3Q2AC

Toluene 4 monooxygenase hd complex with inhibitor p-aminobenzoate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
AFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Toluene-4-monooxygenase system protein A
total genus 25
structure length 81
sequence length 81
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2010-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3q2aC00
3DHGC 4P1CC 3RI7C 4P1BC 3N1ZC 3RNFC 3RNGC 3Q14C 3RNCC 2INDC 3N20C 3N1YC 3Q3OC 2INCC 3I63C 3N1XC 3Q3MC 3Q2AC 3DHIC 1T0QC 3DHHC 3RNBC 3I5JC 2RDBC 1T0RC 3Q3NC 3RNAC 3RN9C 3RMKC 3GE8C 3GE3C 1T0SC 3RNEC
chains in the Genus database with same CATH superfamily
1QILA 2MLBA 1YX5B 4L2YA 4HJKA 2RPVA 4K7UA 1T0YA 1V80A 3P4SB 1V2YA 3HVZA 1SJED 4LJOB 2BYEA 3RNAC 5HG2A 3V61A 1TJEA 1PGXA 1WE7A 1PUTA 2G3QB 5GMVA 3U7ZA 4BKGA 1IUEA 4FHKA 2KANA 3KUZA 3AMZA 1WGRA 3EUB2 1WMHB 1I7HA 3RNBC 4PS8A 1N61A 2W3RA 1XEEA 2MP2B 2NBWB 2QHOA 4OVZA 2GRIA 4K1RB 2GBNA 5E6OA 2D10A 3WANA 1LFDA 4I6NB 1J7CA 4NJ6A 4FULA 4EEWA 2MBQA 1KLVA 3VUXA 4FADA 3VVWB 2KD0A 1P9DU 2GBJA 4C4VA 3VQIA 2VH2A 5IAAC 1STEA 3GE8C 2GMIC 1Z2MA 3V6EB 2CKHB 3DPDA 1XCQL 4FJYA 1XT9B 3WCQA 4W9DA 2WXGA 2ZJDA 2D3BA 2K25A 4L1BA 3P2BA 1V9JA 2KTRB 2HTME 3AB5A 1FEHA 1C78A 4DWFA 2WQYB 4MACA 3QWZB 1V5TA 2KX0A 1H4RA 3Q8EA 1NVID 5H92C 4WWOA 2YVCA 1C77A 2FIDA 4MDKE 1WJ6A 2M0XA 2FCMA 4C7ZA 1XQQA 3I63C 1MHXA 2MA9B 2V1YA 1X1MA 2KQSA 3PREA 1D5MC 1N62A 3I3TB 2YEPF 2NS5A 2G45B 1FMAD 2E3TA 1YN3A 1GPXA 1FXTB 1FXAA 4LNIA 4LDTD 4IM2A 3AEGB 2N7EA 3R7RA 3L17A 4BFRA 1SXTA 1T5XD 3R2TA 1DGJA 2WWZA 3ZTCA 3GZNI 4XDCA 1E8XA 2VZKB 3WAMA 1TKYA 2FUHB 4AJWA 1EO6A 1CZPA 3L13A 2OHFA 1E0ZA 4WQMA 1WGGA 4WWPA 2E6XA 3LB8C 2O2VA 3A9JA 3OWEB 4HPLB 4OVUA 1T6BX 2NVUI 4AP4C 4C7YA 3ZTDA 3IHPC 2R2OA 3V3XA 5EDSA 2L7RA 2L3ZA 4KSLC 2QCZA 3WAOA 2MW5A 2QEJC 4WWNA 1JCKB 3PHXB 3RT3B 4JPSA 4TSSA 5HHDG 3RNCC 4C00A 4L23A 2FCSA 3PO0A 2K9XA 1VD2A 1HA5A 2LGXA 3IG3A 2C60A 1WSPA 4GLSC 3PHWB 2CS4A 3BVMA 2OJWA 2LFIA 4KGTA 2WU2B 1BUIC 1J19A 1GC6A 5FKAC 2ZW1A 3NOBA 3NG0A 3VRAB 3RZFA 2BQQA 4C4VB 1ZXIA 2KKCA 1SF0A 4NNJB 3JYUA 4YTNB 1ESFA 1GNUA 1EWYC 2O6VD 2WXFA 1WXVA 3ENEA 4MJSB 5TSSA 3RNGC 4M0WB 3NY5A 2Z0DB 2V0GA 2JX5A 1J8CA 1TS2A 3KH0A 3TEWA 1MHHE 5GXGB 1T3QA 2PVGC 1DYQA 4Q2JA 3DBRI 4YT0B 2DLBA 1UBQA 3RI7C 4W9HA 3N1ZC 4RF0A 2BB6A 2KHWB 4KV2A 4B0EA 3QCAA 4W9EA 4NAWB 2WDRB 3S2AA 1HTOA 3JSVB 4KSKC 1EU3A 2KWUB 2XNAC 1B9RA 2V4LA 2C5LC 4CHKA 2C7HA 2KAJA 1UNSA 2NBUA 4A3OA 4HRSA 1P7FA 4LNNA 4IWOA 3ZNID 4M01A 3DVNU 2MCNB 3IAM1 1MPEA 1Q1OA 2JF5A 3TSSA 1PGBA 1Q5WB 3RN9C 3UF8A 4RF1A 2BGFA 1HTQA 4HROA 4DDGD 3GS2A 4JX1C 2BYTA 3HM3A 3EECA 2DBYA 3Q8FA 1SJHD 2D2QA 1PYWD 3DVGY 4G50A 2O6VA 1K53A 2WXJA 1DOIA 2AWTA 5TR5A 3NS8A 4MH8A 2ONQA 3DBHI 2WX1A 4KGRA 4MGKE 4RMAA 1K51A 3PRPB 5DPWA 1N6ZA 2KO3A 1Q0WB 4P16A 2JZ3B 2D3AA 1FCLA 4EKUA 3W1SA 3DVGX 3OJ3A 1WJUA 1E5WA 1QOGA 1JWSD 5CTRC 2ZNVC 1FRRA 4N58A 2AQ3B 2NTTA 3QAQA 3DWMA 1YOVB 1YN5A 2WXQA 2FAZA 2KN5A 2M19A 3R3MA 2TSSA 2INCC 2RR9A 1NYRA 5IO9A 3NUHB 1E8YA 1A5RA 4NAMA 5DPTA 3Q8AA 3V6CB 1MI0A 2ICIA 4YTPB 5EE1A 4P6VF 2WXIA 4M0WA 2IZVB 2VRRB 2XBBC 2CHZA 3AE5B 3P4RB 1ZGUB 4LNOA 1AARA 4A8XC 2MWSB 2D07B 1XCTL 2ZNVB 3SU8X 2KYWA 1SIJA 4HEA1 5KHOA 4UDUC 3DOWA 4DHZE 3AH7A 4ZRPA 2RD0A 3V05A 1C4PA 5IKCM 1L7YA 1RAXA 1L6UA 4KIKA 2K3UA 3MP9A 2WNMA 3L10B 3MFGA 4IW0A 5DCNA 2IY0B 3WAPA 3M95A 3VR8B 2NCNA 3Q3JA 3H1UA 2KWCA 3DHGC 4GXBA 3WIMA 3PLVA 4FA6A 3VRBB 2WHIA 3AN1A 3NVVA 1LQBA 2V4IB 4G3XB 2IBIB 2J53A 1QOBA 2QSDA 3A4RA 1HZ6A 2IO3B 3QARA 4YSYB 3HIZA 3JW0X 3W2DA 3H7PB 3ZXRA 4XC2A 3EHVA 3TUOA 2O2VB 2MSED 2LGYA 3K9PB 4ZRKA 4URKA 2OOBB 3DHIC 2KWVB 1Q10A 1ZW7A 2M17A 3HVDA 1TKGA 1I42A 1JMLA 4AWJA 3SHQA 3ZJTA 4DXFA 4W9KA 4RNAA 4FXCA 2KNBA 2WXRA 1Y56A 1EWCA 1FCCC 4KKJA 1FO4A 1L4DB 3W5VB 1IGDA 4WH4A 4XGAB 3NZUA 3PRMB 4E74A 2M56B 3MC8A 4YWGG 1WX8A 2KWDA 1OEYJ 2FIFA 3PLUA 3AI5A 1TTNA 3D32A 4E71A 2LD9A 3KYDD 3KQ4A 1TS5A 2JU6X 2KDBA 3Q3MC 3APDA 2MEKA 5G5GA 3DBLB 1WZ3A 4NPNA 1WR6E 3IFWB 2DAFA 2RSUA 1KTKA 1LM8B 3PVLA 1R4NB 5L83A 2BS3B 3TCAA 3VTUA 1NYQA 3N32A 1V97A 2D11A 3PRZA 1JQ4A 2FCQA 1FFVA 1FXIA 2BKRB 4MGZE 3H6NA 1TS4A 2PKOA 1V6EA 4GDKA 4ITKA 5BMIA 2HJ8A 4OHJA 1EF5A 3ZO5B 4FBJB 2CU1A 3GZNB 2XK5B 5L95C 1K50A 1RFKA 2WS3B 4C56C 1YD8U 2AQ2B 4HPPA 2JYTA 2AX5A 1AW7A 3NVWA 1QLBB 5BYRA 4MM3A 4ZYNA 1OTRB 3EC8A 1WXSA 4IM0A 2Q5WD 1WR1A 2HTHA 2CJOA 3BY4B 3P1MA 3AE1B 2RPQA 2WXOA 3MTNB 5C2TB 2PE9A 5T8IA 4B0MA 1WRIA 3PV1A 4TKNA 4AS1A 3PGEA 3L08A 4ARCA 1E7PB 3A9KB 4WQOB 3KYCD 1L2NA 3APCA 2EELA 3J9CA 1K8RB 2BS2B 1YQ4B 1JWMD 4A9AA 1SBBB 1SE4A 3HUIA 3LDZE 3EA6A 3IAS1 4H2AA 1DOYA 1T0RC 3N30A 1AYFA 1QKZA 3A1QA 4ACFA 3PSEB 4WJNA 4W9FA 4HDOA 3IXSA 1PGAA 3HK0A 3DBLI 3ZLZA 4OW0A 1SGHA 2LUEA 3Q2AC 4K7SA 3BK1A 1VZ6A 2AQ1B 3GOEA 4X57B 5EE9A 1TS3A 3AXCA 4GOCA 2CR5A 3QC8B 4DXAB 2EKIA 2WGSA 3DDCB 4HXDA 2WX0A 4BOZB 4E3CA 5D6JB 1VJKA 3Q6BA 2LEKA 1CQVA 4KDIC 5MPOA 1Y8RC 4WIPA 3C8YA 3SEBA 5J18A 1QZEA 1XLOA 2W55A 1MJDA 2KQ7A 3OJ4B 3R8BA 5JZEB 4O1NA 3FAHA 5CX3A 2IYDB 2EMSA 4BZAA 4W9LA 4F7ZA 2WYQA 3KWVA 3P42A 3R66C 1NEKB 1AWDA 2G4SA 3C0RB 5HI1A 2J0JA 1UGMA 1HZ5A 1YNTE 3FILB 1WYGA 1A70A 1FNWA 3MC9A 3Q3FA 2D3GA 1FD6A 1WX7A 1OEYA 2PPHA 3GE3C 1E6EB 3UIPB 2KJ6A 1FM0D 2N1WA 2N9PC 2K5PA 3FC4A 3OAWA 4HVBA 5JXVA 3ZIMA 1FRDA 2LXAA 1MG4A 1JWAD 2DZIA 3AV8A 2L00B 2JWUA 1C76A 4LTUA 4HJGE 1YQBA 2J7QB 4EZKA 1IGCA 3AULA 1CJEA 1SE9A 2PVOD 2GBKA 2ZZPB 3AE9B 1EU4A 2B3AA 4ANXA 4NZLB 3AE7B 4AUQC 4REZA 1I4QA 3ZJUA 2PJHA 2EKEC 2CU3A 3RMKC 3HM6X 3GB1A 1R4MB 1WI0A 5D7GA 4J3OD 1LGRA 5HFYA 3RNFC 2O6VB 1D6EC 4A6QA 2UYZB 2V9HA 3T8MA 4DQOC 1YQ3B 3TEYA 3NZSA 1JRUA 4PT5A 2Z0EB 2C9WB 1UWXA 2JRIB 2Y5CA 2WDVB 3C19A 2R2QA 4RGOS 1F0ZA 3PZ7A 3AU5A 4BVUC 1OFFA 2ON8A 4TV3A 4JL9A 1NDDA 1TYGB 3AEBB 4YL8A 4LCDE 3KW5B 2DAJA 1JWUD 3A9JB 1L5PA 2IO0B 2L05A 2OJRA 2MP2A 2ZVNA 4WWMA 4GDLB 2BPSA 4LDTB 2V3PA 3VH3B 2KMMA 4A3PA 1YIWA 3HRDD 1ZPSA 2KVZA 3JVZX 1CMXB 2J4XA 1V1PA 1P3QU 3DWGC 2WXKA 3AEEB 4KX6B 4W9CA 4EE2A 3Q3NC 3EFUA 3SFDB 1ZUD2 2J52A 2ZEQA 4M02A 1WRDB 2UU7A 2BTEA 3K9OB 3PS6A 4TQ0A 3TEZA 1UELA 1E7VA 1XLNA 1JW9D 1L6VA 2BYVE 3CWIA 1Z5SB 2KQ4X 1N60A 2N7JA 3U52E 1WXMA 1WM2A 3CMMB 3E9SA 3ZNZB 3QQ8B 4BKSD 2DYOA 4ANWA 4EOYA 1TKEA 4ZOHC 1IYFA 2NBVB 4NQKE 2ZPYA 2K8BA 2M0AA 3BYTB 2MBBB 1SIFA 2K1FA 2QILA 1J7BA 1ROEA 2REXA 2LVPA 3BVZA 3TJPA 1R7SA 2Y3AA 1QF6A 1R4MI 2KN4A 1UZXB 3ZRCA 4N6EB 1EM7A 3W1SC 4JQWC 4MM3B 2L83A 4ZRJA 2M4NA 1S3SG 1VR9A 2KT7A 1WH3A 2PEAA 3RD2A 4A90A 3UGBB 1SE2A 3DBSA 1IBXA 4DDID 1V49A 4I6LB 1XD3B 4RM9A 2JRHA 1C3TA 3P63A 4II2B 2JZZA 4F1SA 3BWUD 3ZYYX 2B76B 2KJRA 2MQJA 4JE3B 2K8CA 4RCOA 3FKYA 1SE3A 4YSXB 4RM8A 1S1QB 3X0WA 2KC2A 1P98A 3UINB 4DHJD 3RUIB 1K52A 3KUCB 2HDEA 1WY8A 5D94A 2N9EB 3QHTA 3PPAA 2PW9A 3A33B 3Q3OC 2KTRA 4JLCA 3H7SA 4AOFA 1F77A 3ETRA 5J17A 4N9F4 4IC7B 2DYBA 4CYEA 5FK9C 4AJYB 2YEPB 1N63A 1GC7A 2GOWA 1YMHE 1N5WA 2N9XA 2IGGA 3L0WB 3BINA 2BYFA 1P1AA 3BVGA 1E9MA 2BF8B 1WFYA 3ZNGC 2GBMA 2DZMA 1FIQA 3B2FA 3DHHC 1HQRD 3L4PA 2KLCA 2LMCA 4ZRIA 4XE0A 3VDZA 1C4AA 2LJ5A 4IWQA 5E6JA 1P7EA 4JGHB 4YSZB 4RH6A 1QOAA 2BS4B 2MBEA 3TL5A 4M00A 2RDHA 3ZQ4A 4ZHOA 2BWFA 4GN1A 3NVZA 4N59A 1AN8A 3ONSA 1F9JA 1F1HA 3APFA 2X8XX 4MGIE 2K8HA 5C23A 2LGDA 2NTSA 2K22A 3ZJVA 2KTFA 2MJEA 4OZBA 5BYQA 1SB3C 4KZ0A 3B9JA 2LRWA 1I4GA 3MHSD 3V60A 3ZKJC 1QOFA 4JWUC 4A55A 2RDGA 2CHXA 2WXHA 1B1ZA 4A20A 2M1MA 1XLPA 4TQ1A 4DHZB 2J42A 4G0NB 4EZLA 1WGHA 3AE2B 3TBLD 2DHZA 2RMMA 1BMLC 1VLBA 3N1XC 4JIOU 3LXFA 2N4FA 2KMCA 2FE8A 1YJ1A 3U8ZA 2KXJA 2PE6B 4BBNC 4PYUA 1ZOYB 1JROA 2AL3A 1D3ZA 1TZOA 1C1YB 1NI2A 3T3OA 2WDTB 2ASQA 3VH4B 4B9KA 4HLEA 3RYTA 1TBEA 4IUMB 4DXGA 5C1ZA 1E8WA 2KMAA 1D5XC 3VUWA 2K6DB 4GU2A 1PFDA 2BW2A 5AUKA 2K6QA 4WAAA 4RGNA 4US9A 2ZCCA 4PK1A 2DZJA 3TIXA 2KOXA 3U2SC 4NAWA 1HEZE 2RGFA 1RM6C 1V1PB 3SFEB 1VRAB 1FNUA 3M3JA 3I57A 2NPTB 4MELA 5DPRA 4S17A 3ECIA 3MJ5A 1QT9A 3RFZB 3N1YC 1GOZA 2WXNA 1P0RA 1UWMA 2I2YA 1HXYD 4USAA 1ACCA 3AE8B 2JUOA 3MJWA 5FR6A 1ET6A 3R2IA 1V8CA 5CHWA 2ZCBA 2LGIA 3VTWA 2Z8LA 4P7IA 1WGYA 4GDLA 1WXQA 4HCPB 4YXDB 1U4AA 3B1LX 4XWWA 1EUVB 3L16A 2LZ6A 3Q14C 5DPSA 3X23A 4FHJA 3VHTC 2L0TA 5LNK1 2H89B 1GJZA 2L0FA 2G4DB 2KFJA 2MX2A 3H7PA 1WM3A 5D2MB 3DVNV 1QQRA 3U7DA 4KGSA 4OZAA 5KHQA 1XLQA 1VZ7A 5G55A 5D3IB 1XF5L 3KVFB 1C4CA 3RNEC 1VCBA 1SEBD 1TZ1A 2MH7A 3RZWC 2LVQA 2AEHA 2DENB 3BZDB 1H8CA 4ANUA 3OLMD 4KKIA 4D2KA 4MSQB 4HK2A 1UBIA 1BT0A 4GSWA 2KDIA 5BYSA 4ANVA 3AU4A 3W9CB 2BBCA 3LJ3A 3OG5A 3Q8CA 4J6IA 3VFKA 4US8A 3N20C 2WXMA 1KF6B 3A9KA 2V3NA 5G5HA 3B0AA 1WZ0A 2DX5B 1SSNA 2ACZB 4IWPA 2KDFB 1L4ZB 2BB5A 4ARIA 3QK0A 3T3NA 4GMVA 1WIAA 1ZE3D 2NPTA 2BVCA 4LNKA 2DNFA 4XYCA 2KDMA 2Z59B 1WGKA 4GGQA 5LXIB 4AQ7A 1E8ZA 4KVGB 3ZRFA 3URYA 2L8JA 1N5XA 1MVKA 2QDFA 2WXLA 1WJNA 2SAKA 2W9NA 3KLSX 4DHJB 1V86A 2MBOA 4I6PA 1V81A 5AZHA 1WE6A 2INDC 1PDXA 3BYYB 4W9GA 4EUTA 2GBRA 2WDQB 3AE6B 5E6PA 3VTVA 1IPGA 3O65B 2EMTA 2IY1B 5G2NA 5LXHA 1WWTA 4ZHPA 1ZP0B 4FLHA 1TT5B 4BKSA 1G6JA 1I4HA 2IPKD 4MJSA 1RWSA 2CHWA 3AEFB 2LRUA 5LLIA 3ZXVA 2ZVOA 3FILA 2LVOA 2ZW0A 3AE3B 4OVVA 3T9LA 1UH6A 1OGWA 2L52A 3V62A 1MG8A 4II3B 1R4NI 3CF6E 4HCNB 2FNJB 1JRPA 1TGZB 2WU5B 2LGSA 1RLFA 3CIRB 1E10A 3ML9A 2LUMA 3NHEB 1BXTA 4EZJA 2XEWA 3JSVA 2J0MA 3AECB 3QX1A 4MEMA 1TIFA 3UQBA 1YX6B 3NS1A 2J0KA 1I4RA 2FBWB 1JALA 4NQLB 5E6NA 3BK2A 5IP4D 3N9YC 2C7NB 3RULA 2W54A 2KJHB 2I38A 4BBNF 4HKQA 2N0SB 5BMHA 4M8MA 3ZGZA 3NVYA 4ZYSA 2I1KA 2Y5PA 2MRPA 5IA7A 4W9IA 1V5OA 1VZ8A 4LJPB 2RDBC 3DBRB 4HDQA 3PT2B 4RGMA 2KZRA 2L76A 2A4ZA 1RFAA 2LJIA 3AEAB 5CHVC 2JT4B 3SD5A 1WF9A 2KFKA 3Q69A 3QJZA 4MT5A 4GB9A 4HPMB 4K81A 4R3DA 1M94A 2DYMA 3KUDB 4JWSC 5EE3A 1ZXHA 1EF1A 3I9V1 4LNFA 1ZDVA 3IBEA 2QC8A 4IG7B 2GI9A 3SDLC 3UIOB 2FCNA 1YJIA 2L32A 1D4BA 4QAYA 2I1JA 4F8CB 2MHJA 2JPHA 1KLUD 3ZUNA 2JYEA 1TY0A 1YN4A 1ZDXA 2HE7A 1WMHA 2IO1B 2WLBA 3PTFC 2IO2B 1NENB 2KC1A 2MJDA 3SR6A 4B6WA 2JVCA 4K7WA 2WXPA 1ET9A 1WYWB 2N9KA 1L0XB 3VXWA 2GB1A 2JWZA 5BO4B 1NBFC 3R7QA 2N1VA 3Q8BA 2AL6A 2G1EA 2SEBD 3E56A 2HD5B 4K3CA 5EE0A 4GDKB 5C3JB 4ZRQA 3VAWA 1TY2A 3RPFC 5BMGA 1F2RI 1LO5D 4WJPA 2PIAA 5J2RA 2FUG1 3P4QB 1YJJA 3A1QB 1UGJA 2Y5BB 3H9DA 2K0PA 4DBGA 4IOIE 1XXGA 3IT4B 2KK8A 3CSTA 5I4DA 1KM7A 3ZDTA 1VDVA 2A5UA 2JSVX 4DK5A 1FPYA 4NJCA 3AM9A 3QIJA 3B08A 2DZKA 4C80A 4RFBA 3VR9B 2JXXA 4P1CC 2PLPA 2QJLA 1FFUA 3W5UB 1CK1A 4TUUA 2IGHA 1GB4A 3L54A 5FR3A 4GIVA 2HJ1A 2YLMA 2LI5A 4HWIB 3O13A 3U4EG 2QMTA 3W1YA 3I5JC 1J7AA 2BT6A 3NZ3A 1OQRA 1UD7A 4ZDVA 2IDYA 2IJ0A 1WJ4A 2R61A 2D3CA 4KZCA 4ASWC 3PZ8A 2MJ3A 5JH5C 4PS7A 4P1BC 1ZKHA 2DWQA 4W9JA 4CO7A 3RCZA 1HE8A 3AE4B 4G11A 1T0QC 5CHFA 1DOXA 3TMPB 2LWPA 4RGTA 2JY6A 3A4SC 1RYJA 2KDEB 1T0SC 2PTLA 5JHAA 4B95A 1GG3A 1UUPA 4MSMB 1I4XA 3IT6B 3ABVB 3ZVVA 2NMQA 4XX5A 2OEDA 2JXTA 2LASA 2JZPA 2VZKD 4XWTA 2MBHA 2INNE 3IVFA 2BWES 1E7UA 2L1AA 2XN9C 3VUYA 3ZDMC 2INPE 3U30A 3M63B 4KDLB 2UWQA 3AEDB 4FJZA 3DQVA 1C79A 4KIKB 1L0VB 3KWLA 1KFYB 4MH0E 2KVRA 4WJOA 1GUAB 1J0GA 3ALBA 1XO3A 4M8NA 4WURA 2QIEB 2LHEA 3ZNHB 1UF0A 3QA8A 2VH1A 1F52A 1WX9A 5IOIA 4XZ4A 5JHBA 4LLGM 4BKTA 4ICVA 3DBHB 4WAFA 5HKHA 5AZGA 2N9LA 3PZDA 2XK5A 1FNVA 3EFCA 1V1OA 2WP9B 4PS3A 1RRBA 3BIID 5IN7A 4FJVB 4XDDA 2LXCA 4NJ7A 5AEKB 3B2GA 2JQRB 3H8HA 3ZW3A 1GAQB 5D3DA 2CJNA 2PMVA 1NI3A 4NY0A 4S0RA 4K3BA 1KRHA 2K39A 1I35A 1OQQA 3NRZA 1F2RC 3MHZA 2G9HD 4HKZE 1OQYA 4IDIA 5H8YE 2ZPNA 3GP7A 1ENFA 1C9FA 2NR2A 1MFWA 2W82A 2N7DA 4FN2A 3EGRA 2KACA 1D5ZC 2AYOB 1IP9A 4IKGA 1KJTA 2V3SA 5AUIA 4TMAB 1IBXB 3NJTA 1E90A 4BAXA 1GB1A 3DCGA 4MGYE 2W3SA 2LHDA 3HHMA 3P4PB 2X38A 3ML8A 2D5GA 3WA0A 3WALA 2KX3A 3TEXA 1WXAA 3MC0B 3N3KB 1KOTA 2C7MB 1KLGD 3LYYA 1WGDA 2KFKB 1JWBD 5AZFA 4WJQA 4ICUA 4PYZA 1KH0A 1LXDA 2BKFA 1I4PA 2KLGA 2H88B 3UQAA 4EFOA 3M62B 1PQSA 1ISNA 4CQNA 4IM3A 4YTMB 1M4VA 4BOSC 4OZCA 1L0YB 2IGDA 4LK0M 3UI3A 3CSFA 2M8SA 2GLSA
chains in the Genus database with same CATH topology
3DHGC 4P1CC 3RI7C 4P1BC 3N1ZC 3RNFC 3RNGC 3Q14C 3RNCC 2INDC 3N20C 3N1YC 3Q3OC 2INCC 3I63C 3N1XC 3Q3MC 3Q2AC 3DHIC 1T0QC 3DHHC 3RNBC 3I5JC 2RDBC 1T0RC 3Q3NC 3RNAC 3RN9C 3RMKC 3GE8C 3GE3C 1T0SC 3RNEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHG C;  4P1C C;  3RI7 C;  4P1B C;  3N1Z C;  3RNF C;  3RNG C;  3Q14 C;  3RNC C;  2IND C;  3N20 C;  3N1Y C;  3Q3O C;  2INC C;  3I63 C;  3N1X C;  3Q3M C;  3Q2A C;  3DHI C;  1T0Q C;  3DHH C;  3RNB C;  3I5J C;  2RDB C;  1T0R C;  3Q3N C;  3RNA C;  3RN9 C;  3RMK C;  3GE8 C;  3GE3 C;  1T0S C;  3RNE C; 
#chains in the Genus database with same CATH topology
 1QIL A;  2MLB A;  1YX5 B;  4L2Y A;  4HJK A;  2RPV A;  4K7U A;  1T0Y A;  1V80 A;  3P4S B;  1V2Y A;  3HVZ A;  1SJE D;  4LJO B;  2BYE A;  3RNA C;  5HG2 A;  3V61 A;  1TJE A;  1PGX A;  1WE7 A;  1PUT A;  2G3Q B;  5GMV A;  3U7Z A;  4BKG A;  1IUE A;  4FHK A;  2KAN A;  3KUZ A;  3AMZ A;  1WGR A;  3EUB 2;  1WMH B;  1I7H A;  3RNB C;  4PS8 A;  1N61 A;  2W3R A;  1XEE A;  2MP2 B;  2NBW B;  2QHO A;  4OVZ A;  2GRI A;  4K1R B;  2GBN A;  5E6O A;  2D10 A;  3WAN A;  1LFD A;  4I6N B;  1J7C A;  4NJ6 A;  4FUL A;  4EEW A;  2MBQ A;  1KLV A;  3VUX A;  4FAD A;  3VVW B;  2KD0 A;  1P9D U;  2GBJ A;  4C4V A;  3VQI A;  2VH2 A;  5IAA C;  1STE A;  3GE8 C;  2GMI C;  1Z2M A;  3V6E B;  2CKH B;  3DPD A;  1XCQ L;  4FJY A;  1XT9 B;  3WCQ A;  4W9D A;  2WXG A;  2ZJD A;  2D3B A;  2K25 A;  4L1B A;  3P2B A;  1V9J A;  2KTR B;  2HTM E;  3AB5 A;  1FEH A;  1C78 A;  4DWF A;  2WQY B;  4MAC A;  3QWZ B;  1V5T A;  2KX0 A;  1H4R A;  3Q8E A;  1NVI D;  5H92 C;  4WWO A;  2YVC A;  1C77 A;  2FID A;  4MDK E;  1WJ6 A;  2M0X A;  2FCM A;  4C7Z A;  1XQQ A;  3I63 C;  1MHX A;  2MA9 B;  2V1Y A;  1X1M A;  2KQS A;  3PRE A;  1D5M C;  1N62 A;  3I3T B;  2YEP F;  2NS5 A;  2G45 B;  1FMA D;  2E3T A;  1YN3 A;  1GPX A;  1FXT B;  1FXA A;  4LNI A;  4LDT D;  4IM2 A;  3AEG B;  2N7E A;  3R7R A;  3L17 A;  4BFR A;  1SXT A;  1T5X D;  3R2T A;  1DGJ A;  2WWZ A;  3ZTC A;  3GZN I;  4XDC A;  1E8X A;  2VZK B;  3WAM A;  1TKY A;  2FUH B;  4AJW A;  1EO6 A;  1CZP A;  3L13 A;  2OHF A;  1E0Z A;  4WQM A;  1WGG A;  4WWP A;  2E6X A;  3LB8 C;  2O2V A;  3A9J A;  3OWE B;  4HPL B;  4OVU A;  1T6B X;  2NVU I;  4AP4 C;  4C7Y A;  3ZTD A;  3IHP C;  2R2O A;  3V3X A;  5EDS A;  2L7R A;  2L3Z A;  4KSL C;  2QCZ A;  3WAO A;  2MW5 A;  2QEJ C;  4WWN A;  1JCK B;  3PHX B;  3RT3 B;  4JPS A;  4TSS A;  5HHD G;  3RNC C;  4C00 A;  4L23 A;  2FCS A;  3PO0 A;  2K9X A;  1VD2 A;  1HA5 A;  2LGX A;  3IG3 A;  2C60 A;  1WSP A;  4GLS C;  3PHW B;  2CS4 A;  3BVM A;  2OJW A;  2LFI A;  4KGT A;  2WU2 B;  1BUI C;  1J19 A;  1GC6 A;  5FKA C;  2ZW1 A;  3NOB A;  3NG0 A;  3VRA B;  3RZF A;  2BQQ A;  4C4V B;  1ZXI A;  2KKC A;  1SF0 A;  4NNJ B;  3JYU A;  4YTN B;  1ESF A;  1GNU A;  1EWY C;  2O6V D;  2WXF A;  1WXV A;  3ENE A;  4MJS B;  5TSS A;  3RNG C;  4M0W B;  3NY5 A;  2Z0D B;  2V0G A;  2JX5 A;  1J8C A;  1TS2 A;  3KH0 A;  3TEW A;  1MHH E;  5GXG B;  1T3Q A;  2PVG C;  1DYQ A;  4Q2J A;  3DBR I;  4YT0 B;  2DLB A;  1UBQ A;  3RI7 C;  4W9H A;  3N1Z C;  4RF0 A;  2BB6 A;  2KHW B;  4KV2 A;  4B0E A;  3QCA A;  4W9E A;  4NAW B;  2WDR B;  3S2A A;  1HTO A;  3JSV B;  4KSK C;  1EU3 A;  2KWU B;  2XNA C;  1B9R A;  2V4L A;  2C5L C;  4CHK A;  2C7H A;  2KAJ A;  1UNS A;  2NBU A;  4A3O A;  4HRS A;  1P7F A;  4LNN A;  4IWO A;  3ZNI D;  4M01 A;  3DVN U;  2MCN B;  3IAM 1;  1MPE A;  1Q1O A;  2JF5 A;  3TSS A;  1PGB A;  1Q5W B;  3RN9 C;  3UF8 A;  4RF1 A;  2BGF A;  1HTQ A;  4HRO A;  4DDG D;  3GS2 A;  4JX1 C;  2BYT A;  3HM3 A;  3EEC A;  2DBY A;  3Q8F A;  1SJH D;  2D2Q A;  1PYW D;  3DVG Y;  4G50 A;  2O6V A;  1K53 A;  2WXJ A;  1DOI A;  2AWT A;  5TR5 A;  3NS8 A;  4MH8 A;  2ONQ A;  3DBH I;  2WX1 A;  4KGR A;  4MGK E;  4RMA A;  1K51 A;  3PRP B;  5DPW A;  1N6Z A;  2KO3 A;  1Q0W B;  4P16 A;  2JZ3 B;  2D3A A;  1FCL A;  4EKU A;  3W1S A;  3DVG X;  3OJ3 A;  1WJU A;  1E5W A;  1QOG A;  1JWS D;  5CTR C;  2ZNV C;  1FRR A;  4N58 A;  2AQ3 B;  2NTT A;  3QAQ A;  3DWM A;  1YOV B;  1YN5 A;  2WXQ A;  2FAZ A;  2KN5 A;  2M19 A;  3R3M A;  2TSS A;  2INC C;  2RR9 A;  1NYR A;  5IO9 A;  3NUH B;  1E8Y A;  1A5R A;  4NAM A;  5DPT A;  3Q8A A;  3V6C B;  1MI0 A;  2ICI A;  4YTP B;  5EE1 A;  4P6V F;  2WXI A;  4M0W A;  2IZV B;  2VRR B;  2XBB C;  2CHZ A;  3AE5 B;  3P4R B;  1ZGU B;  4LNO A;  1AAR A;  4A8X C;  2MWS B;  2D07 B;  1XCT L;  2ZNV B;  3SU8 X;  2KYW A;  1SIJ A;  4HEA 1;  5KHO A;  4UDU C;  3DOW A;  4DHZ E;  3AH7 A;  4ZRP A;  2RD0 A;  3V05 A;  1C4P A;  5IKC M;  1L7Y A;  1RAX A;  1L6U A;  4KIK A;  2K3U A;  3MP9 A;  2WNM A;  3L10 B;  3MFG A;  4IW0 A;  5DCN A;  2IY0 B;  3WAP A;  3M95 A;  3VR8 B;  2NCN A;  3Q3J A;  3H1U A;  2KWC A;  3DHG C;  4GXB A;  3WIM A;  3PLV A;  4FA6 A;  3VRB B;  2WHI A;  3AN1 A;  3NVV A;  1LQB A;  2V4I B;  4G3X B;  2IBI B;  2J53 A;  1QOB A;  2QSD A;  3A4R A;  1HZ6 A;  2IO3 B;  3QAR A;  4YSY B;  3HIZ A;  3JW0 X;  3W2D A;  3H7P B;  3ZXR A;  4XC2 A;  3EHV A;  3TUO A;  2O2V B;  2MSE D;  2LGY A;  3K9P B;  4ZRK A;  4URK A;  2OOB B;  3DHI C;  2KWV B;  1Q10 A;  1ZW7 A;  2M17 A;  3HVD A;  1TKG A;  1I42 A;  1JML A;  4AWJ A;  3SHQ A;  3ZJT A;  4DXF A;  4W9K A;  4RNA A;  4FXC A;  2KNB A;  2WXR A;  1Y56 A;  1EWC A;  1FCC C;  4KKJ A;  1FO4 A;  1L4D B;  3W5V B;  1IGD A;  4WH4 A;  4XGA B;  3NZU A;  3PRM B;  4E74 A;  2M56 B;  3MC8 A;  4YWG G;  1WX8 A;  2KWD A;  1OEY J;  2FIF A;  3PLU A;  3AI5 A;  1TTN A;  3D32 A;  4E71 A;  2LD9 A;  3KYD D;  3KQ4 A;  1TS5 A;  2JU6 X;  2KDB A;  3Q3M C;  3APD A;  2MEK A;  5G5G A;  3DBL B;  1WZ3 A;  4NPN A;  1WR6 E;  3IFW B;  2DAF A;  2RSU A;  1KTK A;  1LM8 B;  3PVL A;  1R4N B;  5L83 A;  2BS3 B;  3TCA A;  3VTU A;  1NYQ A;  3N32 A;  1V97 A;  2D11 A;  3PRZ A;  1JQ4 A;  2FCQ A;  1FFV A;  1FXI A;  2BKR B;  4MGZ E;  3H6N A;  1TS4 A;  2PKO A;  1V6E A;  4GDK A;  4ITK A;  5BMI A;  2HJ8 A;  4OHJ A;  1EF5 A;  3ZO5 B;  4FBJ B;  2CU1 A;  3GZN B;  2XK5 B;  5L95 C;  1K50 A;  1RFK A;  2WS3 B;  4C56 C;  1YD8 U;  2AQ2 B;  4HPP A;  2JYT A;  2AX5 A;  1AW7 A;  3NVW A;  1QLB B;  5BYR A;  4MM3 A;  4ZYN A;  1OTR B;  3EC8 A;  1WXS A;  4IM0 A;  2Q5W D;  1WR1 A;  2HTH A;  2CJO A;  3BY4 B;  3P1M A;  3AE1 B;  2RPQ A;  2WXO A;  3MTN B;  5C2T B;  2PE9 A;  5T8I A;  4B0M A;  1WRI A;  3PV1 A;  4TKN A;  4AS1 A;  3PGE A;  3L08 A;  4ARC A;  1E7P B;  3A9K B;  4WQO B;  3KYC D;  1L2N A;  3APC A;  2EEL A;  3J9C A;  1K8R B;  2BS2 B;  1YQ4 B;  1JWM D;  4A9A A;  1SBB B;  1SE4 A;  3HUI A;  3LDZ E;  3EA6 A;  3IAS 1;  4H2A A;  1DOY A;  1T0R C;  3N30 A;  1AYF A;  1QKZ A;  3A1Q A;  4ACF A;  3PSE B;  4WJN A;  4W9F A;  4HDO A;  3IXS A;  1PGA A;  3HK0 A;  3DBL I;  3ZLZ A;  4OW0 A;  1SGH A;  2LUE A;  3Q2A C;  4K7S A;  3BK1 A;  1VZ6 A;  2AQ1 B;  3GOE A;  4X57 B;  5EE9 A;  1TS3 A;  3AXC A;  4GOC A;  2CR5 A;  3QC8 B;  4DXA B;  2EKI A;  2WGS A;  3DDC B;  4HXD A;  2WX0 A;  4BOZ B;  4E3C A;  5D6J B;  1VJK A;  3Q6B A;  2LEK A;  1CQV A;  4KDI C;  5MPO A;  1Y8R C;  4WIP A;  3C8Y A;  3SEB A;  5J18 A;  1QZE A;  1XLO A;  2W55 A;  1MJD A;  2KQ7 A;  3OJ4 B;  3R8B A;  5JZE B;  4O1N A;  3FAH A;  5CX3 A;  2IYD B;  2EMS A;  4BZA A;  4W9L A;  4F7Z A;  2WYQ A;  3KWV A;  3P42 A;  3R66 C;  1NEK B;  1AWD A;  2G4S A;  3C0R B;  5HI1 A;  2J0J A;  1UGM A;  1HZ5 A;  1YNT E;  3FIL B;  1WYG A;  1A70 A;  1FNW A;  3MC9 A;  3Q3F A;  2D3G A;  1FD6 A;  1WX7 A;  1OEY A;  2PPH A;  3GE3 C;  1E6E B;  3UIP B;  2KJ6 A;  1FM0 D;  2N1W A;  2N9P C;  2K5P A;  3FC4 A;  3OAW A;  4HVB A;  5JXV A;  3ZIM A;  1FRD A;  2LXA A;  1MG4 A;  1JWA D;  2DZI A;  3AV8 A;  2L00 B;  2JWU A;  1C76 A;  4LTU A;  4HJG E;  1YQB A;  2J7Q B;  4EZK A;  1IGC A;  3AUL A;  1CJE A;  1SE9 A;  2PVO D;  2GBK A;  2ZZP B;  3AE9 B;  1EU4 A;  2B3A A;  4ANX A;  4NZL B;  3AE7 B;  4AUQ C;  4REZ A;  1I4Q A;  3ZJU A;  2PJH A;  2EKE C;  2CU3 A;  3RMK C;  3HM6 X;  3GB1 A;  1R4M B;  1WI0 A;  5D7G A;  4J3O D;  1LGR A;  5HFY A;  3RNF C;  2O6V B;  1D6E C;  4A6Q A;  2UYZ B;  2V9H A;  3T8M A;  4DQO C;  1YQ3 B;  3TEY A;  3NZS A;  1JRU A;  4PT5 A;  2Z0E B;  2C9W B;  1UWX A;  2JRI B;  2Y5C A;  2WDV B;  3C19 A;  2R2Q A;  4RGO S;  1F0Z A;  3PZ7 A;  3AU5 A;  4BVU C;  1OFF A;  2ON8 A;  4TV3 A;  4JL9 A;  1NDD A;  1TYG B;  3AEB B;  4YL8 A;  4LCD E;  3KW5 B;  2DAJ A;  1JWU D;  3A9J B;  1L5P A;  2IO0 B;  2L05 A;  2OJR A;  2MP2 A;  2ZVN A;  4WWM A;  4GDL B;  2BPS A;  4LDT B;  2V3P A;  3VH3 B;  2KMM A;  4A3P A;  1YIW A;  3HRD D;  1ZPS A;  2KVZ A;  3JVZ X;  1CMX B;  2J4X A;  1V1P A;  1P3Q U;  3DWG C;  2WXK A;  3AEE B;  4KX6 B;  4W9C A;  4EE2 A;  3Q3N C;  3EFU A;  3SFD B;  1ZUD 2;  2J52 A;  2ZEQ A;  4M02 A;  1WRD B;  2UU7 A;  2BTE A;  3K9O B;  3PS6 A;  4TQ0 A;  3TEZ A;  1UEL A;  1E7V A;  1XLN A;  1JW9 D;  1L6V A;  2BYV E;  3CWI A;  1Z5S B;  2KQ4 X;  1N60 A;  2N7J A;  3U52 E;  1WXM A;  1WM2 A;  3CMM B;  3E9S A;  3ZNZ B;  3QQ8 B;  4BKS D;  2DYO A;  4ANW A;  4EOY A;  1TKE A;  4ZOH C;  1IYF A;  2NBV B;  4NQK E;  2ZPY A;  2K8B A;  2M0A A;  3BYT B;  2MBB B;  1SIF A;  2K1F A;  2QIL A;  1J7B A;  1ROE A;  2REX A;  2LVP A;  3BVZ A;  3TJP A;  1R7S A;  2Y3A A;  1QF6 A;  1R4M I;  2KN4 A;  1UZX B;  3ZRC A;  4N6E B;  1EM7 A;  3W1S C;  4JQW C;  4MM3 B;  2L83 A;  4ZRJ A;  2M4N A;  1S3S G;  1VR9 A;  2KT7 A;  1WH3 A;  2PEA A;  3RD2 A;  4A90 A;  3UGB B;  1SE2 A;  3DBS A;  1IBX A;  4DDI D;  1V49 A;  4I6L B;  1XD3 B;  4RM9 A;  2JRH A;  1C3T A;  3P63 A;  4II2 B;  2JZZ A;  4F1S A;  3BWU D;  3ZYY X;  2B76 B;  2KJR A;  2MQJ A;  4JE3 B;  2K8C A;  4RCO A;  3FKY A;  1SE3 A;  4YSX B;  4RM8 A;  1S1Q B;  3X0W A;  2KC2 A;  1P98 A;  3UIN B;  4DHJ D;  3RUI B;  1K52 A;  3KUC B;  2HDE A;  1WY8 A;  5D94 A;  2N9E B;  3QHT A;  3PPA A;  2PW9 A;  3A33 B;  3Q3O C;  2KTR A;  4JLC A;  3H7S A;  4AOF A;  1F77 A;  3ETR A;  5J17 A;  4N9F 4;  4IC7 B;  2DYB A;  4CYE A;  5FK9 C;  4AJY B;  2YEP B;  1N63 A;  1GC7 A;  2GOW A;  1YMH E;  1N5W A;  2N9X A;  2IGG A;  3L0W B;  3BIN A;  2BYF A;  1P1A A;  3BVG A;  1E9M A;  2BF8 B;  1WFY A;  3ZNG C;  2GBM A;  2DZM A;  1FIQ A;  3B2F A;  3DHH C;  1HQR D;  3L4P A;  2KLC A;  2LMC A;  4ZRI A;  4XE0 A;  3VDZ A;  1C4A A;  2LJ5 A;  4IWQ A;  5E6J A;  1P7E A;  4JGH B;  4YSZ B;  4RH6 A;  1QOA A;  2BS4 B;  2MBE A;  3TL5 A;  4M00 A;  2RDH A;  3ZQ4 A;  4ZHO A;  2BWF A;  4GN1 A;  3NVZ A;  4N59 A;  1AN8 A;  3ONS A;  1F9J A;  1F1H A;  3APF A;  2X8X X;  4MGI E;  2K8H A;  5C23 A;  2LGD A;  2NTS A;  2K22 A;  3ZJV A;  2KTF A;  2MJE A;  4OZB A;  5BYQ A;  1SB3 C;  4KZ0 A;  3B9J A;  2LRW A;  1I4G A;  3MHS D;  3V60 A;  3ZKJ C;  1QOF A;  4JWU C;  4A55 A;  2RDG A;  2CHX A;  2WXH A;  1B1Z A;  4A20 A;  2M1M A;  1XLP A;  4TQ1 A;  4DHZ B;  2J42 A;  4G0N B;  4EZL A;  1WGH A;  3AE2 B;  3TBL D;  2DHZ A;  2RMM A;  1BML C;  1VLB A;  3N1X C;  4JIO U;  3LXF A;  2N4F A;  2KMC A;  2FE8 A;  1YJ1 A;  3U8Z A;  2KXJ A;  2PE6 B;  4BBN C;  4PYU A;  1ZOY B;  1JRO A;  2AL3 A;  1D3Z A;  1TZO A;  1C1Y B;  1NI2 A;  3T3O A;  2WDT B;  2ASQ A;  3VH4 B;  4B9K A;  4HLE A;  3RYT A;  1TBE A;  4IUM B;  4DXG A;  5C1Z A;  1E8W A;  2KMA A;  1D5X C;  3VUW A;  2K6D B;  4GU2 A;  1PFD A;  2BW2 A;  5AUK A;  2K6Q A;  4WAA A;  4RGN A;  4US9 A;  2ZCC A;  4PK1 A;  2DZJ A;  3TIX A;  2KOX A;  3U2S C;  4NAW A;  1HEZ E;  2RGF A;  1RM6 C;  1V1P B;  3SFE B;  1VRA B;  1FNU A;  3M3J A;  3I57 A;  2NPT B;  4MEL A;  5DPR A;  4S17 A;  3ECI A;  3MJ5 A;  1QT9 A;  3RFZ B;  3N1Y C;  1GOZ A;  2WXN A;  1P0R A;  1UWM A;  2I2Y A;  1HXY D;  4USA A;  1ACC A;  3AE8 B;  2JUO A;  3MJW A;  5FR6 A;  1ET6 A;  3R2I A;  1V8C A;  5CHW A;  2ZCB A;  2LGI A;  3VTW A;  2Z8L A;  4P7I A;  1WGY A;  4GDL A;  1WXQ A;  4HCP B;  4YXD B;  1U4A A;  3B1L X;  4XWW A;  1EUV B;  3L16 A;  2LZ6 A;  3Q14 C;  5DPS A;  3X23 A;  4FHJ A;  3VHT C;  2L0T A;  5LNK 1;  2H89 B;  1GJZ A;  2L0F A;  2G4D B;  2KFJ A;  2MX2 A;  3H7P A;  1WM3 A;  5D2M B;  3DVN V;  1QQR A;  3U7D A;  4KGS A;  4OZA A;  5KHQ A;  1XLQ A;  1VZ7 A;  5G55 A;  5D3I B;  1XF5 L;  3KVF B;  1C4C A;  3RNE C;  1VCB A;  1SEB D;  1TZ1 A;  2MH7 A;  3RZW C;  2LVQ A;  2AEH A;  2DEN B;  3BZD B;  1H8C A;  4ANU A;  3OLM D;  4KKI A;  4D2K A;  4MSQ B;  4HK2 A;  1UBI A;  1BT0 A;  4GSW A;  2KDI A;  5BYS A;  4ANV A;  3AU4 A;  3W9C B;  2BBC A;  3LJ3 A;  3OG5 A;  3Q8C A;  4J6I A;  3VFK A;  4US8 A;  3N20 C;  2WXM A;  1KF6 B;  3A9K A;  2V3N A;  5G5H A;  3B0A A;  1WZ0 A;  2DX5 B;  1SSN A;  2ACZ B;  4IWP A;  2KDF B;  1L4Z B;  2BB5 A;  4ARI A;  3QK0 A;  3T3N A;  4GMV A;  1WIA A;  1ZE3 D;  2NPT A;  2BVC A;  4LNK A;  2DNF A;  4XYC A;  2KDM A;  2Z59 B;  1WGK A;  4GGQ A;  5LXI B;  4AQ7 A;  1E8Z A;  4KVG B;  3ZRF A;  3URY A;  2L8J A;  1N5X A;  1MVK A;  2QDF A;  2WXL A;  1WJN A;  2SAK A;  2W9N A;  3KLS X;  4DHJ B;  1V86 A;  2MBO A;  4I6P A;  1V81 A;  5AZH A;  1WE6 A;  2IND C;  1PDX A;  3BYY B;  4W9G A;  4EUT A;  2GBR A;  2WDQ B;  3AE6 B;  5E6P A;  3VTV A;  1IPG A;  3O65 B;  2EMT A;  2IY1 B;  5G2N A;  5LXH A;  1WWT A;  4ZHP A;  1ZP0 B;  4FLH A;  1TT5 B;  4BKS A;  1G6J A;  1I4H A;  2IPK D;  4MJS A;  1RWS A;  2CHW A;  3AEF B;  2LRU A;  5LLI A;  3ZXV A;  2ZVO A;  3FIL A;  2LVO A;  2ZW0 A;  3AE3 B;  4OVV A;  3T9L A;  1UH6 A;  1OGW A;  2L52 A;  3V62 A;  1MG8 A;  4II3 B;  1R4N I;  3CF6 E;  4HCN B;  2FNJ B;  1JRP A;  1TGZ B;  2WU5 B;  2LGS A;  1RLF A;  3CIR B;  1E10 A;  3ML9 A;  2LUM A;  3NHE B;  1BXT A;  4EZJ A;  2XEW A;  3JSV A;  2J0M A;  3AEC B;  3QX1 A;  4MEM A;  1TIF A;  3UQB A;  1YX6 B;  3NS1 A;  2J0K A;  1I4R A;  2FBW B;  1JAL A;  4NQL B;  5E6N A;  3BK2 A;  5IP4 D;  3N9Y C;  2C7N B;  3RUL A;  2W54 A;  2KJH B;  2I38 A;  4BBN F;  4HKQ A;  2N0S B;  5BMH A;  4M8M A;  3ZGZ A;  3NVY A;  4ZYS A;  2I1K A;  2Y5P A;  2MRP A;  5IA7 A;  4W9I A;  1V5O A;  1VZ8 A;  4LJP B;  2RDB C;  3DBR B;  4HDQ A;  3PT2 B;  4RGM A;  2KZR A;  2L76 A;  2A4Z A;  1RFA A;  2LJI A;  3AEA B;  5CHV C;  2JT4 B;  3SD5 A;  1WF9 A;  2KFK A;  3Q69 A;  3QJZ A;  4MT5 A;  4GB9 A;  4HPM B;  4K81 A;  4R3D A;  1M94 A;  2DYM A;  3KUD B;  4JWS C;  5EE3 A;  1ZXH A;  1EF1 A;  3I9V 1;  4LNF A;  1ZDV A;  3IBE A;  2QC8 A;  4IG7 B;  2GI9 A;  3SDL C;  3UIO B;  2FCN A;  1YJI A;  2L32 A;  1D4B A;  4QAY A;  2I1J A;  4F8C B;  2MHJ A;  2JPH A;  1KLU D;  3ZUN A;  2JYE A;  1TY0 A;  1YN4 A;  1ZDX A;  2HE7 A;  1WMH A;  2IO1 B;  2WLB A;  3PTF C;  2IO2 B;  1NEN B;  2KC1 A;  2MJD A;  3SR6 A;  4B6W A;  2JVC A;  4K7W A;  2WXP A;  1ET9 A;  1WYW B;  2N9K A;  1L0X B;  3VXW A;  2GB1 A;  2JWZ A;  5BO4 B;  1NBF C;  3R7Q A;  2N1V A;  3Q8B A;  2AL6 A;  2G1E A;  2SEB D;  3E56 A;  2HD5 B;  4K3C A;  5EE0 A;  4GDK B;  5C3J B;  4ZRQ A;  3VAW A;  1TY2 A;  3RPF C;  5BMG A;  1F2R I;  1LO5 D;  4WJP A;  2PIA A;  5J2R A;  2FUG 1;  3P4Q B;  1YJJ A;  3A1Q B;  1UGJ A;  2Y5B B;  3H9D A;  2K0P A;  4DBG A;  4IOI E;  1XXG A;  3IT4 B;  2KK8 A;  3CST A;  5I4D A;  1KM7 A;  3ZDT A;  1VDV A;  2A5U A;  2JSV X;  4DK5 A;  1FPY A;  4NJC A;  3AM9 A;  3QIJ A;  3B08 A;  2DZK A;  4C80 A;  4RFB A;  3VR9 B;  2JXX A;  4P1C C;  2PLP A;  2QJL A;  1FFU A;  3W5U B;  1CK1 A;  4TUU A;  2IGH A;  1GB4 A;  3L54 A;  5FR3 A;  4GIV A;  2HJ1 A;  2YLM A;  2LI5 A;  4HWI B;  3O13 A;  3U4E G;  2QMT A;  3W1Y A;  3I5J C;  1J7A A;  2BT6 A;  3NZ3 A;  1OQR A;  1UD7 A;  4ZDV A;  2IDY A;  2IJ0 A;  1WJ4 A;  2R61 A;  2D3C A;  4KZC A;  4ASW C;  3PZ8 A;  2MJ3 A;  5JH5 C;  4PS7 A;  4P1B C;  1ZKH A;  2DWQ A;  4W9J A;  4CO7 A;  3RCZ A;  1HE8 A;  3AE4 B;  4G11 A;  1T0Q C;  5CHF A;  1DOX A;  3TMP B;  2LWP A;  4RGT A;  2JY6 A;  3A4S C;  1RYJ A;  2KDE B;  1T0S C;  2PTL A;  5JHA A;  4B95 A;  1GG3 A;  1UUP A;  4MSM B;  1I4X A;  3IT6 B;  3ABV B;  3ZVV A;  2NMQ A;  4XX5 A;  2OED A;  2JXT A;  2LAS A;  2JZP A;  2VZK D;  4XWT A;  2MBH A;  2INN E;  3IVF A;  2BWE S;  1E7U A;  2L1A A;  2XN9 C;  3VUY A;  3ZDM C;  2INP E;  3U30 A;  3M63 B;  4KDL B;  2UWQ A;  3AED B;  4FJZ A;  3DQV A;  1C79 A;  4KIK B;  1L0V B;  3KWL A;  1KFY B;  4MH0 E;  2KVR A;  4WJO A;  1GUA B;  1J0G A;  3ALB A;  1XO3 A;  4M8N A;  4WUR A;  2QIE B;  2LHE A;  3ZNH B;  1UF0 A;  3QA8 A;  2VH1 A;  1F52 A;  1WX9 A;  5IOI A;  4XZ4 A;  5JHB A;  4LLG M;  4BKT A;  4ICV A;  3DBH B;  4WAF A;  5HKH A;  5AZG A;  2N9L A;  3PZD A;  2XK5 A;  1FNV A;  3EFC A;  1V1O A;  2WP9 B;  4PS3 A;  1RRB A;  3BII D;  5IN7 A;  4FJV B;  4XDD A;  2LXC A;  4NJ7 A;  5AEK B;  3B2G A;  2JQR B;  3H8H A;  3ZW3 A;  1GAQ B;  5D3D A;  2CJN A;  2PMV A;  1NI3 A;  4NY0 A;  4S0R A;  4K3B A;  1KRH A;  2K39 A;  1I35 A;  1OQQ A;  3NRZ A;  1F2R C;  3MHZ A;  2G9H D;  4HKZ E;  1OQY A;  4IDI A;  5H8Y E;  2ZPN A;  3GP7 A;  1ENF A;  1C9F A;  2NR2 A;  1MFW A;  2W82 A;  2N7D A;  4FN2 A;  3EGR A;  2KAC A;  1D5Z C;  2AYO B;  1IP9 A;  4IKG A;  1KJT A;  2V3S A;  5AUI A;  4TMA B;  1IBX B;  3NJT A;  1E90 A;  4BAX A;  1GB1 A;  3DCG A;  4MGY E;  2W3S A;  2LHD A;  3HHM A;  3P4P B;  2X38 A;  3ML8 A;  2D5G A;  3WA0 A;  3WAL A;  2KX3 A;  3TEX A;  1WXA A;  3MC0 B;  3N3K B;  1KOT A;  2C7M B;  1KLG D;  3LYY A;  1WGD A;  2KFK B;  1JWB D;  5AZF A;  4WJQ A;  4ICU A;  4PYZ A;  1KH0 A;  1LXD A;  2BKF A;  1I4P A;  2KLG A;  2H88 B;  3UQA A;  4EFO A;  3M62 B;  1PQS A;  1ISN A;  4CQN A;  4IM3 A;  4YTM B;  1M4V A;  4BOS C;  4OZC A;  1L0Y B;  2IGD A;  4LK0 M;  3UI3 A;  3CSF A;  2M8S A;  2GLS A; 
#chains in the Genus database with same CATH homology
 3DHG C;  4P1C C;  3RI7 C;  4P1B C;  3N1Z C;  3RNF C;  3RNG C;  3Q14 C;  3RNC C;  2IND C;  3N20 C;  3N1Y C;  3Q3O C;  2INC C;  3I63 C;  3N1X C;  3Q3M C;  3Q2A C;  3DHI C;  1T0Q C;  3DHH C;  3RNB C;  3I5J C;  2RDB C;  1T0R C;  3Q3N C;  3RNA C;  3RN9 C;  3RMK C;  3GE8 C;  3GE3 C;  1T0S C;  3RNE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...