3Q2AC

Toluene 4 monooxygenase hd complex with inhibitor p-aminobenzoate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
AFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 25
structure length 81
sequence length 81
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2010-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3q2aC00
3DHIC 3Q3NC 3GE3C 1T0RC 4P1BC 3RNGC 3GE8C 4P1CC 3DHHC 3I5JC 3RI7C 3DHGC 3RNEC 3N1ZC 3N1YC 1T0SC 3RMKC 3RN9C 3Q3OC 3RNFC 3Q2AC 2INDC 2INCC 3N1XC 1T0QC 3RNAC 3N20C 3RNBC 3Q14C 3I63C 3Q3MC 3RNCC 2RDBC
chains in the Genus database with same CATH superfamily
4EFOA 2D3GA 2EMSA 2CHWA 1OQRA 2EMTA 4WJOA 2OEDA 2FCMA 2DAJA 4M8NA 3ZO5B 5AZFA 3ZGZA 1P7EA 2XK5B 2KMCA 1LFDA 1HE8A 3AXCA 3N3KB 1CJEA 2HE7A 1WZ0A 3HRDD 4NAMA 4IUMB 4E71A 2MW5A 1IP9A 4R3DA 1WI0A 5IKCM 4ARCA 5LXHA 2GLSA 4ZHPA 1ACCA 2MHJA 3EUB2 2L76A 4IM2A 1VLBA 2KX3A 4GB9A 4M00A 1OGWA 2LGXA 4W9FA 2KOXA 1XEEA 3ETRA 4RGNA 1SJED 4KVGB 2IO0B 5FR3A 2EKEC 2ZCBA 1VZ6A 1ESFA 3E56A 3V60A 2D10A 1RFKA 1S1QB 3MHZA 1FXAA 3N32A 4OHJA 3TUOA 1PGAA 1R4MB 3LXFA 3ZKJC 1E0ZA 1WY8A 5D7GA 3U30A 2KTRA 4GDLB 4B9KA 3P4RB 1XQQA 2WP9B 2IY1B 2N9XA 2K0PA 3V62A 2O2VA 3RNGC 3GB1A 4IKGA 3N30A 5MPOA 2GMIC 1UBIA 4DHJD 2KJ6A 3RNEC 2MH7A 2WQYB 2K8CA 1I42A 4ACFA 3P4SB 2ZNVC 1WR6E 1XLNA 1FIQA 3Q3JA 3VTVA 2ZZPB 2WXIA 4TQ1A 4TKNA 1YJJA 3EA6A 4DDID 1E90A 2KDIA 3X0WA 2FUHB 4G11A 4HDQA 2HTME 1GG3A 3NVWA 3ABVB 2LJIA 2BVCA 1PQSA 4MACA 3ZJUA 3A9JA 2JZZA 3RNAC 4YT0B 4NJ6A 3JSVA 2BKFA 4WQMA 4LNKA 5D3DA 1SEBD 3IVFA 2BYTA 3Q8BA 3W1SA 1WE6A 2WXHA 4YL8A 2K25A 2VZKD 4KDLB 4KDIC 4OW0A 2KDMA 2KXJA 3Q3OC 1QZEA 1TYGB 2JZPA 3ZDTA 5L95C 1KM7A 4IWQA 2MJDA 2N1WA 2BYFA 4GMVA 1WGYA 3AE7B 1T0RC 2MBHA 2VRRB 1I4XA 4RM9A 3AEEB 3GP7A 4IG7B 1WGGA 2H89B 1E5WA 1ZXIA 2I1JA 2WX1A 3ZXRA 1KTKA 2BTEA 3PV1A 3ONSA 1EO6A 1SXTA 4IC7B 4BOSC 4WURA 3A33B 2G45B 2N9LA 2BWES 1WYGA 2KTRB 2RDGA 4USAA 3TEYA 2KKCA 2BT6A 4ZHOA 5LNK1 1SE2A 4DK5A 1L0XB 1GNUA 2W54A 2O2VB 3S2AA 4G3XB 3NZUA 2ON8A 3URYA 2Z8LA 4ICUA 4DHJB 2FCQA 3OJ4B 3QCAA 3OJ3A 4NQKE 4ASWC 4BKGA 3FAHA 2INNE 3L0WB 4PS3A 4EEWA 1WFYA 2IGGA 1RRBA 2WDRB 4EE2A 3C8YA 2KACA 4BVUC 2IO3B 1HQRD 3DVNV 4C00A 1VDVA 3A9JB 5EE0A 5TR5A 2LRUA 3HVZA 3JSVB 1K52A 1NYQA 3KYDD 4CQNA 2KO3A 4GOCA 2KJRA 1KJTA 1AW7A 3VRBB 1VZ7A 1TGZB 1GB1A 1ZUD2 1OTRB 4W9GA 2Z59B 1M4VA 1P3QU 5E6JA 4I6PA 2WXLA 2NBVB 2MRPA 4K7UA 2IO2B 3RI7C 1D3ZA 1J7BA 1F0ZA 4DWFA 3ZNZB 3GOEA 4BKSD 2EELA 2NPTA 4BKSA 2KFKA 1WXQA 2PPHA 4DHZB 4W9JA 3IFWB 2MWSB 1IBXA 2GOWA 3APDA 3PTFC 2Y5PA 1Q5WB 2B76B 3EECA 3OLMD 2MJ3A 4KGTA 1FXIA 3BVZA 2WXGA 3RMKC 3AE1B 2V0GA 5L83A 1T6BX 1FFVA 3DBLB 1WXVA 3N1XC 3DCGA 4RFBA 3NZSA 1EWYC 5KHOA 2GI9A 5DPRA 1HZ6A 1VR9A 3W5VB 4GIVA 3QARA 3TEXA 2HJ8A 4WAAA 2WXMA 3R2TA 2FBWB 2J4XA 1P7FA 1NBFC 2INCC 1JRUA 4JQWC 2JYTA 3ZQ4A 4KZ0A 1EU4A 2C7MB 1B9RA 4C80A 4GGQA 3PPAA 4XGAB 4PT5A 4IDIA 1YQ3B 3DOWA 3ZTCA 2Z0EB 2W3SA 3L13A 2VH2A 2KHWB 1WX9A 3SHQA 2JYEA 3BINA 1CZPA 2NBUA 3CSFA 4AS1A 3GE8C 3IAM1 4S0RA 4CYEA 1TS2A 2YLMA 1M94A 5CX3A 4DXFA 2L7RA 2XBBC 2LXAA 2ZVNA 3KWVA 3DWMA 2CU1A 2I2YA 4F7ZA 3ZJTA 3JVZX 4KIKA 4ZOHC 4D2KA 3RFZB 1WRIA 2NPTB 2FNJB 2KFKB 3SDLC 1VRAB 4FHKA 4GLSC 4NQLB 2REXA 2FCNA 4G0NB 1V1PB 4HRSA 2KC2A 1FM0D 2V9HA 2J7QB 3QX1A 5G55A 1P9DU 2DX5B 2KDFB 3PO0A 4GXBA 2O6VD 2KAJA 3BZDB 1WJ4A 2V3PA 3AEDB 1FEHA 2JQRB 2D07B 4A90A 2L00B 2ZW0A 4H2AA 2H88B 2MJEA 4C56C 3MP9A 3ZDMC 5HHDG 4DXGA 2IPKD 4FHJA 1PDXA 2QDFA 3AB5A 4MGZE 4MT5A 2N9EB 4HWIB 3QWZB 2J52A 4W9CA 1X1MA 3NHEB 2WHIA 1GC7A 1HEZE 3R3MA 4W9EA 1LGRA 2HDEA 3VTUA 4HKZE 1HZ5A 2KX0A 3Q8FA 4PYUA 4IM0A 1Q10A 1IGCA 3AH7A 5E6OA 3VDZA 3PT2B 1YN5A 4BOZB 3JYUA 3LJ3A 1Q0WB 3EFCA 3IT4B 1N6ZA 2AX5A 5EDSA 1SE4A 1C77A 3R7QA 4XYCA 3VUXA 3NVVA 4OVUA 4K7WA 2CJNA 5T8IA 3ZRCA 1WM2A 4YSZB 2DNFA 3TSSA 1STEA 1XT9B 1WE7A 2C7NB 1QLBB 1WMHA 2MSED 2RR9A 1WWTA 4YTPB 3AECB 3LYYA 1L7YA 2D3CA 4A6QA 1R4NI 3PLVA 3ZIMA 3GE3C 4P1BC 2XN9C 1QOBA 2N1VA 2ZJDA 4KIKB 3DHGC 2D3BA 2WYQA 2HD5B 5AUKA 4XWWA 2E6XA 2L8JA 1MPEA 3RUIB 4K3BA 1L2NA 3PHXB 4JIOU 3VH4B 1XLPA 4RH6A 4FLHA 5JZEB 3TIXA 3AEBB 4JWSC 4LCDE 4HPMB 1N5WA 1T0SC 4LJPB 2ZNVB 1XF5L 3DBRI 4HCNB 2KMAA 1NI2A 2QHOA 4K1RB 1HTOA 2OJWA 3M95A 3MHSD 3H9DA 4E3CA 1I4PA 2L52A 2K8HA 2Y5CA 4HCPB 5FKAC 3SFEB 3HM3A 2KT7A 2BB6A 1FXTB 2CR5A 1WJ6A 3A9KA 2GBJA 4HJGE 4M02A 1LQBA 3RULA 1GAQB 3ECIA 1IUEA 4JPSA 1ROEA 1XLOA 2M19A 1FNUA 2B3AA 1YNTE 2AWTA 3UI3A 2MBEA 4LNNA 2GBMA 3P2BA 4WH4A 1JWMD 2BGFA 4F8CB 1WMHB 3N9YC 4TUUA 3FKYA 1SSNA 1WX8A 4URKA 2LASA 3DHIC 2NR2A 3MC0B 3UIOB 1UD7A 3BYYB 1PGXA 1E7UA 1WM3A 1TBEA 1PGBA 4ZRIA 1JALA 2MP2A 2N7EA 1WJUA 2INDC 4A9AA 3AU5A 3I63C 2KMMA 3BK2A 5J17A 2DAFA 3TEWA 3WANA 5JHBA 3CWIA 3U52E 1JCKB 3RPFC 1K51A 1C78A 2IO1B 2AQ3B 3PZ7A 3IG3A 2PE6B 4HEA1 1JROA 1OEYA 4ZDVA 2V4LA 2ZVOA 4G50A 2JU6X 1YOVB 1KLVA 4RGMA 2KQ7A 3AU4A 4RGTA 2GBRA 2C5LC 2BS4B 2L05A 3B1LX 3EC8A 2XEWA 2FAZA 3NRZA 1TTNA 1E8WA 3P42A 3V05A 5IO9A 2RGFA 4C4VA 1L0VB 1YIWA 2UU7A 2BS3B 4FJZA 1V9JA 1V86A 3C19A 2N9KA 4FJVB 2M0XA 3IHPC 3U7ZA 3WAOA 2BWFA 3VR9B 3A9KB 4FN2A 2R61A 4ZRPA 4PK1A 2JT4B 2YEPF 2PW9A 5GXGB 3AEGB 2TSSA 5EE3A 2C7HA 1FMAD 2DHZA 1K8RB 2Z0DB 3DVGY 4DQOC 4JWUC 1C79A 3WAPA 3DPDA 4RF0A 1I4RA 4ANVA 2OHFA 4CHKA 1EM7A 4REZA 3HIZA 3NVYA 4KZCA 2DYBA 2SEBD 2V3NA 1J7AA 1ZKHA 2MBBB 4DBGA 3HUIA 4ICVA 5BMIA 1U4AA 1UH6A 1H4RA 4LTUA 1ZP0B 1XCQL 2RMMA 2I38A 4TMAB 2KN4A 4ZYNA 2MP2B 3QQ8B 3DWGC 1S3SG 3TJPA 1PFDA 4AP4C 4MGYE 3DBSA 3I9V1 3SEBA 3UF8A 2DZJA 2M17A 3ZJVA 4AOFA 2RD0A 2JXTA 2MBOA 2GBKA 3W5UB 2LVQA 1UBQA 3Q3MC 3RZFA 3VTWA 3UGBB 5D6JB 5AUIA 2K8BA 5BYQA 4K7SA 3ZNHB 1A5RA 1KFYB 2BPSA 2ONQA 3SU8X 2W55A 2M56B 3V61A 4C4VB 4BBNF 2NBWB 4RNAA 1GUAB 2A4ZA 2KFJA 3I57A 5EE9A 1R7SA 2LEKA 5E6NA 2Y5BB 3QA8A 4N9F4 3AN1A 4FA6A 1ET6A 2VZKB 1P0RA 2NS5A 1D5XC 3U2SC 4W9KA 1JW9D 3AE3B 3B9JA 4ANWA 5D2MB 5C2TB 1NEKB 5CTRC 2FCSA 2ZPYA 3TMPB 1XO3A 2ZPNA 1TKEA 1JMLA 3ML9A 1PYWD 4XWTA 1KRHA 2JPHA 3M3JA 3AMZA 1V5TA 2WXQA 3P4QB 3LDZE 2DZMA 2NTSA 1E7PB 4WJQA 3MC9A 5J2RA 4LDTD 4KGSA 4EKUA 3NZ3A 2KLCA 4KGRA 4N59A 4NZLB 2NMQA 4DDGD 1KOTA 3X23A 1P1AA 2WLBA 4I6LB 3W1YA 1LM8B 3BYTB 4ZRQA 2QJLA 4E74A 3HVDA 2K3UA 4JGHB 1FO4A 2K6DB 2PLPA 2JWZA 4MSQB 3OG5A 4XC2A 2MQJA 4RCOA 3VR8B 2CHZA 2KVZA 2KQ4X 3LB8C 3Q8CA 2L1AA 3R66C 2DWQA 4P16A 4MGIE 4QAYA 1R4NB 4FADA 5DCNA 2IJ0A 1QT9A 3IAS1 1HXYD 5HI1A 1ZGUB 1JWAD 3WALA 5FK9C 3AE6B 3K9OB 5IA7A 1K53A 2D2QA 1F52A 1A70A 4C7YA 3C0RB 2PEAA 3A1QA 4KV2A 1QKZA 2KD0A 2ZEQA 2JXXA 3Q2AC 2G3QB 1L4ZB 2BS2B 1EWCA 2JRHA 3NUHB 1SBBB 2W3RA 5TSSA 1Y56A 1TKGA 4TSSA 5BYSA 3DDCB 3DBRB 2WXJA 2FE8A 4A55A 2PJHA 4PYZA 3DVNU 4M0WA 4NY0A 2JUOA 5G2NA 3APCA 3FILA 2DYMA 3SFDB 2CKHB 4NNJB 3VUYA 4AWJA 1F2RC 4IM3A 3IXSA 3L54A 1V6EA 1IBXB 3BVGA 1EU3A 1N5XA 1E8YA 3L17A 1G6JA 4LDTB 3RZWC 2LZ6A 2WXOA 4MH0E 2O6VA 2JX5A 1UGMA 2R2QA 4X57B 1N63A 4FULA 1IPGA 4EZKA 2D5GA 2L83A 2K6QA 1J7CA 2W82A 1J8CA 3N1ZC 4EZLA 5G5HA 2DENB 1V81A 3TL5A 3BK1A 3PGEA 1E8ZA 1DYQA 2R2OA 1F9JA 5H8YE 4K3CA 2N9PC 1FFUA 3CMMB 3HM6X 4I6NB 1SIFA 3EGRA 1TS4A 2BYEA 2KC1A 1YQBA 2KWDA 1Y8RC 4KSLC 1ENFA 5EE1A 3IBEA 2KWCA 2JSVX 1E9MA 2CHXA 1F2RI 1UGJA 3A1QB 3H6NA 1C3TA 3V6CB 2QEJC 2J0JA 1N62A 3ZXVA 3CSTA 3NS1A 1NI3A 1CMXB 2KQSA 2DBYA 1EF5A 3AM9A 3L4PA 4P1CC 4ARIA 5H92C 3L10B 4BZAA 1V80A 1F77A 3Q69A 1OFFA 2FIFA 1J0GA 1PUTA 1SE9A 1BXTA 4XX5A 4A3PA 4HPLB 4HKQA 3V3XA 1GJZA 4TQ0A 2KDBA 4JL9A 2MEKA 4IOIE 3CIRB 4US8A 2LGIA 1RLFA 2INPE 1SE3A 4MDKE 4YWGG 3FILB 1C9FA 2ACZB 2AYOB 1QOAA 3DBHI 2WNMA 4EUTA 1H8CA 4P6VF 1FRRA 3KW5B 1TS3A 5IN7A 4LJOB 1FCCC 2VH1A 5KHQA 3UIPB 1WGKA 2O6VB 2D3AA 1P98A 1JQ4A 2JRIB 1WGHA 1JWUD 3APFA 1XD3B 1D6EC 3VRAB 2BQQA 2JY6A 3ZLZA 2WU5B 3PZ8A 5IOIA 1QF6A 5JXVA 3ZVVA 1BUIC 2M4NA 4US9A 4WJNA 4LLGM 4RM8A 5C3JB 1C4PA 3NJTA 3TBLD 4ZRJA 5C1ZA 1GC6A 5CHVC 3GZNI 5HG2A 1XXGA 1TZOA 3ML8A 4B0MA 2KWVB 3H7PA 3B0AA 1SGHA 3AV8A 2K9XA 1HTQA 2L3ZA 3CF6E 2ASQA 2WXNA 3Q14C 3QHTA 4MEMA 4S17A 2RDBC 2WDTB 1GPXA 3H7SA 2IDYA 1EUVB 2D11A 1E8XA 1V8CA 1MG4A 4KKJA 4W9IA 3RCZA 4HK2A 2WXRA 4OZCA 4L2YA 1N61A 1OQYA 4FJYA 2LD9A 3AEAB 3KYCD 3RNBC 1MHXA 1E10A 2J0MA 2CS4A 3ALBA 5HKHA 2KK8A 4HDOA 2V1YA 3E9SA 3MFGA 4MGKE 1OQQA 5BMGA 1YMHE 3I3TB 4F1SA 1L4DB 3B2GA 4II3B 1UZXB 2WX0A 1FRDA 3NOBA 3NY5A 3W9CB 2G4SA 3AE9B 5IP4D 2DLBA 2A5UA 1WXAA 3H8HA 2J53A 2X38A 5FR6A 1FPYA 1DOXA 1N60A 2NVUI 3N1YC 4GSWA 4LNOA 3T3NA 5AZHA 2M0AA 2MX2A 1L6UA 3SR6A 3RYTA 1DOYA 2RDHA 4C7ZA 1V97A 1WX7A 2LVOA 1TIFA 1I4QA 2WWZA 2G9HD 2YEPB 2QIEB 2KN5A 1KLGD 4PS8A 4KKIA 1TJEA 4RF1A 4GDKA 1V1OA 1EF1A 1UUPA 2IGDA 2OJRA 2GBNA 1RAXA 1JWSD 4B6WA 1UNSA 1FNWA 5CHWA 2BYVE 3HHMA 4L23A 1WZ3A 1OEYJ 3H7PB 2WGSA 5JHAA 1FCLA 1MHHE 5CHFA 3T9LA 3AE2B 4NPNA 4OZAA 3ZNGC 4YSXB 3RD2A 1E6EB 2DZIA 1KLUD 1WXSA 2CU3A 4NAWA 2FUG1 5IAAC 2ZW1A 1XCTL 3KLSX 3NVZA 1V5OA 1NDDA 4XE0A 1E7VA 1V2YA 2LI5A 4XZ4A 2L0TA 3ZUNA 2LMCA 1YX6B 2XNAC 2KDEB 1T0YA 2DYOA 5JH5C 1BT0A 5BO4B 3QC8B 2NCNA 1C1YB 4LNIA 5HFYA 3A4SC 1GOZA 1WGDA 4ITKA 1WRDB 2ZCCA 2LVPA 1F1HA 4FXCA 3FC4A 4Q2JA 4NJ7A 1VJKA 4L1BA 4GN1A 3KH0A 3O65B 3MJWA 2LGSA 1ZW7A 2PIAA 2MA9B 2N0SB 4A8XC 3SD5A 4AJYB 4DHZE 3JW0X 1WXMA 4EOYA 2BB5A 1MFWA 3Q6BA 2WXFA 2X8XX 3PS6A 1YD8U 3V6EB 4N58A 1UELA 4W9LA 1WSPA 1B1ZA 4BKTA 2KNBA 4ANUA 1LO5D 1Z5SB 2LHDA 4W9HA 1WGRA 5D94A 3ZW3A 3UQBA 1RM6C 1ZOYB 2LUEA 2E3TA 1TKYA 1T0QC 3N20C 2WDVB 4GDKB 3P4PB 2MCNB 3BY4B 4RGOS 3VQIA 2LXCA 3K9PB 2WXPA 4ZYSA 1QILA 3WIMA 1BMLC 4IWPA 2WU2B 1Z2MA 2JVCA 1V49A 4JX1C 2KYWA 4K81A 3VAWA 2SAKA 4HXDA 1TZ1A 2MLBA 4LNFA 2M8SA 3VHTC 3HK0A 5AEKB 2LGDA 3Q8AA 1R4MI 3Q3FA 1GB4A 3GS2A 5LLIA 4W9DA 3Q3NC 1I4HA 3T8MA 3KQ4A 4NAWB 1YJ1A 4B95A 1VCBA 4WWPA 4KX6B 4HROA 2K39A 3U8ZA 3AE8B 2K1FA 1KH0A 3B08A 1WYWB 3WAMA 5AZGA 2BF8B 3VFKA 1D5ZC 3KWLA 2QC8A 1WIAA 1RYJA 2V4IB 5BMHA 4BAXA 3H1UA 3IT6B 3R7RA 4YSYB 1TY0A 3OAWA 3WCQA 1C4AA 2PVGC 1D4BA 1UF0A 3PRPB 3O13A 4P7IA 4FBJB 1ZPSA 2UWQA 2DZKA 4JLCA 3D32A 2N7JA 2K22A 2N4FA 4BBNC 1WH3A 1V1PA 4MJSA 2BKRB 4MH8A 3EFUA 3T3OA 2WXKA 3AE4B 3PHWB 4WWMA 3U4EG 1MI0A 3MTNB 1SJHD 2W9NA 3BIID 1LXDA 4GU2A 1ZXHA 3PREA 2KTFA 3VVWB 3J9CA 2LHEA 4OVZA 5DPTA 5DPWA 2N7DA 1XLQA 4WJPA 3DBHB 4PS7A 1DOIA 3M63B 2KZRA 4NJCA 3P63A 1WR1A 2KVRA 2AL3A 1WJNA 3PZDA 4WIPA 2LRWA 2RPVA 2LJ5A 3RT3B 4TV3A 1VD2A 2FIDA 4WWNA 4M8MA 3DVGX 2LGYA 2NTTA 2LUMA 2IZVB 1L5PA 2I1KA 5C23A 1TT5B 5GMVA 4DXAB 1NVID 3TCAA 1IYFA 1NYRA 4M01A 1I7HA 2OOBB 1T3QA 2AQ2B 3PLUA 1C4CA 3W1SC 3ENEA 4WAFA 1FNVA 2L32A 2KWUB 2QSDA 1ZE3D 2IGHA 3VUWA 1JRPA 3ZYYX 3NG0A 1CQVA 2CJOA 1YJIA 3VXWA 3GZNB 2BW2A 4ZRKA 3OWEB 2LFIA 4MM3A 2MBQA 3RN9C 1RWSA 4XDCA 2PTLA 2G1EA 4EZJA 2KANA 1TY2A 4BFRA 2WS3B 3PRZA 4HVBA 1AYFA 4OZBA 3EHVA 2HJ1A 1RFAA 4MJSB 3NS8A 1TS5A 5I4DA 2AEHA 1QOFA 4B0EA 3QJZA 3QAQA 1JWBD 2AL6A 4A20A 1C76A 4OVVA 2RPQA 3AULA 1K50A 2K5PA 1D5MC 2Q5WD 1HA5A 2EKIA 3KUDB 2RSUA 3ZNID 3L16A 1WF9A 3ZRFA 4N6EB 1NENB 1IGDA 4AUQC 3B2FA 2JWUA 4AQ7A 1YX5B 3PSEB 1SF0A 5J18A 2BBCA 1AARA 4CO7A 4IWOA 1AWDA 5DPSA 2QMTA 1MJDA 2WDQB 3AEFB 1KF6B 1ZDVA 4XDDA 4AJWA 3PVLA 3MJ5A 2LWPA 1ET9A 2XK5A 3KUZA 2IYDB 4KSKC 3P1MA 3R2IA 4LK0M 4II2B 1YN3A 3U7DA 3AI5A 3BVMA 2Y3AA 2PE9A 1L6VA 3KUCB 3MC8A 3BWUD 4RMAA 3VH3B 4O1NA 4YXDB 2C60A 2JZ3B 4WQOB 3A4RA 5D3IB 1SIJA 4HPPA 3DBLI 5G5GA 1I4GA 2UYZB 4M0WB 3W2DA 3WA0A 1FD6A 4MELA 3KVFB 3Q8EA 3R8BA 5BYRA 4IW0A 3M62B 2QILA 4YTMB 2HTHA 1YN4A 2PVOD 2IY0B 3QIJA 2C9WB 1SB3C 3PRMB 4MM3B 4HLEA 4UDUC 1QQRA 1QOGA 1UWXA 2G4DB 3L08A 2J0KA 1ISNA 1VZ8A 5E6PA 1MG8A 1Q1OA 1T5XD 2GB1A 4JE3B 4HJKA 3I5JC 2L0FA 4GDLA 2YVCA 2QCZA 3AE5B 2PKOA 2ICIA 4J3OD 2M1MA 3RNFC 4J6IA 1YQ4B 1AN8A 2KJHB 2IBIB 1MVKA 1J19A 4A3OA 3UINB 2KLGA 3DQVA 3ZTDA 2AQ1B 2J42A 4YTNB 3QK0A 3DHHC 2JF5A 4MSMB 4ANXA 1DGJA 5LXIB 3UQAA 2PMVA 2GRIA 1UWMA 1ZDXA 1L0YB 4WWOA 2V3SA 3TEZA 3RNCC 1CK1A 1I35A
chains in the Genus database with same CATH topology
3DHIC 3Q3NC 3GE3C 1T0RC 4P1BC 3RNGC 3GE8C 4P1CC 3DHHC 3I5JC 3RI7C 3DHGC 3RNEC 3N1ZC 3N1YC 1T0SC 3RMKC 3RN9C 3Q3OC 3RNFC 3Q2AC 2INDC 2INCC 3N1XC 1T0QC 3RNAC 3N20C 3RNBC 3Q14C 3I63C 3Q3MC 3RNCC 2RDBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHI C;  3Q3N C;  3GE3 C;  1T0R C;  4P1B C;  3RNG C;  3GE8 C;  4P1C C;  3DHH C;  3I5J C;  3RI7 C;  3DHG C;  3RNE C;  3N1Z C;  3N1Y C;  1T0S C;  3RMK C;  3RN9 C;  3Q3O C;  3RNF C;  3Q2A C;  2IND C;  2INC C;  3N1X C;  1T0Q C;  3RNA C;  3N20 C;  3RNB C;  3Q14 C;  3I63 C;  3Q3M C;  3RNC C;  2RDB C; 
#chains in the Genus database with same CATH topology
 4EFO A;  2D3G A;  2EMS A;  2CHW A;  1OQR A;  2EMT A;  4WJO A;  2OED A;  2FCM A;  2DAJ A;  4M8N A;  3ZO5 B;  5AZF A;  3ZGZ A;  1P7E A;  2XK5 B;  2KMC A;  1LFD A;  1HE8 A;  3AXC A;  3N3K B;  1CJE A;  2HE7 A;  1WZ0 A;  3HRD D;  4NAM A;  4IUM B;  4E71 A;  2MW5 A;  1IP9 A;  4R3D A;  1WI0 A;  5IKC M;  4ARC A;  5LXH A;  2GLS A;  4ZHP A;  1ACC A;  2MHJ A;  3EUB 2;  2L76 A;  4IM2 A;  1VLB A;  2KX3 A;  4GB9 A;  4M00 A;  1OGW A;  2LGX A;  4W9F A;  2KOX A;  1XEE A;  3ETR A;  4RGN A;  1SJE D;  4KVG B;  2IO0 B;  5FR3 A;  2EKE C;  2ZCB A;  1VZ6 A;  1ESF A;  3E56 A;  3V60 A;  2D10 A;  1RFK A;  1S1Q B;  3MHZ A;  1FXA A;  3N32 A;  4OHJ A;  3TUO A;  1PGA A;  1R4M B;  3LXF A;  3ZKJ C;  1E0Z A;  1WY8 A;  5D7G A;  3U30 A;  2KTR A;  4GDL B;  4B9K A;  3P4R B;  1XQQ A;  2WP9 B;  2IY1 B;  2N9X A;  2K0P A;  3V62 A;  2O2V A;  3RNG C;  3GB1 A;  4IKG A;  3N30 A;  5MPO A;  2GMI C;  1UBI A;  4DHJ D;  2KJ6 A;  3RNE C;  2MH7 A;  2WQY B;  2K8C A;  1I42 A;  4ACF A;  3P4S B;  2ZNV C;  1WR6 E;  1XLN A;  1FIQ A;  3Q3J A;  3VTV A;  2ZZP B;  2WXI A;  4TQ1 A;  4TKN A;  1YJJ A;  3EA6 A;  4DDI D;  1E90 A;  2KDI A;  3X0W A;  2FUH B;  4G11 A;  4HDQ A;  2HTM E;  1GG3 A;  3NVW A;  3ABV B;  2LJI A;  2BVC A;  1PQS A;  4MAC A;  3ZJU A;  3A9J A;  2JZZ A;  3RNA C;  4YT0 B;  4NJ6 A;  3JSV A;  2BKF A;  4WQM A;  4LNK A;  5D3D A;  1SEB D;  3IVF A;  2BYT A;  3Q8B A;  3W1S A;  1WE6 A;  2WXH A;  4YL8 A;  2K25 A;  2VZK D;  4KDL B;  4KDI C;  4OW0 A;  2KDM A;  2KXJ A;  3Q3O C;  1QZE A;  1TYG B;  2JZP A;  3ZDT A;  5L95 C;  1KM7 A;  4IWQ A;  2MJD A;  2N1W A;  2BYF A;  4GMV A;  1WGY A;  3AE7 B;  1T0R C;  2MBH A;  2VRR B;  1I4X A;  4RM9 A;  3AEE B;  3GP7 A;  4IG7 B;  1WGG A;  2H89 B;  1E5W A;  1ZXI A;  2I1J A;  2WX1 A;  3ZXR A;  1KTK A;  2BTE A;  3PV1 A;  3ONS A;  1EO6 A;  1SXT A;  4IC7 B;  4BOS C;  4WUR A;  3A33 B;  2G45 B;  2N9L A;  2BWE S;  1WYG A;  2KTR B;  2RDG A;  4USA A;  3TEY A;  2KKC A;  2BT6 A;  4ZHO A;  5LNK 1;  1SE2 A;  4DK5 A;  1L0X B;  1GNU A;  2W54 A;  2O2V B;  3S2A A;  4G3X B;  3NZU A;  2ON8 A;  3URY A;  2Z8L A;  4ICU A;  4DHJ B;  2FCQ A;  3OJ4 B;  3QCA A;  3OJ3 A;  4NQK E;  4ASW C;  4BKG A;  3FAH A;  2INN E;  3L0W B;  4PS3 A;  4EEW A;  1WFY A;  2IGG A;  1RRB A;  2WDR B;  4EE2 A;  3C8Y A;  2KAC A;  4BVU C;  2IO3 B;  1HQR D;  3DVN V;  4C00 A;  1VDV A;  3A9J B;  5EE0 A;  5TR5 A;  2LRU A;  3HVZ A;  3JSV B;  1K52 A;  1NYQ A;  3KYD D;  4CQN A;  2KO3 A;  4GOC A;  2KJR A;  1KJT A;  1AW7 A;  3VRB B;  1VZ7 A;  1TGZ B;  1GB1 A;  1ZUD 2;  1OTR B;  4W9G A;  2Z59 B;  1M4V A;  1P3Q U;  5E6J A;  4I6P A;  2WXL A;  2NBV B;  2MRP A;  4K7U A;  2IO2 B;  3RI7 C;  1D3Z A;  1J7B A;  1F0Z A;  4DWF A;  3ZNZ B;  3GOE A;  4BKS D;  2EEL A;  2NPT A;  4BKS A;  2KFK A;  1WXQ A;  2PPH A;  4DHZ B;  4W9J A;  3IFW B;  2MWS B;  1IBX A;  2GOW A;  3APD A;  3PTF C;  2Y5P A;  1Q5W B;  2B76 B;  3EEC A;  3OLM D;  2MJ3 A;  4KGT A;  1FXI A;  3BVZ A;  2WXG A;  3RMK C;  3AE1 B;  2V0G A;  5L83 A;  1T6B X;  1FFV A;  3DBL B;  1WXV A;  3N1X C;  3DCG A;  4RFB A;  3NZS A;  1EWY C;  5KHO A;  2GI9 A;  5DPR A;  1HZ6 A;  1VR9 A;  3W5V B;  4GIV A;  3QAR A;  3TEX A;  2HJ8 A;  4WAA A;  2WXM A;  3R2T A;  2FBW B;  2J4X A;  1P7F A;  1NBF C;  2INC C;  1JRU A;  4JQW C;  2JYT A;  3ZQ4 A;  4KZ0 A;  1EU4 A;  2C7M B;  1B9R A;  4C80 A;  4GGQ A;  3PPA A;  4XGA B;  4PT5 A;  4IDI A;  1YQ3 B;  3DOW A;  3ZTC A;  2Z0E B;  2W3S A;  3L13 A;  2VH2 A;  2KHW B;  1WX9 A;  3SHQ A;  2JYE A;  3BIN A;  1CZP A;  2NBU A;  3CSF A;  4AS1 A;  3GE8 C;  3IAM 1;  4S0R A;  4CYE A;  1TS2 A;  2YLM A;  1M94 A;  5CX3 A;  4DXF A;  2L7R A;  2XBB C;  2LXA A;  2ZVN A;  3KWV A;  3DWM A;  2CU1 A;  2I2Y A;  4F7Z A;  3ZJT A;  3JVZ X;  4KIK A;  4ZOH C;  4D2K A;  3RFZ B;  1WRI A;  2NPT B;  2FNJ B;  2KFK B;  3SDL C;  1VRA B;  4FHK A;  4GLS C;  4NQL B;  2REX A;  2FCN A;  4G0N B;  1V1P B;  4HRS A;  2KC2 A;  1FM0 D;  2V9H A;  2J7Q B;  3QX1 A;  5G55 A;  1P9D U;  2DX5 B;  2KDF B;  3PO0 A;  4GXB A;  2O6V D;  2KAJ A;  3BZD B;  1WJ4 A;  2V3P A;  3AED B;  1FEH A;  2JQR B;  2D07 B;  4A90 A;  2L00 B;  2ZW0 A;  4H2A A;  2H88 B;  2MJE A;  4C56 C;  3MP9 A;  3ZDM C;  5HHD G;  4DXG A;  2IPK D;  4FHJ A;  1PDX A;  2QDF A;  3AB5 A;  4MGZ E;  4MT5 A;  2N9E B;  4HWI B;  3QWZ B;  2J52 A;  4W9C A;  1X1M A;  3NHE B;  2WHI A;  1GC7 A;  1HEZ E;  3R3M A;  4W9E A;  1LGR A;  2HDE A;  3VTU A;  4HKZ E;  1HZ5 A;  2KX0 A;  3Q8F A;  4PYU A;  4IM0 A;  1Q10 A;  1IGC A;  3AH7 A;  5E6O A;  3VDZ A;  3PT2 B;  1YN5 A;  4BOZ B;  3JYU A;  3LJ3 A;  1Q0W B;  3EFC A;  3IT4 B;  1N6Z A;  2AX5 A;  5EDS A;  1SE4 A;  1C77 A;  3R7Q A;  4XYC A;  3VUX A;  3NVV A;  4OVU A;  4K7W A;  2CJN A;  5T8I A;  3ZRC A;  1WM2 A;  4YSZ B;  2DNF A;  3TSS A;  1STE A;  1XT9 B;  1WE7 A;  2C7N B;  1QLB B;  1WMH A;  2MSE D;  2RR9 A;  1WWT A;  4YTP B;  3AEC B;  3LYY A;  1L7Y A;  2D3C A;  4A6Q A;  1R4N I;  3PLV A;  3ZIM A;  3GE3 C;  4P1B C;  2XN9 C;  1QOB A;  2N1V A;  2ZJD A;  4KIK B;  3DHG C;  2D3B A;  2WYQ A;  2HD5 B;  5AUK A;  4XWW A;  2E6X A;  2L8J A;  1MPE A;  3RUI B;  4K3B A;  1L2N A;  3PHX B;  4JIO U;  3VH4 B;  1XLP A;  4RH6 A;  4FLH A;  5JZE B;  3TIX A;  3AEB B;  4JWS C;  4LCD E;  4HPM B;  1N5W A;  1T0S C;  4LJP B;  2ZNV B;  1XF5 L;  3DBR I;  4HCN B;  2KMA A;  1NI2 A;  2QHO A;  4K1R B;  1HTO A;  2OJW A;  3M95 A;  3MHS D;  3H9D A;  4E3C A;  1I4P A;  2L52 A;  2K8H A;  2Y5C A;  4HCP B;  5FKA C;  3SFE B;  3HM3 A;  2KT7 A;  2BB6 A;  1FXT B;  2CR5 A;  1WJ6 A;  3A9K A;  2GBJ A;  4HJG E;  4M02 A;  1LQB A;  3RUL A;  1GAQ B;  3ECI A;  1IUE A;  4JPS A;  1ROE A;  1XLO A;  2M19 A;  1FNU A;  2B3A A;  1YNT E;  2AWT A;  3UI3 A;  2MBE A;  4LNN A;  2GBM A;  3P2B A;  4WH4 A;  1JWM D;  2BGF A;  4F8C B;  1WMH B;  3N9Y C;  4TUU A;  3FKY A;  1SSN A;  1WX8 A;  4URK A;  2LAS A;  3DHI C;  2NR2 A;  3MC0 B;  3UIO B;  1UD7 A;  3BYY B;  1PGX A;  1E7U A;  1WM3 A;  1TBE A;  1PGB A;  4ZRI A;  1JAL A;  2MP2 A;  2N7E A;  1WJU A;  2IND C;  4A9A A;  3AU5 A;  3I63 C;  2KMM A;  3BK2 A;  5J17 A;  2DAF A;  3TEW A;  3WAN A;  5JHB A;  3CWI A;  3U52 E;  1JCK B;  3RPF C;  1K51 A;  1C78 A;  2IO1 B;  2AQ3 B;  3PZ7 A;  3IG3 A;  2PE6 B;  4HEA 1;  1JRO A;  1OEY A;  4ZDV A;  2V4L A;  2ZVO A;  4G50 A;  2JU6 X;  1YOV B;  1KLV A;  4RGM A;  2KQ7 A;  3AU4 A;  4RGT A;  2GBR A;  2C5L C;  2BS4 B;  2L05 A;  3B1L X;  3EC8 A;  2XEW A;  2FAZ A;  3NRZ A;  1TTN A;  1E8W A;  3P42 A;  3V05 A;  5IO9 A;  2RGF A;  4C4V A;  1L0V B;  1YIW A;  2UU7 A;  2BS3 B;  4FJZ A;  1V9J A;  1V86 A;  3C19 A;  2N9K A;  4FJV B;  2M0X A;  3IHP C;  3U7Z A;  3WAO A;  2BWF A;  3VR9 B;  3A9K B;  4FN2 A;  2R61 A;  4ZRP A;  4PK1 A;  2JT4 B;  2YEP F;  2PW9 A;  5GXG B;  3AEG B;  2TSS A;  5EE3 A;  2C7H A;  1FMA D;  2DHZ A;  1K8R B;  2Z0D B;  3DVG Y;  4DQO C;  4JWU C;  1C79 A;  3WAP A;  3DPD A;  4RF0 A;  1I4R A;  4ANV A;  2OHF A;  4CHK A;  1EM7 A;  4REZ A;  3HIZ A;  3NVY A;  4KZC A;  2DYB A;  2SEB D;  2V3N A;  1J7A A;  1ZKH A;  2MBB B;  4DBG A;  3HUI A;  4ICV A;  5BMI A;  1U4A A;  1UH6 A;  1H4R A;  4LTU A;  1ZP0 B;  1XCQ L;  2RMM A;  2I38 A;  4TMA B;  2KN4 A;  4ZYN A;  2MP2 B;  3QQ8 B;  3DWG C;  1S3S G;  3TJP A;  1PFD A;  4AP4 C;  4MGY E;  3DBS A;  3I9V 1;  3SEB A;  3UF8 A;  2DZJ A;  2M17 A;  3ZJV A;  4AOF A;  2RD0 A;  2JXT A;  2MBO A;  2GBK A;  3W5U B;  2LVQ A;  1UBQ A;  3Q3M C;  3RZF A;  3VTW A;  3UGB B;  5D6J B;  5AUI A;  2K8B A;  5BYQ A;  4K7S A;  3ZNH B;  1A5R A;  1KFY B;  2BPS A;  2ONQ A;  3SU8 X;  2W55 A;  2M56 B;  3V61 A;  4C4V B;  4BBN F;  2NBW B;  4RNA A;  1GUA B;  2A4Z A;  2KFJ A;  3I57 A;  5EE9 A;  1R7S A;  2LEK A;  5E6N A;  2Y5B B;  3QA8 A;  4N9F 4;  3AN1 A;  4FA6 A;  1ET6 A;  2VZK B;  1P0R A;  2NS5 A;  1D5X C;  3U2S C;  4W9K A;  1JW9 D;  3AE3 B;  3B9J A;  4ANW A;  5D2M B;  5C2T B;  1NEK B;  5CTR C;  2FCS A;  2ZPY A;  3TMP B;  1XO3 A;  2ZPN A;  1TKE A;  1JML A;  3ML9 A;  1PYW D;  4XWT A;  1KRH A;  2JPH A;  3M3J A;  3AMZ A;  1V5T A;  2WXQ A;  3P4Q B;  3LDZ E;  2DZM A;  2NTS A;  1E7P B;  4WJQ A;  3MC9 A;  5J2R A;  4LDT D;  4KGS A;  4EKU A;  3NZ3 A;  2KLC A;  4KGR A;  4N59 A;  4NZL B;  2NMQ A;  4DDG D;  1KOT A;  3X23 A;  1P1A A;  2WLB A;  4I6L B;  3W1Y A;  1LM8 B;  3BYT B;  4ZRQ A;  2QJL A;  4E74 A;  3HVD A;  2K3U A;  4JGH B;  1FO4 A;  2K6D B;  2PLP A;  2JWZ A;  4MSQ B;  3OG5 A;  4XC2 A;  2MQJ A;  4RCO A;  3VR8 B;  2CHZ A;  2KVZ A;  2KQ4 X;  3LB8 C;  3Q8C A;  2L1A A;  3R66 C;  2DWQ A;  4P16 A;  4MGI E;  4QAY A;  1R4N B;  4FAD A;  5DCN A;  2IJ0 A;  1QT9 A;  3IAS 1;  1HXY D;  5HI1 A;  1ZGU B;  1JWA D;  3WAL A;  5FK9 C;  3AE6 B;  3K9O B;  5IA7 A;  1K53 A;  2D2Q A;  1F52 A;  1A70 A;  4C7Y A;  3C0R B;  2PEA A;  3A1Q A;  4KV2 A;  1QKZ A;  2KD0 A;  2ZEQ A;  2JXX A;  3Q2A C;  2G3Q B;  1L4Z B;  2BS2 B;  1EWC A;  2JRH A;  3NUH B;  1SBB B;  2W3R A;  5TSS A;  1Y56 A;  1TKG A;  4TSS A;  5BYS A;  3DDC B;  3DBR B;  2WXJ A;  2FE8 A;  4A55 A;  2PJH A;  4PYZ A;  3DVN U;  4M0W A;  4NY0 A;  2JUO A;  5G2N A;  3APC A;  3FIL A;  2DYM A;  3SFD B;  2CKH B;  4NNJ B;  3VUY A;  4AWJ A;  1F2R C;  4IM3 A;  3IXS A;  3L54 A;  1V6E A;  1IBX B;  3BVG A;  1EU3 A;  1N5X A;  1E8Y A;  3L17 A;  1G6J A;  4LDT B;  3RZW C;  2LZ6 A;  2WXO A;  4MH0 E;  2O6V A;  2JX5 A;  1UGM A;  2R2Q A;  4X57 B;  1N63 A;  4FUL A;  1IPG A;  4EZK A;  2D5G A;  2L83 A;  2K6Q A;  1J7C A;  2W82 A;  1J8C A;  3N1Z C;  4EZL A;  5G5H A;  2DEN B;  1V81 A;  3TL5 A;  3BK1 A;  3PGE A;  1E8Z A;  1DYQ A;  2R2O A;  1F9J A;  5H8Y E;  4K3C A;  2N9P C;  1FFU A;  3CMM B;  3HM6 X;  4I6N B;  1SIF A;  3EGR A;  1TS4 A;  2BYE A;  2KC1 A;  1YQB A;  2KWD A;  1Y8R C;  4KSL C;  1ENF A;  5EE1 A;  3IBE A;  2KWC A;  2JSV X;  1E9M A;  2CHX A;  1F2R I;  1UGJ A;  3A1Q B;  3H6N A;  1C3T A;  3V6C B;  2QEJ C;  2J0J A;  1N62 A;  3ZXV A;  3CST A;  3NS1 A;  1NI3 A;  1CMX B;  2KQS A;  2DBY A;  1EF5 A;  3AM9 A;  3L4P A;  4P1C C;  4ARI A;  5H92 C;  3L10 B;  4BZA A;  1V80 A;  1F77 A;  3Q69 A;  1OFF A;  2FIF A;  1J0G A;  1PUT A;  1SE9 A;  1BXT A;  4XX5 A;  4A3P A;  4HPL B;  4HKQ A;  3V3X A;  1GJZ A;  4TQ0 A;  2KDB A;  4JL9 A;  2MEK A;  4IOI E;  3CIR B;  4US8 A;  2LGI A;  1RLF A;  2INP E;  1SE3 A;  4MDK E;  4YWG G;  3FIL B;  1C9F A;  2ACZ B;  2AYO B;  1QOA A;  3DBH I;  2WNM A;  4EUT A;  1H8C A;  4P6V F;  1FRR A;  3KW5 B;  1TS3 A;  5IN7 A;  4LJO B;  1FCC C;  2VH1 A;  5KHQ A;  3UIP B;  1WGK A;  2O6V B;  2D3A A;  1P98 A;  1JQ4 A;  2JRI B;  1WGH A;  1JWU D;  3APF A;  1XD3 B;  1D6E C;  3VRA B;  2BQQ A;  2JY6 A;  3ZLZ A;  2WU5 B;  3PZ8 A;  5IOI A;  1QF6 A;  5JXV A;  3ZVV A;  1BUI C;  2M4N A;  4US9 A;  4WJN A;  4LLG M;  4RM8 A;  5C3J B;  1C4P A;  3NJT A;  3TBL D;  4ZRJ A;  5C1Z A;  1GC6 A;  5CHV C;  3GZN I;  5HG2 A;  1XXG A;  1TZO A;  3ML8 A;  4B0M A;  2KWV B;  3H7P A;  3B0A A;  1SGH A;  3AV8 A;  2K9X A;  1HTQ A;  2L3Z A;  3CF6 E;  2ASQ A;  2WXN A;  3Q14 C;  3QHT A;  4MEM A;  4S17 A;  2RDB C;  2WDT B;  1GPX A;  3H7S A;  2IDY A;  1EUV B;  2D11 A;  1E8X A;  1V8C A;  1MG4 A;  4KKJ A;  4W9I A;  3RCZ A;  4HK2 A;  2WXR A;  4OZC A;  4L2Y A;  1N61 A;  1OQY A;  4FJY A;  2LD9 A;  3AEA B;  3KYC D;  3RNB C;  1MHX A;  1E10 A;  2J0M A;  2CS4 A;  3ALB A;  5HKH A;  2KK8 A;  4HDO A;  2V1Y A;  3E9S A;  3MFG A;  4MGK E;  1OQQ A;  5BMG A;  1YMH E;  3I3T B;  4F1S A;  1L4D B;  3B2G A;  4II3 B;  1UZX B;  2WX0 A;  1FRD A;  3NOB A;  3NY5 A;  3W9C B;  2G4S A;  3AE9 B;  5IP4 D;  2DLB A;  2A5U A;  1WXA A;  3H8H A;  2J53 A;  2X38 A;  5FR6 A;  1FPY A;  1DOX A;  1N60 A;  2NVU I;  3N1Y C;  4GSW A;  4LNO A;  3T3N A;  5AZH A;  2M0A A;  2MX2 A;  1L6U A;  3SR6 A;  3RYT A;  1DOY A;  2RDH A;  4C7Z A;  1V97 A;  1WX7 A;  2LVO A;  1TIF A;  1I4Q A;  2WWZ A;  2G9H D;  2YEP B;  2QIE B;  2KN5 A;  1KLG D;  4PS8 A;  4KKI A;  1TJE A;  4RF1 A;  4GDK A;  1V1O A;  1EF1 A;  1UUP A;  2IGD A;  2OJR A;  2GBN A;  1RAX A;  1JWS D;  4B6W A;  1UNS A;  1FNW A;  5CHW A;  2BYV E;  3HHM A;  4L23 A;  1WZ3 A;  1OEY J;  3H7P B;  2WGS A;  5JHA A;  1FCL A;  1MHH E;  5CHF A;  3T9L A;  3AE2 B;  4NPN A;  4OZA A;  3ZNG C;  4YSX B;  3RD2 A;  1E6E B;  2DZI A;  1KLU D;  1WXS A;  2CU3 A;  4NAW A;  2FUG 1;  5IAA C;  2ZW1 A;  1XCT L;  3KLS X;  3NVZ A;  1V5O A;  1NDD A;  4XE0 A;  1E7V A;  1V2Y A;  2LI5 A;  4XZ4 A;  2L0T A;  3ZUN A;  2LMC A;  1YX6 B;  2XNA C;  2KDE B;  1T0Y A;  2DYO A;  5JH5 C;  1BT0 A;  5BO4 B;  3QC8 B;  2NCN A;  1C1Y B;  4LNI A;  5HFY A;  3A4S C;  1GOZ A;  1WGD A;  4ITK A;  1WRD B;  2ZCC A;  2LVP A;  1F1H A;  4FXC A;  3FC4 A;  4Q2J A;  4NJ7 A;  1VJK A;  4L1B A;  4GN1 A;  3KH0 A;  3O65 B;  3MJW A;  2LGS A;  1ZW7 A;  2PIA A;  2MA9 B;  2N0S B;  4A8X C;  3SD5 A;  4AJY B;  4DHZ E;  3JW0 X;  1WXM A;  4EOY A;  2BB5 A;  1MFW A;  3Q6B A;  2WXF A;  2X8X X;  3PS6 A;  1YD8 U;  3V6E B;  4N58 A;  1UEL A;  4W9L A;  1WSP A;  1B1Z A;  4BKT A;  2KNB A;  4ANU A;  1LO5 D;  1Z5S B;  2LHD A;  4W9H A;  1WGR A;  5D94 A;  3ZW3 A;  3UQB A;  1RM6 C;  1ZOY B;  2LUE A;  2E3T A;  1TKY A;  1T0Q C;  3N20 C;  2WDV B;  4GDK B;  3P4P B;  2MCN B;  3BY4 B;  4RGO S;  3VQI A;  2LXC A;  3K9P B;  2WXP A;  4ZYS A;  1QIL A;  3WIM A;  1BML C;  4IWP A;  2WU2 B;  1Z2M A;  2JVC A;  1V49 A;  4JX1 C;  2KYW A;  4K81 A;  3VAW A;  2SAK A;  4HXD A;  1TZ1 A;  2MLB A;  4LNF A;  2M8S A;  3VHT C;  3HK0 A;  5AEK B;  2LGD A;  3Q8A A;  1R4M I;  3Q3F A;  1GB4 A;  3GS2 A;  5LLI A;  4W9D A;  3Q3N C;  1I4H A;  3T8M A;  3KQ4 A;  4NAW B;  1YJ1 A;  4B95 A;  1VCB A;  4WWP A;  4KX6 B;  4HRO A;  2K39 A;  3U8Z A;  3AE8 B;  2K1F A;  1KH0 A;  3B08 A;  1WYW B;  3WAM A;  5AZG A;  2BF8 B;  3VFK A;  1D5Z C;  3KWL A;  2QC8 A;  1WIA A;  1RYJ A;  2V4I B;  5BMH A;  4BAX A;  3H1U A;  3IT6 B;  3R7R A;  4YSY B;  1TY0 A;  3OAW A;  3WCQ A;  1C4A A;  2PVG C;  1D4B A;  1UF0 A;  3PRP B;  3O13 A;  4P7I A;  4FBJ B;  1ZPS A;  2UWQ A;  2DZK A;  4JLC A;  3D32 A;  2N7J A;  2K22 A;  2N4F A;  4BBN C;  1WH3 A;  1V1P A;  4MJS A;  2BKR B;  4MH8 A;  3EFU A;  3T3O A;  2WXK A;  3AE4 B;  3PHW B;  4WWM A;  3U4E G;  1MI0 A;  3MTN B;  1SJH D;  2W9N A;  3BII D;  1LXD A;  4GU2 A;  1ZXH A;  3PRE A;  2KTF A;  3VVW B;  3J9C A;  2LHE A;  4OVZ A;  5DPT A;  5DPW A;  2N7D A;  1XLQ A;  4WJP A;  3DBH B;  4PS7 A;  1DOI A;  3M63 B;  2KZR A;  4NJC A;  3P63 A;  1WR1 A;  2KVR A;  2AL3 A;  1WJN A;  3PZD A;  4WIP A;  2LRW A;  2RPV A;  2LJ5 A;  3RT3 B;  4TV3 A;  1VD2 A;  2FID A;  4WWN A;  4M8M A;  3DVG X;  2LGY A;  2NTT A;  2LUM A;  2IZV B;  1L5P A;  2I1K A;  5C23 A;  1TT5 B;  5GMV A;  4DXA B;  1NVI D;  3TCA A;  1IYF A;  1NYR A;  4M01 A;  1I7H A;  2OOB B;  1T3Q A;  2AQ2 B;  3PLU A;  1C4C A;  3W1S C;  3ENE A;  4WAF A;  1FNV A;  2L32 A;  2KWU B;  2QSD A;  1ZE3 D;  2IGH A;  3VUW A;  1JRP A;  3ZYY X;  3NG0 A;  1CQV A;  2CJO A;  1YJI A;  3VXW A;  3GZN B;  2BW2 A;  4ZRK A;  3OWE B;  2LFI A;  4MM3 A;  2MBQ A;  3RN9 C;  1RWS A;  4XDC A;  2PTL A;  2G1E A;  4EZJ A;  2KAN A;  1TY2 A;  4BFR A;  2WS3 B;  3PRZ A;  4HVB A;  1AYF A;  4OZB A;  3EHV A;  2HJ1 A;  1RFA A;  4MJS B;  3NS8 A;  1TS5 A;  5I4D A;  2AEH A;  1QOF A;  4B0E A;  3QJZ A;  3QAQ A;  1JWB D;  2AL6 A;  4A20 A;  1C76 A;  4OVV A;  2RPQ A;  3AUL A;  1K50 A;  2K5P A;  1D5M C;  2Q5W D;  1HA5 A;  2EKI A;  3KUD B;  2RSU A;  3ZNI D;  3L16 A;  1WF9 A;  3ZRF A;  4N6E B;  1NEN B;  1IGD A;  4AUQ C;  3B2F A;  2JWU A;  4AQ7 A;  1YX5 B;  3PSE B;  1SF0 A;  5J18 A;  2BBC A;  1AAR A;  4CO7 A;  4IWO A;  1AWD A;  5DPS A;  2QMT A;  1MJD A;  2WDQ B;  3AEF B;  1KF6 B;  1ZDV A;  4XDD A;  4AJW A;  3PVL A;  3MJ5 A;  2LWP A;  1ET9 A;  2XK5 A;  3KUZ A;  2IYD B;  4KSK C;  3P1M A;  3R2I A;  4LK0 M;  4II2 B;  1YN3 A;  3U7D A;  3AI5 A;  3BVM A;  2Y3A A;  2PE9 A;  1L6V A;  3KUC B;  3MC8 A;  3BWU D;  4RMA A;  3VH3 B;  4O1N A;  4YXD B;  2C60 A;  2JZ3 B;  4WQO B;  3A4R A;  5D3I B;  1SIJ A;  4HPP A;  3DBL I;  5G5G A;  1I4G A;  2UYZ B;  4M0W B;  3W2D A;  3WA0 A;  1FD6 A;  4MEL A;  3KVF B;  3Q8E A;  3R8B A;  5BYR A;  4IW0 A;  3M62 B;  2QIL A;  4YTM B;  2HTH A;  1YN4 A;  2PVO D;  2IY0 B;  3QIJ A;  2C9W B;  1SB3 C;  3PRM B;  4MM3 B;  4HLE A;  4UDU C;  1QQR A;  1QOG A;  1UWX A;  2G4D B;  3L08 A;  2J0K A;  1ISN A;  1VZ8 A;  5E6P A;  1MG8 A;  1Q1O A;  1T5X D;  2GB1 A;  4JE3 B;  4HJK A;  3I5J C;  2L0F A;  4GDL A;  2YVC A;  2QCZ A;  3AE5 B;  2PKO A;  2ICI A;  4J3O D;  2M1M A;  3RNF C;  4J6I A;  1YQ4 B;  1AN8 A;  2KJH B;  2IBI B;  1MVK A;  1J19 A;  4A3O A;  3UIN B;  2KLG A;  3DQV A;  3ZTD A;  2AQ1 B;  2J42 A;  4YTN B;  3QK0 A;  3DHH C;  2JF5 A;  4MSM B;  4ANX A;  1DGJ A;  5LXI B;  3UQA A;  2PMV A;  2GRI A;  1UWM A;  1ZDX A;  1L0Y B;  4WWO A;  2V3S A;  3TEZ A;  3RNC C;  1CK1 A;  1I35 A; 
#chains in the Genus database with same CATH homology
 3DHI C;  3Q3N C;  3GE3 C;  1T0R C;  4P1B C;  3RNG C;  3GE8 C;  4P1C C;  3DHH C;  3I5J C;  3RI7 C;  3DHG C;  3RNE C;  3N1Z C;  3N1Y C;  1T0S C;  3RMK C;  3RN9 C;  3Q3O C;  3RNF C;  3Q2A C;  2IND C;  2INC C;  3N1X C;  1T0Q C;  3RNA C;  3N20 C;  3RNB C;  3Q14 C;  3I63 C;  3Q3M C;  3RNC C;  2RDB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...