 1ATGA 1MQJA 1BK4A 1KA0A 4GD5A 4IY6A 1A8EA 1MY2A 3K6XA 1WVJA 3FJ7A 3TPAA 2VGQA 3G3FA 3H7MA 1B5JA 2D21A 2GQ1A 4BDNA 4E0WA 2OLBA 1B2HA 4XIGQ 4XKPA 2Z23A 4LVQA 1S7YA 1LBWA 1M5FA 1PB7A 4P47A 1G0HA 3Q29A 3R7XA 2QRYA 4GFRA 2HFBA 4IY5A 1OMPA 5H8FA 3PD8A 3ILTB 3N94A 4ELRA 3MZBA 5ESYA 4JVCA 5H8HB 1B5HA 1P1NA 3PD9A 3K01A 2HEUA 1RYXA 1WODA 3QAXA 3O9PA 3O66A 4E0XA 1H45A 4LN5A 1QVSA 3S9NC 4IR8A 1XOCA 2DE2A 3TELA 4Q5TA 4F22A 3T9HB 3M3LA 1MQDA 4X1DA 2XXQA 4U4XA 1GR2A 1PB9A 4F29A 4UA8A 2BJJX 1MRPA 1ZKBA 4YZZA 4EDPA 2B3FA 1GV8A 4POXA 2Z8DA 4MFIA 4OVPA 5L9OA 4N81A 2XD3A 3LSFB 1INPA 3RQTA 4NF5B 1MY0A 3VVEA 4X1BA 5H8SA 1N84A 4WKMA 2AL5A 1KWHA 1DCUA 4GX6A 4WEDA 4MX6A 3D1RA 1P1WA 2O6AA 3QMFA 1QUJA 2CZIA 1NV4A 2RF1A 1DSNA 2A5TB 4AB6A 5M2VA 1FPBA 5ET5A 2PFYA 1ZU0A 2OCUA 1B5IA 4BDMA 4BDQA 2F97A 3OD7A 4F18A 2Y84A 3EHSA 2V93A 3HN0A 5AA4B 1VSOA 1ZJLA 1MDP1 3K6UA 4GQOA 4NN3A 5JEIA 2XXHA 2F36A 1LB8A 4PP0A 4NHBA 4KFQA 1R9LA 2V3QA 3MBPA 3CG3A 4DI3D 1P1OA 4H45A 4YMBA 4YU0A 3C9HA 4I8CA 2O69A 4MAGA 4PBQA 4FATA 3N6TA 3HPIA 4YKIA 1R6ZA 3T9VA 3BIHA 2ZZVA 5AA3A 1PBQA 1R9QA 5I84A 1P99A 3PPNA 3C35A 1YAEA 2AL4A 5I2KA 3TTRA 4IGRA 2R8TA 2Q2AA 2REJA 3CVGA 3FJMA 3K4UA 5A5XB 1MY4A 1FBDA 5TP9A 1BKAA 3TTMA 2Q8JA 3TKDA 1SVXB 3PTYA 3K1MA 1M5EA 3K00A 1YCJA 3QSLA 2GRVA 4EXLA 2NUVA 4ZDMA 4BDOA 4GF8A 4UABA 1JEVA 4N91A 3O97A 4I1DA 4G61A 3OELA 5DTBA 4XEQA 3KG2A 1EZ9A 1O64A 1LEVA 4AS5A 1FCKA 2RKMA 4MNCA 2F7CA 3MAMA 3DM0A 4PFBA 5ET6A 4PFUA 3IFAA 3VVDA 2OZZA 2WBDA 1UTHB 3VLVA 4JSDA 3PMXA 4ZE8A 4EUOA 2VP1A 3MVXA 4GWYA 2JJKA 4ZZAA 4P9KA 3TYHA 1NH8A 1F9BA 3MW0A 1FQCA 4MIJA 4GWXA 1Y20A 4YKJA 1QUIA 4QFPA 4X04A 3SEYA 1JVXA 4LATA 3SEWA 1FPKA 1EH3A 4EQ9A 2WKYA 5EYGA 2A5TA 4ZZEA 4M1VA 4I9DA 1N0TA 1N7WA 2Y7RA 3KOSA 1IXGA 2RCAA 2P1SA 2B4MA 3MP8A 5DT6A 3OSQA 4G68A 2FIXA 4OXVA 4RJZA 5F1QA 2VPNA 2OBGA 3FXRA 4PFWA 3VLUA 4GL8A 1YPNA 1LBYA 4XFEA 4ZEIA 3UA8A 3B7DA 1NMUA 4GX3A 4P1EA 2W7YA 5HBCA 2I3WA 3QXMA 2Z8EA 4ESXA 1LFGA 4OESA 1FSAA 2XXVA 4OVSA 4R75A 5EYFA 4RA1A 1Y1MA 1URGA 3OOAA 4F39A 4R6YA 1BLFA 3G3KA 4IO7A 3OEMA 2V3TA 5CI5A 3DELB 4OMBA 1II5A 4O94A 3DLNA 4RK9A 2UVJA 3PV0E 1D9YA 2M8CA 3MPKA 4OTEA 1LBBA 1B51A 1FQAA 4LUBA 3EHUA 1S9TA 4G8HA 2O7UA 3U65A 3U72A 3ROJA 1CNQA 1QULA 2E1SA 4L17A 2QJEA 4Z7EA 3B8BA 3MVWA 5H8HA 2AIXA 2WX9A 5I58A 1POY1 3VV5A 2XXIA 3N6UA 3HHFA 3Q26A 5FHNA 2Y5KA 4FORA 2GFEA 4KYDA 1JW1A 3M8UA 2HPGA 1N7XA 4MBPA 4NF5A 4FECA 1TXFA 1LAHE 5J1DA 5B70A 3H6VA 2YPNA 2UVHA 4AQ4A 3K0VA 2RINA 1GTKA 3KN3A 1QGXA 1TFDA 1VR5A 3IK6B 2PBWA 4DXUA 3VLWA 1NNKA 1SW4A 1URSA 3QUFA 2XA5A 3B6QA 2OWSA 4JVDA 3T0JA 4R9FA 1IMEA 3G3GA 3OO6A 4KYSA 4GL0A 1P1UA 2GHAA 4G77A 2FBPA 2HHMA 5AA1A 4ZS9A 2R9JA 3IJOB 5CRYA 3ZKLA 4GBWA 4M4GA 3U1OA 5BWJA 4BDLA 3MJNA 3RLFE 2ZYKA 2FA7A 1NNTA 4GOTA 4PF6A 5FHMA 4YB7A 2ZZWA 1SW2A 1DPPA 1SPIA 3KJ7A 1Q9DA 4F2OA 1Y4TA 2QMXA 4YMAA 5I56A 3MVZA 3OXNA 1SI0A 4Q8RA 2PFZA 5DVIA 4PTKA 5I7IA 1SI1A 2OWZA 1B3EA 2ZNTA 3RGYA 1FPIA 3FJGA 1B05A 4KCDA 2ZNUA 1NV5A 5I2NB 3KEIA 3SKPA 1B0LA 1JNFA 1MY3A 3IOUA 4KXPA 4O3BA 4PE5B 2G29A 4JDFA 4U21A 2DYXA 3IB0A 3ZSFA 3MUQA 5LTCA 1PBPA 1ZMGA 1LGBC 3IORA 3K1NA 3Q28A 4H5FA 1FTJA 3PU5A 4OANA 3T1BA 1MDQA 5IZ1A 1JW5A 3E13X 1DPEA 1RDXA 2MKZA 2QFLA 2DVZA 3H4ZA 2ZYNA 3T9UA 4IO4A 5CBSA 3SDFA 1FBFA 1LBCA 4NG7A 4GXAA 2XXUA 1JQFA 1FTMA 1RDZA 1FRPA 4DCYA 5TP9B 1B32A 5CMKA 3D4CA 4ND9A 1MXVA 1DTZA 2V3UA 1KA1A 2IA4A 2XXPA 5I2NA 4TLMB 3Q27A 2F34A 1D9VA 3G3HA 3PUWE 2P0SA 5IZZA 4PGPA 1LCTA 1B1XA 4EQ7A 3CHGA 1JW4A 4X8RA 1MQHA 3UK4A 2DE4A 4X48A 2Q74A 1Y4CA 1I6BA 2ONRA 3E79A 4H1XA 2NXOA 1DTGA 2HQ0A 2D3IA 2QPQA 1FBHA 1UTBB 1MXZA 4P8BA 2KQZA 4YAHX 3RPLA 5IKBA 4JSOA 4NF8B 3UP9A 4QFNA 1LBZA 3CI8A 2FVZA 3B50A 1Y3QA 5LDZA 2PYYA 1N04A 2DS9A 3FIRA 1GVCA 2FIEA 3RYDA 4G8MA 2Q88A 1SYHA 4H6DA 3TZAA 2O68A 4OWDA 4THIA 3HCQA 3FXUA 5ICTA 4N07A 2FYIA 4DCXA 1O63A 2ESNA 2XXXA 2GH9A 1XVYA 4MMPA 5F24A 3BFUA 5ITPA 1FBGA 5KCJB 3MPLA 1US5A 2DXRA 3T66A 5AA4A 1EYKA 4F3GA 3EN3A 5L9SA 2AYSA 3MC2A 4R2FA 3QYTA 1OQGA 3R6UA 2F3BA 2IEEA 4H65A 4MF3A 4TLLB 5IM2A 4LONB 1FJ9A 4XF5A 5FTHA 3MZ9A 1NV0A 3TEPA 4JVIA 5F7VA 3B6TA 1B3LA 3MP1A 4U23A 1B46A 4N4UA 3G3JA 3KOTA 2VHAA 1A40A 2DWJA 1LAXA 2XXTA 5IZ3B 1B1HA 3K6WA 3KSJA 4OENA 3SETA 1B9JA 3I5OA 1FQEA 5EQ7A 1NNFA 1A7LA 4R74A 2I48A 2I6EA 4P0GA 3OO8A 1AH5A 1FPLA 2QVRA 1XI6A 1UIUA 1NUZA 3UORA 2X26A 2UYFA 3EPEA 4NWCA 3O2AA 5H8NA 3IX1A 1B7ZA 1T0KA 3T93B 1R1NA 2ZZXA 2CEYA 2H4IA 4F1UA 3R26A 4F31B 1NNPA 3TMGA 1NV6A 4AB5A 3SESA 4FEDA 4KCCA 2XWOA 1FTKA 1H76A 2F6GA 3IL1B 2DQVA 2PT1A 3MVYA 5CC2A 2Q2CA 3C36A 3G3IA 3RTWB 1SYIA 1ZBMA 3M3KA 5BUUA 4PE3A 4KR5A 3CR9A 4KI0E 1US4A 1UTBA 4KYEA 3V8XB 3UIFA 4JWYA 3O28A 3T22A 3OENA 4NTLA 3FD3A 5AA2A 1M5CA 4NX1A 1I6AA 3K02A 5I56B 4OHNA 5EQAA 1LBXA 3KBRA 1GGGA 1JEUA 4X9TA 1FBPA 5K2YA 3K2DA 4P3LA 2X7QA 4HE2A 4NF0A 1NUWA 5ICQA 4KHZE 3HSTA 3LSWA 4QRZA 3IJXB 2CZLA 4U22A 1IQ7A 4P11A 3AXFA 1RKMA 3W9VA 5I3SA 1FQDA 2H5YA 2F8DA 2I0CA 4PF8A 5EHMA 2DP8A 2O1LA 3BKIB 5IAIA 1SW1A 3LUYA 1QKAA 3A09A 2P2AA 2HCAA 2NOOA 1UQWA 1OVTA 2GHBA 5IZ3A 3IO4A 4G4PA 4LZ5A 2DDKA 4G68C 4GRKA 5FBPA 1MM7A 4NF6A 5ELVA 4I3YA 4ELOA 3TQLA 1D3KA 2O84X 5DVJA 2ONSA 4U1OA 4PAKA 4O7MA 4WXJA 4PBHA 3I3VA 1FQBA 2KR0A 4HW8A 4O8MA 2F78A 4QFKA 4DIGA 3HFUA 4FE8A 2F5XA 1LFHA 3EKIA 1NV7A 2HXWA 3K6VA 1A99A 3UGWA 4N6PA 2OWTA 1B40A 1QW0A 3DP4A 2OJTA 3U93A 3MSTA 4PAFA 2I49A 2Y7WA 1A54A 3T96B 2X7PA 3A3CA 3KSXA 4LQ2A 4OVJA 2OX3A 1DK4A 3QUJA 3OSRA 4QF9A 2D5WA 2KLFA 1MXYA 2UXAA 3TODA 3KJTA 4XKRA 2XX9A 4AS4A 3HV1A 2XXRA 3IB1A 1PEBA 3UN6A 3PPOA 4GVOA 4QHQA 3C31A 2V4CA 1FPJA 1KZ8A 3VFJA 4GWZA 1AOVA 4DXBA 4I40A 2F35A 1FPFA 4NGUA 1FBEA 1VFEA 1NUXA 2VPOA 4QFLA 1IMCA 1IMFA 5EQ8A 1B6HA 1IMAA 1SQYA 3HHGA 5A5LA 1MQGA 4QSDA 1DOTA 3PPQA 2WBBA 5EYHA 5KDTB 3L6HA 1QJMA 1SBPA 2ONKE 2DSFA 2Y7IA 1NV2A 3ILUB 1Q35A 4H67A 1OVBA 3ZKKA 1LAFE 4ONYA 3C34A 4GWWA 3D4GA 3TCFA 3JV9A 4OZ9A 3PUXE 2CZHA 1B3GA 3A29A 4IO2A 1MS7A 1IITA 4XXUA 2LAOA 3GLBA 4RYAA 4PC9A 3THIA 4F19A 3FUZA 3U94A 3KC0A 3BIGA 3SEUA 2QS3A 4K3FA 1AWBA 5DW8A 2QVVA 4MNPA 3E3KA 3CRBA 4R2BA 3V5AA 5JK4A 2O1MA 4HXVA 2Q8MA 1AIVA 4C0RA 2FNCA 2ZXTA 3RTFB 1TFAA 3VE1B
chains in the Genus database with same CATH topology
1A8FA 4QFNA 2O69A 1SW5A 3CI8A 2THIA 1Y3QA 3FXQA 4FEBA 4FATA 3N6TA 2PYYA 3GBAA 1ELJA 3HPIA 4YKIA 1R6ZA 1N04A 2DS9A 4OFLA 4PFTA 3IO6A 3T9VA 5AA2D 3FIRA 3S9EA 1GVCA 1Q1KA 2VD2A 3E9XA 3TQWA 1H44A 4G8MA 5LOMA 2Q88A 5AA3A 5HPQA 1PBQA 4FIMA 5DYHA 1R9QA 4GWOA 5DEXA 5I84A 1SYHA 3OMBA 2ALUA 4H6DA 3TZAA 4YB6A 2O68A 2RCBA 3LR1A 3HCQA 1FTOA 1P99A 2QSXA 3FXUA 2ZNSA 3C35A 3PPNA 3CIJA 1HSEA 4RNSA 1YAEA 2AL4A 5I2KA 3TTRA 4OERA 4IGRA 4KD5A 2REJA 2Q2AA 3CVGA 4R6HA 1XHYA 5AA2B 3FJMA 3K4UA 3RY3A 5A5XB 4HS7A 5TPAA 1MY4A 2I4CA 1LB9A 3DP6A 4MLQA 5TP9A 1BKAA 2Q89A 4N07A 3SEVA 3TTMA 4DE8A 5ICTA 1LFIA 2Q8JA 1JVYA 1I6QA 1SD3A 1SVXB 2FYIA 3IOWA 3TKDA 4ESWA 3MWBA 4DCXA 3TTNA 4DLDA 1CE2A 2UVIA 2XX7A 3CSBA 1O63A 2ESNA 1M5EA 2XXXA 3C32A 2GH9A 3K00A 3N5LA 1YCJA 3VDFA 1XVYA 3QSLA 2GRVA 3O6HA 2NUVA 2R6GE 3Q25A 4IB2A 4NMYA 2XHDA 1B52A 2H98A 4GF8A 4ZDMA 4BDOA 4DXCA 3H03A 3BFUA 3TDJA 5ITPA 5KCJB 3FVNA 3TTKA 4BDRA 3MPLA 1US5A 1JEVA 3FZVA 3M3FA 3OEKA 2DXRA 5H8QB 3T66A 3LBSA 4OFOA 4F3GA 5AA4A 3O97A 4I1DA 3EN3A 1WDNA 3OELA 5L9SA 5DTBA 3OO7A 1ANFA 3PPPA 2AYSA 3KG2A 4ZEFA 3MC2A 1EZ9A 4R2FA 1J1NA 1O64A 1EU8A 1SDXA 4NF8A 4ZEBA 3V83A 4JB7A 1USYE 3U8QA 3QYTA 5H8FB 1OQGA 1FCKA 3R6UA 2RKMA 2Z8FA 2F7CA 2DVCA 3MAMA 3DM0A 2IEEA 2B65A 2Z22A 1MXUA 4H65A 1IXIA 4OEVA 4MF3A 4XKQA 3B6WA 4TLLB 1Z7ME 4O3AA 2UYEA 3EF7A 3FASA 4JWOA 1IZ1A 4LONB 1MG1A 4OETA 2B3BA 4PFUA 5I59A 5FTHA 3MZ9A 3VVDA 4HTGA 2OZZA 3TEPA 1UTHB 3VLVA 4POWA 4JSDA 2HZLA 3PMXA 5F7VA 4OWDA 1B0HA 4YICA 4ZE8A 2VP1A 4EUOA 2ZYOA 3MVXA 3B6TA 1B3LA 2I4BA 3PUYE 1DMBA 1BP5A 1M5DA 4ZZAA 3MP6A 1NH8A 1QKBA 3GBBA 3MQ9A 4MH5A 3TYHA 4DDDA 5L9MA 2CMOA 1F9BA 2QS4A 1PC3A 3MW0A 4NF6B 1FTLA 1QUKA 2O7IA 3MP1A 4ZE9A 1IEJA 1FQCA 4U23A 1B46A 1Y20A 3H6UA 5HM4B 3JZJA 3G3JA 4QFOA 1NFTA 3KOTA 4RK2A 2VHAA 4YKJA 1A40A 2UVGA 2DWJA 1AMFA 2NWJA 4EF2A 1LAXA 2DWAA 5CBRA 2XXTA 1QUIA 1B1HA 2ANJA 3K6WA 3KSJA 4OENA 3SETA 1B9JA 3FATA 1FQEA 3I5OA 4QFPA 4C1TA 1EZPA 2RC7A 2R71A 5I57B 2HAVA 1NNFA 2QMWA 1LLSA 3SEYA 1A7LA 2PMSA 1JVXA 4LATA 4R74A 5ITOA 3SEXA 3TUSA 2I48A 2I6EA 3SEWA 3VXCA 1EH3A 4P0GA 3OO8A 2WKYA 4EQ9A 1MPDA 5KCJA 3IOVA 3VXBA 1ZIUA 5FHOA 1AH5A 2A5TA 4JWXA 4PETA 4YB5A 5L8DA 1PB8A 2V84A 1UIUA 1FQFA 4H5GA 4ZZEA 4IGTA 4DZ1A 4M1VA 3UORA 2F7BA 1URDA 4ISUA 4I9DA 1N0TA 1N7WA 2Y7RA 3OO9A 1HSJA 4G68B 3KOSA 2V25A 2X26A 1IXGA 1M5BA 2UYFA 2RCAA 4TOZA 3GZGA 4R73A 2P1SA 3EPEA 3O2AA 4NWCA 5CMCA 5H8NA 2RC9A 1H3DA 3IX1A 3FVKA 1B7ZA 3MP8A 4HCYA 2G93A 4QSCA 4U2RA 5DT6A 1T0KA 3T93B 1MPCA 3OSQA 4FJPA 1R1NA 4G68A 1POTA 2H4IA 2QS2A 4OXVA 4F1UA 4RJZA 4NF4B 3R26A 1MPBA 1I69A 1NNPA 2ZYMA 4LZ7A 1XS5A 2XXWA 5F1QA 4F31B 2OBGA 2QS1A 3FXRA 1NH7A 4PFWA 3VLUA 1S50A 4H0WA 4O3CA 2ZMBA 3TMGA 4GL8A 1YPNA 3L6GA 4NEDA 4AB5A 3SESA 1IIWA 2DWHA 1MXXA 3IB2A 4FEDA 2DE3A 1FTKA 2I58A 4KCCA 4XKNA 1H76A 2F6GA 3B7DA 4ZEIA 3TTLA 3UA8A 1D4NA 3IL1B 2DQVA 1NMUA 2PT1A 2Y7PA 3CSGA 3MVYA 3QIMA 4RXLA 3CFZA 4EXKA 4JBZA 2W7YA 5CC2A 1IXHA 2Q2CA 4G2ZA 5HBCA 2I3WA 3QXMA 4MLVA 3FV2A 1N3XA 4Z0IA 3EQ1A 2Z8EA 3TCHA 4C1UA 4IO6A 4ESXA 3C36A 1LFGA 1TT1A 1SYIA 1ZBMA 2A5SA 3G3IA 4OESA 3M3KA 3RTWB 5BUUA 5DEXB 4KR5A 3CR9A 1MY1A 2RC8A 1US4A 4KI0E 2XXVA 1UTBA 1JETA 1NL5A 1Y9UA 3A3UA 4R75A 5EYFA 2YJPA 1CB6A 4KYEA 4OQOA 2HZKA 3PMWA 4RA1A 1UIVA 3UIFA 4JWYA 2DWIA 2Y7KA 1Y1MA 3ECRA 3LC8A 1URGA 3O28A 1VFDA 3T22A 4LA9A 3OENA 3OOAA 4F39A 4F3SA 4NTLA 4R6YA 3FD3A 1BLFA 3G3KA 1M5CA 4IO7A 1I6AA 5AA2A 3K02A 5FTIA 3FGSA 2QL3A 3OEMA 4MBPA 4OHNA 1MQIA 3KBRA 4FAJA 2V3TA 1GGGA 1IXCA 1NKXA 1JEUA 2DOJA 4X9TA 5CI5A 1B4HA 2F7AA 3K2DA 3DELB 4NE4A 5K2YA 2X7QA 1FW0A 4OMBA 1Y1ZA 1II5A 3DLNA 4RK9A 1B3FA 3G7WA 3RT6B 1O7TA 3V89B 4ZECA 5ICQA 2UVJA 4KHZE 3PV0E 3HSTA 3LSWA 1D9YA 5H8NB 1AL3A 2M8CA 4QRZA 3RPWA 4LP2B 1XVXA 3MPKA 4OTEA 1LBBA 1B51A 1FQAA 4LUBA 3EHUA 3IJXB 3KFMA 5TU0A 1S9TA 4G8HA 2CZLA 2XD2A 4BLAA 4U22A 3ZS6A 2I0BA 2O7UA 3N26A 5I2KB 3U72A 1TWYA 1LCFA 2HAUA 4R6KA 3H6WA 4U4SA 4YKPA 3WAFA 1IQ7A 4LZ8A 1HSLA 3IR1A 4P0IA 1QULA 2E1SA 4L17A 2QJEA 4Z7EA 4N13A 4I62A 3MVWA 4GIZA 2AIXA 1MM6A 1N76A 3AXFA 1RKMA 4P11A 5H8HA 3W9VA 4F3PA 1FQDA 1POY1 5I58A 3VV5A 4YKKA 1P1QA 3PGFA 2OK2A 2H5YA 2XXIA 3N6UA 1XC1A 2H9BA 2F8DA 3ODBA 1YTVA 3HHFA 3Q26A 5FHNA 4FORA 2I0CA 2GFEA 4LQ5A 5EHMA 4KYDA 3RUMA 1JW1A 4QSEA 3V8XB 2DP8A 2DXYA 3U92A 3FVGA 2O1LA 3BKIB 3M8UA 5A5XA 5IAIA 1SW1A 2XX8A 3C33A 3LUYA 4F1YA 1VE4A 4NWDA 1QKAA 2E0SA 1ATGA 1MQJA 1N7XA 2P2AA 2HCAA 2NOOA 3A09A 1UQWA 3LSLA 1OVTA 4FECA 1TXFA 2REGA 4GD5A 4IY6A 1A8EA 1MY2A 1LAHE 2GHBA 3K6XA 4KPTA 4OYVA 3IO4A 4G4PA 2PVUA 3MZ1A 4LZ5A 5B70A 5J1DA 1WVJA 1IUDA 1XT8A 2VGQA 1B7HA 3FJ7A 3H6VA 3PMVA 4G68C 3TPAA 5I57A 3G3FA 2YPNA 1H43A 4GRKA 3S9MC 2UVHA 3RT8A 4AQ4A 1MM7A 3GXAA 4NF6A 3H7MA 3K0VA 5ELVA 5I2NB 2RINA 4Q30B 1B5JA 3T9XB 1GTKA 2D21A 4ELOA 4BDNA 4E0WA 3KN3A 3TQLA 5B7DA 1D3KA 2O84X 5DVJA 2OLBA 1B2HA 3O29A 4XIGQ 2H99A 3KZGA 1TFDA 1VR5A 4KQPA 3IK6B 4IO3A 3TCGA 2PBWA 4XKPA 3IOTA 4F3BA 4DXUA 3CFXA 3VLWA 2ONSA 4U1OA 2Z23A 4LVQA 1S7YA 4H8JA 1NNKA 1SW4A 3PUZE 4WXJA 1M5FA 3I3VA 1FQBA 1PB7A 3F11A 1URSA 4GXSB 5CMMA 4HW8A 3QUFA 3RNNA 3B6QA 2OWSA 5AE4A 2F78A 4QFKA 4DIGA 4R9FA 3G3GA 4FE8A 2F5XA 3OO6A 4KYSA 4GL0A 3Q29A 2NVUB 3R7XA 1P1UA 1MXWA 2GHAA 3H6TA 2PT2A 2QRYA 4G77A 4GFRA 4Q0CA 3BBRA 1LFHA 2HFBA 4IY5A 1OMPA 5AA1A 3VE1B 1OIBA 4ZS9A 3S2VA 2R9JA 3H3GA 5H8FA 3IJOB 2HXWA 3ILTB 3PD8A 5CRYA 3N94A 3W9WA 3K6VA 3MZBA 4ELRA 4ZEDA 1A99A 5H8HB 3ZKLA 3S4UA 3UGWA 4N6PA 4M4GA 3U1OA 2OWTA 1B5HA 1P1NA 1B40A 5BWJA 4BDLA 3MJNA 3PD9A 3RLFE 4EF1A 1B58A 3K01A 3DP8A 2HEUA 1BIYA 2ZYKA 4ELQA 4ELPA 1RYXA 1UTHA 2FA7A 1NNTA 1QW0A 3DP4A 3O6IA 3PUVE 1Y3NA 4GOTA 3FVOA 4HCWA 5FHMA 2OJTA 4YB7A 1WODA 5K2XA 3QAXA 3U93A 1N3WA 1EZOA 1SW2A 3O9PA 1DPPA 3O66A 3EHTA 3KJ7A 4E0XA 4F2OA 1H45A 1BTJA 1Y4TA 2QMXA 1QVSA 4YMAA 4THIA 3PPRA 2I49A 3S9NC 2Y7WA 1A54A 1AIVA 5I56A 5I59B 3T96B 1Z7NE 1XOCA 2X7PA 2DE2A 3MVZA 1OQHA 3OXNA 1SI0A 3S9LC 3A3CA 3TAJA 3KSXA 4NF4A 4LQ2A 4OVJA 4Q8RA 3TELA 5DVIA 3QUJA 4XTCQ 3OSRA 4QF9A 5I56B 4U1ZA 4Q5TA 4F22A 2D5WA 2KLFA 1MXYA 2UXAA 4RPOA 3SERA 3T9HB 3M3LA 1SI1A 3JYRA 1B3EA 1MQDA 2ZNTA 3KJTA 4XKRA 3RGYA 2XX9A 2XXQA 4X1DA 3TODA 3E4RA 3FJGA 1B05A 4KCDA 2ZNUA 2XXRA 3HV1A 3CG1A 3IB1A 1PEBA 3KEIA 4U4XA 3SKPA 4TQUQ 3UN6A 1B0LA 1GR2A 3PPOA 1JNFA 1MY3A 1PB9A 4GVOA 3IOUA 4RPNA 4QHQA 3C31A 3H06B 4O3BA 4PE5B 2G29A 4JDFA 4U21A 3VVFA 4F29A 3VFJA 2VD3A 2DYXA 4UA8A 3IB0A 3ZSFA 2BJJX 4F1VA 4PFYA 3MUQA 3LSXA 1MRPA 4NF5A 1AOVA 1ZTYA 1ZKBA 4YZZA 4DXBA 1PBPA 1ZMGA 3I6VA 4EDPA 2B3FA 1LGBC 3IORA 1GV8A 4POXA 2F35A 5CM6A 2Z8DA 3K1NA 4MFIA 5L9OA 3Q28A 4PQJA 1OLAA 4EQBA 4H5FA 1FTJA 2XD3A 3PU5A 4EXLA 3LSFB 1MDQA 3QK6A 5KZTA 1JW5A 3O6GA 3RQTA 2XXYA 1B3HA 1DPEA 3E13X 4NF5B 2DVZA 1MY0A 3H4ZA 2ZYNA 3VVEA 3BFTA 1VFEA 3KGCA 3T9UA 4X1BA 5H8SA 4IO4A 5CMBA 1N84A 4WKMA 3ONMA 2AL5A 3SDFA 1KWHA 5CBSA 4QFLA 1LBCA 2YLNA 1B6HA 4WEDA 1P1WA 4GXAA 1SQYA 2O6AA 2I3VA 2XXUA 3HHGA 1MQGA 4JXIA 1JQFA 4QSDA 4R9GA 1FTMA 3HO7A 1QUJA 1DOTA 1L5TA 2RF1A 3PPQA 5JTYB 1Y3PA 1DSNA 2H25A 4DCYA 2A5TB 4AB6A 5M2VA 3W15C 5TP9B 1B32A 5KDTB 5ISUA 3L6HA 5CMKA 1QJMA 1PDAA 1ZU0A 2OCUA 3D4CA 1B5IA 4BDMA 1SBPA 5DVFA 2ONKE 2DSFA 4ND9A 4BDQA 1MXVA 2F97A 1ZLQA 1DTZA 5I58B 2V3UA 4UACA 3OD7A 3K1MA 1USYH 4OEUA 3IAZA 2Y7IA 3ILUB 2IA4A 1Q35A 2XXPA 4H67A 4F18A 5I2NA 2Y84A 4TLMB 5KDTA 1OVBA 3ZKKA 3EHSA 2F34A 2F6PA 2V93A 3HN0A 3Q27A 1LAFE 4ONYA 3C34A 4G8NA 5H8QA 5EHSA 5AA4B 1VSOA 3D4GA 3TCFA 1ZJLA 1MDP1 3JV9A 4OZ9A 2ABHA 1D9VA 3PUXE 4R72A 3K6UA 3G3HA 4GQOA 1RYOA 2O51A 3PUWE 1B3GA 4OFJA 5JEIA 2P0SA 4IO2A 1LCTA 1B1XA 1A55A 4EQ7A 1MS7A 5TPAB 1IITA 2XXHA 3CFLA 4XXUA 2LAOA 3GLBA 4RYAA 1JW4A 3USDA 2F36A 3THIA 1LB8A 4F19A 1MQHA 1MH3A 2DE4A 3C4MA 3FUZA 4IO5A 4PP0A 4X48A 3U94A 3UK4A 1OLCA 3WAEA 1Y4CA 1I6BA 1LSTA 2ONRA 3SEUA 2QS3A 1B4ZA 4WEPA 1LAGE 3P7IA 4K3FA 3KN8A 4H1XA 1R9LA 1DTGA 2HQ0A 2NXOA 3KN7A 4KFQA 2V3QA 2D3IA 3MBPA 4ECFA 3CG3A 2QPQA 2Q9TA 2VOZA 1UTBB 1MXZA 3E3KA 3RN8A 3CRBA 1P1OA 4R2BA 3V5AA 5JK4A 4H8IA 2O1MA 4YAHX 3K1PA 4RY1A 4YMBA 3FV1A 5IKBA 4F2QA 1MH4A 4GLIA 4YU0A 4C0RA 2FNCA 2ZXTA 3C9HA 3RTFB 1TFAA 4JSOA 4NF8B 4ZEKA 5JTYA 3UP9A 3TFLA 1B7UA 2PX1A 4I8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A8F A;  4QFN A;  2O69 A;  1SW5 A;  3CI8 A;  2THI A;  1Y3Q A;  3FXQ A;  4FEB A;  4FAT A;  3N6T A;  2PYY A;  3GBA A;  1ELJ A;  3HPI A;  4YKI A;  1R6Z A;  1N04 A;  2DS9 A;  4OFL A;  4PFT A;  3IO6 A;  3T9V A;  5AA2 D;  3FIR A;  3S9E A;  1GVC A;  1Q1K A;  2VD2 A;  3E9X A;  3TQW A;  1H44 A;  4G8M A;  5LOM A;  2Q88 A;  5AA3 A;  5HPQ A;  1PBQ A;  4FIM A;  5DYH A;  1R9Q A;  4GWO A;  5DEX A;  5I84 A;  1SYH A;  3OMB A;  2ALU A;  4H6D A;  3TZA A;  4YB6 A;  2O68 A;  2RCB A;  3LR1 A;  3HCQ A;  1FTO A;  1P99 A;  2QSX A;  3FXU A;  2ZNS A;  3C35 A;  3PPN A;  3CIJ A;  1HSE A;  4RNS A;  1YAE A;  2AL4 A;  5I2K A;  3TTR A;  4OER A;  4IGR A;  4KD5 A;  2REJ A;  2Q2A A;  3CVG A;  4R6H A;  1XHY A;  5AA2 B;  3FJM A;  3K4U A;  3RY3 A;  5A5X B;  4HS7 A;  5TPA A;  1MY4 A;  2I4C A;  1LB9 A;  3DP6 A;  4MLQ A;  5TP9 A;  1BKA A;  2Q89 A;  4N07 A;  3SEV A;  3TTM A;  4DE8 A;  5ICT A;  1LFI A;  2Q8J A;  1JVY A;  1I6Q A;  1SD3 A;  1SVX B;  2FYI A;  3IOW A;  3TKD A;  4ESW A;  3MWB A;  4DCX A;  3TTN A;  4DLD A;  1CE2 A;  2UVI A;  2XX7 A;  3CSB A;  1O63 A;  2ESN A;  1M5E A;  2XXX A;  3C32 A;  2GH9 A;  3K00 A;  3N5L A;  1YCJ A;  3VDF A;  1XVY A;  3QSL A;  2GRV A;  3O6H A;  2NUV A;  2R6G E;  3Q25 A;  4IB2 A;  4NMY A;  2XHD A;  1B52 A;  2H98 A;  4GF8 A;  4ZDM A;  4BDO A;  4DXC A;  3H03 A;  3BFU A;  3TDJ A;  5ITP A;  5KCJ B;  3FVN A;  3TTK A;  4BDR A;  3MPL A;  1US5 A;  1JEV A;  3FZV A;  3M3F A;  3OEK A;  2DXR A;  5H8Q B;  3T66 A;  3LBS A;  4OFO A;  4F3G A;  5AA4 A;  3O97 A;  4I1D A;  3EN3 A;  1WDN A;  3OEL A;  5L9S A;  5DTB A;  3OO7 A;  1ANF A;  3PPP A;  2AYS A;  3KG2 A;  4ZEF A;  3MC2 A;  1EZ9 A;  4R2F A;  1J1N A;  1O64 A;  1EU8 A;  1SDX A;  4NF8 A;  4ZEB A;  3V83 A;  4JB7 A;  1USY E;  3U8Q A;  3QYT A;  5H8F B;  1OQG A;  1FCK A;  3R6U A;  2RKM A;  2Z8F A;  2F7C A;  2DVC A;  3MAM A;  3DM0 A;  2IEE A;  2B65 A;  2Z22 A;  1MXU A;  4H65 A;  1IXI A;  4OEV A;  4MF3 A;  4XKQ A;  3B6W A;  4TLL B;  1Z7M E;  4O3A A;  2UYE A;  3EF7 A;  3FAS A;  4JWO A;  1IZ1 A;  4LON B;  1MG1 A;  4OET A;  2B3B A;  4PFU A;  5I59 A;  5FTH A;  3MZ9 A;  3VVD A;  4HTG A;  2OZZ A;  3TEP A;  1UTH B;  3VLV A;  4POW A;  4JSD A;  2HZL A;  3PMX A;  5F7V A;  4OWD A;  1B0H A;  4YIC A;  4ZE8 A;  2VP1 A;  4EUO A;  2ZYO A;  3MVX A;  3B6T A;  1B3L A;  2I4B A;  3PUY E;  1DMB A;  1BP5 A;  1M5D A;  4ZZA A;  3MP6 A;  1NH8 A;  1QKB A;  3GBB A;  3MQ9 A;  4MH5 A;  3TYH A;  4DDD A;  5L9M A;  2CMO A;  1F9B A;  2QS4 A;  1PC3 A;  3MW0 A;  4NF6 B;  1FTL A;  1QUK A;  2O7I A;  3MP1 A;  4ZE9 A;  1IEJ A;  1FQC A;  4U23 A;  1B46 A;  1Y20 A;  3H6U A;  5HM4 B;  3JZJ A;  3G3J A;  4QFO A;  1NFT A;  3KOT A;  4RK2 A;  2VHA A;  4YKJ A;  1A40 A;  2UVG A;  2DWJ A;  1AMF A;  2NWJ A;  4EF2 A;  1LAX A;  2DWA A;  5CBR A;  2XXT A;  1QUI A;  1B1H A;  2ANJ A;  3K6W A;  3KSJ A;  4OEN A;  3SET A;  1B9J A;  3FAT A;  1FQE A;  3I5O A;  4QFP A;  4C1T A;  1EZP A;  2RC7 A;  2R71 A;  5I57 B;  2HAV A;  1NNF A;  2QMW A;  1LLS A;  3SEY A;  1A7L A;  2PMS A;  1JVX A;  4LAT A;  4R74 A;  5ITO A;  3SEX A;  3TUS A;  2I48 A;  2I6E A;  3SEW A;  3VXC A;  1EH3 A;  4P0G A;  3OO8 A;  2WKY A;  4EQ9 A;  1MPD A;  5KCJ A;  3IOV A;  3VXB A;  1ZIU A;  5FHO A;  1AH5 A;  2A5T A;  4JWX A;  4PET A;  4YB5 A;  5L8D A;  1PB8 A;  2V84 A;  1UIU A;  1FQF A;  4H5G A;  4ZZE A;  4IGT A;  4DZ1 A;  4M1V A;  3UOR A;  2F7B A;  1URD A;  4ISU A;  4I9D A;  1N0T A;  1N7W A;  2Y7R A;  3OO9 A;  1HSJ A;  4G68 B;  3KOS A;  2V25 A;  2X26 A;  1IXG A;  1M5B A;  2UYF A;  2RCA A;  4TOZ A;  3GZG A;  4R73 A;  2P1S A;  3EPE A;  3O2A A;  4NWC A;  5CMC A;  5H8N A;  2RC9 A;  1H3D A;  3IX1 A;  3FVK A;  1B7Z A;  3MP8 A;  4HCY A;  2G93 A;  4QSC A;  4U2R A;  5DT6 A;  1T0K A;  3T93 B;  1MPC A;  3OSQ A;  4FJP A;  1R1N A;  4G68 A;  1POT A;  2H4I A;  2QS2 A;  4OXV A;  4F1U A;  4RJZ A;  4NF4 B;  3R26 A;  1MPB A;  1I69 A;  1NNP A;  2ZYM A;  4LZ7 A;  1XS5 A;  2XXW A;  5F1Q A;  4F31 B;  2OBG A;  2QS1 A;  3FXR A;  1NH7 A;  4PFW A;  3VLU A;  1S50 A;  4H0W A;  4O3C A;  2ZMB A;  3TMG A;  4GL8 A;  1YPN A;  3L6G A;  4NED A;  4AB5 A;  3SES A;  1IIW A;  2DWH A;  1MXX A;  3IB2 A;  4FED A;  2DE3 A;  1FTK A;  2I58 A;  4KCC A;  4XKN A;  1H76 A;  2F6G A;  3B7D A;  4ZEI A;  3TTL A;  3UA8 A;  1D4N A;  3IL1 B;  2DQV A;  1NMU A;  2PT1 A;  2Y7P A;  3CSG A;  3MVY A;  3QIM A;  4RXL A;  3CFZ A;  4EXK A;  4JBZ A;  2W7Y A;  5CC2 A;  1IXH A;  2Q2C A;  4G2Z A;  5HBC A;  2I3W A;  3QXM A;  4MLV A;  3FV2 A;  1N3X A;  4Z0I A;  3EQ1 A;  2Z8E A;  3TCH A;  4C1U A;  4IO6 A;  4ESX A;  3C36 A;  1LFG A;  1TT1 A;  1SYI A;  1ZBM A;  2A5S A;  3G3I A;  4OES A;  3M3K A;  3RTW B;  5BUU A;  5DEX B;  4KR5 A;  3CR9 A;  1MY1 A;  2RC8 A;  1US4 A;  4KI0 E;  2XXV A;  1UTB A;  1JET A;  1NL5 A;  1Y9U A;  3A3U A;  4R75 A;  5EYF A;  2YJP A;  1CB6 A;  4KYE A;  4OQO A;  2HZK A;  3PMW A;  4RA1 A;  1UIV A;  3UIF A;  4JWY A;  2DWI A;  2Y7K A;  1Y1M A;  3ECR A;  3LC8 A;  1URG A;  3O28 A;  1VFD A;  3T22 A;  4LA9 A;  3OEN A;  3OOA A;  4F39 A;  4F3S A;  4NTL A;  4R6Y A;  3FD3 A;  1BLF A;  3G3K A;  1M5C A;  4IO7 A;  1I6A A;  5AA2 A;  3K02 A;  5FTI A;  3FGS A;  2QL3 A;  3OEM A;  4MBP A;  4OHN A;  1MQI A;  3KBR A;  4FAJ A;  2V3T A;  1GGG A;  1IXC A;  1NKX A;  1JEU A;  2DOJ A;  4X9T A;  5CI5 A;  1B4H A;  2F7A A;  3K2D A;  3DEL B;  4NE4 A;  5K2Y A;  2X7Q A;  1FW0 A;  4OMB A;  1Y1Z A;  1II5 A;  3DLN A;  4RK9 A;  1B3F A;  3G7W A;  3RT6 B;  1O7T A;  3V89 B;  4ZEC A;  5ICQ A;  2UVJ A;  4KHZ E;  3PV0 E;  3HST A;  3LSW A;  1D9Y A;  5H8N B;  1AL3 A;  2M8C A;  4QRZ A;  3RPW A;  4LP2 B;  1XVX A;  3MPK A;  4OTE A;  1LBB A;  1B51 A;  1FQA A;  4LUB A;  3EHU A;  3IJX B;  3KFM A;  5TU0 A;  1S9T A;  4G8H A;  2CZL A;  2XD2 A;  4BLA A;  4U22 A;  3ZS6 A;  2I0B A;  2O7U A;  3N26 A;  5I2K B;  3U72 A;  1TWY A;  1LCF A;  2HAU A;  4R6K A;  3H6W A;  4U4S A;  4YKP A;  3WAF A;  1IQ7 A;  4LZ8 A;  1HSL A;  3IR1 A;  4P0I A;  1QUL A;  2E1S A;  4L17 A;  2QJE A;  4Z7E A;  4N13 A;  4I62 A;  3MVW A;  4GIZ A;  2AIX A;  1MM6 A;  1N76 A;  3AXF A;  1RKM A;  4P11 A;  5H8H A;  3W9V A;  4F3P A;  1FQD A;  1POY 1;  5I58 A;  3VV5 A;  4YKK A;  1P1Q A;  3PGF A;  2OK2 A;  2H5Y A;  2XXI A;  3N6U A;  1XC1 A;  2H9B A;  2F8D A;  3ODB A;  1YTV A;  3HHF A;  3Q26 A;  5FHN A;  4FOR A;  2I0C A;  2GFE A;  4LQ5 A;  5EHM A;  4KYD A;  3RUM A;  1JW1 A;  4QSE A;  3V8X B;  2DP8 A;  2DXY A;  3U92 A;  3FVG A;  2O1L A;  3BKI B;  3M8U A;  5A5X A;  5IAI A;  1SW1 A;  2XX8 A;  3C33 A;  3LUY A;  4F1Y A;  1VE4 A;  4NWD A;  1QKA A;  2E0S A;  1ATG A;  1MQJ A;  1N7X A;  2P2A A;  2HCA A;  2NOO A;  3A09 A;  1UQW A;  3LSL A;  1OVT A;  4FEC A;  1TXF A;  2REG A;  4GD5 A;  4IY6 A;  1A8E A;  1MY2 A;  1LAH E;  2GHB A;  3K6X A;  4KPT A;  4OYV A;  3IO4 A;  4G4P A;  2PVU A;  3MZ1 A;  4LZ5 A;  5B70 A;  5J1D A;  1WVJ A;  1IUD A;  1XT8 A;  2VGQ A;  1B7H A;  3FJ7 A;  3H6V A;  3PMV A;  4G68 C;  3TPA A;  5I57 A;  3G3F A;  2YPN A;  1H43 A;  4GRK A;  3S9M C;  2UVH A;  3RT8 A;  4AQ4 A;  1MM7 A;  3GXA A;  4NF6 A;  3H7M A;  3K0V A;  5ELV A;  5I2N B;  2RIN A;  4Q30 B;  1B5J A;  3T9X B;  1GTK A;  2D21 A;  4ELO A;  4BDN A;  4E0W A;  3KN3 A;  3TQL A;  5B7D A;  1D3K A;  2O84 X;  5DVJ A;  2OLB A;  1B2H A;  3O29 A;  4XIG Q;  2H99 A;  3KZG A;  1TFD A;  1VR5 A;  4KQP A;  3IK6 B;  4IO3 A;  3TCG A;  2PBW A;  4XKP A;  3IOT A;  4F3B A;  4DXU A;  3CFX A;  3VLW A;  2ONS A;  4U1O A;  2Z23 A;  4LVQ A;  1S7Y A;  4H8J A;  1NNK A;  1SW4 A;  3PUZ E;  4WXJ A;  1M5F A;  3I3V A;  1FQB A;  1PB7 A;  3F11 A;  1URS A;  4GXS B;  5CMM A;  4HW8 A;  3QUF A;  3RNN A;  3B6Q A;  2OWS A;  5AE4 A;  2F78 A;  4QFK A;  4DIG A;  4R9F A;  3G3G A;  4FE8 A;  2F5X A;  3OO6 A;  4KYS A;  4GL0 A;  3Q29 A;  2NVU B;  3R7X A;  1P1U A;  1MXW A;  2GHA A;  3H6T A;  2PT2 A;  2QRY A;  4G77 A;  4GFR A;  4Q0C A;  3BBR A;  1LFH A;  2HFB A;  4IY5 A;  1OMP A;  5AA1 A;  3VE1 B;  1OIB A;  4ZS9 A;  3S2V A;  2R9J A;  3H3G A;  5H8F A;  3IJO B;  2HXW A;  3ILT B;  3PD8 A;  5CRY A;  3N94 A;  3W9W A;  3K6V A;  3MZB A;  4ELR A;  4ZED A;  1A99 A;  5H8H B;  3ZKL A;  3S4U A;  3UGW A;  4N6P A;  4M4G A;  3U1O A;  2OWT A;  1B5H A;  1P1N A;  1B40 A;  5BWJ A;  4BDL A;  3MJN A;  3PD9 A;  3RLF E;  4EF1 A;  1B58 A;  3K01 A;  3DP8 A;  2HEU A;  1BIY A;  2ZYK A;  4ELQ A;  4ELP A;  1RYX A;  1UTH A;  2FA7 A;  1NNT A;  1QW0 A;  3DP4 A;  3O6I A;  3PUV E;  1Y3N A;  4GOT A;  3FVO A;  4HCW A;  5FHM A;  2OJT A;  4YB7 A;  1WOD A;  5K2X A;  3QAX A;  3U93 A;  1N3W A;  1EZO A;  1SW2 A;  3O9P A;  1DPP A;  3O66 A;  3EHT A;  3KJ7 A;  4E0X A;  4F2O A;  1H45 A;  1BTJ A;  1Y4T A;  2QMX A;  1QVS A;  4YMA A;  4THI A;  3PPR A;  2I49 A;  3S9N C;  2Y7W A;  1A54 A;  1AIV A;  5I56 A;  5I59 B;  3T96 B;  1Z7N E;  1XOC A;  2X7P A;  2DE2 A;  3MVZ A;  1OQH A;  3OXN A;  1SI0 A;  3S9L C;  3A3C A;  3TAJ A;  3KSX A;  4NF4 A;  4LQ2 A;  4OVJ A;  4Q8R A;  3TEL A;  5DVI A;  3QUJ A;  4XTC Q;  3OSR A;  4QF9 A;  5I56 B;  4U1Z A;  4Q5T A;  4F22 A;  2D5W A;  2KLF A;  1MXY A;  2UXA A;  4RPO A;  3SER A;  3T9H B;  3M3L A;  1SI1 A;  3JYR A;  1B3E A;  1MQD A;  2ZNT A;  3KJT A;  4XKR A;  3RGY A;  2XX9 A;  2XXQ A;  4X1D A;  3TOD A;  3E4R A;  3FJG A;  1B05 A;  4KCD A;  2ZNU A;  2XXR A;  3HV1 A;  3CG1 A;  3IB1 A;  1PEB A;  3KEI A;  4U4X A;  3SKP A;  4TQU Q;  3UN6 A;  1B0L A;  1GR2 A;  3PPO A;  1JNF A;  1MY3 A;  1PB9 A;  4GVO A;  3IOU A;  4RPN A;  4QHQ A;  3C31 A;  3H06 B;  4O3B A;  4PE5 B;  2G29 A;  4JDF A;  4U21 A;  3VVF A;  4F29 A;  3VFJ A;  2VD3 A;  2DYX A;  4UA8 A;  3IB0 A;  3ZSF A;  2BJJ X;  4F1V A;  4PFY A;  3MUQ A;  3LSX A;  1MRP A;  4NF5 A;  1AOV A;  1ZTY A;  1ZKB A;  4YZZ A;  4DXB A;  1PBP A;  1ZMG A;  3I6V A;  4EDP A;  2B3F A;  1LGB C;  3IOR A;  1GV8 A;  4POX A;  2F35 A;  5CM6 A;  2Z8D A;  3K1N A;  4MFI A;  5L9O A;  3Q28 A;  4PQJ A;  1OLA A;  4EQB A;  4H5F A;  1FTJ A;  2XD3 A;  3PU5 A;  4EXL A;  3LSF B;  1MDQ A;  3QK6 A;  5KZT A;  1JW5 A;  3O6G A;  3RQT A;  2XXY A;  1B3H A;  1DPE A;  3E13 X;  4NF5 B;  2DVZ A;  1MY0 A;  3H4Z A;  2ZYN A;  3VVE A;  3BFT A;  1VFE A;  3KGC A;  3T9U A;  4X1B A;  5H8S A;  4IO4 A;  5CMB A;  1N84 A;  4WKM A;  3ONM A;  2AL5 A;  3SDF A;  1KWH A;  5CBS A;  4QFL A;  1LBC A;  2YLN A;  1B6H A;  4WED A;  1P1W A;  4GXA A;  1SQY A;  2O6A A;  2I3V A;  2XXU A;  3HHG A;  1MQG A;  4JXI A;  1JQF A;  4QSD A;  4R9G A;  1FTM A;  3HO7 A;  1QUJ A;  1DOT A;  1L5T A;  2RF1 A;  3PPQ A;  5JTY B;  1Y3P A;  1DSN A;  2H25 A;  4DCY A;  2A5T B;  4AB6 A;  5M2V A;  3W15 C;  5TP9 B;  1B32 A;  5KDT B;  5ISU A;  3L6H A;  5CMK A;  1QJM A;  1PDA A;  1ZU0 A;  2OCU A;  3D4C A;  1B5I A;  4BDM A;  1SBP A;  5DVF A;  2ONK E;  2DSF A;  4ND9 A;  4BDQ A;  1MXV A;  2F97 A;  1ZLQ A;  1DTZ A;  5I58 B;  2V3U A;  4UAC A;  3OD7 A;  3K1M A;  1USY H;  4OEU A;  3IAZ A;  2Y7I A;  3ILU B;  2IA4 A;  1Q35 A;  2XXP A;  4H67 A;  4F18 A;  5I2N A;  2Y84 A;  4TLM B;  5KDT A;  1OVB A;  3ZKK A;  3EHS A;  2F34 A;  2F6P A;  2V93 A;  3HN0 A;  3Q27 A;  1LAF E;  4ONY A;  3C34 A;  4G8N A;  5H8Q A;  5EHS A;  5AA4 B;  1VSO A;  3D4G A;  3TCF A;  1ZJL A;  1MDP 1;  3JV9 A;  4OZ9 A;  2ABH A;  1D9V A;  3PUX E;  4R72 A;  3K6U A;  3G3H A;  4GQO A;  1RYO A;  2O51 A;  3PUW E;  1B3G A;  4OFJ A;  5JEI A;  2P0S A;  4IO2 A;  1LCT A;  1B1X A;  1A55 A;  4EQ7 A;  1MS7 A;  5TPA B;  1IIT A;  2XXH A;  3CFL A;  4XXU A;  2LAO A;  3GLB A;  4RYA A;  1JW4 A;  3USD A;  2F36 A;  3THI A;  1LB8 A;  4F19 A;  1MQH A;  1MH3 A;  2DE4 A;  3C4M A;  3FUZ A;  4IO5 A;  4PP0 A;  4X48 A;  3U94 A;  3UK4 A;  1OLC A;  3WAE A;  1Y4C A;  1I6B A;  1LST A;  2ONR A;  3SEU A;  2QS3 A;  1B4Z A;  4WEP A;  1LAG E;  3P7I A;  4K3F A;  3KN8 A;  4H1X A;  1R9L A;  1DTG A;  2HQ0 A;  2NXO A;  3KN7 A;  4KFQ A;  2V3Q A;  2D3I A;  3MBP A;  4ECF A;  3CG3 A;  2QPQ A;  2Q9T A;  2VOZ A;  1UTB B;  1MXZ A;  3E3K A;  3RN8 A;  3CRB A;  1P1O A;  4R2B A;  3V5A A;  5JK4 A;  4H8I A;  2O1M A;  4YAH X;  3K1P A;  4RY1 A;  4YMB A;  3FV1 A;  5IKB A;  4F2Q A;  1MH4 A;  4GLI A;  4YU0 A;  4C0R A;  2FNC A;  2ZXT A;  3C9H A;  3RTF B;  1TFA A;  4JSO A;  4NF8 B;  4ZEK A;  5JTY A;  3UP9 A;  3TFL A;  1B7U A;  2PX1 A;  4I8C A; 
#chains in the Genus database with same CATH topology
 1SW5 A;  3MYU A;  2THI A;  3FXQ A;  4FEB A;  3IO6 A;  5AA2 D;  3S9E A;  3ISP A;  1Q1K A;  1H44 A;  5LOM A;  5HPQ A;  4FIM A;  5DYH A;  5DEX A;  3OMB A;  2ALU A;  4P56 A;  4YB6 A;  2ZNS A;  1HSE A;  4RNS A;  4OER A;  4KD5 A;  4N6K A;  1XHY A;  1K9Z A;  4HS7 A;  5TPA A;  2I4C A;  1LB9 A;  3DP6 A;  4MLQ A;  2Q89 A;  1JVY A;  2F3D A;  3IOW A;  3TTN A;  4DLD A;  2UVI A;  2XX7 A;  3CSB A;  3N5L A;  3VDF A;  4NMY A;  4OVR A;  3O6H A;  2R6G E;  3Q25 A;  1B52 A;  3FVN A;  4MCO A;  3FZV A;  3OEK A;  3M3F A;  5H8Q B;  3LBS A;  4OFO A;  3PPP A;  4ZEF A;  4PGN A;  1EU8 A;  4NF8 A;  3V83 A;  4JB7 A;  3U8Q A;  5H8F B;  2Z8F A;  5ET8 A;  2B65 A;  1MXU A;  1Z7M E;  4O3A A;  4JWO A;  1IZ1 A;  1MG1 A;  5I59 A;  4HTG A;  2HZL A;  4YIC A;  2ZYO A;  3PUY E;  1DMB A;  1BP5 A;  1M5D A;  1QKB A;  4MH5 A;  4DDD A;  3MQ9 A;  2CMO A;  1PC3 A;  1FTL A;  1QUK A;  2O7I A;  2XWV A;  4N17 A;  1IEJ A;  2FHY A;  3H6U A;  5HM4 B;  1NFT A;  4RK2 A;  5CBR A;  1EZP A;  3FAT A;  2RC7 A;  2R71 A;  2HAV A;  4H46 A;  1LLS A;  2PMS A;  2WEF A;  3VXC A;  5KCJ A;  3VXB A;  1ZIU A;  5FHO A;  4JWX A;  4PET A;  5L8D A;  2V84 A;  4ISU A;  1HSJ A;  3GZG A;  1H3D A;  4HCY A;  4U2R A;  2G93 A;  2CZK A;  1K9Y A;  3KBZ A;  4NF4 B;  1MPB A;  2ZYM A;  4LZ7 A;  1XS5 A;  2QS1 A;  1NH7 A;  1G0I A;  1S50 A;  4O3C A;  2ZMB A;  1NI9 A;  3L6G A;  4NED A;  4O7I A;  1MXX A;  4XKN A;  2I58 A;  3CSG A;  3CFZ A;  4JBZ A;  1IXH A;  3FV2 A;  4C1U A;  3TCH A;  3EQ1 A;  5DEX B;  4ZEK A;  2XXK A;  3A3U A;  4F1V A;  1CB6 A;  2HZK A;  3PMW A;  1UIV A;  3ECR A;  2Y7K A;  3LC8 A;  1VFD A;  4LA9 A;  4F3S A;  2P3V A;  5FTI A;  2QL3 A;  1LBV A;  1MQI A;  4FAJ A;  2WYP A;  3KC1 A;  1FW0 A;  1Y1Z A;  1B3F A;  3G7W A;  3RT6 B;  4ZEC A;  5H8N B;  1AL3 A;  3RPW A;  1NV1 A;  4PDH A;  5TU0 A;  2I0B A;  5I2K B;  1LCF A;  4R6K A;  4U4S A;  4MNI A;  1HSL A;  3IR1 A;  4NAP A;  4I62 A;  4GIZ A;  1MM6 A;  4N8G A;  4F3P A;  4YKK A;  1XC1 A;  2H9B A;  3ODB A;  1YTV A;  4LQ5 A;  2DXY A;  2WYK A;  3C33 A;  1FPG A;  4NWD A;  2E0S A;  3LSL A;  1FJ6 A;  2REG A;  4OYV A;  4PDD A;  4KPT A;  2PVU A;  3MZ1 A;  1XT8 A;  1IUD A;  3PMV A;  1B7H A;  5I57 A;  1H43 A;  3S9M C;  3RT8 A;  3GXA A;  4Q30 B;  3T9X B;  4N8Y A;  3IFC A;  5B7D A;  3O29 A;  1FTA A;  2H99 A;  3KZG A;  4KQP A;  3TCG A;  4IO3 A;  3IOT A;  4F3B A;  3CFX A;  4H8J A;  3PUZ E;  3F11 A;  4GXS B;  5CMM A;  3RNN A;  5AE4 A;  2NVU B;  1MXW A;  3H6T A;  4Q0C A;  2PT2 A;  3BBR A;  5ET7 A;  1OIB A;  1JP4 A;  3H3G A;  4MEV A;  3W9W A;  4ZED A;  3S4U A;  1EYJ A;  4QXD A;  1B58 A;  4EF1 A;  3DP8 A;  1BIY A;  4ELQ A;  4ELP A;  1UTH A;  3O6I A;  4HCW A;  3PUV E;  1Y3N A;  3FVO A;  2P3N A;  5K2X A;  1N3W A;  1EZO A;  3EHT A;  1BTJ A;  2B4L A;  3PPR A;  3E78 A;  5I59 B;  4GX4 A;  1Z7N E;  1OQH A;  3S9L C;  3TAJ A;  4NF4 A;  4XTC Q;  4U1Z A;  3SER A;  4RPO A;  2Y5L A;  3JYR A;  3E4R A;  3CG1 A;  4TQU Q;  4I3E A;  4RPN A;  3H06 B;  3VVF A;  2VD3 A;  4PFY A;  3LSX A;  1ZTY A;  3I6V A;  5CM6 A;  4PQJ A;  1OLA A;  4EQB A;  3QK6 A;  5KZT A;  3O6G A;  2XXY A;  1B3H A;  5T3J A;  4PFR A;  3BFT A;  3KGC A;  5CMB A;  3ONM A;  5EQ9 A;  2YLN A;  4R9G A;  2I3V A;  4JXI A;  3HO7 A;  1L5T A;  3LV0 A;  5JTY B;  1Y3P A;  4OA4 A;  2H25 A;  3W15 C;  5ISU A;  1PDA A;  1YZ0 A;  5DVF A;  1ZLQ A;  5I58 B;  4UAC A;  4OEU A;  1USY H;  3IAZ A;  5KDT A;  2F6P A;  4QBA A;  4G8N A;  5H8Q A;  5EHS A;  4NQ8 A;  2ABH A;  4R72 A;  1NUY A;  1RYO A;  2O51 A;  4OFJ A;  2XWI A;  1A55 A;  5TPA B;  3CFL A;  1YYZ A;  3USD A;  1MH3 A;  3C4M A;  4IO5 A;  1OLC A;  3WAE A;  1LST A;  1B4Z A;  4WEP A;  1LAG E;  3P7I A;  3KN8 A;  3KN7 A;  2BJI A;  4ECF A;  2Q9T A;  2VOZ A;  3RN8 A;  1FPE A;  2XWK A;  4H8I A;  4PAI A;  3K1P A;  4RY1 A;  3FV1 A;  4F2Q A;  1MH4 A;  4GLI A;  5JTY A;  3TFL A;  1B7U A;  2PX1 A;  1A8F A;  3GBA A;  1ELJ A;  5J16 A;  4PFT A;  4OFL A;  2VD2 A;  3E9X A;  3TQW A;  2PCR A;  4HE1 A;  4GWO A;  4GWS A;  2RCB A;  3LR1 A;  3SEX A;  3S2V A;  1FTO A;  2QSX A;  4F1Y A;  5A5X A;  3CIJ A;  1VDW A;  1RDY A;  3FXB A;  4R6H A;  5AA2 B;  3RY3 A;  3SEV A;  4DE8 A;  4MHF A;  1LFI A;  1SD3 A;  1I6Q A;  4ESW A;  3MWB A;  5IGA A;  1CE2 A;  2VT5 A;  3C32 A;  4IB2 A;  2XHD A;  2H98 A;  3H03 A;  3TDJ A;  3TTK A;  2L5V A;  4GBV A;  4OVT A;  4BDR A;  1FPD A;  1WDN A;  4PFI A;  3OO7 A;  1ANF A;  3RPL B;  5I5P A;  4P1L A;  1J1N A;  1SDX A;  4ZEB A;  1USY E;  4PCD A;  2DVC A;  2Z22 A;  1IXI A;  1EYI A;  4OEV A;  4XKQ A;  3B6W A;  1YXI A;  4N15 A;  2UYE A;  3EF7 A;  3FAS A;  4OET A;  2B3B A;  4POW A;  1B0H A;  1IMD A;  2I4B A;  3MP6 A;  3GBB A;  5L9M A;  4ZE9 A;  2QS4 A;  4NF6 B;  3JZJ A;  4QFO A;  2NWJ A;  4EF2 A;  2UVG A;  1AMF A;  2DWA A;  2ANJ A;  4C1T A;  5I57 B;  2QMW A;  4OVQ A;  5ITO A;  3TUS A;  2QVU A;  1MPD A;  3IOV A;  4YB5 A;  1PB8 A;  4H5G A;  1FQF A;  4IGT A;  4DZ1 A;  2F7B A;  1IMB A;  1URD A;  3OO9 A;  4G68 B;  2V25 A;  4TOZ A;  1M5B A;  3LUZ A;  4R73 A;  5CMC A;  4FBP A;  2RC9 A;  3FVK A;  4QSC A;  1MPC A;  4FJP A;  1POT A;  2QS2 A;  1I69 A;  2XXW A;  1FBC A;  4H0W A;  1IIW A;  2DWH A;  3IB2 A;  4DI4 B;  2DE3 A;  4GWU A;  1D4N A;  2Y7P A;  3QIM A;  4RXL A;  4EXK A;  1NV3 A;  4G2Z A;  2CEX A;  4MLV A;  4Z0I A;  1N3X A;  4IO6 A;  4DXC A;  1D9Q A;  1TT1 A;  2A5S A;  4HE0 A;  1MY1 A;  2RC8 A;  1JET A;  1NL5 A;  1Y9U A;  1DBZ A;  2YJP A;  4OQO A;  2DWI A;  3FGS A;  1IXC A;  1NKX A;  2DOJ A;  3FBP A;  1B4H A;  2F7A A;  2HXR A;  4NE4 A;  3V89 B;  3SZP A;  1O7T A;  4MJO A;  4LP2 B;  1XVX A;  3KFM A;  2XD2 A;  4BLA A;  3ZS6 A;  3N26 A;  1TWY A;  2HAU A;  3H6W A;  4YKP A;  3WAF A;  4LZ8 A;  4P0I A;  4N6D A;  4N13 A;  3GYY A;  1N76 A;  1P1Q A;  3PGF A;  2OK2 A;  3TTL A;  3RUM A;  4QSE A;  3U92 A;  3FVG A;  2XX8 A;  1VE4 A;  3NOH A;  1ATG A;  1MQJ A;  1BK4 A;  1KA0 A;  4GD5 A;  4IY6 A;  1A8E A;  1MY2 A;  3K6X A;  1WVJ A;  3FJ7 A;  3TPA A;  2VGQ A;  3G3F A;  3H7M A;  1B5J A;  2D21 A;  2GQ1 A;  4BDN A;  4E0W A;  2OLB A;  1B2H A;  4XIG Q;  4XKP A;  2Z23 A;  4LVQ A;  1S7Y A;  1LBW A;  1M5F A;  1PB7 A;  4P47 A;  1G0H A;  3Q29 A;  3R7X A;  2QRY A;  4GFR A;  2HFB A;  4IY5 A;  1OMP A;  5H8F A;  3PD8 A;  3ILT B;  3N94 A;  4ELR A;  3MZB A;  5ESY A;  4JVC A;  5H8H B;  1B5H A;  1P1N A;  3PD9 A;  3K01 A;  2HEU A;  1RYX A;  1WOD A;  3QAX A;  3O9P A;  3O66 A;  4E0X A;  1H45 A;  4LN5 A;  1QVS A;  3S9N C;  4IR8 A;  1XOC A;  2DE2 A;  3TEL A;  4Q5T A;  4F22 A;  3T9H B;  3M3L A;  1MQD A;  4X1D A;  2XXQ A;  4U4X A;  1GR2 A;  1PB9 A;  4F29 A;  4UA8 A;  2BJJ X;  1MRP A;  1ZKB A;  4YZZ A;  4EDP A;  2B3F A;  1GV8 A;  4POX A;  2Z8D A;  4MFI A;  4OVP A;  5L9O A;  4N81 A;  2XD3 A;  3LSF B;  1INP A;  3RQT A;  4NF5 B;  1MY0 A;  3VVE A;  4X1B A;  5H8S A;  1N84 A;  4WKM A;  2AL5 A;  1KWH A;  1DCU A;  4GX6 A;  4WED A;  4MX6 A;  3D1R A;  1P1W A;  2O6A A;  3QMF A;  1QUJ A;  2CZI A;  1NV4 A;  2RF1 A;  1DSN A;  2A5T B;  4AB6 A;  5M2V A;  1FPB A;  5ET5 A;  2PFY A;  1ZU0 A;  2OCU A;  1B5I A;  4BDM A;  4BDQ A;  2F97 A;  3OD7 A;  4F18 A;  2Y84 A;  3EHS A;  2V93 A;  3HN0 A;  5AA4 B;  1VSO A;  1ZJL A;  1MDP 1;  3K6U A;  4GQO A;  4NN3 A;  5JEI A;  2XXH A;  2F36 A;  1LB8 A;  4PP0 A;  4NHB A;  4KFQ A;  1R9L A;  2V3Q A;  3MBP A;  3CG3 A;  4DI3 D;  1P1O A;  4H45 A;  4YMB A;  4YU0 A;  3C9H A;  4I8C A;  2O69 A;  4MAG A;  4PBQ A;  4FAT A;  3N6T A;  3HPI A;  4YKI A;  1R6Z A;  3T9V A;  3BIH A;  2ZZV A;  5AA3 A;  1PBQ A;  1R9Q A;  5I84 A;  1P99 A;  3PPN A;  3C35 A;  1YAE A;  2AL4 A;  5I2K A;  3TTR A;  4IGR A;  2R8T A;  2Q2A A;  2REJ A;  3CVG A;  3FJM A;  3K4U A;  5A5X B;  1MY4 A;  1FBD A;  5TP9 A;  1BKA A;  3TTM A;  2Q8J A;  3TKD A;  1SVX B;  3PTY A;  3K1M A;  1M5E A;  3K00 A;  1YCJ A;  3QSL A;  2GRV A;  4EXL A;  2NUV A;  4ZDM A;  4BDO A;  4GF8 A;  4UAB A;  1JEV A;  4N91 A;  3O97 A;  4I1D A;  4G61 A;  3OEL A;  5DTB A;  4XEQ A;  3KG2 A;  1EZ9 A;  1O64 A;  1LEV A;  4AS5 A;  1FCK A;  2RKM A;  4MNC A;  2F7C A;  3MAM A;  3DM0 A;  4PFB A;  5ET6 A;  4PFU A;  3IFA A;  3VVD A;  2OZZ A;  2WBD A;  1UTH B;  3VLV A;  4JSD A;  3PMX A;  4ZE8 A;  4EUO A;  2VP1 A;  3MVX A;  4GWY A;  2JJK A;  4ZZA A;  4P9K A;  3TYH A;  1NH8 A;  1F9B A;  3MW0 A;  1FQC A;  4MIJ A;  4GWX A;  1Y20 A;  4YKJ A;  1QUI A;  4QFP A;  4X04 A;  3SEY A;  1JVX A;  4LAT A;  3SEW A;  1FPK A;  1EH3 A;  4EQ9 A;  2WKY A;  5EYG A;  2A5T A;  4ZZE A;  4M1V A;  4I9D A;  1N0T A;  1N7W A;  2Y7R A;  3KOS A;  1IXG A;  2RCA A;  2P1S A;  2B4M A;  3MP8 A;  5DT6 A;  3OSQ A;  4G68 A;  2FIX A;  4OXV A;  4RJZ A;  5F1Q A;  2VPN A;  2OBG A;  3FXR A;  4PFW A;  3VLU A;  4GL8 A;  1YPN A;  1LBY A;  4XFE A;  4ZEI A;  3UA8 A;  3B7D A;  1NMU A;  4GX3 A;  4P1E A;  2W7Y A;  5HBC A;  2I3W A;  3QXM A;  2Z8E A;  4ESX A;  1LFG A;  4OES A;  1FSA A;  2XXV A;  4OVS A;  4R75 A;  5EYF A;  4RA1 A;  1Y1M A;  1URG A;  3OOA A;  4F39 A;  4R6Y A;  1BLF A;  3G3K A;  4IO7 A;  3OEM A;  2V3T A;  5CI5 A;  3DEL B;  4OMB A;  1II5 A;  4O94 A;  3DLN A;  4RK9 A;  2UVJ A;  3PV0 E;  1D9Y A;  2M8C A;  3MPK A;  4OTE A;  1LBB A;  1B51 A;  1FQA A;  4LUB A;  3EHU A;  1S9T A;  4G8H A;  2O7U A;  3U65 A;  3U72 A;  3ROJ A;  1CNQ A;  1QUL A;  2E1S A;  4L17 A;  2QJE A;  4Z7E A;  3B8B A;  3MVW A;  5H8H A;  2AIX A;  2WX9 A;  5I58 A;  1POY 1;  3VV5 A;  2XXI A;  3N6U A;  3HHF A;  3Q26 A;  5FHN A;  2Y5K A;  4FOR A;  2GFE A;  4KYD A;  1JW1 A;  3M8U A;  2HPG A;  1N7X A;  4MBP A;  4NF5 A;  4FEC A;  1TXF A;  1LAH E;  5J1D A;  5B70 A;  3H6V A;  2YPN A;  2UVH A;  4AQ4 A;  3K0V A;  2RIN A;  1GTK A;  3KN3 A;  1QGX A;  1TFD A;  1VR5 A;  3IK6 B;  2PBW A;  4DXU A;  3VLW A;  1NNK A;  1SW4 A;  1URS A;  3QUF A;  2XA5 A;  3B6Q A;  2OWS A;  4JVD A;  3T0J A;  4R9F A;  1IME A;  3G3G A;  3OO6 A;  4KYS A;  4GL0 A;  1P1U A;  2GHA A;  4G77 A;  2FBP A;  2HHM A;  5AA1 A;  4ZS9 A;  2R9J A;  3IJO B;  5CRY A;  3ZKL A;  4GBW A;  4M4G A;  3U1O A;  5BWJ A;  4BDL A;  3MJN A;  3RLF E;  2ZYK A;  2FA7 A;  1NNT A;  4GOT A;  4PF6 A;  5FHM A;  4YB7 A;  2ZZW A;  1SW2 A;  1DPP A;  1SPI A;  3KJ7 A;  1Q9D A;  4F2O A;  1Y4T A;  2QMX A;  4YMA A;  5I56 A;  3MVZ A;  3OXN A;  1SI0 A;  4Q8R A;  2PFZ A;  5DVI A;  4PTK A;  5I7I A;  1SI1 A;  2OWZ A;  1B3E A;  2ZNT A;  3RGY A;  1FPI A;  3FJG A;  1B05 A;  4KCD A;  2ZNU A;  1NV5 A;  5I2N B;  3KEI A;  3SKP A;  1B0L A;  1JNF A;  1MY3 A;  3IOU A;  4KXP A;  4O3B A;  4PE5 B;  2G29 A;  4JDF A;  4U21 A;  2DYX A;  3IB0 A;  3ZSF A;  3MUQ A;  5LTC A;  1PBP A;  1ZMG A;  1LGB C;  3IOR A;  3K1N A;  3Q28 A;  4H5F A;  1FTJ A;  3PU5 A;  4OAN A;  3T1B A;  1MDQ A;  5IZ1 A;  1JW5 A;  3E13 X;  1DPE A;  1RDX A;  2MKZ A;  2QFL A;  2DVZ A;  3H4Z A;  2ZYN A;  3T9U A;  4IO4 A;  5CBS A;  3SDF A;  1FBF A;  1LBC A;  4NG7 A;  4GXA A;  2XXU A;  1JQF A;  1FTM A;  1RDZ A;  1FRP A;  4DCY A;  5TP9 B;  1B32 A;  5CMK A;  3D4C A;  4ND9 A;  1MXV A;  1DTZ A;  2V3U A;  1KA1 A;  2IA4 A;  2XXP A;  5I2N A;  4TLM B;  3Q27 A;  2F34 A;  1D9V A;  3G3H A;  3PUW E;  2P0S A;  5IZZ A;  4PGP A;  1LCT A;  1B1X A;  4EQ7 A;  3CHG A;  1JW4 A;  4X8R A;  1MQH A;  3UK4 A;  2DE4 A;  4X48 A;  2Q74 A;  1Y4C A;  1I6B A;  2ONR A;  3E79 A;  4H1X A;  2NXO A;  1DTG A;  2HQ0 A;  2D3I A;  2QPQ A;  1FBH A;  1UTB B;  1MXZ A;  4P8B A;  2KQZ A;  4YAH X;  3RPL A;  5IKB A;  4JSO A;  4NF8 B;  3UP9 A;  4QFN A;  1LBZ A;  3CI8 A;  2FVZ A;  3B50 A;  1Y3Q A;  5LDZ A;  2PYY A;  1N04 A;  2DS9 A;  3FIR A;  1GVC A;  2FIE A;  3RYD A;  4G8M A;  2Q88 A;  1SYH A;  4H6D A;  3TZA A;  2O68 A;  4OWD A;  4THI A;  3HCQ A;  3FXU A;  5ICT A;  4N07 A;  2FYI A;  4DCX A;  1O63 A;  2ESN A;  2XXX A;  2GH9 A;  1XVY A;  4MMP A;  5F24 A;  3BFU A;  5ITP A;  1FBG A;  5KCJ B;  3MPL A;  1US5 A;  2DXR A;  3T66 A;  5AA4 A;  1EYK A;  4F3G A;  3EN3 A;  5L9S A;  2AYS A;  3MC2 A;  4R2F A;  3QYT A;  1OQG A;  3R6U A;  2F3B A;  2IEE A;  4H65 A;  4MF3 A;  4TLL B;  5IM2 A;  4LON B;  1FJ9 A;  4XF5 A;  5FTH A;  3MZ9 A;  1NV0 A;  3TEP A;  4JVI A;  5F7V A;  3B6T A;  1B3L A;  3MP1 A;  4U23 A;  1B46 A;  4N4U A;  3G3J A;  3KOT A;  2VHA A;  1A40 A;  2DWJ A;  1LAX A;  2XXT A;  5IZ3 B;  1B1H A;  3K6W A;  3KSJ A;  4OEN A;  3SET A;  1B9J A;  3I5O A;  1FQE A;  5EQ7 A;  1NNF A;  1A7L A;  4R74 A;  2I48 A;  2I6E A;  4P0G A;  3OO8 A;  1AH5 A;  1FPL A;  2QVR A;  1XI6 A;  1UIU A;  1NUZ A;  3UOR A;  2X26 A;  2UYF A;  3EPE A;  4NWC A;  3O2A A;  5H8N A;  3IX1 A;  1B7Z A;  1T0K A;  3T93 B;  1R1N A;  2ZZX A;  2CEY A;  2H4I A;  4F1U A;  3R26 A;  4F31 B;  1NNP A;  3TMG A;  1NV6 A;  4AB5 A;  3SES A;  4FED A;  4KCC A;  2XWO A;  1FTK A;  1H76 A;  2F6G A;  3IL1 B;  2DQV A;  2PT1 A;  3MVY A;  5CC2 A;  2Q2C A;  3C36 A;  3G3I A;  3RTW B;  1SYI A;  1ZBM A;  3M3K A;  5BUU A;  4PE3 A;  4KR5 A;  3CR9 A;  4KI0 E;  1US4 A;  1UTB A;  4KYE A;  3V8X B;  3UIF A;  4JWY A;  3O28 A;  3T22 A;  3OEN A;  4NTL A;  3FD3 A;  5AA2 A;  1M5C A;  4NX1 A;  1I6A A;  3K02 A;  5I56 B;  4OHN A;  5EQA A;  1LBX A;  3KBR A;  1GGG A;  1JEU A;  4X9T A;  1FBP A;  5K2Y A;  3K2D A;  4P3L A;  2X7Q A;  4HE2 A;  4NF0 A;  1NUW A;  5ICQ A;  4KHZ E;  3HST A;  3LSW A;  4QRZ A;  3IJX B;  2CZL A;  4U22 A;  1IQ7 A;  4P11 A;  3AXF A;  1RKM A;  3W9V A;  5I3S A;  1FQD A;  2H5Y A;  2F8D A;  2I0C A;  4PF8 A;  5EHM A;  2DP8 A;  2O1L A;  3BKI B;  5IAI A;  1SW1 A;  3LUY A;  1QKA A;  3A09 A;  2P2A A;  2HCA A;  2NOO A;  1UQW A;  1OVT A;  2GHB A;  5IZ3 A;  3IO4 A;  4G4P A;  4LZ5 A;  2DDK A;  4G68 C;  4GRK A;  5FBP A;  1MM7 A;  4NF6 A;  5ELV A;  4I3Y A;  4ELO A;  3TQL A;  1D3K A;  2O84 X;  5DVJ A;  2ONS A;  4U1O A;  4PAK A;  4O7M A;  4WXJ A;  4PBH A;  3I3V A;  1FQB A;  2KR0 A;  4HW8 A;  4O8M A;  2F78 A;  4QFK A;  4DIG A;  3HFU A;  4FE8 A;  2F5X A;  1LFH A;  3EKI A;  1NV7 A;  2HXW A;  3K6V A;  1A99 A;  3UGW A;  4N6P A;  2OWT A;  1B40 A;  1QW0 A;  3DP4 A;  2OJT A;  3U93 A;  3MST A;  4PAF A;  2I49 A;  2Y7W A;  1A54 A;  3T96 B;  2X7P A;  3A3C A;  3KSX A;  4LQ2 A;  4OVJ A;  2OX3 A;  1DK4 A;  3QUJ A;  3OSR A;  4QF9 A;  2D5W A;  2KLF A;  1MXY A;  2UXA A;  3TOD A;  3KJT A;  4XKR A;  2XX9 A;  4AS4 A;  3HV1 A;  2XXR A;  3IB1 A;  1PEB A;  3UN6 A;  3PPO A;  4GVO A;  4QHQ A;  3C31 A;  2V4C A;  1FPJ A;  1KZ8 A;  3VFJ A;  4GWZ A;  1AOV A;  4DXB A;  4I40 A;  2F35 A;  1FPF A;  4NGU A;  1FBE A;  1VFE A;  1NUX A;  2VPO A;  4QFL A;  1IMC A;  1IMF A;  5EQ8 A;  1B6H A;  1IMA A;  1SQY A;  3HHG A;  5A5L A;  1MQG A;  4QSD A;  1DOT A;  3PPQ A;  2WBB A;  5EYH A;  5KDT B;  3L6H A;  1QJM A;  1SBP A;  2ONK E;  2DSF A;  2Y7I A;  1NV2 A;  3ILU B;  1Q35 A;  4H67 A;  1OVB A;  3ZKK A;  1LAF E;  4ONY A;  3C34 A;  4GWW A;  3D4G A;  3TCF A;  3JV9 A;  4OZ9 A;  3PUX E;  2CZH A;  1B3G A;  3A29 A;  4IO2 A;  1MS7 A;  1IIT A;  4XXU A;  2LAO A;  3GLB A;  4RYA A;  4PC9 A;  3THI A;  4F19 A;  3FUZ A;  3U94 A;  3KC0 A;  3BIG A;  3SEU A;  2QS3 A;  4K3F A;  1AWB A;  5DW8 A;  2QVV A;  4MNP A;  3E3K A;  3CRB A;  4R2B A;  3V5A A;  5JK4 A;  2O1M A;  4HXV A;  2Q8M A;  1AIV A;  4C0R A;  2FNC A;  2ZXT A;  3RTF B;  1TFA A;  3VE1 B; 
#chains in the Genus database with same CATH homology
 1A8F A;  4QFN A;  2O69 A;  1SW5 A;  3CI8 A;  2THI A;  1Y3Q A;  3FXQ A;  4FEB A;  4FAT A;  3N6T A;  2PYY A;  3GBA A;  1ELJ A;  3HPI A;  4YKI A;  1R6Z A;  1N04 A;  2DS9 A;  4OFL A;  4PFT A;  3IO6 A;  3T9V A;  5AA2 D;  3FIR A;  3S9E A;  1GVC A;  1Q1K A;  2VD2 A;  3E9X A;  3TQW A;  1H44 A;  4G8M A;  5LOM A;  2Q88 A;  5AA3 A;  5HPQ A;  1PBQ A;  4FIM A;  5DYH A;  1R9Q A;  4GWO A;  5DEX A;  5I84 A;  1SYH A;  3OMB A;  2ALU A;  4H6D A;  3TZA A;  4YB6 A;  2O68 A;  2RCB A;  3LR1 A;  3HCQ A;  1FTO A;  1P99 A;  2QSX A;  3FXU A;  2ZNS A;  3C35 A;  3PPN A;  3CIJ A;  1HSE A;  4RNS A;  1YAE A;  2AL4 A;  5I2K A;  3TTR A;  4OER A;  4IGR A;  4KD5 A;  2REJ A;  2Q2A A;  3CVG A;  4R6H A;  1XHY A;  5AA2 B;  3FJM A;  3K4U A;  3RY3 A;  5A5X B;  4HS7 A;  5TPA A;  1MY4 A;  2I4C A;  1LB9 A;  3DP6 A;  4MLQ A;  5TP9 A;  1BKA A;  2Q89 A;  4N07 A;  3SEV A;  3TTM A;  4DE8 A;  5ICT A;  1LFI A;  2Q8J A;  1JVY A;  1I6Q A;  1SD3 A;  1SVX B;  2FYI A;  3IOW A;  3TKD A;  4ESW A;  3MWB A;  4DCX A;  3TTN A;  4DLD A;  1CE2 A;  2UVI A;  2XX7 A;  3CSB A;  1O63 A;  2ESN A;  1M5E A;  2XXX A;  3C32 A;  2GH9 A;  3K00 A;  3N5L A;  1YCJ A;  3VDF A;  1XVY A;  3QSL A;  2GRV A;  3O6H A;  2NUV A;  2R6G E;  3Q25 A;  4IB2 A;  4NMY A;  2XHD A;  1B52 A;  2H98 A;  4GF8 A;  4ZDM A;  4BDO A;  4DXC A;  3H03 A;  3BFU A;  3TDJ A;  5ITP A;  5KCJ B;  3FVN A;  3TTK A;  4BDR A;  3MPL A;  1US5 A;  1JEV A;  3FZV A;  3M3F A;  3OEK A;  2DXR A;  5H8Q B;  3T66 A;  3LBS A;  4OFO A;  4F3G A;  5AA4 A;  3O97 A;  4I1D A;  3EN3 A;  1WDN A;  3OEL A;  5L9S A;  5DTB A;  3OO7 A;  1ANF A;  3PPP A;  2AYS A;  3KG2 A;  4ZEF A;  3MC2 A;  1EZ9 A;  4R2F A;  1J1N A;  1O64 A;  1EU8 A;  1SDX A;  4NF8 A;  4ZEB A;  3V83 A;  4JB7 A;  1USY E;  3U8Q A;  3QYT A;  5H8F B;  1OQG A;  1FCK A;  3R6U A;  2RKM A;  2Z8F A;  2F7C A;  2DVC A;  3MAM A;  3DM0 A;  2IEE A;  2B65 A;  2Z22 A;  1MXU A;  4H65 A;  1IXI A;  4OEV A;  4MF3 A;  4XKQ A;  3B6W A;  4TLL B;  1Z7M E;  4O3A A;  2UYE A;  3EF7 A;  3FAS A;  4JWO A;  1IZ1 A;  4LON B;  1MG1 A;  4OET A;  2B3B A;  4PFU A;  5I59 A;  5FTH A;  3MZ9 A;  3VVD A;  4HTG A;  2OZZ A;  3TEP A;  1UTH B;  3VLV A;  4POW A;  4JSD A;  2HZL A;  3PMX A;  5F7V A;  4OWD A;  1B0H A;  4YIC A;  4ZE8 A;  2VP1 A;  4EUO A;  2ZYO A;  3MVX A;  3B6T A;  1B3L A;  2I4B A;  3PUY E;  1DMB A;  1BP5 A;  1M5D A;  4ZZA A;  3MP6 A;  1NH8 A;  1QKB A;  3GBB A;  3MQ9 A;  4MH5 A;  3TYH A;  4DDD A;  5L9M A;  2CMO A;  1F9B A;  2QS4 A;  1PC3 A;  3MW0 A;  4NF6 B;  1FTL A;  1QUK A;  2O7I A;  3MP1 A;  4ZE9 A;  1IEJ A;  1FQC A;  4U23 A;  1B46 A;  1Y20 A;  3H6U A;  5HM4 B;  3JZJ A;  3G3J A;  4QFO A;  1NFT A;  3KOT A;  4RK2 A;  2VHA A;  4YKJ A;  1A40 A;  2UVG A;  2DWJ A;  1AMF A;  2NWJ A;  4EF2 A;  1LAX A;  2DWA A;  5CBR A;  2XXT A;  1QUI A;  1B1H A;  2ANJ A;  3K6W A;  3KSJ A;  4OEN A;  3SET A;  1B9J A;  3FAT A;  1FQE A;  3I5O A;  4QFP A;  4C1T A;  1EZP A;  2RC7 A;  2R71 A;  5I57 B;  2HAV A;  1NNF A;  2QMW A;  1LLS A;  3SEY A;  1A7L A;  2PMS A;  1JVX A;  4LAT A;  4R74 A;  5ITO A;  3SEX A;  3TUS A;  2I48 A;  2I6E A;  3SEW A;  3VXC A;  1EH3 A;  4P0G A;  3OO8 A;  2WKY A;  4EQ9 A;  1MPD A;  5KCJ A;  3IOV A;  3VXB A;  1ZIU A;  5FHO A;  1AH5 A;  2A5T A;  4JWX A;  4PET A;  4YB5 A;  5L8D A;  1PB8 A;  2V84 A;  1UIU A;  1FQF A;  4H5G A;  4ZZE A;  4IGT A;  4DZ1 A;  4M1V A;  3UOR A;  2F7B A;  1URD A;  4ISU A;  4I9D A;  1N0T A;  1N7W A;  2Y7R A;  3OO9 A;  1HSJ A;  4G68 B;  3KOS A;  2V25 A;  2X26 A;  1IXG A;  1M5B A;  2UYF A;  2RCA A;  4TOZ A;  3GZG A;  4R73 A;  2P1S A;  3EPE A;  3O2A A;  4NWC A;  5CMC A;  5H8N A;  2RC9 A;  1H3D A;  3IX1 A;  3FVK A;  1B7Z A;  3MP8 A;  4HCY A;  2G93 A;  4QSC A;  4U2R A;  5DT6 A;  1T0K A;  3T93 B;  1MPC A;  3OSQ A;  4FJP A;  1R1N A;  4G68 A;  1POT A;  2H4I A;  2QS2 A;  4OXV A;  4F1U A;  4RJZ A;  4NF4 B;  3R26 A;  1MPB A;  1I69 A;  1NNP A;  2ZYM A;  4LZ7 A;  1XS5 A;  2XXW A;  5F1Q A;  4F31 B;  2OBG A;  2QS1 A;  3FXR A;  1NH7 A;  4PFW A;  3VLU A;  1S50 A;  4H0W A;  4O3C A;  2ZMB A;  3TMG A;  4GL8 A;  1YPN A;  3L6G A;  4NED A;  4AB5 A;  3SES A;  1IIW A;  2DWH A;  1MXX A;  3IB2 A;  4FED A;  2DE3 A;  1FTK A;  2I58 A;  4KCC A;  4XKN A;  1H76 A;  2F6G A;  3B7D A;  4ZEI A;  3TTL A;  3UA8 A;  1D4N A;  3IL1 B;  2DQV A;  1NMU A;  2PT1 A;  2Y7P A;  3CSG A;  3MVY A;  3QIM A;  4RXL A;  3CFZ A;  4EXK A;  4JBZ A;  2W7Y A;  5CC2 A;  1IXH A;  2Q2C A;  4G2Z A;  5HBC A;  2I3W A;  3QXM A;  4MLV A;  3FV2 A;  1N3X A;  4Z0I A;  3EQ1 A;  2Z8E A;  3TCH A;  4C1U A;  4IO6 A;  4ESX A;  3C36 A;  1LFG A;  1TT1 A;  1SYI A;  1ZBM A;  2A5S A;  3G3I A;  4OES A;  3M3K A;  3RTW B;  5BUU A;  5DEX B;  4KR5 A;  3CR9 A;  1MY1 A;  2RC8 A;  1US4 A;  4KI0 E;  2XXV A;  1UTB A;  1JET A;  1NL5 A;  1Y9U A;  3A3U A;  4R75 A;  5EYF A;  2YJP A;  1CB6 A;  4KYE A;  4OQO A;  2HZK A;  3PMW A;  4RA1 A;  1UIV A;  3UIF A;  4JWY A;  2DWI A;  2Y7K A;  1Y1M A;  3ECR A;  3LC8 A;  1URG A;  3O28 A;  1VFD A;  3T22 A;  4LA9 A;  3OEN A;  3OOA A;  4F39 A;  4F3S A;  4NTL A;  4R6Y A;  3FD3 A;  1BLF A;  3G3K A;  1M5C A;  4IO7 A;  1I6A A;  5AA2 A;  3K02 A;  5FTI A;  3FGS A;  2QL3 A;  3OEM A;  4MBP A;  4OHN A;  1MQI A;  3KBR A;  4FAJ A;  2V3T A;  1GGG A;  1IXC A;  1NKX A;  1JEU A;  2DOJ A;  4X9T A;  5CI5 A;  1B4H A;  2F7A A;  3K2D A;  3DEL B;  4NE4 A;  5K2Y A;  2X7Q A;  1FW0 A;  4OMB A;  1Y1Z A;  1II5 A;  3DLN A;  4RK9 A;  1B3F A;  3G7W A;  3RT6 B;  1O7T A;  3V89 B;  4ZEC A;  5ICQ A;  2UVJ A;  4KHZ E;  3PV0 E;  3HST A;  3LSW A;  1D9Y A;  5H8N B;  1AL3 A;  2M8C A;  4QRZ A;  3RPW A;  4LP2 B;  1XVX A;  3MPK A;  4OTE A;  1LBB A;  1B51 A;  1FQA A;  4LUB A;  3EHU A;  3IJX B;  3KFM A;  5TU0 A;  1S9T A;  4G8H A;  2CZL A;  2XD2 A;  4BLA A;  4U22 A;  3ZS6 A;  2I0B A;  2O7U A;  3N26 A;  5I2K B;  3U72 A;  1TWY A;  1LCF A;  2HAU A;  4R6K A;  3H6W A;  4U4S A;  4YKP A;  3WAF A;  1IQ7 A;  4LZ8 A;  1HSL A;  3IR1 A;  4P0I A;  1QUL A;  2E1S A;  4L17 A;  2QJE A;  4Z7E A;  4N13 A;  4I62 A;  3MVW A;  4GIZ A;  2AIX A;  1MM6 A;  1N76 A;  3AXF A;  1RKM A;  4P11 A;  5H8H A;  3W9V A;  4F3P A;  1FQD A;  1POY 1;  5I58 A;  3VV5 A;  4YKK A;  1P1Q A;  3PGF A;  2OK2 A;  2H5Y A;  2XXI A;  3N6U A;  1XC1 A;  2H9B A;  2F8D A;  3ODB A;  1YTV A;  3HHF A;  3Q26 A;  5FHN A;  4FOR A;  2I0C A;  2GFE A;  4LQ5 A;  5EHM A;  4KYD A;  3RUM A;  1JW1 A;  4QSE A;  3V8X B;  2DP8 A;  2DXY A;  3U92 A;  3FVG A;  2O1L A;  3BKI B;  3M8U A;  5A5X A;  5IAI A;  1SW1 A;  2XX8 A;  3C33 A;  3LUY A;  4F1Y A;  1VE4 A;  4NWD A;  1QKA A;  2E0S A;  1ATG A;  1MQJ A;  1N7X A;  2P2A A;  2HCA A;  2NOO A;  3A09 A;  1UQW A;  3LSL A;  1OVT A;  4FEC A;  1TXF A;  2REG A;  4GD5 A;  4IY6 A;  1A8E A;  1MY2 A;  1LAH E;  2GHB A;  3K6X A;  4KPT A;  4OYV A;  3IO4 A;  4G4P A;  2PVU A;  3MZ1 A;  4LZ5 A;  5B70 A;  5J1D A;  1WVJ A;  1IUD A;  1XT8 A;  2VGQ A;  1B7H A;  3FJ7 A;  3H6V A;  3PMV A;  4G68 C;  3TPA A;  5I57 A;  3G3F A;  2YPN A;  1H43 A;  4GRK A;  3S9M C;  2UVH A;  3RT8 A;  4AQ4 A;  1MM7 A;  3GXA A;  4NF6 A;  3H7M A;  3K0V A;  5ELV A;  5I2N B;  2RIN A;  4Q30 B;  1B5J A;  3T9X B;  1GTK A;  2D21 A;  4ELO A;  4BDN A;  4E0W A;  3KN3 A;  3TQL A;  5B7D A;  1D3K A;  2O84 X;  5DVJ A;  2OLB A;  1B2H A;  3O29 A;  4XIG Q;  2H99 A;  3KZG A;  1TFD A;  1VR5 A;  4KQP A;  3IK6 B;  4IO3 A;  3TCG A;  2PBW A;  4XKP A;  3IOT A;  4F3B A;  4DXU A;  3CFX A;  3VLW A;  2ONS A;  4U1O A;  2Z23 A;  4LVQ A;  1S7Y A;  4H8J A;  1NNK A;  1SW4 A;  3PUZ E;  4WXJ A;  1M5F A;  3I3V A;  1FQB A;  1PB7 A;  3F11 A;  1URS A;  4GXS B;  5CMM A;  4HW8 A;  3QUF A;  3RNN A;  3B6Q A;  2OWS A;  5AE4 A;  2F78 A;  4QFK A;  4DIG A;  4R9F A;  3G3G A;  4FE8 A;  2F5X A;  3OO6 A;  4KYS A;  4GL0 A;  3Q29 A;  2NVU B;  3R7X A;  1P1U A;  1MXW A;  2GHA A;  3H6T A;  2PT2 A;  2QRY A;  4G77 A;  4GFR A;  4Q0C A;  3BBR A;  1LFH A;  2HFB A;  4IY5 A;  1OMP A;  5AA1 A;  3VE1 B;  1OIB A;  4ZS9 A;  3S2V A;  2R9J A;  3H3G A;  5H8F A;  3IJO B;  2HXW A;  3ILT B;  3PD8 A;  5CRY A;  3N94 A;  3W9W A;  3K6V A;  3MZB A;  4ELR A;  4ZED A;  1A99 A;  5H8H B;  3ZKL A;  3S4U A;  3UGW A;  4N6P A;  4M4G A;  3U1O A;  2OWT A;  1B5H A;  1P1N A;  1B40 A;  5BWJ A;  4BDL A;  3MJN A;  3PD9 A;  3RLF E;  4EF1 A;  1B58 A;  3K01 A;  3DP8 A;  2HEU A;  1BIY A;  2ZYK A;  4ELQ A;  4ELP A;  1RYX A;  1UTH A;  2FA7 A;  1NNT A;  1QW0 A;  3DP4 A;  3O6I A;  3PUV E;  1Y3N A;  4GOT A;  3FVO A;  4HCW A;  5FHM A;  2OJT A;  4YB7 A;  1WOD A;  5K2X A;  3QAX A;  3U93 A;  1N3W A;  1EZO A;  1SW2 A;  3O9P A;  1DPP A;  3O66 A;  3EHT A;  3KJ7 A;  4E0X A;  4F2O A;  1H45 A;  1BTJ A;  1Y4T A;  2QMX A;  1QVS A;  4YMA A;  4THI A;  3PPR A;  2I49 A;  3S9N C;  2Y7W A;  1A54 A;  1AIV A;  5I56 A;  5I59 B;  3T96 B;  1Z7N E;  1XOC A;  2X7P A;  2DE2 A;  3MVZ A;  1OQH A;  3OXN A;  1SI0 A;  3S9L C;  3A3C A;  3TAJ A;  3KSX A;  4NF4 A;  4LQ2 A;  4OVJ A;  4Q8R A;  3TEL A;  5DVI A;  3QUJ A;  4XTC Q;  3OSR A;  4QF9 A;  5I56 B;  4U1Z A;  4Q5T A;  4F22 A;  2D5W A;  2KLF A;  1MXY A;  2UXA A;  4RPO A;  3SER A;  3T9H B;  3M3L A;  1SI1 A;  3JYR A;  1B3E A;  1MQD A;  2ZNT A;  3KJT A;  4XKR A;  3RGY A;  2XX9 A;  2XXQ A;  4X1D A;  3TOD A;  3E4R A;  3FJG A;  1B05 A;  4KCD A;  2ZNU A;  2XXR A;  3HV1 A;  3CG1 A;  3IB1 A;  1PEB A;  3KEI A;  4U4X A;  3SKP A;  4TQU Q;  3UN6 A;  1B0L A;  1GR2 A;  3PPO A;  1JNF A;  1MY3 A;  1PB9 A;  4GVO A;  3IOU A;  4RPN A;  4QHQ A;  3C31 A;  3H06 B;  4O3B A;  4PE5 B;  2G29 A;  4JDF A;  4U21 A;  3VVF A;  4F29 A;  3VFJ A;  2VD3 A;  2DYX A;  4UA8 A;  3IB0 A;  3ZSF A;  2BJJ X;  4F1V A;  4PFY A;  3MUQ A;  3LSX A;  1MRP A;  4NF5 A;  1AOV A;  1ZTY A;  1ZKB A;  4YZZ A;  4DXB A;  1PBP A;  1ZMG A;  3I6V A;  4EDP A;  2B3F A;  1LGB C;  3IOR A;  1GV8 A;  4POX A;  2F35 A;  5CM6 A;  2Z8D A;  3K1N A;  4MFI A;  5L9O A;  3Q28 A;  4PQJ A;  1OLA A;  4EQB A;  4H5F A;  1FTJ A;  2XD3 A;  3PU5 A;  4EXL A;  3LSF B;  1MDQ A;  3QK6 A;  5KZT A;  1JW5 A;  3O6G A;  3RQT A;  2XXY A;  1B3H A;  1DPE A;  3E13 X;  4NF5 B;  2DVZ A;  1MY0 A;  3H4Z A;  2ZYN A;  3VVE A;  3BFT A;  1VFE A;  3KGC A;  3T9U A;  4X1B A;  5H8S A;  4IO4 A;  5CMB A;  1N84 A;  4WKM A;  3ONM A;  2AL5 A;  3SDF A;  1KWH A;  5CBS A;  4QFL A;  1LBC A;  2YLN A;  1B6H A;  4WED A;  1P1W A;  4GXA A;  1SQY A;  2O6A A;  2I3V A;  2XXU A;  3HHG A;  1MQG A;  4JXI A;  1JQF A;  4QSD A;  4R9G A;  1FTM A;  3HO7 A;  1QUJ A;  1DOT A;  1L5T A;  2RF1 A;  3PPQ A;  5JTY B;  1Y3P A;  1DSN A;  2H25 A;  4DCY A;  2A5T B;  4AB6 A;  5M2V A;  3W15 C;  5TP9 B;  1B32 A;  5KDT B;  5ISU A;  3L6H A;  5CMK A;  1QJM A;  1PDA A;  1ZU0 A;  2OCU A;  3D4C A;  1B5I A;  4BDM A;  1SBP A;  5DVF A;  2ONK E;  2DSF A;  4ND9 A;  4BDQ A;  1MXV A;  2F97 A;  1ZLQ A;  1DTZ A;  5I58 B;  2V3U A;  4UAC A;  3OD7 A;  3K1M A;  1USY H;  4OEU A;  3IAZ A;  2Y7I A;  3ILU B;  2IA4 A;  1Q35 A;  2XXP A;  4H67 A;  4F18 A;  5I2N A;  2Y84 A;  4TLM B;  5KDT A;  1OVB A;  3ZKK A;  3EHS A;  2F34 A;  2F6P A;  2V93 A;  3HN0 A;  3Q27 A;  1LAF E;  4ONY A;  3C34 A;  4G8N A;  5H8Q A;  5EHS A;  5AA4 B;  1VSO A;  3D4G A;  3TCF A;  1ZJL A;  1MDP 1;  3JV9 A;  4OZ9 A;  2ABH A;  1D9V A;  3PUX E;  4R72 A;  3K6U A;  3G3H A;  4GQO A;  1RYO A;  2O51 A;  3PUW E;  1B3G A;  4OFJ A;  5JEI A;  2P0S A;  4IO2 A;  1LCT A;  1B1X A;  1A55 A;  4EQ7 A;  1MS7 A;  5TPA B;  1IIT A;  2XXH A;  3CFL A;  4XXU A;  2LAO A;  3GLB A;  4RYA A;  1JW4 A;  3USD A;  2F36 A;  3THI A;  1LB8 A;  4F19 A;  1MQH A;  1MH3 A;  2DE4 A;  3C4M A;  3FUZ A;  4IO5 A;  4PP0 A;  4X48 A;  3U94 A;  3UK4 A;  1OLC A;  3WAE A;  1Y4C A;  1I6B A;  1LST A;  2ONR A;  3SEU A;  2QS3 A;  1B4Z A;  4WEP A;  1LAG E;  3P7I A;  4K3F A;  3KN8 A;  4H1X A;  1R9L A;  1DTG A;  2HQ0 A;  2NXO A;  3KN7 A;  4KFQ A;  2V3Q A;  2D3I A;  3MBP A;  4ECF A;  3CG3 A;  2QPQ A;  2Q9T A;  2VOZ A;  1UTB B;  1MXZ A;  3E3K A;  3RN8 A;  3CRB A;  1P1O A;  4R2B A;  3V5A A;  5JK4 A;  4H8I A;  2O1M A;  4YAH X;  3K1P A;  4RY1 A;  4YMB A;  3FV1 A;  5IKB A;  4F2Q A;  1MH4 A;  4GLI A;  4YU0 A;  4C0R A;  2FNC A;  2ZXT A;  3C9H A;  3RTF B;  1TFA A;  4JSO A;  4NF8 B;  4ZEK A;  5JTY A;  3UP9 A;  3TFL A;  1B7U A;  2PX1 A;  4I8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...