3Q2AC

Toluene 4 monooxygenase hd complex with inhibitor p-aminobenzoate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
b'AFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Pseudomonas mendocina
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
total genus 25
structure length 81
sequence length 81
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2010-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3q2aC00
3DHHC 2RDBC 4P1BC 4P1CC 3RNAC 1T0QC 3N1ZC 3I5JC 2INDC 3N1YC 3N20C 3RN9C 3DHGC 3RNFC 3Q14C 3Q2AC 2INCC 3Q3MC 3Q3OC 3RNBC 3RI7C 3DHIC 3GE8C 3Q3NC 3RNCC 3RMKC 1T0RC 3RNGC 3I63C 3RNEC 1T0SC 3N1XC 3GE3C
chains in the Genus database with same CATH superfamily
4DK5A 1IYFA 2ZPNA 3C8YA 2NPTB 3URYA 1OGWA 3ZO5B 1GC6A 1MI0A 4RGTA 1IP9A 2RD0A 2JY6A 3RNBC 3BYYB 1TKYA 2C60A 2AQ2B 2ZNVB 2KK8A 4PYZA 2NPTA 3RPFC 5JZEB 1WGKA 4AJYB 2NVUI 3EECA 5LNK1 1PGXA 4WJOA 1WX8A 2JU6X 3ALBA 2WXPA 2RGFA 4WIPA 4G0NB 1FEHA 1ZGUB 4EZLA 2KDIA 3B0AA 1ZUD2 1ZW7A 4IM3A 4W9HA 4OVZA 5DPRA 4JX1C 3H9DA 1E8WA 2CU3A 4W9CA 3TSSA 1D5MC 1I7HA 4GDLB 3HUIA 4NPNA 2MBEA 1Y56A 4GDKB 3NVYA 2RSUA 5AZGA 1YX6B 2JRHA 3PZ7A 4NZLB 1WMHA 1JROA 2LHDA 1RWSA 1TJEA 3BVZA 4W9JA 1SJHD 4DXFA 4J3OD 1NYQA 1R4NB 4W9FA 1R4MB 2KWCA 3VR8B 1C77A 4GSWA 3GB1A 1I4HA 2DYMA 2WXHA 1TKGA 3BWUD 4MACA 4YSZB 4WWMA 3E9SA 2W54A 3PTFC 3NG0A 1EM7A 2IY1B 2HTHA 4JGHB 4LJOB 1LO5D 2FNJB 1F2RC 2IGDA 1FFVA 2K39A 1P7FA 2VZKD 1T6BX 5DPSA 2C7NB 2WX1A 2KLCA 2XEWA 4FN2A 1Q10A 3Q14C 2Q5WD 2V3PA 4Q2JA 3T3OA 5LLIA 3DHIC 3L17A 4GIVA 2KN5A 3BZDB 4RM8A 1VJKA 1QOGA 1FRDA 1WWTA 3R2TA 3RT3B 1TGZB 3GE3C 3TMPB 3P4RB 4OZCA 1YN5A 3AB5A 2WDVB 3W2DA 1WZ0A 2GOWA 2KTRB 2ZZPB 1GG3A 3GZNB 3Q3OC 2K9XA 3T9LA 3AE2B 1LGRA 1AYFA 1V86A 4ICUA 3U8ZA 1WF9A 1C1YB 4RFBA 2BGFA 2W55A 4H2AA 1LM8B 1WI0A 1WYWB 1YQ4B 1UZXB 3A4RA 2DYOA 3MJWA 1PFDA 2O6VD 3FAHA 3ZJVA 1JALA 2WGSA 2BWES 1EU3A 4IG7B 1BMLC 3NZSA 2V4IB 4C56C 1RRBA 4FADA 4B6WA 1C76A 4P1CC 1NVID 1XLQA 2CS4A 1C4CA 2KACA 2WU5B 2K25A 2WXNA 1LFDA 4PYUA 1TS5A 2J0MA 3QC8B 2ASQA 3UQAA 4PT5A 4NQLB 3BYTB 1WRIA 3AU4A 4DXGA 4IOIE 1WGDA 3AEEB 3A4SC 4HPPA 2LJ5A 1H8CA 2LGSA 2QCZA 1PUTA 1PQSA 5T8IA 2LGIA 5EE0A 2D3AA 2ZPYA 3I5JC 1VZ7A 1WM2A 3PLUA 1UGMA 3UINB 2WXMA 3U7ZA 2WHIA 2TSSA 1G6JA 4DHJB 3R7QA 2JVCA 2JWUA 5D94A 5C1ZA 2UYZB 3IVFA 2EKEC 3VRBB 4K7SA 4KGSA 2D3GA 4C7ZA 3FILA 4MGKE 3DBHB 2KNBA 4YWGG 1R7SA 3DQVA 2DAJA 2O6VB 2N9EB 2GMIC 2KFKA 2Y5BB 2FAZA 3ABVB 3QWZB 3WIMA 2KX0A 4HCPB 4HDOA 5C2TB 4BKSA 1HZ5A 4GN1A 4TMAB 2I38A 5E6JA 1I4RA 2HD5B 4GMVA 4HRSA 3WCQA 3QK0A 3WAMA 1GAQB 2LXAA 3NOBA 1E7UA 2JWZA 3RZWC 2J0KA 2FBWB 4C4VB 2CU1A 1EWYC 2NCNA 2BB5A 2Y5PA 3ZXRA 2WXKA 3RUIB 1QOFA 2INPE 1ZOYB 3P4SB 2LGYA 3NY5A 2KYWA 2BYFA 2BKRB 2ZNVC 3N1XC 1PGBA 1R4NI 2JZPA 4GDKA 1KH0A 1FO4A 2HJ8A 4IDIA 4JQWC 3L10B 1OEYJ 3MFGA 2IJ0A 4K3BA 3AI5A 4X57B 1WXAA 3OAWA 1KLUD 3MP9A 3VHTC 1ENFA 4KZCA 4WAAA 5TR5A 4BKTA 2L83A 5G5HA 3Q3JA 4YTPB 3P4QB 4W9LA 2INDC 1AN8A 3PSEB 2QJLA 2IDYA 5J2RA 4N58A 3U2SC 2PLPA 2DLBA 2KDEB 4LNIA 2AL3A 2G3QB 3VH4B 2NS5A 3ZNGC 5LXIB 3UQBA 2J42A 2KJHB 4DDGD 3QAQA 4FHJA 4IM0A 2WLBA 2AEHA 3PRPB 5BYRA 1WJNA 3KH0A 1JMLA 1WX9A 4OZBA 2IY0B 2EKIA 3TEZA 3TBLD 1KRHA 2KC1A 2D2QA 2ZW0A 2D5GA 1K50A 3Q8AA 1OQQA 1E90A 2DX5B 1V6EA 3DBLI 5BYQA 3VH3B 2KTRA 1N5XA 2CHWA 3VUXA 5AUKA 1T5XD 1DYQA 2I1KA 1YJ1A 3NHEB 2JYTA 3N9YC 1TZOA 3DBRB 2VRRB 3AMZA 5BMGA 3A9JB 4ZRKA 4MGYE 4II3B 5AUIA 3TL5A 3KVFB 1WE6A 2BWFA 2DAFA 4A3PA 1C78A 2ZVOA 3LDZE 3ONSA 5D2MB 1MVKA 2KOXA 3CSFA 3NVWA 1TS4A 5EE1A 4DQOC 4MDKE 3TEYA 2J4XA 4FHKA 1DGJA 3IAM1 3ZW3A 2ZJDA 1KOTA 3NJTA 1OQYA 2ZCBA 5DCNA 3DPDA 1YIWA 2KC2A 3EHVA 1E7PB 5EE3A 2R2QA 4KIKA 4EEWA 2IBIB 1SBBB 2MX2A 1WYGA 4AOFA 4LDTB 1YQ3B 1V1OA 3ML8A 4M0WB 3W1SC 2NR2A 1RFAA 4HXDA 1STEA 2MH7A 4KSKC 3VVWB 1UWMA 2OJWA 4MM3A 2KAJA 2IPKD 3U52E 3V61A 1GPXA 4MSMB 2AWTA 4KIKB 2L00B 1V9JA 2WXGA 3I63C 3M3JA 2VH1A 2RPVA 2FCQA 4TQ1A 1QT9A 4NY0A 2BPSA 2BYTA 4BKGA 4IWPA 4LJPB 2L7RA 3I3TB 2WP9B 2M17A 2M0XA 4LNNA 2E3TA 3A1QA 2W3SA 3H7SA 3UIOB 2JT4B 2EMTA 1WMHB 4W9DA 1ZP0B 4ACFA 1RFKA 4TQ0A 2PKOA 2JSVX 1JWMD 2LGXA 2N7DA 4HKZE 2KXJA 1F2RI 3ZRFA 3AE4B 3ZQ4A 3UIPB 4JLCA 4WJNA 5J18A 1N61A 3ZVVA 1E8YA 4P6VF 3VUWA 3B2GA 3L54A 1JWSD 3W5VB 4TV3A 1TY0A 4BZAA 1WSPA 5CTRC 2JZZA 1CK1A 3LJ3A 3R8BA 2LUMA 2IO3B 2LRUA 3DVNU 1PDXA 2WXIA 2YEPF 1J8CA 1L7YA 1J7BA 4IM2A 3V6EB 4B0EA 2N9PC 2CJNA 1J0GA 3IXSA 2WXJA 3MC9A 4ZRQA 1VRAB 1WZ3A 3AN1A 3DBHI 1EU4A 2KWUB 2LFIA 3LYYA 1Q1OA 2GBNA 3NRZA 2B3AA 1MHXA 3MTNB 2ZVNA 1IPGA 4EZKA 1RLFA 2MJDA 2JYEA 1Y8RC 3EFCA 1JWUD 2INCC 3AXCA 4FJVB 2Y3AA 3RMKC 2J0JA 3RZFA 3PPAA 2AX5A 3DBSA 1JRPA 2D3BA 1C4AA 3MC0B 1TZ1A 2BYEA 3APDA 1QZEA 1EO6A 4OVUA 3N1YC 3AE7B 4JIOU 3ZRCA 3LXFA 3DHGC 4WJPA 3JYUA 3T8MA 2DBYA 2QC8A 1L5PA 4G11A 4ZOHC 1WM3A 3Q8CA 1SGHA 5H92C 1GNUA 3N30A 2GBKA 3CSTA 1XO3A 1QF6A 4N59A 1I4XA 3P1MA 2Z0DB 2QDFA 3IT4B 1HEZE 4NAMA 1D3ZA 3H6NA 2OEDA 2CHXA 1IBXB 3JSVA 3HM6X 1IUEA 4ZYNA 3NVVA 1D4BA 3JW0X 1D5ZC 3AU5A 1TIFA 3VFKA 2D10A 2MRPA 5FK9C 4RF0A 3V6CB 3W1SA 1SIJA 3KUZA 3U4EG 4US9A 4ZYSA 3I9V1 5D3IB 3Q3MC 3SEBA 2KDBA 3D32A 2JPHA 4TKNA 1I4GA 4ITKA 3UGBB 3IFWB 1FXIA 2LI5A 2Z8LA 1JW9D 2N4FA 5CX3A 2KJ6A 4DHZE 3BY4B 3ZDMC 2FCSA 3DCGA 3Q8FA 3CF6E 5L95C 1HA5A 1SEBD 1IGCA 1KJTA 1XF5L 2C7HA 2LVQA 3BVGA 4HEA1 2PE6B 4DWFA 2BKFA 4RGOS 4ANUA 1UH6A 4I6PA 5BMHA 1WJUA 1YOVB 4URKA 2NBVB 3PZ8A 1HXYD 3NVZA 3B2FA 4F7ZA 1KM7A 1V97A 4DBGA 3A9KA 1TKEA 3PHXB 3ML9A 3KLSX 1J7CA 3APFA 1V5TA 3E56A 1A5RA 3L08A 3KW5B 3P4PB 4LK0M 4UDUC 2NBUA 1Q0WB 1EF5A 4I6LB 2KMAA 1N60A 2KDMA 3RN9C 1MG4A 4B9KA 2XK5B 2WU2B 2DWQA 4QAYA 2LRWA 2PVGC 4MGIE 2JXTA 3TEXA 2N0SB 4HLEA 2LMCA 4CYEA 4WURA 2WDRB 4B95A 2V3NA 2UU7A 1P0RA 3L13A 4ANWA 1NENB 1OFFA 2LZ6A 2L3ZA 2M1MA 1JRUA 3AE6B 4YL8A 3P2BA 3W5UB 2UWQA 3VR9B 1I4QA 1BT0A 3DWGC 3UI3A 4LDTD 3V05A 5FKAC 2B76B 3L4PA 2KN4A 5BMIA 1SE2A 2G4DB 1RYJA 2BB6A 4ZHPA 1XCQL 4AP4C 2JF5A 3H8HA 5FR3A 1F0ZA 2V1YA 1HTQA 3SDLC 2N9LA 1K8RB 1L6VA 2NTSA 1ROEA 4RM9A 1K51A 4E71A 4S0RA 4W9EA 1BXTA 2BS4B 4W9GA 2FUHB 4A6QA 1VLBA 1FD6A 1HTOA 5G55A 1MHHE 2RR9A 3W1YA 1J19A 3AM9A 5AZHA 2DZKA 4YT0B 1SE4A 4ZDVA 5KHOA 2L52A 4NNJB 1GUAB 3EFUA 5E6PA 4HPMB 2X8XX 2WXLA 1BUIC 4EOYA 1XLNA 4HJGE 1NI3A 2QSDA 1V49A 3N20C 4BOSC 1MFWA 4ANVA 4K3CA 1UNSA 3X0WA 2ON8A 3KYCD 4HROA 1SE9A 1UWXA 1OEYA 2ZCCA 3H7PB 1WJ4A 2Z0EB 2DYBA 3R66C 3RFZB 2HJ1A 3AE1B 3ZNHB 4B0MA 2MCNB 3KUDB 3K9OB 2PVOD 3R2IA 1B9RA 2MJEA 1SIFA 4XDDA 5CHVC 4LTUA 2N7JA 1T0RC 1KLGD 3H1UA 3VAWA 3CMMB 1TBEA 1DOXA 1FFUA 2NMQA 5HHDG 1QQRA 5HI1A 1X1MA 2MP2A 1UBIA 2C5LC 2G1EA 3AEBB 2L32A 1GC7A 3M95A 1WX7A 1XLOA 4KDIC 4P16A 5EE9A 4BOZB 3EGRA 2KMCA 4E3CA 2WXOA 4G50A 5CHWA 2L0TA 5E6OA 4FA6A 4BVUC 3V62A 2FCMA 3DHHC 2K6QA 2MP2B 1CMXB 3RNAC 4K7UA 1FCCC 3VUYA 3ZTDA 3A9JA 3RULA 3ZNZB 3RI7C 2ZW1A 4XGAB 4XWTA 1E10A 3DVGX 2JUOA 2LVPA 1ZKHA 5JHBA 5HFYA 1SJED 2GI9A 3VQIA 3HHMA 1AWDA 4JPSA 1WXQA 1VR9A 3ZXVA 4GGQA 1CJEA 1WE7A 2M56B 3DVNV 1DOIA 2KFJA 4RGNA 1M94A 1E9MA 3DVGY 4HWIB 1P98A 2WS3B 4XC2A 3EUB2 3QARA 1WXMA 4S17A 5FR6A 4JE3B 1WIAA 3C19A 1IGDA 3AV8A 5EDSA 4RF1A 3PO0A 1L4ZB 1GB4A 4L23A 4M8NA 3WAPA 1GJZA 2L76A 4F1SA 4FLHA 2KWVB 3NUHB 1L0VB 3PVLA 2LUEA 4A90A 4OVVA 3VRAB 2L0FA 1H4RA 1XLPA 1T0SC 2PJHA 4A20A 3CIRB 2K5PA 4NJCA 2V4LA 2C7MB 4FXCA 1YN3A 1T0QC 1JWAD 4HCNB 2RPQA 4ICVA 4NAWA 4RCOA 1WFYA 2CHZA 1ZPSA 2WXQA 4KX6B 1N5WA 1QILA 4P7IA 4KVGB 1UUPA 3ENEA 3RNEC 2L1AA 4GU2A 3Q69A 2BF8B 2KD0A 4P1BC 2W82A 2ICIA 2K8CA 1NBFC 4FULA 4IC7B 3T3NA 1VCBA 3TCAA 1EF1A 1FCLA 1WJ6A 2Z59B 1V81A 3M62B 1XT9B 3V60A 3KUCB 3PZDA 1Z5SB 2RDBC 1E6EB 3WAOA 4YXDB 2QIEB 2EMSA 4TUUA 3PS6A 1EWCA 5LXHA 2IGGA 1GOZA 4ASWC 3L16A 3R3MA 2DNFA 5TSSA 1DOYA 5C3JB 2R61A 5GXGB 2INNE 3IG3A 1P3QU 2N1WA 3GZNI 4RGMA 2CKHB 2OOBB 3AE8B 4YTMB 1HQRD 2KHWB 3ZKJC 3PT2B 3U7DA 1SSNA 2FE8A 4HK2A 3OWEB 2M0AA 3NZ3A 4ANXA 1WY8A 2K0PA 5HG2A 3NS1A 3DDCB 4M02A 1L4DB 4JWUC 1E8XA 4CHKA 4ARIA 3NS8A 2K22A 4KGRA 5DPWA 3N32A 3QX1A 4DDID 1TTNA 4MT5A 1PYWD 2GBJA 2H89B 3AEGB 1T3QA 2PEAA 1WXSA 1YJJA 2JQRB 4G3XB 4PK1A 4HKQA 5IN7A 3RCZA 3L0WB 3Q3NC 1V2YA 4MJSA 5JXVA 4M0WA 4L2YA 2NTTA 4I6NB 3ZYYX 1ZDVA 2CR5A 1FM0D 1IBXA 3DBLB 1V5OA 3PHWB 4WAFA 1E0ZA 2BS2B 5KHQA 1L6UA 2PTLA 2QILA 2W3RA 4MSQB 2H88B 3QA8A 4IWQA 1E5WA 2XNAC 3JSVB 2FCNA 2MBQA 3OJ4B 3B9JA 3I57A 4LNFA 4KKIA 3SR6A 2MW5A 4FJYA 2MSED 1CQVA 2AQ3B 4WH4A 1K52A 1OTRB 1YNTE 4BFRA 2AQ1B 2LVOA 3B1LX 1L0YB 5IA7A 2G45B 4KGTA 4AQ7A 3R7RA 1C9FA 3JVZX 1RM6C 1WGYA 2LD9A 4JWSC 2KQSA 2IYDB 2BW2A 1ZXHA 2V9HA 3Q3FA 3SFEB 1MG8A 2DZIA 2K8HA 3LB8C 2O6VA 5HKHA 2QEJC 3KQ4A 5I4DA 2SEBD 2YLMA 4A8XC 5IAAC 3Q8BA 2DHZA 2MA9B 1A70A 5JH5C 2KWDA 4KDLB 3QJZA 4E74A 2WXRA 2ZEQA 2V0GA 2N9KA 1ZE3D 4PS3A 2K8BA 2IO2B 3NZUA 3P63A 2HE7A 4FBJB 2XBBC 1L0XB 2Y5CA 3X23A 2J7QB 3TJPA 1F1HA 3VXWA 4RMAA 4ARCA 4EZJA 4YSXB 2CJOA 2K1FA 2KJRA 3PGEA 4TSSA 3Q6BA 2GBMA 2IZVB 5G2NA 1F9JA 3ZJUA 1LQBA 4R3DA 4WWNA 3P42A 2XK5A 3N1ZC 1SE3A 3APCA 3GS2A 2W9NA 3HVDA 4N6EB 1B1ZA 4IKGA 1YX5B 4HJKA 5AEKB 1FXAA 3M63B 5D7GA 3AE9B 2J52A 2KO3A 2N9XA 2I1JA 3WALA 5L83A 2OHFA 4KZ0A 1N63A 1S1QB 2ACZB 1QKZA 1WGHA 1QOAA 4C80A 4AS1A 3Q2AC 4LNOA 1UD7A 2MBBB 4GB9A 2BVCA 4DHJD 1T0YA 1Z2MA 5BYSA 2K3UA 4JL9A 2FIDA 2BYVE 4D2KA 4EFOA 5C23A 3TEWA 4AUQC 4MGZE 4WJQA 4C7YA 1CZPA 2MLBA 2WXFA 4K1RB 1AW7A 2KLGA 2KVRA 3SD5A 2KQ7A 2HTME 4GOCA 3VDZA 4EKUA 2VH2A 3BINA 1WRDB 2MHJA 1JWBD 3VTWA 2N1VA 2R2OA 3RYTA 3SU8X 4EE2A 2A5UA 1YMHE 2FUG1 4GDLA 3OLMD 1L2NA 2REXA 2G4SA 2PPHA 4MH8A 4IW0A 2HDEA 4AJWA 3DOWA 3ZLZA 4HVBA 2GRIA 2MBOA 3AE3B 4WWPA 2PE9A 1WXVA 1KF6B 4IUMB 4F8CB 1WGRA 1UELA 1E8ZA 1XCTL 2RMMA 2IGHA 3RNGC 3PRMB 2DZMA 1D6EC 1MJDA 1N6ZA 2KMMA 4MJSB 4KKJA 2J53A 1NEKB 2C9WB 2AYOB 2BS3B 2XN9C 5CHFA 2KTFA 4K7WA 2WNMA 4A3OA 3RNFC 2KDFB 1I42A 1SXTA 1JQ4A 1WGGA 4WQMA 1I35A 1FNVA 1UGJA 3QCAA 3GOEA 3ZDTA 4FJZA 3DWMA 4XYCA 2PW9A 4A9AA 3VTUA 3PLVA 4WWOA 2PMVA 5J17A 1WH3A 1OQRA 3SHQA 3A1QB 2EELA 1QOBA 2M8SA 2KX3A 3GE8C 2X38A 2I2YA 3WA0A 4ZRPA 4J6IA 1N62A 2O2VB 3AECB 5IKCM 1V1PB 3TUOA 3DBRI 3AEAB 3CWIA 4HPLB 5IO9A 2MEKA 3C0RB 1P1AA 1ZXIA 4OW0A 4W9KA 3KYDD 1FXTB 4NQKE 4CO7A 1VD2A 1P7EA 5BO4B 1FNWA 2FIFA 2WQYB 3W9CB 3AE5B 1SF0A 3FKYA 3AEFB 2DZJA 3HM3A 2M19A 5IP4D 2LEKA 2BT6A 1TS3A 4ZRJA 1V80A 3HIZA 2BQQA 4KV2A 1V1PA 2MBHA 4RNAA 1JCKB 1J7AA 1AARA 5IOIA 3FC4A 3U30A 2KFKB 3AH7A 3ZNID 1ZDXA 3V3XA 3N3KB 4OZAA 4NJ6A 1YJIA 3BIID 2K6DB 2LWPA 3J9CA 2M4NA 4BAXA 1YD8U 4LNKA 1TT5B 1RAXA 3B08A 1VDVA 3ZIMA 1I4PA 2QMTA 3VTVA 2RDGA 5AZFA 1S3SG 1YQBA 4XZ4A 4USAA 4IWOA 4C00A 2G9HD 2KVZA 1MPEA 2O2VA 3MJ5A 1F77A 2WWZA 1NI2A 4YSYB 4ZHOA 4DHZB 1XXGA 2WDQB 2IO1B 5H8YE 3QHTA 2JXXA 4NAWB 4K81A 4II2B 4XX5A 3S2AA 1NDDA 2VZKB 2YVCA 1FNUA 3QIJA 1WR6E 2ONQA 3A33B 3O13A 1NYRA 1XEEA 1TS2A 4A55A 1C3TA 2QHOA 1ET6A 3BVMA 1HE8A 1EUVB 4HDQA 1P9DU 4WQOB 1M4VA 2JRIB 1KLVA 3GP7A 4XE0A 4M8MA 2A4ZA 3AEDB 2MJ3A 3KWLA 1ACCA 1HZ6A 3ZJTA 3BK2A 4N9F4 2N7EA 3WANA 1PGAA 2AL6A 3QQ8B 4AWJA 4XDCA 1GB1A 1TYGB 1KFYB 1R4MI 2LHEA 1KTKA 2SAKA 2V3SA 4YTNB 4PS8A 2KQ4X 2L8JA 2WX0A 2KT7A 2GLSA 1TY2A 2PIAA 2YEPB 2MQJA 5G5GA 4EUTA 3SFDB 2E6XA 3ZUNA 1UF0A 3MC8A 2JX5A 1C79A 2D11A 3AULA 3IAS1 3PV1A 4O1NA 3Q8EA 4XWWA 2GB1A 5D6JB 3K9PB 3MHSD 5E6NA 4GXBA 2WDTB 4W9IA 3IT6B 3MHZA 2OJRA 1FPYA 1ESFA 2BBCA 2JZ3B 2KANA 4BBNF 3RNCC 1YN4A 2NBWB 3IHPC 1XD3B 1UBQA 4US8A 4BBNC 4MM3B 4NJ7A 5MPOA 4MH0E 3ZGZA 2WYQA 2LXCA 2LASA 1XQQA 3EC8A 3OG5A 4GLSC 3ETRA 1V8CA 3PREA 5DPTA 1E7VA 1U4AA 1LXDA 2DENB 2BTEA 2RDHA 4DXAB 4KSLC 1SB3C 3FILB 4BKSD 1FRRA 4LLGM 3TIXA 4M01A 3OJ3A 2D07B 5D3DA 4REZA 4M00A 1FMAD 4CQNA 4PS7A 5JHAA 3UF8A 3HK0A 1D5XC 1K53A 2IO0B 4OHJA 3O65B 2GBRA 2D3CA 2LJIA 5GMVA 4MEMA 2KKCA 3ECIA 2LGDA 3H7PA 1VZ8A 3PRZA 1F52A 1WR1A 1ISNA 2L05A 3BK1A 4LCDE 3EA6A 3KWVA 1C4PA 3ZTCA 3RD2A 3HRDD 2MWSB 4C4VA 1ET9A 3IBEA 4MELA 4ZRIA 1Q5WB 2KZRA 1FIQA 3A9KB 3HVZA 1VZ6A 4L1BA 4RH6A 1QLBB
chains in the Genus database with same CATH topology
3DHHC 2RDBC 4P1BC 4P1CC 3RNAC 1T0QC 3N1ZC 3I5JC 2INDC 3N1YC 3N20C 3RN9C 3DHGC 3RNFC 3Q14C 3Q2AC 2INCC 3Q3MC 3Q3OC 3RNBC 3RI7C 3DHIC 3GE8C 3Q3NC 3RNCC 3RMKC 1T0RC 3RNGC 3I63C 3RNEC 1T0SC 3N1XC 3GE3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHH C;  2RDB C;  4P1B C;  4P1C C;  3RNA C;  1T0Q C;  3N1Z C;  3I5J C;  2IND C;  3N1Y C;  3N20 C;  3RN9 C;  3DHG C;  3RNF C;  3Q14 C;  3Q2A C;  2INC C;  3Q3M C;  3Q3O C;  3RNB C;  3RI7 C;  3DHI C;  3GE8 C;  3Q3N C;  3RNC C;  3RMK C;  1T0R C;  3RNG C;  3I63 C;  3RNE C;  1T0S C;  3N1X C;  3GE3 C; 
#chains in the Genus database with same CATH topology
 4DK5 A;  1IYF A;  2ZPN A;  3C8Y A;  2NPT B;  3URY A;  1OGW A;  3ZO5 B;  1GC6 A;  1MI0 A;  4RGT A;  1IP9 A;  2RD0 A;  2JY6 A;  3RNB C;  3BYY B;  1TKY A;  2C60 A;  2AQ2 B;  2ZNV B;  2KK8 A;  4PYZ A;  2NPT A;  3RPF C;  5JZE B;  1WGK A;  4AJY B;  2NVU I;  3EEC A;  5LNK 1;  1PGX A;  4WJO A;  1WX8 A;  2JU6 X;  3ALB A;  2WXP A;  2RGF A;  4WIP A;  4G0N B;  1FEH A;  1ZGU B;  4EZL A;  2KDI A;  3B0A A;  1ZUD 2;  1ZW7 A;  4IM3 A;  4W9H A;  4OVZ A;  5DPR A;  4JX1 C;  3H9D A;  1E8W A;  2CU3 A;  4W9C A;  3TSS A;  1D5M C;  1I7H A;  4GDL B;  3HUI A;  4NPN A;  2MBE A;  1Y56 A;  4GDK B;  3NVY A;  2RSU A;  5AZG A;  1YX6 B;  2JRH A;  3PZ7 A;  4NZL B;  1WMH A;  1JRO A;  2LHD A;  1RWS A;  1TJE A;  3BVZ A;  4W9J A;  1SJH D;  4DXF A;  4J3O D;  1NYQ A;  1R4N B;  4W9F A;  1R4M B;  2KWC A;  3VR8 B;  1C77 A;  4GSW A;  3GB1 A;  1I4H A;  2DYM A;  2WXH A;  1TKG A;  3BWU D;  4MAC A;  4YSZ B;  4WWM A;  3E9S A;  2W54 A;  3PTF C;  3NG0 A;  1EM7 A;  2IY1 B;  2HTH A;  4JGH B;  4LJO B;  1LO5 D;  2FNJ B;  1F2R C;  2IGD A;  1FFV A;  2K39 A;  1P7F A;  2VZK D;  1T6B X;  5DPS A;  2C7N B;  2WX1 A;  2KLC A;  2XEW A;  4FN2 A;  1Q10 A;  3Q14 C;  2Q5W D;  2V3P A;  4Q2J A;  3T3O A;  5LLI A;  3DHI C;  3L17 A;  4GIV A;  2KN5 A;  3BZD B;  4RM8 A;  1VJK A;  1QOG A;  1FRD A;  1WWT A;  3R2T A;  3RT3 B;  1TGZ B;  3GE3 C;  3TMP B;  3P4R B;  4OZC A;  1YN5 A;  3AB5 A;  2WDV B;  3W2D A;  1WZ0 A;  2GOW A;  2KTR B;  2ZZP B;  1GG3 A;  3GZN B;  3Q3O C;  2K9X A;  3T9L A;  3AE2 B;  1LGR A;  1AYF A;  1V86 A;  4ICU A;  3U8Z A;  1WF9 A;  1C1Y B;  4RFB A;  2BGF A;  2W55 A;  4H2A A;  1LM8 B;  1WI0 A;  1WYW B;  1YQ4 B;  1UZX B;  3A4R A;  2DYO A;  3MJW A;  1PFD A;  2O6V D;  3FAH A;  3ZJV A;  1JAL A;  2WGS A;  2BWE S;  1EU3 A;  4IG7 B;  1BML C;  3NZS A;  2V4I B;  4C56 C;  1RRB A;  4FAD A;  4B6W A;  1C76 A;  4P1C C;  1NVI D;  1XLQ A;  2CS4 A;  1C4C A;  2KAC A;  2WU5 B;  2K25 A;  2WXN A;  1LFD A;  4PYU A;  1TS5 A;  2J0M A;  3QC8 B;  2ASQ A;  3UQA A;  4PT5 A;  4NQL B;  3BYT B;  1WRI A;  3AU4 A;  4DXG A;  4IOI E;  1WGD A;  3AEE B;  3A4S C;  4HPP A;  2LJ5 A;  1H8C A;  2LGS A;  2QCZ A;  1PUT A;  1PQS A;  5T8I A;  2LGI A;  5EE0 A;  2D3A A;  2ZPY A;  3I5J C;  1VZ7 A;  1WM2 A;  3PLU A;  1UGM A;  3UIN B;  2WXM A;  3U7Z A;  2WHI A;  2TSS A;  1G6J A;  4DHJ B;  3R7Q A;  2JVC A;  2JWU A;  5D94 A;  5C1Z A;  2UYZ B;  3IVF A;  2EKE C;  3VRB B;  4K7S A;  4KGS A;  2D3G A;  4C7Z A;  3FIL A;  4MGK E;  3DBH B;  2KNB A;  4YWG G;  1R7S A;  3DQV A;  2DAJ A;  2O6V B;  2N9E B;  2GMI C;  2KFK A;  2Y5B B;  2FAZ A;  3ABV B;  3QWZ B;  3WIM A;  2KX0 A;  4HCP B;  4HDO A;  5C2T B;  4BKS A;  1HZ5 A;  4GN1 A;  4TMA B;  2I38 A;  5E6J A;  1I4R A;  2HD5 B;  4GMV A;  4HRS A;  3WCQ A;  3QK0 A;  3WAM A;  1GAQ B;  2LXA A;  3NOB A;  1E7U A;  2JWZ A;  3RZW C;  2J0K A;  2FBW B;  4C4V B;  2CU1 A;  1EWY C;  2NCN A;  2BB5 A;  2Y5P A;  3ZXR A;  2WXK A;  3RUI B;  1QOF A;  2INP E;  1ZOY B;  3P4S B;  2LGY A;  3NY5 A;  2KYW A;  2BYF A;  2BKR B;  2ZNV C;  3N1X C;  1PGB A;  1R4N I;  2JZP A;  4GDK A;  1KH0 A;  1FO4 A;  2HJ8 A;  4IDI A;  4JQW C;  3L10 B;  1OEY J;  3MFG A;  2IJ0 A;  4K3B A;  3AI5 A;  4X57 B;  1WXA A;  3OAW A;  1KLU D;  3MP9 A;  3VHT C;  1ENF A;  4KZC A;  4WAA A;  5TR5 A;  4BKT A;  2L83 A;  5G5H A;  3Q3J A;  4YTP B;  3P4Q B;  4W9L A;  2IND C;  1AN8 A;  3PSE B;  2QJL A;  2IDY A;  5J2R A;  4N58 A;  3U2S C;  2PLP A;  2DLB A;  2KDE B;  4LNI A;  2AL3 A;  2G3Q B;  3VH4 B;  2NS5 A;  3ZNG C;  5LXI B;  3UQB A;  2J42 A;  2KJH B;  4DDG D;  3QAQ A;  4FHJ A;  4IM0 A;  2WLB A;  2AEH A;  3PRP B;  5BYR A;  1WJN A;  3KH0 A;  1JML A;  1WX9 A;  4OZB A;  2IY0 B;  2EKI A;  3TEZ A;  3TBL D;  1KRH A;  2KC1 A;  2D2Q A;  2ZW0 A;  2D5G A;  1K50 A;  3Q8A A;  1OQQ A;  1E90 A;  2DX5 B;  1V6E A;  3DBL I;  5BYQ A;  3VH3 B;  2KTR A;  1N5X A;  2CHW A;  3VUX A;  5AUK A;  1T5X D;  1DYQ A;  2I1K A;  1YJ1 A;  3NHE B;  2JYT A;  3N9Y C;  1TZO A;  3DBR B;  2VRR B;  3AMZ A;  5BMG A;  3A9J B;  4ZRK A;  4MGY E;  4II3 B;  5AUI A;  3TL5 A;  3KVF B;  1WE6 A;  2BWF A;  2DAF A;  4A3P A;  1C78 A;  2ZVO A;  3LDZ E;  3ONS A;  5D2M B;  1MVK A;  2KOX A;  3CSF A;  3NVW A;  1TS4 A;  5EE1 A;  4DQO C;  4MDK E;  3TEY A;  2J4X A;  4FHK A;  1DGJ A;  3IAM 1;  3ZW3 A;  2ZJD A;  1KOT A;  3NJT A;  1OQY A;  2ZCB A;  5DCN A;  3DPD A;  1YIW A;  2KC2 A;  3EHV A;  1E7P B;  5EE3 A;  2R2Q A;  4KIK A;  4EEW A;  2IBI B;  1SBB B;  2MX2 A;  1WYG A;  4AOF A;  4LDT B;  1YQ3 B;  1V1O A;  3ML8 A;  4M0W B;  3W1S C;  2NR2 A;  1RFA A;  4HXD A;  1STE A;  2MH7 A;  4KSK C;  3VVW B;  1UWM A;  2OJW A;  4MM3 A;  2KAJ A;  2IPK D;  3U52 E;  3V61 A;  1GPX A;  4MSM B;  2AWT A;  4KIK B;  2L00 B;  1V9J A;  2WXG A;  3I63 C;  3M3J A;  2VH1 A;  2RPV A;  2FCQ A;  4TQ1 A;  1QT9 A;  4NY0 A;  2BPS A;  2BYT A;  4BKG A;  4IWP A;  4LJP B;  2L7R A;  3I3T B;  2WP9 B;  2M17 A;  2M0X A;  4LNN A;  2E3T A;  3A1Q A;  2W3S A;  3H7S A;  3UIO B;  2JT4 B;  2EMT A;  1WMH B;  4W9D A;  1ZP0 B;  4ACF A;  1RFK A;  4TQ0 A;  2PKO A;  2JSV X;  1JWM D;  2LGX A;  2N7D A;  4HKZ E;  2KXJ A;  1F2R I;  3ZRF A;  3AE4 B;  3ZQ4 A;  3UIP B;  4JLC A;  4WJN A;  5J18 A;  1N61 A;  3ZVV A;  1E8Y A;  4P6V F;  3VUW A;  3B2G A;  3L54 A;  1JWS D;  3W5V B;  4TV3 A;  1TY0 A;  4BZA A;  1WSP A;  5CTR C;  2JZZ A;  1CK1 A;  3LJ3 A;  3R8B A;  2LUM A;  2IO3 B;  2LRU A;  3DVN U;  1PDX A;  2WXI A;  2YEP F;  1J8C A;  1L7Y A;  1J7B A;  4IM2 A;  3V6E B;  4B0E A;  2N9P C;  2CJN A;  1J0G A;  3IXS A;  2WXJ A;  3MC9 A;  4ZRQ A;  1VRA B;  1WZ3 A;  3AN1 A;  3DBH I;  1EU4 A;  2KWU B;  2LFI A;  3LYY A;  1Q1O A;  2GBN A;  3NRZ A;  2B3A A;  1MHX A;  3MTN B;  2ZVN A;  1IPG A;  4EZK A;  1RLF A;  2MJD A;  2JYE A;  1Y8R C;  3EFC A;  1JWU D;  2INC C;  3AXC A;  4FJV B;  2Y3A A;  3RMK C;  2J0J A;  3RZF A;  3PPA A;  2AX5 A;  3DBS A;  1JRP A;  2D3B A;  1C4A A;  3MC0 B;  1TZ1 A;  2BYE A;  3APD A;  1QZE A;  1EO6 A;  4OVU A;  3N1Y C;  3AE7 B;  4JIO U;  3ZRC A;  3LXF A;  3DHG C;  4WJP A;  3JYU A;  3T8M A;  2DBY A;  2QC8 A;  1L5P A;  4G11 A;  4ZOH C;  1WM3 A;  3Q8C A;  1SGH A;  5H92 C;  1GNU A;  3N30 A;  2GBK A;  3CST A;  1XO3 A;  1QF6 A;  4N59 A;  1I4X A;  3P1M A;  2Z0D B;  2QDF A;  3IT4 B;  1HEZ E;  4NAM A;  1D3Z A;  3H6N A;  2OED A;  2CHX A;  1IBX B;  3JSV A;  3HM6 X;  1IUE A;  4ZYN A;  3NVV A;  1D4B A;  3JW0 X;  1D5Z C;  3AU5 A;  1TIF A;  3VFK A;  2D10 A;  2MRP A;  5FK9 C;  4RF0 A;  3V6C B;  3W1S A;  1SIJ A;  3KUZ A;  3U4E G;  4US9 A;  4ZYS A;  3I9V 1;  5D3I B;  3Q3M C;  3SEB A;  2KDB A;  3D32 A;  2JPH A;  4TKN A;  1I4G A;  4ITK A;  3UGB B;  3IFW B;  1FXI A;  2LI5 A;  2Z8L A;  1JW9 D;  2N4F A;  5CX3 A;  2KJ6 A;  4DHZ E;  3BY4 B;  3ZDM C;  2FCS A;  3DCG A;  3Q8F A;  3CF6 E;  5L95 C;  1HA5 A;  1SEB D;  1IGC A;  1KJT A;  1XF5 L;  2C7H A;  2LVQ A;  3BVG A;  4HEA 1;  2PE6 B;  4DWF A;  2BKF A;  4RGO S;  4ANU A;  1UH6 A;  4I6P A;  5BMH A;  1WJU A;  1YOV B;  4URK A;  2NBV B;  3PZ8 A;  1HXY D;  3NVZ A;  3B2F A;  4F7Z A;  1KM7 A;  1V97 A;  4DBG A;  3A9K A;  1TKE A;  3PHX B;  3ML9 A;  3KLS X;  1J7C A;  3APF A;  1V5T A;  3E56 A;  1A5R A;  3L08 A;  3KW5 B;  3P4P B;  4LK0 M;  4UDU C;  2NBU A;  1Q0W B;  1EF5 A;  4I6L B;  2KMA A;  1N60 A;  2KDM A;  3RN9 C;  1MG4 A;  4B9K A;  2XK5 B;  2WU2 B;  2DWQ A;  4QAY A;  2LRW A;  2PVG C;  4MGI E;  2JXT A;  3TEX A;  2N0S B;  4HLE A;  2LMC A;  4CYE A;  4WUR A;  2WDR B;  4B95 A;  2V3N A;  2UU7 A;  1P0R A;  3L13 A;  4ANW A;  1NEN B;  1OFF A;  2LZ6 A;  2L3Z A;  2M1M A;  1JRU A;  3AE6 B;  4YL8 A;  3P2B A;  3W5U B;  2UWQ A;  3VR9 B;  1I4Q A;  1BT0 A;  3DWG C;  3UI3 A;  4LDT D;  3V05 A;  5FKA C;  2B76 B;  3L4P A;  2KN4 A;  5BMI A;  1SE2 A;  2G4D B;  1RYJ A;  2BB6 A;  4ZHP A;  1XCQ L;  4AP4 C;  2JF5 A;  3H8H A;  5FR3 A;  1F0Z A;  2V1Y A;  1HTQ A;  3SDL C;  2N9L A;  1K8R B;  1L6V A;  2NTS A;  1ROE A;  4RM9 A;  1K51 A;  4E71 A;  4S0R A;  4W9E A;  1BXT A;  2BS4 B;  4W9G A;  2FUH B;  4A6Q A;  1VLB A;  1FD6 A;  1HTO A;  5G55 A;  1MHH E;  2RR9 A;  3W1Y A;  1J19 A;  3AM9 A;  5AZH A;  2DZK A;  4YT0 B;  1SE4 A;  4ZDV A;  5KHO A;  2L52 A;  4NNJ B;  1GUA B;  3EFU A;  5E6P A;  4HPM B;  2X8X X;  2WXL A;  1BUI C;  4EOY A;  1XLN A;  4HJG E;  1NI3 A;  2QSD A;  1V49 A;  3N20 C;  4BOS C;  1MFW A;  4ANV A;  4K3C A;  1UNS A;  3X0W A;  2ON8 A;  3KYC D;  4HRO A;  1SE9 A;  1UWX A;  1OEY A;  2ZCC A;  3H7P B;  1WJ4 A;  2Z0E B;  2DYB A;  3R66 C;  3RFZ B;  2HJ1 A;  3AE1 B;  3ZNH B;  4B0M A;  2MCN B;  3KUD B;  3K9O B;  2PVO D;  3R2I A;  1B9R A;  2MJE A;  1SIF A;  4XDD A;  5CHV C;  4LTU A;  2N7J A;  1T0R C;  1KLG D;  3H1U A;  3VAW A;  3CMM B;  1TBE A;  1DOX A;  1FFU A;  2NMQ A;  5HHD G;  1QQR A;  5HI1 A;  1X1M A;  2MP2 A;  1UBI A;  2C5L C;  2G1E A;  3AEB B;  2L32 A;  1GC7 A;  3M95 A;  1WX7 A;  1XLO A;  4KDI C;  4P16 A;  5EE9 A;  4BOZ B;  3EGR A;  2KMC A;  4E3C A;  2WXO A;  4G50 A;  5CHW A;  2L0T A;  5E6O A;  4FA6 A;  4BVU C;  3V62 A;  2FCM A;  3DHH C;  2K6Q A;  2MP2 B;  1CMX B;  3RNA C;  4K7U A;  1FCC C;  3VUY A;  3ZTD A;  3A9J A;  3RUL A;  3ZNZ B;  3RI7 C;  2ZW1 A;  4XGA B;  4XWT A;  1E10 A;  3DVG X;  2JUO A;  2LVP A;  1ZKH A;  5JHB A;  5HFY A;  1SJE D;  2GI9 A;  3VQI A;  3HHM A;  1AWD A;  4JPS A;  1WXQ A;  1VR9 A;  3ZXV A;  4GGQ A;  1CJE A;  1WE7 A;  2M56 B;  3DVN V;  1DOI A;  2KFJ A;  4RGN A;  1M94 A;  1E9M A;  3DVG Y;  4HWI B;  1P98 A;  2WS3 B;  4XC2 A;  3EUB 2;  3QAR A;  1WXM A;  4S17 A;  5FR6 A;  4JE3 B;  1WIA A;  3C19 A;  1IGD A;  3AV8 A;  5EDS A;  4RF1 A;  3PO0 A;  1L4Z B;  1GB4 A;  4L23 A;  4M8N A;  3WAP A;  1GJZ A;  2L76 A;  4F1S A;  4FLH A;  2KWV B;  3NUH B;  1L0V B;  3PVL A;  2LUE A;  4A90 A;  4OVV A;  3VRA B;  2L0F A;  1H4R A;  1XLP A;  1T0S C;  2PJH A;  4A20 A;  3CIR B;  2K5P A;  4NJC A;  2V4L A;  2C7M B;  4FXC A;  1YN3 A;  1T0Q C;  1JWA D;  4HCN B;  2RPQ A;  4ICV A;  4NAW A;  4RCO A;  1WFY A;  2CHZ A;  1ZPS A;  2WXQ A;  4KX6 B;  1N5W A;  1QIL A;  4P7I A;  4KVG B;  1UUP A;  3ENE A;  3RNE C;  2L1A A;  4GU2 A;  3Q69 A;  2BF8 B;  2KD0 A;  4P1B C;  2W82 A;  2ICI A;  2K8C A;  1NBF C;  4FUL A;  4IC7 B;  3T3N A;  1VCB A;  3TCA A;  1EF1 A;  1FCL A;  1WJ6 A;  2Z59 B;  1V81 A;  3M62 B;  1XT9 B;  3V60 A;  3KUC B;  3PZD A;  1Z5S B;  2RDB C;  1E6E B;  3WAO A;  4YXD B;  2QIE B;  2EMS A;  4TUU A;  3PS6 A;  1EWC A;  5LXH A;  2IGG A;  1GOZ A;  4ASW C;  3L16 A;  3R3M A;  2DNF A;  5TSS A;  1DOY A;  5C3J B;  2R61 A;  5GXG B;  2INN E;  3IG3 A;  1P3Q U;  2N1W A;  3GZN I;  4RGM A;  2CKH B;  2OOB B;  3AE8 B;  4YTM B;  1HQR D;  2KHW B;  3ZKJ C;  3PT2 B;  3U7D A;  1SSN A;  2FE8 A;  4HK2 A;  3OWE B;  2M0A A;  3NZ3 A;  4ANX A;  1WY8 A;  2K0P A;  5HG2 A;  3NS1 A;  3DDC B;  4M02 A;  1L4D B;  4JWU C;  1E8X A;  4CHK A;  4ARI A;  3NS8 A;  2K22 A;  4KGR A;  5DPW A;  3N32 A;  3QX1 A;  4DDI D;  1TTN A;  4MT5 A;  1PYW D;  2GBJ A;  2H89 B;  3AEG B;  1T3Q A;  2PEA A;  1WXS A;  1YJJ A;  2JQR B;  4G3X B;  4PK1 A;  4HKQ A;  5IN7 A;  3RCZ A;  3L0W B;  3Q3N C;  1V2Y A;  4MJS A;  5JXV A;  4M0W A;  4L2Y A;  2NTT A;  4I6N B;  3ZYY X;  1ZDV A;  2CR5 A;  1FM0 D;  1IBX A;  3DBL B;  1V5O A;  3PHW B;  4WAF A;  1E0Z A;  2BS2 B;  5KHQ A;  1L6U A;  2PTL A;  2QIL A;  2W3R A;  4MSQ B;  2H88 B;  3QA8 A;  4IWQ A;  1E5W A;  2XNA C;  3JSV B;  2FCN A;  2MBQ A;  3OJ4 B;  3B9J A;  3I57 A;  4LNF A;  4KKI A;  3SR6 A;  2MW5 A;  4FJY A;  2MSE D;  1CQV A;  2AQ3 B;  4WH4 A;  1K52 A;  1OTR B;  1YNT E;  4BFR A;  2AQ1 B;  2LVO A;  3B1L X;  1L0Y B;  5IA7 A;  2G45 B;  4KGT A;  4AQ7 A;  3R7R A;  1C9F A;  3JVZ X;  1RM6 C;  1WGY A;  2LD9 A;  4JWS C;  2KQS A;  2IYD B;  2BW2 A;  1ZXH A;  2V9H A;  3Q3F A;  3SFE B;  1MG8 A;  2DZI A;  2K8H A;  3LB8 C;  2O6V A;  5HKH A;  2QEJ C;  3KQ4 A;  5I4D A;  2SEB D;  2YLM A;  4A8X C;  5IAA C;  3Q8B A;  2DHZ A;  2MA9 B;  1A70 A;  5JH5 C;  2KWD A;  4KDL B;  3QJZ A;  4E74 A;  2WXR A;  2ZEQ A;  2V0G A;  2N9K A;  1ZE3 D;  4PS3 A;  2K8B A;  2IO2 B;  3NZU A;  3P63 A;  2HE7 A;  4FBJ B;  2XBB C;  1L0X B;  2Y5C A;  3X23 A;  2J7Q B;  3TJP A;  1F1H A;  3VXW A;  4RMA A;  4ARC A;  4EZJ A;  4YSX B;  2CJO A;  2K1F A;  2KJR A;  3PGE A;  4TSS A;  3Q6B A;  2GBM A;  2IZV B;  5G2N A;  1F9J A;  3ZJU A;  1LQB A;  4R3D A;  4WWN A;  3P42 A;  2XK5 A;  3N1Z C;  1SE3 A;  3APC A;  3GS2 A;  2W9N A;  3HVD A;  4N6E B;  1B1Z A;  4IKG A;  1YX5 B;  4HJK A;  5AEK B;  1FXA A;  3M63 B;  5D7G A;  3AE9 B;  2J52 A;  2KO3 A;  2N9X A;  2I1J A;  3WAL A;  5L83 A;  2OHF A;  4KZ0 A;  1N63 A;  1S1Q B;  2ACZ B;  1QKZ A;  1WGH A;  1QOA A;  4C80 A;  4AS1 A;  3Q2A C;  4LNO A;  1UD7 A;  2MBB B;  4GB9 A;  2BVC A;  4DHJ D;  1T0Y A;  1Z2M A;  5BYS A;  2K3U A;  4JL9 A;  2FID A;  2BYV E;  4D2K A;  4EFO A;  5C23 A;  3TEW A;  4AUQ C;  4MGZ E;  4WJQ A;  4C7Y A;  1CZP A;  2MLB A;  2WXF A;  4K1R B;  1AW7 A;  2KLG A;  2KVR A;  3SD5 A;  2KQ7 A;  2HTM E;  4GOC A;  3VDZ A;  4EKU A;  2VH2 A;  3BIN A;  1WRD B;  2MHJ A;  1JWB D;  3VTW A;  2N1V A;  2R2O A;  3RYT A;  3SU8 X;  4EE2 A;  2A5U A;  1YMH E;  2FUG 1;  4GDL A;  3OLM D;  1L2N A;  2REX A;  2G4S A;  2PPH A;  4MH8 A;  4IW0 A;  2HDE A;  4AJW A;  3DOW A;  3ZLZ A;  4HVB A;  2GRI A;  2MBO A;  3AE3 B;  4WWP A;  2PE9 A;  1WXV A;  1KF6 B;  4IUM B;  4F8C B;  1WGR A;  1UEL A;  1E8Z A;  1XCT L;  2RMM A;  2IGH A;  3RNG C;  3PRM B;  2DZM A;  1D6E C;  1MJD A;  1N6Z A;  2KMM A;  4MJS B;  4KKJ A;  2J53 A;  1NEK B;  2C9W B;  2AYO B;  2BS3 B;  2XN9 C;  5CHF A;  2KTF A;  4K7W A;  2WNM A;  4A3O A;  3RNF C;  2KDF B;  1I42 A;  1SXT A;  1JQ4 A;  1WGG A;  4WQM A;  1I35 A;  1FNV A;  1UGJ A;  3QCA A;  3GOE A;  3ZDT A;  4FJZ A;  3DWM A;  4XYC A;  2PW9 A;  4A9A A;  3VTU A;  3PLV A;  4WWO A;  2PMV A;  5J17 A;  1WH3 A;  1OQR A;  3SHQ A;  3A1Q B;  2EEL A;  1QOB A;  2M8S A;  2KX3 A;  3GE8 C;  2X38 A;  2I2Y A;  3WA0 A;  4ZRP A;  4J6I A;  1N62 A;  2O2V B;  3AEC B;  5IKC M;  1V1P B;  3TUO A;  3DBR I;  3AEA B;  3CWI A;  4HPL B;  5IO9 A;  2MEK A;  3C0R B;  1P1A A;  1ZXI A;  4OW0 A;  4W9K A;  3KYD D;  1FXT B;  4NQK E;  4CO7 A;  1VD2 A;  1P7E A;  5BO4 B;  1FNW A;  2FIF A;  2WQY B;  3W9C B;  3AE5 B;  1SF0 A;  3FKY A;  3AEF B;  2DZJ A;  3HM3 A;  2M19 A;  5IP4 D;  2LEK A;  2BT6 A;  1TS3 A;  4ZRJ A;  1V80 A;  3HIZ A;  2BQQ A;  4KV2 A;  1V1P A;  2MBH A;  4RNA A;  1JCK B;  1J7A A;  1AAR A;  5IOI A;  3FC4 A;  3U30 A;  2KFK B;  3AH7 A;  3ZNI D;  1ZDX A;  3V3X A;  3N3K B;  4OZA A;  4NJ6 A;  1YJI A;  3BII D;  2K6D B;  2LWP A;  3J9C A;  2M4N A;  4BAX A;  1YD8 U;  4LNK A;  1TT5 B;  1RAX A;  3B08 A;  1VDV A;  3ZIM A;  1I4P A;  2QMT A;  3VTV A;  2RDG A;  5AZF A;  1S3S G;  1YQB A;  4XZ4 A;  4USA A;  4IWO A;  4C00 A;  2G9H D;  2KVZ A;  1MPE A;  2O2V A;  3MJ5 A;  1F77 A;  2WWZ A;  1NI2 A;  4YSY B;  4ZHO A;  4DHZ B;  1XXG A;  2WDQ B;  2IO1 B;  5H8Y E;  3QHT A;  2JXX A;  4NAW B;  4K81 A;  4II2 B;  4XX5 A;  3S2A A;  1NDD A;  2VZK B;  2YVC A;  1FNU A;  3QIJ A;  1WR6 E;  2ONQ A;  3A33 B;  3O13 A;  1NYR A;  1XEE A;  1TS2 A;  4A55 A;  1C3T A;  2QHO A;  1ET6 A;  3BVM A;  1HE8 A;  1EUV B;  4HDQ A;  1P9D U;  4WQO B;  1M4V A;  2JRI B;  1KLV A;  3GP7 A;  4XE0 A;  4M8M A;  2A4Z A;  3AED B;  2MJ3 A;  3KWL A;  1ACC A;  1HZ6 A;  3ZJT A;  3BK2 A;  4N9F 4;  2N7E A;  3WAN A;  1PGA A;  2AL6 A;  3QQ8 B;  4AWJ A;  4XDC A;  1GB1 A;  1TYG B;  1KFY B;  1R4M I;  2LHE A;  1KTK A;  2SAK A;  2V3S A;  4YTN B;  4PS8 A;  2KQ4 X;  2L8J A;  2WX0 A;  2KT7 A;  2GLS A;  1TY2 A;  2PIA A;  2YEP B;  2MQJ A;  5G5G A;  4EUT A;  3SFD B;  2E6X A;  3ZUN A;  1UF0 A;  3MC8 A;  2JX5 A;  1C79 A;  2D11 A;  3AUL A;  3IAS 1;  3PV1 A;  4O1N A;  3Q8E A;  4XWW A;  2GB1 A;  5D6J B;  3K9P B;  3MHS D;  5E6N A;  4GXB A;  2WDT B;  4W9I A;  3IT6 B;  3MHZ A;  2OJR A;  1FPY A;  1ESF A;  2BBC A;  2JZ3 B;  2KAN A;  4BBN F;  3RNC C;  1YN4 A;  2NBW B;  3IHP C;  1XD3 B;  1UBQ A;  4US8 A;  4BBN C;  4MM3 B;  4NJ7 A;  5MPO A;  4MH0 E;  3ZGZ A;  2WYQ A;  2LXC A;  2LAS A;  1XQQ A;  3EC8 A;  3OG5 A;  4GLS C;  3ETR A;  1V8C A;  3PRE A;  5DPT A;  1E7V A;  1U4A A;  1LXD A;  2DEN B;  2BTE A;  2RDH A;  4DXA B;  4KSL C;  1SB3 C;  3FIL B;  4BKS D;  1FRR A;  4LLG M;  3TIX A;  4M01 A;  3OJ3 A;  2D07 B;  5D3D A;  4REZ A;  4M00 A;  1FMA D;  4CQN A;  4PS7 A;  5JHA A;  3UF8 A;  3HK0 A;  1D5X C;  1K53 A;  2IO0 B;  4OHJ A;  3O65 B;  2GBR A;  2D3C A;  2LJI A;  5GMV A;  4MEM A;  2KKC A;  3ECI A;  2LGD A;  3H7P A;  1VZ8 A;  3PRZ A;  1F52 A;  1WR1 A;  1ISN A;  2L05 A;  3BK1 A;  4LCD E;  3EA6 A;  3KWV A;  1C4P A;  3ZTC A;  3RD2 A;  3HRD D;  2MWS B;  4C4V A;  1ET9 A;  3IBE A;  4MEL A;  4ZRI A;  1Q5W B;  2KZR A;  1FIQ A;  3A9K B;  3HVZ A;  1VZ6 A;  4L1B A;  4RH6 A;  1QLB B; 
#chains in the Genus database with same CATH homology
 3DHH C;  2RDB C;  4P1B C;  4P1C C;  3RNA C;  1T0Q C;  3N1Z C;  3I5J C;  2IND C;  3N1Y C;  3N20 C;  3RN9 C;  3DHG C;  3RNF C;  3Q14 C;  3Q2A C;  2INC C;  3Q3M C;  3Q3O C;  3RNB C;  3RI7 C;  3DHI C;  3GE8 C;  3Q3N C;  3RNC C;  3RMK C;  1T0R C;  3RNG C;  3I63 C;  3RNE C;  1T0S C;  3N1X C;  3GE3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...