3Q2AC

Toluene 4 monooxygenase hd complex with inhibitor p-aminobenzoate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
b'AFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 25
structure length 81
sequence length 81
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2010-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3q2aC00
2INCC 3RNBC 3GE3C 3DHHC 4P1BC 3N20C 3N1XC 1T0RC 2INDC 3RNEC 2RDBC 1T0QC 3Q3MC 3RN9C 3N1ZC 3RNAC 3Q3OC 3DHGC 3RNFC 3RI7C 3Q2AC 3Q3NC 3RNCC 1T0SC 4P1CC 3DHIC 3GE8C 3RMKC 3RNGC 3N1YC 3I5JC 3I63C 3Q14C
chains in the Genus database with same CATH superfamily
3NZ3A 3RZFA 1UD7A 4ZHOA 2BW2A 2M0XA 4FHJA 3MC9A 1D3ZA 3ZJUA 1S1QB 3IXSA 3BZDB 3U2SC 2WDTB 2IPKD 3KLSX 4MM3B 4ANVA 2IYDB 4BFRA 3O65B 3UQBA 1L7YA 4C4VB 2JT4B 1WMHA 2BS2B 4ICVA 1PYWD 4BZAA 3MFGA 3BVZA 4NNJB 3FAHA 4LLGM 1T3QA 5LXIB 4MGIE 2C5LC 2AQ2B 4A6QA 1QOAA 1TGZB 3D32A 1ET6A 1GUAB 4GDKA 4M02A 3H9DA 4WURA 5FKAC 3V05A 3AEDB 4W9IA 3R2IA 1HZ5A 2KDFB 3BY4B 1QILA 1KLGD 2Z0DB 4IM2A 3PPAA 2I38A 2FIFA 2PIAA 1RAXA 4YTPB 3W1SC 2KQSA 3NVYA 1VLBA 1J8CA 1YIWA 2BKRB 2ZNVB 5CHVC 4YSZB 3W9CB 1UWXA 4YT0B 1ZDXA 1EU3A 3S2AA 4C7YA 1HXYD 4I6NB 1IBXB 2M4NA 2AEHA 1S3SG 4K7SA 4YL8A 5DCNA 1V2YA 1R4NI 1IUEA 3TSSA 2O6VD 3WANA 3IT6B 4LNKA 2XEWA 2D10A 2PKOA 3RYTA 3TUOA 2KC1A 1SB3C 4PK1A 1B1ZA 4LJOB 3AM9A 4ZRJA 2W3RA 1ACCA 5HFYA 1WGRA 2DZKA 2KNBA 4DDGD 1L4ZB 4GIVA 4N9F4 3BYYB 1MJDA 4HCNB 2BBCA 2KDIA 2PPHA 2KWDA 2MJDA 3QQ8B 1NBFC 4WWNA 4TV3A 1CK1A 3TEXA 2LMCA 3B2GA 1K51A 3ABVB 5G55A 3AU5A 3EC8A 5CTRC 2ZCCA 4HDQA 1WGYA 3IG3A 1E8WA 1UH6A 3PT2B 2JPHA 4MACA 3GE8C 2O2VA 1MVKA 4HJKA 2XBBC 4LNIA 3U30A 2J42A 1NYQA 2JYEA 3KUCB 2LRUA 2ZW0A 2CU1A 1ZXIA 4K3BA 1QT9A 1TKYA 2BPSA 2IJ0A 1L0VB 3WIMA 1Q1OA 5D3DA 1R4NB 4IWQA 2DX5B 4US9A 4JGHB 2DZMA 2G4SA 4MJSA 3AE6B 3Q69A 4GU2A 2MP2B 1V6EA 2E6XA 5BYQA 3KWLA 1FFVA 2LXCA 2D2QA 2QDFA 4DHJD 3VH3B 1WYGA 5DPWA 4ZYNA 1WJ6A 4C7ZA 4EZJA 3Q3FA 2KLGA 3WA0A 1BUIC 2KMAA 3AECB 3UGBB 3VFKA 1KH0A 1XLNA 3PRPB 4W9DA 1L2NA 3BK2A 3T8MA 2LUEA 3JW0X 1M94A 2QIEB 3M63B 4OVZA 2LWPA 1BMLC 3K9PB 2PVGC 1K53A 4JX1C 1E10A 1QLBB 4WJQA 2JY6A 4REZA 2YVCA 3ZTCA 1SJED 4LK0M 5D2MB 1SGHA 3ZYYX 1Y56A 2IO3B 2R2QA 4II2B 4BKGA 1J0GA 2WXNA 3EGRA 4EE2A 2BYVE 3AE2B 4WWPA 4NQLB 2J0JA 4HXDA 1WR1A 3VR8B 2RDHA 2FCSA 3RUIB 3Q8FA 2DYBA 1L4DB 1Z2MA 4JL9A 3N9YC 1JW9D 2MHJA 4NPNA 1P1AA 5BMGA 3AE7B 4NAMA 1YNTE 1R4MI 1V1PA 4AWJA 4RM9A 1QZEA 1HA5A 5BYRA 3T9LA 1T6BX 4MDKE 3W1YA 2JSVX 3V6EB 4TMAB 4K81A 2ZJDA 4KV2A 4PT5A 3R2TA 3N3KB 1AN8A 1SIFA 3KH0A 5JH5C 3CWIA 4G11A 1SJHD 4HKZE 4LCDE 1WY8A 2I1JA 1KFYB 4DHZB 5IKCM 4LNFA 4WJOA 3APDA 3AEEB 3RD2A 2IGGA 1D4BA 1YQBA 1HE8A 1ZPSA 2VZKD 2JZ3B 4PS7A 3ZXVA 4IC7B 3CIRB 4MH8A 1D5XC 3I3TB 4S17A 2WXJA 2K0PA 4HPLB 2MBEA 4W9CA 3AE3B 3M3JA 3QAQA 1T0YA 3ZNGC 2L76A 3T3NA 3FILA 1J7BA 1TKEA 2YEPF 2O2VB 2AQ1B 2NBWB 1GNUA 3ZW3A 2WQYB 1V81A 1EU4A 1T0RC 3Q8AA 3NVZA 4N6EB 3UF8A 1KTKA 4FXCA 3P63A 5G2NA 4HWIB 2KWVB 4AJWA 1NYRA 1EWCA 1IGDA 4GB9A 3EUB2 1Q0WB 1R4MB 2KXJA 2HDEA 1XQQA 1FCLA 3DVNU 4A3PA 2WDVB 3LB8C 2KJ6A 3R66C 3OJ3A 2V1YA 1ET9A 1OTRB 2N9XA 3UIOB 1Q10A 2RPQA 2DENB 2ZPNA 4XDCA 5CHFA 2KVRA 3I63C 2LGDA 1GAQB 4MGKE 3Q8CA 4XZ4A 1SXTA 1LO5D 4F7ZA 1RFAA 4FJVB 3ZJTA 4BKSD 4KIKB 1ZOYB 2WXKA 3A1QA 1EF1A 1XEEA 1CQVA 2ON8A 3L54A 3VR9B 1C4CA 1E7PB 5E6NA 2SAKA 1WR6E 1XLPA 2AL6A 2C7HA 2OHFA 1XLOA 3ALBA 3A9KB 1XD3B 4RGMA 2QCZA 4BAXA 2GBRA 3U7DA 1PFDA 3C8YA 2ZVOA 2QSDA 3RNCC 2ZEQA 1ZKHA 3MHSD 1WX8A 2G1EA 5C1ZA 2W55A 2LJIA 1DOIA 2DNFA 2LRWA 4DDID 1EO6A 2MBHA 2PE6B 3RNAC 4JE3B 4HPPA 4FLHA 5MPOA 2KWCA 2MH7A 4WJNA 4IOIE 2WU5B 1YD8U 4ZRKA 1T0QC 4NY0A 2KHWB 2AYOB 4HEA1 4LDTB 3ECIA 2WXGA 3ML9A 3NVVA 1PGAA 1A5RA 2HD5B 3H7PA 2FAZA 2J52A 5FR3A 3PRZA 1B9RA 1EWYC 1TS3A 1JWSD 2LGSA 2IGDA 2IGHA 2KN5A 3IFWB 2IZVB 4EZLA 3VHTC 1UBQA 5BMIA 5C3JB 2X38A 4NZLB 1E8ZA 4BBNF 2RD0A 3ZDMC 1UWMA 3SHQA 2XNAC 2K8BA 2MWSB 1L6UA 4MELA 3WAOA 4DWFA 3VTUA 3FILB 4GDLA 2UU7A 2GLSA 1OEYJ 2CR5A 1I4HA 2INDC 4GMVA 1IPGA 3DWMA 2EELA 2MJEA 3NJTA 4L2YA 1DYQA 2EMSA 1VRAB 3RNGC 3ZQ4A 1AWDA 5L95C 3C19A 3DOWA 1UGMA 2ONQA 2LVQA 3U7ZA 1JRUA 3QK0A 4Q2JA 4M8NA 3KYCD 4RM8A 4DHZE 2HTHA 1FXIA 1OEYA 4P6VF 2FCQA 3N32A 4ZRQA 1F9JA 2V9HA 4C56C 2JUOA 1ZP0B 2N7EA 4RCOA 2KTRB 2ACZB 1LQBA 4YSYB 5AEKB 2V0GA 2GBKA 1FPYA 2LFIA 1N62A 2WXQA 4IM3A 4B95A 4HLEA 1TS4A 3A1QB 1WRDB 1N63A 3ONSA 4XE0A 3M62B 1SSNA 2AQ3B 4MH0E 3VXWA 5BO4B 2JZZA 2VH2A 2QHOA 2K25A 2C7MB 1JQ4A 1XT9B 1RYJA 1H8CA 1GG3A 1V5OA 1V1OA 4AJYB 5CX3A 3RULA 2Z8LA 2C9WB 2J0MA 3A4SC 4US8A 3GE3C 1KRHA 4EOYA 2CU3A 3N20C 1YX6B 4FADA 2D5GA 4MGYE 3ZRCA 1TJEA 3VRAB 2KDBA 4MSQB 1TZOA 4GSWA 1N5XA 2CJNA 4M01A 2NTSA 4OVVA 4GN1A 3PTFC 3VUWA 1MHHE 3ZRFA 4BVUC 1V97A 2WXLA 3VUYA 4IKGA 2ASQA 2L00B 1JALA 3RCZA 5HG2A 3MC8A 4XGAB 3KWVA 4PS3A 2WX0A 4II3B 2DAJA 2L05A 3AMZA 4WQMA 4A3OA 2IDYA 3H7PB 2N9PC 1YQ3B 3NG0A 3L10B 2QMTA 4ZYSA 1I42A 3RNBC 2BGFA 4KGTA 1YJJA 3VVWB 3NZUA 2N0SB 3RN9C 2TSSA 4HDOA 1WIAA 1VR9A 1EF5A 3ZJVA 1GC6A 1WX9A 3P1MA 3PHXB 3MTNB 1HTOA 1FFUA 1WM2A 1YN5A 1FMAD 4PYUA 2KT7A 3HUIA 2HE7A 4ZRIA 1TS5A 2JF5A 4KDIC 2RPVA 2KMCA 3W2DA 2RSUA 1I7HA 2N7JA 4KSKC 5JHBA 4KVGB 3L16A 2NPTA 1X1MA 4L1BA 4N59A 3RI7C 4XYCA 1HTQA 1WZ0A 2WXFA 4NAWB 3NVWA 1MG8A 2BB5A 2BF8B 1E0ZA 2L1AA 4BKTA 1UNSA 1I4PA 5E6PA 2OJRA 5IA7A 3PLVA 2WXRA 2QEJC 1WXMA 3W1SA 3ZVVA 2K6DB 2INNE 2NVUI 1NVID 2V4LA 2Y3AA 1HZ6A 2WGSA 2K5PA 5T8IA 4EKUA 2D3AA 2KDEB 5L83A 4WWOA 4OZAA 5AZGA 1LM8B 3DVNV 4FJZA 5J18A 2BS4B 3Q3MC 5AUKA 1WMHB 4DXFA 3AB5A 3B0AA 2G9HD 1UUPA 1C9FA 3PO0A 5BYSA 1RFKA 1GB4A 2LASA 3AU4A 5DPTA 2OJWA 4K3CA 1KJTA 1OGWA 2AWTA 4CYEA 1WRIA 1IGCA 4DXGA 2INCC 4H2AA 3DHHC 3EFCA 1TKGA 2D3GA 3SU8X 2LVPA 3OLMD 3GP7A 2KKCA 5G5HA 2X8XX 1MI0A 3IBEA 2NCNA 1T5XD 2ZZPB 3RNFC 1FD6A 3QCAA 4TSSA 2FE8A 4GDKB 1C78A 4S0RA 1J7AA 2WP9B 1UBIA 1VZ8A 5IOIA 1DGJA 2PW9A 2IO0B 1FIQA 3B9JA 4M00A 3NS1A 3A4RA 2IO2B 2MBQA 4P1BC 4C00A 4B6WA 1SIJA 2H88B 1SE3A 1V80A 5AUIA 4XX5A 3URYA 2LEKA 3APCA 4LDTD 3Q3OC 2DWQA 3BK1A 2VH1A 5E6JA 1KLUD 2K3UA 3DHIC 4NQKE 1L6VA 1EM7A 3V62A 3BIID 1YQ4B 1QOBA 4USAA 2G3QB 2KFKA 3JSVA 2MCNB 4CHKA 4JPSA 4RGOS 4FA6A 1JCKB 1SBBB 3R7QA 1JMLA 3IAS1 2Y5CA 1WZ3A 2J53A 3TEZA 2BB6A 2JWUA 4ZRPA 2FNJB 2AX5A 1ZE3D 4RNAA 5FK9C 2FUHB 3PLUA 2KD0A 1HQRD 1ENFA 1XF5L 2OEDA 3ENEA 4JWUC 1GJZA 2ICIA 2Y5BB 2DYMA 1MPEA 5IAAC 3ZUNA 1F0ZA 1JWMD 1K52A 2KZRA 4M0WA 2K39A 1OQRA 3ZGZA 4WAAA 3A9JA 3ZNZB 4ACFA 1P3QU 5JZEB 1AYFA 1WX7A 3H7SA 1L0XB 4LNNA 3PZDA 3VRBB 2WXIA 4ZHPA 2L52A 2L7RA 3KVFB 3X23A 3PHWB 3BWUD 2LJ5A 2LVOA 3UINB 1WJNA 4RGTA 5CHWA 4TQ0A 3B2FA 2VRRB 1I4RA 4RMAA 3R7RA 3FKYA 2I1KA 3RZWC 1XO3A 2V3PA 4MJSB 3VAWA 2IY1B 1OQQA 4I6PA 1A70A 2JRIB 2CJOA 3CSFA 3X0WA 4BBNC 3PGEA 2WNMA 4E71A 1WYWB 1ZUD2 2JZPA 3HRDD 4DQOC 2KK8A 3B08A 2BVCA 2WHIA 1WSPA 2DZIA 2K1FA 3MP9A 1F2RI 2L32A 4OW0A 2XN9C 2JVCA 1SF0A 2L0TA 3AE5B 1P98A 3PREA 4MT5A 5I4DA 1R7SA 2G4DB 4B0EA 4OVUA 3PVLA 3Q6BA 1WGGA 2PTLA 1D6EC 3DWGC 3KQ4A 2J0KA 4LTUA 1FM0D 1L5PA 2CHWA 2A5UA 2RDBC 2XK5A 4A8XC 2YLMA 1PDXA 4IWOA 3EA6A 3T3OA 4IM0A 2GI9A 1E8XA 3ZNHB 2C7NB 3L0WB 3IT4B 2OOBB 3JYUA 2SEBD 3P42A 3AI5A 4ZOHC 2WXHA 1NDDA 3TL5A 2E3TA 1TZ1A 4GGQA 4DXAB 5BMHA 3GZNI 1WGKA 3ML8A 2FUG1 4PYZA 2KX0A 4ANWA 3HHMA 3HVZA 4TUUA 5KHQA 3ZLZA 4HKQA 3LJ3A 1NI2A 2WDQB 2KMMA 1WXQA 3GS2A 1N60A 3AE1B 3E56A 4PS8A 2FCNA 1V1PB 1STEA 4F1SA 3WALA 3PS6A 3MC0B 4CO7A 2BS3B 2D07B 3QARA 1UZXB 2YEPB 1FCCC 3W5UB 1RWSA 3U52E 1RLFA 3WAPA 4ANUA 5J17A 2N4FA 2KX3A 3ZIMA 3CF6E 2ZVNA 3PZ7A 1EUVB 1WGDA 1HEZE 3TMPB 4EZKA 2BYEA 3N30A 2BWES 2JYTA 2MQJA 2M19A 1VD2A 1M4VA 1P7FA 3BINA 4ARIA 3DBRI 1GB1A 3CSTA 2B76B 4ARCA 3GZNB 2R2OA 2GBNA 3HM6X 3V3XA 3N1ZC 4DBGA 1YJIA 2KAJA 1I4GA 1C77A 4I6LB 4AUQC 3QC8B 3RMKC 3M95A 1Z5SB 4FULA 2KJRA 2JXXA 4G50A 3AULA 2KDMA 3AEBB 2KVZA 2EMTA 1VCBA 2G45B 2GB1A 4RF1A 4HPMB 3ZNID 1QOGA 1WE7A 4FBJB 1LFDA 2JRHA 3TBLD 4BOSC 3TIXA 5C2TB 1VZ7A 2NTTA 3H1UA 1C4AA 3JVZX 3NHEB 3TEYA 3PRMB 5EE9A 2LXAA 3AEAB 2MP2A 2K22A 4G0NB 3QHTA 1E7UA 1KM7A 4ICUA 1VZ6A 4W9JA 2WXOA 1YX5B 1ZW7A 2MRPA 1WXSA 1IYFA 2NBUA 4TKNA 2INPE 3SEBA 3V61A 1AARA 2A4ZA 2J4XA 4OZCA 1WXVA 1GOZA 1J19A 2RDGA 5D7GA 2K8CA 3DBRB 2N9LA 3LYYA 1WXAA 3DBHI 3PSEB 1FNVA 2MEKA 3GOEA 4B9KA 2BWFA 2M17A 3KUZA 4TQ1A 1K8RB 2LZ6A 1KOTA 2GOWA 2XK5B 3NUHB 1L0YB 1DOYA 2DZJA 2RGFA 1TBEA 3P2BA 2MA9B 3OG5A 2GBMA 3VQIA 5FR6A 4K7UA 3L13A 1ROEA 4K1RB 4K7WA 3P4QB 2C60A 4MSMB 5AZFA 5JXVA 5KHOA 1PUTA 4O1NA 2MJ3A 3NS8A 2W54A 2KQ7A 1XCQL 1PGBA 3EHVA 1MG4A 1TTNA 4WQOB 2LGXA 2CHZA 5EE3A 1ESFA 1N61A 3HK0A 1TYGB 1CMXB 2W3SA 3OAWA 1D5MC 1GPXA 2NS5A 1WWTA 1ZGUB 2JXTA 3LXFA 2JQRB 3NZSA 2BKFA 3TEWA 2LGYA 3N1XC 2PE9A 4YTMB 1WJ4A 2FCMA 2H89B 2B3AA 1E90A 3DHGC 2UWQA 1H4RA 2KANA 2WLBA 3Q3NC 1T0SC 1YJ1A 1P7EA 3O13A 1C76A 5D94A 1UF0A 3UQAA 3DBHB 3J9CA 2KN4A 2MX2A 3DPDA 3IVFA 3L17A 4KSLC 3BVGA 1J7CA 2JX5A 5H92C 2NBVB 4KZCA 5EDSA 2O6VA 1BT0A 1E5WA 2GBJA 4FJYA 2L8JA 1E9MA 4JLCA 1FO4A 2NR2A 3Q2AC 4P1CC 2HTME 1E6EB 2D3CA 4NJCA 4XC2A 4A55A 3WAMA 2PJHA 1ISNA 1V5TA 2MBBB 2WDRB 1N5WA 1C3TA 3AEGB 2KWUB 3I57A 4GDLB 5AZHA 1XCTL 2K8HA 2FBWB 5D3IB 4IUMB 4WJPA 3Q8BA 1WI0A 4JIOU 2IBIB 4XWTA 1UELA 1V49A 2UYZB 3P4RB 3ZTDA 2ZCBA 2LI5A 1TT5B 2V3NA 4XWWA 4YWGG 4E74A 2KTFA 4DK5A 3QA8A 2Z59B 4A9AA 1NI3A 2D3BA 1DOXA 1WF9A 5EE1A 1F2RC 2DLBA 4W9LA 4NJ6A 1FNUA 2LUMA 1JWBD 1PQSA 3DDCB 2M56B 3HM3A 3DBLI 3H8HA 4KGRA 4IWPA 5C23A 1LGRA 2V4IB 2QC8A 1KF6B 1LXDA 2JWZA 4BOZB 4AQ7A 1VJKA 4HCPB 1TIFA 3ETRA 5HHDG 2DYOA 3LDZE 3A33B 4AS1A 1C4PA 1FEHA 1V8CA 1F77A 4R3DA 3Q3JA 2M1MA 4KIKA 1SE4A 4J6IA 3QJZA 4A90A 1F1HA 2BQQA 1OFFA 1OQYA 3W5VB 3QX1A 3B1LX 3QWZB 4AOFA 2KC2A 5GXGB 4URKA 1YOVB 3AE4B 3A9KA 4MGZE 1WJUA 1I4XA 3AH7A 2KYWA 1MFWA 2RR9A 3IAM1 3RFZB 5TR5A 4X57B 2KO3A 4WAFA 2CS4A 3SR6A 4HVBA 1PGXA 3DBLB 2LHEA 3ZO5B 3AE9B 1Y8RC 2WXPA 3L4PA 4IDIA 4CQNA 4W9KA 3VH4B 3QIJA 2KACA 4KGSA 1D5ZC 5D6JB 1QOFA 3RT3B 4YSXB 1YMHE 1P0RA 1C79A 2BYFA 4B0MA 3R8BA 3DVGY 2EKIA 3Q14C 1BXTA 3VUXA 4EUTA 1I4QA 1P9DU 1I35A 4KKJA 3RNEC 4KX6B 2M0AA 4IW0A 2REXA 4GXBA 1WE6A 2O6VB 2KJHB 3C0RB 3AV8A 4AP4C 2EKEC 3CMMB 4KKIA 3I5JC 1F52A 1UGJA 1WH3A 1FRRA 5LNK1 3AE8B 3P4SB 2ZPYA 4ZDVA 3EECA 2N9KA 5G5GA 1E8YA 3DBSA 1E7VA 1FNWA 5IN7A 3VTVA 2M8SA 3Q8EA 3UI3A 3VDZA 2MW5A 4E3CA 2D11A 3E9SA 4RH6A 3ZKJC 4A20A 1IP9A 3KUDB 4HK2A 1N6ZA 1C1YB 1U4AA 1MHXA 4LNOA 3OJ4B 3VTWA 2NPTB 2V3SA 2KFJA 3H6NA 2PMVA 4W9HA 4ITKA 1TY0A 2N1WA 2KOXA 1CZPA 2JU6X 4LJPB 4RF0A 1JWUD 4GOCA 3OWEB 4JWSC 4MEMA 4RFBA 2DBYA 3HVDA 5HKHA 4KZ0A 3MHZA 4J3OD 2WXMA 3SDLC 2ZNVC 2PVOD 3GB1A 2IO1B 5IO9A 2CHXA 1WM3A 4KDLB 2LHDA 2I2YA 1QQRA 1SE2A 2K9XA 2QJLA 3BVMA 4FN2A 2L0FA 3BYTB 5LLIA 5IP4D 1QF6A 3UIPB 2HJ1A 4ASWC 2MBOA 3HIZA 2Y5PA 4FHKA 4MM3A 1QKZA 3DVGX 3EFUA 2KTRA 2J7QB 4M8MA 3K9OB 4D2KA 5E6OA 4C4VA 4W9FA 4WH4A 1VDVA 1SEBD 4DHJB 3DCGA 4WWMA 5TSSA 4F8CB 2GRIA 1JWAD 3I9V1 5JHAA 3TCAA 3R3MA 2K6QA 2BTEA 5J2RA 4ANXA 1XLQA 2N9EB 3SD5A 3MJ5A 1FXAA 4BKSA 4YTNB 1JROA 3IHPC 3AEFB 2W82A 3APFA 2FIDA 3KW5B 2N1VA 3RPFC 3PV1A 4UDUC 1AW7A 1ZXHA 2R61A 3L08A 2L3ZA 4HRSA 4C80A 1YN3A 4P16A 3SFDB 1RM6C 4QAYA 1WGHA 4W9EA 2MSED 2QILA 2WX1A 2L83A 1CJEA 2KFKB 2PEAA 2NMQA 3JSVB 2WS3B 2WWZA 4WIPA 4L23A 1JRPA 1IBXA 2N7DA 1FRDA 1Q5WB 4G3XB 1GC7A 3P4PB 3ZXRA 1K50A 1RRBA 1SE9A 3SFEB 2Z0EB 3MJWA 4XDDA 3ZDTA 2IY0B 5H8YE 2KQ4X 1G6JA 3FC4A 2HJ8A 2ZW1A 4NJ7A 4OZBA 5DPSA 3WCQA 4EFOA 2DHZA 2Q5WD 3AXCA 4M0WB 4HJGE 4OHJA 4W9GA 3A9JB 2MLBA 3AN1A 4IG7B 3U4EG 3KYDD 4RGNA 5LXHA 1KLVA 1NENB 3DQVA 1NEKB 1V86A 4N58A 3PZ8A 3NY5A 2PLPA 3N1YC 3NOBA 2RMMA 2DAFA 2VZKB 4P7IA 1TY2A 2GMIC 3V6CB 1XXGA 1TS2A 2WYQA 5GMVA 5HI1A 5DPRA 2WU2B 3U8ZA 4EEWA 2BYTA 4GLSC 1YN4A 4JQWC 1ZDVA 4HROA 4NAWA 3TJPA 2CKHB 3V60A 5EE0A 2W9NA 2LGIA 3NRZA 2KLCA 2AL3A 2LD9A 2BT6A 4YXDB 1WFYA 1FXTB 1V9JA
chains in the Genus database with same CATH topology
2INCC 3RNBC 3GE3C 3DHHC 4P1BC 3N20C 3N1XC 1T0RC 2INDC 3RNEC 2RDBC 1T0QC 3Q3MC 3RN9C 3N1ZC 3RNAC 3Q3OC 3DHGC 3RNFC 3RI7C 3Q2AC 3Q3NC 3RNCC 1T0SC 4P1CC 3DHIC 3GE8C 3RMKC 3RNGC 3N1YC 3I5JC 3I63C 3Q14C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2INC C;  3RNB C;  3GE3 C;  3DHH C;  4P1B C;  3N20 C;  3N1X C;  1T0R C;  2IND C;  3RNE C;  2RDB C;  1T0Q C;  3Q3M C;  3RN9 C;  3N1Z C;  3RNA C;  3Q3O C;  3DHG C;  3RNF C;  3RI7 C;  3Q2A C;  3Q3N C;  3RNC C;  1T0S C;  4P1C C;  3DHI C;  3GE8 C;  3RMK C;  3RNG C;  3N1Y C;  3I5J C;  3I63 C;  3Q14 C; 
#chains in the Genus database with same CATH topology
 3NZ3 A;  3RZF A;  1UD7 A;  4ZHO A;  2BW2 A;  2M0X A;  4FHJ A;  3MC9 A;  1D3Z A;  3ZJU A;  1S1Q B;  3IXS A;  3BZD B;  3U2S C;  2WDT B;  2IPK D;  3KLS X;  4MM3 B;  4ANV A;  2IYD B;  4BFR A;  3O65 B;  3UQB A;  1L7Y A;  4C4V B;  2JT4 B;  1WMH A;  2BS2 B;  4ICV A;  1PYW D;  4BZA A;  3MFG A;  3BVZ A;  4NNJ B;  3FAH A;  4LLG M;  1T3Q A;  5LXI B;  4MGI E;  2C5L C;  2AQ2 B;  4A6Q A;  1QOA A;  1TGZ B;  3D32 A;  1ET6 A;  1GUA B;  4GDK A;  4M02 A;  3H9D A;  4WUR A;  5FKA C;  3V05 A;  3AED B;  4W9I A;  3R2I A;  1HZ5 A;  2KDF B;  3BY4 B;  1QIL A;  1KLG D;  2Z0D B;  4IM2 A;  3PPA A;  2I38 A;  2FIF A;  2PIA A;  1RAX A;  4YTP B;  3W1S C;  2KQS A;  3NVY A;  1VLB A;  1J8C A;  1YIW A;  2BKR B;  2ZNV B;  5CHV C;  4YSZ B;  3W9C B;  1UWX A;  4YT0 B;  1ZDX A;  1EU3 A;  3S2A A;  4C7Y A;  1HXY D;  4I6N B;  1IBX B;  2M4N A;  2AEH A;  1S3S G;  4K7S A;  4YL8 A;  5DCN A;  1V2Y A;  1R4N I;  1IUE A;  3TSS A;  2O6V D;  3WAN A;  3IT6 B;  4LNK A;  2XEW A;  2D10 A;  2PKO A;  3RYT A;  3TUO A;  2KC1 A;  1SB3 C;  4PK1 A;  1B1Z A;  4LJO B;  3AM9 A;  4ZRJ A;  2W3R A;  1ACC A;  5HFY A;  1WGR A;  2DZK A;  2KNB A;  4DDG D;  1L4Z B;  4GIV A;  4N9F 4;  3BYY B;  1MJD A;  4HCN B;  2BBC A;  2KDI A;  2PPH A;  2KWD A;  2MJD A;  3QQ8 B;  1NBF C;  4WWN A;  4TV3 A;  1CK1 A;  3TEX A;  2LMC A;  3B2G A;  1K51 A;  3ABV B;  5G55 A;  3AU5 A;  3EC8 A;  5CTR C;  2ZCC A;  4HDQ A;  1WGY A;  3IG3 A;  1E8W A;  1UH6 A;  3PT2 B;  2JPH A;  4MAC A;  3GE8 C;  2O2V A;  1MVK A;  4HJK A;  2XBB C;  4LNI A;  3U30 A;  2J42 A;  1NYQ A;  2JYE A;  3KUC B;  2LRU A;  2ZW0 A;  2CU1 A;  1ZXI A;  4K3B A;  1QT9 A;  1TKY A;  2BPS A;  2IJ0 A;  1L0V B;  3WIM A;  1Q1O A;  5D3D A;  1R4N B;  4IWQ A;  2DX5 B;  4US9 A;  4JGH B;  2DZM A;  2G4S A;  4MJS A;  3AE6 B;  3Q69 A;  4GU2 A;  2MP2 B;  1V6E A;  2E6X A;  5BYQ A;  3KWL A;  1FFV A;  2LXC A;  2D2Q A;  2QDF A;  4DHJ D;  3VH3 B;  1WYG A;  5DPW A;  4ZYN A;  1WJ6 A;  4C7Z A;  4EZJ A;  3Q3F A;  2KLG A;  3WA0 A;  1BUI C;  2KMA A;  3AEC B;  3UGB B;  3VFK A;  1KH0 A;  1XLN A;  3PRP B;  4W9D A;  1L2N A;  3BK2 A;  3T8M A;  2LUE A;  3JW0 X;  1M94 A;  2QIE B;  3M63 B;  4OVZ A;  2LWP A;  1BML C;  3K9P B;  2PVG C;  1K53 A;  4JX1 C;  1E10 A;  1QLB B;  4WJQ A;  2JY6 A;  4REZ A;  2YVC A;  3ZTC A;  1SJE D;  4LK0 M;  5D2M B;  1SGH A;  3ZYY X;  1Y56 A;  2IO3 B;  2R2Q A;  4II2 B;  4BKG A;  1J0G A;  2WXN A;  3EGR A;  4EE2 A;  2BYV E;  3AE2 B;  4WWP A;  4NQL B;  2J0J A;  4HXD A;  1WR1 A;  3VR8 B;  2RDH A;  2FCS A;  3RUI B;  3Q8F A;  2DYB A;  1L4D B;  1Z2M A;  4JL9 A;  3N9Y C;  1JW9 D;  2MHJ A;  4NPN A;  1P1A A;  5BMG A;  3AE7 B;  4NAM A;  1YNT E;  1R4M I;  1V1P A;  4AWJ A;  4RM9 A;  1QZE A;  1HA5 A;  5BYR A;  3T9L A;  1T6B X;  4MDK E;  3W1Y A;  2JSV X;  3V6E B;  4TMA B;  4K81 A;  2ZJD A;  4KV2 A;  4PT5 A;  3R2T A;  3N3K B;  1AN8 A;  1SIF A;  3KH0 A;  5JH5 C;  3CWI A;  4G11 A;  1SJH D;  4HKZ E;  4LCD E;  1WY8 A;  2I1J A;  1KFY B;  4DHZ B;  5IKC M;  4LNF A;  4WJO A;  3APD A;  3AEE B;  3RD2 A;  2IGG A;  1D4B A;  1YQB A;  1HE8 A;  1ZPS A;  2VZK D;  2JZ3 B;  4PS7 A;  3ZXV A;  4IC7 B;  3CIR B;  4MH8 A;  1D5X C;  3I3T B;  4S17 A;  2WXJ A;  2K0P A;  4HPL B;  2MBE A;  4W9C A;  3AE3 B;  3M3J A;  3QAQ A;  1T0Y A;  3ZNG C;  2L76 A;  3T3N A;  3FIL A;  1J7B A;  1TKE A;  2YEP F;  2O2V B;  2AQ1 B;  2NBW B;  1GNU A;  3ZW3 A;  2WQY B;  1V81 A;  1EU4 A;  1T0R C;  3Q8A A;  3NVZ A;  4N6E B;  3UF8 A;  1KTK A;  4FXC A;  3P63 A;  5G2N A;  4HWI B;  2KWV B;  4AJW A;  1NYR A;  1EWC A;  1IGD A;  4GB9 A;  3EUB 2;  1Q0W B;  1R4M B;  2KXJ A;  2HDE A;  1XQQ A;  1FCL A;  3DVN U;  4A3P A;  2WDV B;  3LB8 C;  2KJ6 A;  3R66 C;  3OJ3 A;  2V1Y A;  1ET9 A;  1OTR B;  2N9X A;  3UIO B;  1Q10 A;  2RPQ A;  2DEN B;  2ZPN A;  4XDC A;  5CHF A;  2KVR A;  3I63 C;  2LGD A;  1GAQ B;  4MGK E;  3Q8C A;  4XZ4 A;  1SXT A;  1LO5 D;  4F7Z A;  1RFA A;  4FJV B;  3ZJT A;  4BKS D;  4KIK B;  1ZOY B;  2WXK A;  3A1Q A;  1EF1 A;  1XEE A;  1CQV A;  2ON8 A;  3L54 A;  3VR9 B;  1C4C A;  1E7P B;  5E6N A;  2SAK A;  1WR6 E;  1XLP A;  2AL6 A;  2C7H A;  2OHF A;  1XLO A;  3ALB A;  3A9K B;  1XD3 B;  4RGM A;  2QCZ A;  4BAX A;  2GBR A;  3U7D A;  1PFD A;  3C8Y A;  2ZVO A;  2QSD A;  3RNC C;  2ZEQ A;  1ZKH A;  3MHS D;  1WX8 A;  2G1E A;  5C1Z A;  2W55 A;  2LJI A;  1DOI A;  2DNF A;  2LRW A;  4DDI D;  1EO6 A;  2MBH A;  2PE6 B;  3RNA C;  4JE3 B;  4HPP A;  4FLH A;  5MPO A;  2KWC A;  2MH7 A;  4WJN A;  4IOI E;  2WU5 B;  1YD8 U;  4ZRK A;  1T0Q C;  4NY0 A;  2KHW B;  2AYO B;  4HEA 1;  4LDT B;  3ECI A;  2WXG A;  3ML9 A;  3NVV A;  1PGA A;  1A5R A;  2HD5 B;  3H7P A;  2FAZ A;  2J52 A;  5FR3 A;  3PRZ A;  1B9R A;  1EWY C;  1TS3 A;  1JWS D;  2LGS A;  2IGD A;  2IGH A;  2KN5 A;  3IFW B;  2IZV B;  4EZL A;  3VHT C;  1UBQ A;  5BMI A;  5C3J B;  2X38 A;  4NZL B;  1E8Z A;  4BBN F;  2RD0 A;  3ZDM C;  1UWM A;  3SHQ A;  2XNA C;  2K8B A;  2MWS B;  1L6U A;  4MEL A;  3WAO A;  4DWF A;  3VTU A;  3FIL B;  4GDL A;  2UU7 A;  2GLS A;  1OEY J;  2CR5 A;  1I4H A;  2IND C;  4GMV A;  1IPG A;  3DWM A;  2EEL A;  2MJE A;  3NJT A;  4L2Y A;  1DYQ A;  2EMS A;  1VRA B;  3RNG C;  3ZQ4 A;  1AWD A;  5L95 C;  3C19 A;  3DOW A;  1UGM A;  2ONQ A;  2LVQ A;  3U7Z A;  1JRU A;  3QK0 A;  4Q2J A;  4M8N A;  3KYC D;  4RM8 A;  4DHZ E;  2HTH A;  1FXI A;  1OEY A;  4P6V F;  2FCQ A;  3N32 A;  4ZRQ A;  1F9J A;  2V9H A;  4C56 C;  2JUO A;  1ZP0 B;  2N7E A;  4RCO A;  2KTR B;  2ACZ B;  1LQB A;  4YSY B;  5AEK B;  2V0G A;  2GBK A;  1FPY A;  2LFI A;  1N62 A;  2WXQ A;  4IM3 A;  4B95 A;  4HLE A;  1TS4 A;  3A1Q B;  1WRD B;  1N63 A;  3ONS A;  4XE0 A;  3M62 B;  1SSN A;  2AQ3 B;  4MH0 E;  3VXW A;  5BO4 B;  2JZZ A;  2VH2 A;  2QHO A;  2K25 A;  2C7M B;  1JQ4 A;  1XT9 B;  1RYJ A;  1H8C A;  1GG3 A;  1V5O A;  1V1O A;  4AJY B;  5CX3 A;  3RUL A;  2Z8L A;  2C9W B;  2J0M A;  3A4S C;  4US8 A;  3GE3 C;  1KRH A;  4EOY A;  2CU3 A;  3N20 C;  1YX6 B;  4FAD A;  2D5G A;  4MGY E;  3ZRC A;  1TJE A;  3VRA B;  2KDB A;  4MSQ B;  1TZO A;  4GSW A;  1N5X A;  2CJN A;  4M01 A;  2NTS A;  4OVV A;  4GN1 A;  3PTF C;  3VUW A;  1MHH E;  3ZRF A;  4BVU C;  1V97 A;  2WXL A;  3VUY A;  4IKG A;  2ASQ A;  2L00 B;  1JAL A;  3RCZ A;  5HG2 A;  3MC8 A;  4XGA B;  3KWV A;  4PS3 A;  2WX0 A;  4II3 B;  2DAJ A;  2L05 A;  3AMZ A;  4WQM A;  4A3O A;  2IDY A;  3H7P B;  2N9P C;  1YQ3 B;  3NG0 A;  3L10 B;  2QMT A;  4ZYS A;  1I42 A;  3RNB C;  2BGF A;  4KGT A;  1YJJ A;  3VVW B;  3NZU A;  2N0S B;  3RN9 C;  2TSS A;  4HDO A;  1WIA A;  1VR9 A;  1EF5 A;  3ZJV A;  1GC6 A;  1WX9 A;  3P1M A;  3PHX B;  3MTN B;  1HTO A;  1FFU A;  1WM2 A;  1YN5 A;  1FMA D;  4PYU A;  2KT7 A;  3HUI A;  2HE7 A;  4ZRI A;  1TS5 A;  2JF5 A;  4KDI C;  2RPV A;  2KMC A;  3W2D A;  2RSU A;  1I7H A;  2N7J A;  4KSK C;  5JHB A;  4KVG B;  3L16 A;  2NPT A;  1X1M A;  4L1B A;  4N59 A;  3RI7 C;  4XYC A;  1HTQ A;  1WZ0 A;  2WXF A;  4NAW B;  3NVW A;  1MG8 A;  2BB5 A;  2BF8 B;  1E0Z A;  2L1A A;  4BKT A;  1UNS A;  1I4P A;  5E6P A;  2OJR A;  5IA7 A;  3PLV A;  2WXR A;  2QEJ C;  1WXM A;  3W1S A;  3ZVV A;  2K6D B;  2INN E;  2NVU I;  1NVI D;  2V4L A;  2Y3A A;  1HZ6 A;  2WGS A;  2K5P A;  5T8I A;  4EKU A;  2D3A A;  2KDE B;  5L83 A;  4WWO A;  4OZA A;  5AZG A;  1LM8 B;  3DVN V;  4FJZ A;  5J18 A;  2BS4 B;  3Q3M C;  5AUK A;  1WMH B;  4DXF A;  3AB5 A;  3B0A A;  2G9H D;  1UUP A;  1C9F A;  3PO0 A;  5BYS A;  1RFK A;  1GB4 A;  2LAS A;  3AU4 A;  5DPT A;  2OJW A;  4K3C A;  1KJT A;  1OGW A;  2AWT A;  4CYE A;  1WRI A;  1IGC A;  4DXG A;  2INC C;  4H2A A;  3DHH C;  3EFC A;  1TKG A;  2D3G A;  3SU8 X;  2LVP A;  3OLM D;  3GP7 A;  2KKC A;  5G5H A;  2X8X X;  1MI0 A;  3IBE A;  2NCN A;  1T5X D;  2ZZP B;  3RNF C;  1FD6 A;  3QCA A;  4TSS A;  2FE8 A;  4GDK B;  1C78 A;  4S0R A;  1J7A A;  2WP9 B;  1UBI A;  1VZ8 A;  5IOI A;  1DGJ A;  2PW9 A;  2IO0 B;  1FIQ A;  3B9J A;  4M00 A;  3NS1 A;  3A4R A;  2IO2 B;  2MBQ A;  4P1B C;  4C00 A;  4B6W A;  1SIJ A;  2H88 B;  1SE3 A;  1V80 A;  5AUI A;  4XX5 A;  3URY A;  2LEK A;  3APC A;  4LDT D;  3Q3O C;  2DWQ A;  3BK1 A;  2VH1 A;  5E6J A;  1KLU D;  2K3U A;  3DHI C;  4NQK E;  1L6V A;  1EM7 A;  3V62 A;  3BII D;  1YQ4 B;  1QOB A;  4USA A;  2G3Q B;  2KFK A;  3JSV A;  2MCN B;  4CHK A;  4JPS A;  4RGO S;  4FA6 A;  1JCK B;  1SBB B;  3R7Q A;  1JML A;  3IAS 1;  2Y5C A;  1WZ3 A;  2J53 A;  3TEZ A;  2BB6 A;  2JWU A;  4ZRP A;  2FNJ B;  2AX5 A;  1ZE3 D;  4RNA A;  5FK9 C;  2FUH B;  3PLU A;  2KD0 A;  1HQR D;  1ENF A;  1XF5 L;  2OED A;  3ENE A;  4JWU C;  1GJZ A;  2ICI A;  2Y5B B;  2DYM A;  1MPE A;  5IAA C;  3ZUN A;  1F0Z A;  1JWM D;  1K52 A;  2KZR A;  4M0W A;  2K39 A;  1OQR A;  3ZGZ A;  4WAA A;  3A9J A;  3ZNZ B;  4ACF A;  1P3Q U;  5JZE B;  1AYF A;  1WX7 A;  3H7S A;  1L0X B;  4LNN A;  3PZD A;  3VRB B;  2WXI A;  4ZHP A;  2L52 A;  2L7R A;  3KVF B;  3X23 A;  3PHW B;  3BWU D;  2LJ5 A;  2LVO A;  3UIN B;  1WJN A;  4RGT A;  5CHW A;  4TQ0 A;  3B2F A;  2VRR B;  1I4R A;  4RMA A;  3R7R A;  3FKY A;  2I1K A;  3RZW C;  1XO3 A;  2V3P A;  4MJS B;  3VAW A;  2IY1 B;  1OQQ A;  4I6P A;  1A70 A;  2JRI B;  2CJO A;  3CSF A;  3X0W A;  4BBN C;  3PGE A;  2WNM A;  4E71 A;  1WYW B;  1ZUD 2;  2JZP A;  3HRD D;  4DQO C;  2KK8 A;  3B08 A;  2BVC A;  2WHI A;  1WSP A;  2DZI A;  2K1F A;  3MP9 A;  1F2R I;  2L32 A;  4OW0 A;  2XN9 C;  2JVC A;  1SF0 A;  2L0T A;  3AE5 B;  1P98 A;  3PRE A;  4MT5 A;  5I4D A;  1R7S A;  2G4D B;  4B0E A;  4OVU A;  3PVL A;  3Q6B A;  1WGG A;  2PTL A;  1D6E C;  3DWG C;  3KQ4 A;  2J0K A;  4LTU A;  1FM0 D;  1L5P A;  2CHW A;  2A5U A;  2RDB C;  2XK5 A;  4A8X C;  2YLM A;  1PDX A;  4IWO A;  3EA6 A;  3T3O A;  4IM0 A;  2GI9 A;  1E8X A;  3ZNH B;  2C7N B;  3L0W B;  3IT4 B;  2OOB B;  3JYU A;  2SEB D;  3P42 A;  3AI5 A;  4ZOH C;  2WXH A;  1NDD A;  3TL5 A;  2E3T A;  1TZ1 A;  4GGQ A;  4DXA B;  5BMH A;  3GZN I;  1WGK A;  3ML8 A;  2FUG 1;  4PYZ A;  2KX0 A;  4ANW A;  3HHM A;  3HVZ A;  4TUU A;  5KHQ A;  3ZLZ A;  4HKQ A;  3LJ3 A;  1NI2 A;  2WDQ B;  2KMM A;  1WXQ A;  3GS2 A;  1N60 A;  3AE1 B;  3E56 A;  4PS8 A;  2FCN A;  1V1P B;  1STE A;  4F1S A;  3WAL A;  3PS6 A;  3MC0 B;  4CO7 A;  2BS3 B;  2D07 B;  3QAR A;  1UZX B;  2YEP B;  1FCC C;  3W5U B;  1RWS A;  3U52 E;  1RLF A;  3WAP A;  4ANU A;  5J17 A;  2N4F A;  2KX3 A;  3ZIM A;  3CF6 E;  2ZVN A;  3PZ7 A;  1EUV B;  1WGD A;  1HEZ E;  3TMP B;  4EZK A;  2BYE A;  3N30 A;  2BWE S;  2JYT A;  2MQJ A;  2M19 A;  1VD2 A;  1M4V A;  1P7F A;  3BIN A;  4ARI A;  3DBR I;  1GB1 A;  3CST A;  2B76 B;  4ARC A;  3GZN B;  2R2O A;  2GBN A;  3HM6 X;  3V3X A;  3N1Z C;  4DBG A;  1YJI A;  2KAJ A;  1I4G A;  1C77 A;  4I6L B;  4AUQ C;  3QC8 B;  3RMK C;  3M95 A;  1Z5S B;  4FUL A;  2KJR A;  2JXX A;  4G50 A;  3AUL A;  2KDM A;  3AEB B;  2KVZ A;  2EMT A;  1VCB A;  2G45 B;  2GB1 A;  4RF1 A;  4HPM B;  3ZNI D;  1QOG A;  1WE7 A;  4FBJ B;  1LFD A;  2JRH A;  3TBL D;  4BOS C;  3TIX A;  5C2T B;  1VZ7 A;  2NTT A;  3H1U A;  1C4A A;  3JVZ X;  3NHE B;  3TEY A;  3PRM B;  5EE9 A;  2LXA A;  3AEA B;  2MP2 A;  2K22 A;  4G0N B;  3QHT A;  1E7U A;  1KM7 A;  4ICU A;  1VZ6 A;  4W9J A;  2WXO A;  1YX5 B;  1ZW7 A;  2MRP A;  1WXS A;  1IYF A;  2NBU A;  4TKN A;  2INP E;  3SEB A;  3V61 A;  1AAR A;  2A4Z A;  2J4X A;  4OZC A;  1WXV A;  1GOZ A;  1J19 A;  2RDG A;  5D7G A;  2K8C A;  3DBR B;  2N9L A;  3LYY A;  1WXA A;  3DBH I;  3PSE B;  1FNV A;  2MEK A;  3GOE A;  4B9K A;  2BWF A;  2M17 A;  3KUZ A;  4TQ1 A;  1K8R B;  2LZ6 A;  1KOT A;  2GOW A;  2XK5 B;  3NUH B;  1L0Y B;  1DOY A;  2DZJ A;  2RGF A;  1TBE A;  3P2B A;  2MA9 B;  3OG5 A;  2GBM A;  3VQI A;  5FR6 A;  4K7U A;  3L13 A;  1ROE A;  4K1R B;  4K7W A;  3P4Q B;  2C60 A;  4MSM B;  5AZF A;  5JXV A;  5KHO A;  1PUT A;  4O1N A;  2MJ3 A;  3NS8 A;  2W54 A;  2KQ7 A;  1XCQ L;  1PGB A;  3EHV A;  1MG4 A;  1TTN A;  4WQO B;  2LGX A;  2CHZ A;  5EE3 A;  1ESF A;  1N61 A;  3HK0 A;  1TYG B;  1CMX B;  2W3S A;  3OAW A;  1D5M C;  1GPX A;  2NS5 A;  1WWT A;  1ZGU B;  2JXT A;  3LXF A;  2JQR B;  3NZS A;  2BKF A;  3TEW A;  2LGY A;  3N1X C;  2PE9 A;  4YTM B;  1WJ4 A;  2FCM A;  2H89 B;  2B3A A;  1E90 A;  3DHG C;  2UWQ A;  1H4R A;  2KAN A;  2WLB A;  3Q3N C;  1T0S C;  1YJ1 A;  1P7E A;  3O13 A;  1C76 A;  5D94 A;  1UF0 A;  3UQA A;  3DBH B;  3J9C A;  2KN4 A;  2MX2 A;  3DPD A;  3IVF A;  3L17 A;  4KSL C;  3BVG A;  1J7C A;  2JX5 A;  5H92 C;  2NBV B;  4KZC A;  5EDS A;  2O6V A;  1BT0 A;  1E5W A;  2GBJ A;  4FJY A;  2L8J A;  1E9M A;  4JLC A;  1FO4 A;  2NR2 A;  3Q2A C;  4P1C C;  2HTM E;  1E6E B;  2D3C A;  4NJC A;  4XC2 A;  4A55 A;  3WAM A;  2PJH A;  1ISN A;  1V5T A;  2MBB B;  2WDR B;  1N5W A;  1C3T A;  3AEG B;  2KWU B;  3I57 A;  4GDL B;  5AZH A;  1XCT L;  2K8H A;  2FBW B;  5D3I B;  4IUM B;  4WJP A;  3Q8B A;  1WI0 A;  4JIO U;  2IBI B;  4XWT A;  1UEL A;  1V49 A;  2UYZ B;  3P4R B;  3ZTD A;  2ZCB A;  2LI5 A;  1TT5 B;  2V3N A;  4XWW A;  4YWG G;  4E74 A;  2KTF A;  4DK5 A;  3QA8 A;  2Z59 B;  4A9A A;  1NI3 A;  2D3B A;  1DOX A;  1WF9 A;  5EE1 A;  1F2R C;  2DLB A;  4W9L A;  4NJ6 A;  1FNU A;  2LUM A;  1JWB D;  1PQS A;  3DDC B;  2M56 B;  3HM3 A;  3DBL I;  3H8H A;  4KGR A;  4IWP A;  5C23 A;  1LGR A;  2V4I B;  2QC8 A;  1KF6 B;  1LXD A;  2JWZ A;  4BOZ B;  4AQ7 A;  1VJK A;  4HCP B;  1TIF A;  3ETR A;  5HHD G;  2DYO A;  3LDZ E;  3A33 B;  4AS1 A;  1C4P A;  1FEH A;  1V8C A;  1F77 A;  4R3D A;  3Q3J A;  2M1M A;  4KIK A;  1SE4 A;  4J6I A;  3QJZ A;  4A90 A;  1F1H A;  2BQQ A;  1OFF A;  1OQY A;  3W5V B;  3QX1 A;  3B1L X;  3QWZ B;  4AOF A;  2KC2 A;  5GXG B;  4URK A;  1YOV B;  3AE4 B;  3A9K A;  4MGZ E;  1WJU A;  1I4X A;  3AH7 A;  2KYW A;  1MFW A;  2RR9 A;  3IAM 1;  3RFZ B;  5TR5 A;  4X57 B;  2KO3 A;  4WAF A;  2CS4 A;  3SR6 A;  4HVB A;  1PGX A;  3DBL B;  2LHE A;  3ZO5 B;  3AE9 B;  1Y8R C;  2WXP A;  3L4P A;  4IDI A;  4CQN A;  4W9K A;  3VH4 B;  3QIJ A;  2KAC A;  4KGS A;  1D5Z C;  5D6J B;  1QOF A;  3RT3 B;  4YSX B;  1YMH E;  1P0R A;  1C79 A;  2BYF A;  4B0M A;  3R8B A;  3DVG Y;  2EKI A;  3Q14 C;  1BXT A;  3VUX A;  4EUT A;  1I4Q A;  1P9D U;  1I35 A;  4KKJ A;  3RNE C;  4KX6 B;  2M0A A;  4IW0 A;  2REX A;  4GXB A;  1WE6 A;  2O6V B;  2KJH B;  3C0R B;  3AV8 A;  4AP4 C;  2EKE C;  3CMM B;  4KKI A;  3I5J C;  1F52 A;  1UGJ A;  1WH3 A;  1FRR A;  5LNK 1;  3AE8 B;  3P4S B;  2ZPY A;  4ZDV A;  3EEC A;  2N9K A;  5G5G A;  1E8Y A;  3DBS A;  1E7V A;  1FNW A;  5IN7 A;  3VTV A;  2M8S A;  3Q8E A;  3UI3 A;  3VDZ A;  2MW5 A;  4E3C A;  2D11 A;  3E9S A;  4RH6 A;  3ZKJ C;  4A20 A;  1IP9 A;  3KUD B;  4HK2 A;  1N6Z A;  1C1Y B;  1U4A A;  1MHX A;  4LNO A;  3OJ4 B;  3VTW A;  2NPT B;  2V3S A;  2KFJ A;  3H6N A;  2PMV A;  4W9H A;  4ITK A;  1TY0 A;  2N1W A;  2KOX A;  1CZP A;  2JU6 X;  4LJP B;  4RF0 A;  1JWU D;  4GOC A;  3OWE B;  4JWS C;  4MEM A;  4RFB A;  2DBY A;  3HVD A;  5HKH A;  4KZ0 A;  3MHZ A;  4J3O D;  2WXM A;  3SDL C;  2ZNV C;  2PVO D;  3GB1 A;  2IO1 B;  5IO9 A;  2CHX A;  1WM3 A;  4KDL B;  2LHD A;  2I2Y A;  1QQR A;  1SE2 A;  2K9X A;  2QJL A;  3BVM A;  4FN2 A;  2L0F A;  3BYT B;  5LLI A;  5IP4 D;  1QF6 A;  3UIP B;  2HJ1 A;  4ASW C;  2MBO A;  3HIZ A;  2Y5P A;  4FHK A;  4MM3 A;  1QKZ A;  3DVG X;  3EFU A;  2KTR A;  2J7Q B;  4M8M A;  3K9O B;  4D2K A;  5E6O A;  4C4V A;  4W9F A;  4WH4 A;  1VDV A;  1SEB D;  4DHJ B;  3DCG A;  4WWM A;  5TSS A;  4F8C B;  2GRI A;  1JWA D;  3I9V 1;  5JHA A;  3TCA A;  3R3M A;  2K6Q A;  2BTE A;  5J2R A;  4ANX A;  1XLQ A;  2N9E B;  3SD5 A;  3MJ5 A;  1FXA A;  4BKS A;  4YTN B;  1JRO A;  3IHP C;  3AEF B;  2W82 A;  3APF A;  2FID A;  3KW5 B;  2N1V A;  3RPF C;  3PV1 A;  4UDU C;  1AW7 A;  1ZXH A;  2R61 A;  3L08 A;  2L3Z A;  4HRS A;  4C80 A;  1YN3 A;  4P16 A;  3SFD B;  1RM6 C;  4QAY A;  1WGH A;  4W9E A;  2MSE D;  2QIL A;  2WX1 A;  2L83 A;  1CJE A;  2KFK B;  2PEA A;  2NMQ A;  3JSV B;  2WS3 B;  2WWZ A;  4WIP A;  4L23 A;  1JRP A;  1IBX A;  2N7D A;  1FRD A;  1Q5W B;  4G3X B;  1GC7 A;  3P4P B;  3ZXR A;  1K50 A;  1RRB A;  1SE9 A;  3SFE B;  2Z0E B;  3MJW A;  4XDD A;  3ZDT A;  2IY0 B;  5H8Y E;  2KQ4 X;  1G6J A;  3FC4 A;  2HJ8 A;  2ZW1 A;  4NJ7 A;  4OZB A;  5DPS A;  3WCQ A;  4EFO A;  2DHZ A;  2Q5W D;  3AXC A;  4M0W B;  4HJG E;  4OHJ A;  4W9G A;  3A9J B;  2MLB A;  3AN1 A;  4IG7 B;  3U4E G;  3KYD D;  4RGN A;  5LXH A;  1KLV A;  1NEN B;  3DQV A;  1NEK B;  1V86 A;  4N58 A;  3PZ8 A;  3NY5 A;  2PLP A;  3N1Y C;  3NOB A;  2RMM A;  2DAF A;  2VZK B;  4P7I A;  1TY2 A;  2GMI C;  3V6C B;  1XXG A;  1TS2 A;  2WYQ A;  5GMV A;  5HI1 A;  5DPR A;  2WU2 B;  3U8Z A;  4EEW A;  2BYT A;  4GLS C;  1YN4 A;  4JQW C;  1ZDV A;  4HRO A;  4NAW A;  3TJP A;  2CKH B;  3V60 A;  5EE0 A;  2W9N A;  2LGI A;  3NRZ A;  2KLC A;  2AL3 A;  2LD9 A;  2BT6 A;  4YXD B;  1WFY A;  1FXT B;  1V9J A; 
#chains in the Genus database with same CATH homology
 2INC C;  3RNB C;  3GE3 C;  3DHH C;  4P1B C;  3N20 C;  3N1X C;  1T0R C;  2IND C;  3RNE C;  2RDB C;  1T0Q C;  3Q3M C;  3RN9 C;  3N1Z C;  3RNA C;  3Q3O C;  3DHG C;  3RNF C;  3RI7 C;  3Q2A C;  3Q3N C;  3RNC C;  1T0S C;  4P1C C;  3DHI C;  3GE8 C;  3RMK C;  3RNG C;  3N1Y C;  3I5J C;  3I63 C;  3Q14 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...