3Q2CA

Binding properties to hla class i molecules and the structure of the leukocyte ig-like receptor a3 (lilra3/ilt6/lir4/cd85e)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
PLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukocyte immunoglobulin-like receptor subfamily A member 3
publication title LILRA3 binds both classical and non-classical HLA class I molecules but with reduced affinities compared to LILRB1/LILRB2: structural evidence
pubmed doi rcsb
molecule tags Immune system
total genus 21
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q2cA00
1QHPA 4JY5H 3ARBC 5M95B 2HG5B 3RGVB 3QWQB 2YMXL 4P5TA 3QJHB 4NJ9L 2DL2A 5D6DC 3KPNA 3V6ZB 1ZGLB 4NFCA 4X6DA 5JDSB 1VFOA 3GEWB 2H6PA 3O6FB 2BJML 2FX9L 4BA8A 3HMXL 1A3LL 2FJHB 1JZ4A 2WBJA 1DANT 3MJ9H 3REWA 2I25N 1JCKA 4X8JA 1DQJB 4ONFH 3RX7A 4U6XA 5SWSE 3NCJH 5ESQB 1C16B 2VB5A 4X8XA 2CK2A 5HY9A 4MA3A 1QA9B 1RZKH 5I66B 4BJLA 4WJ5B 4ZAKD 3PWVB 1TTUA 3ARXA 1PG7L 3KJ6L 4K8RL 1IAII 1SYVB 4P2QD 2A1WH 5JXEC 1YJDH 4X6DE 3QZWB 4CKVX 3EFDH 4XRCA 1A1OA 2G60H 1MH5A 2UYLB 1IKNC 4GXUM 5FAAA 5BRZD 4M6NL 3TBSA 5TFSH 2RCSL 1PQZA 1OPGL 1X44A 1MLCB 1CXKA 4POZC 4U6TA 1E4KA 3VJ6A 3C6LC 4MJIA 5KSAC 1P4LB 1S8DA 4HPOL 3CZFA 4Z7UB 4NWTL 3MGOB 3RVXD 4U33A 2LTQB 3TJEL 4GQPH 4GG6B 3L7EB 3OGOE 1FNGA 3BO8A 5INDA 3LPGA 1OGAB 2X4NB 5F7MC 4PJDA 4Z7VF 4DVBA 2DLFH 3FAWA 1NMCB 3GKWL 1TZIA 4OCYL 4FG6C 2A38A 4J23A 5FKAB 3TBWA 5F96L 2ORBH 4M7LT 1UEMA 2W60B 4ORGB 5I1KH 3VXQB 3KR3H 1VDGA 1K9TA 4Y5XA 3UROR 4HLZG 2Y6SD 1MFNA 4MJIE 2YMXH 1NUFA 1ZVHA 4NKMA 3G6JF 4PP1D 2XWJA 3IETB 3WFEL 2E9BA 4K8RD 1F90L 1SEQH 1PZ5B 1HIMH 2BJMH 4B41A 1C12A 2BMKB 2JK5B 4JDTH 3R1GL 3KPRD 2FEEL 3BPLB 1A3LH 1X5KA 2E6JA 4PJDE 4FXKB 1U95A 1CQYA 3QXDA 3SJVA 4M6MH 4WTXA 5CBAA 3RWDA 3D9AL 1RHHA 2QSCL 2XRAL 4HF5L 1MCPL 5F70A 2EH8L 4YXKH 1Q94A 1D5ZA 5L8LB 3T4AB 5EO1B 3FFDB 1X7QA 2E7HA 3KYNB 4UAOC 1PG7H 3F12A 5IG7A 4HWBL 1MRDL 3QUML 4Q2ZA 1AXSB 4BSVA 4HJ0D 5DJDB 5D1ZB 1OY3B 1ZHBA 3TYGL 2VRAA 2EIZB 1T7XA 3CLEL 4EZMA 4KK9D 3STZA 5TF1L 4DAGH 2RCSH 3HG1D 4UQ3B 3SJVE 4AIZA 1B3JA 3K4AA 5HHXH 4Y7MA 4HPOH 4OLVL 4YAQB 5D1QB 4ZFZB 3RTQB 5C0RL 5CD5C 3MX0A 3O0RL 3MLUL 1XF5B 1QBBA 4I0PC 3UYRH 4HXAL 4LHUA 2IALB 5J1TC 2GUOA 1J05A 5DC9B 3SGEH 4ZUUB 3RDTA 1OTUC 4IEFB 4KJWC 1CDHA 3QHTC 4MNQD 1D5XB 3BOVA 5TE4H 2ZUYA 1OTSD 2Y06L 4XH2B 2BFVH 4G7VL 4YX2L 3MLZH 5FM5M 3Q5OA 1DQLH 2Q7YB 2DQHH 2CKBL 1ETZA 3RZWA 5LVEA 4YNYA 4OLWH 4G9FD 5CZKA 3E0GA 1A1MB 2VDKH 3QUZC 4H0IA 1GC1L 4U1JA 1K6QH 1KJMA 2J12B 4NUGL 3TGXA 4LCCA 1JIBA 4YHZH 2PF6A 3FB7B 4PRPD 2FB4H 1HOCB 3ZMRA 2R2EA 4GMTH 4LGSB 4ZAKB 3WO3B 2FZ3B 1N6VA 5HGBA 2H9GB 3QG7L 4P2QB 2VMFA 1MCPH 3B6SB 4U1HA 1AGDA 1S7TA 2ATPA 3BDXA 1GGBL 5BRZB 3SDAA 1MRDH 4XPFL 3QISA 1E28A 2NXYD 4LSRL 5E2JA 2A9MH 4YDIL 2WK2A 1I8KA 3W0WA 1LEIA 4DCQA 4JQVC 1FDLL 5GISH 4HIIA 3N85H 3OAUL 5CJXA 4FFZL 4JANB 1AD0B 3L7FA 5JPNA 4RGMB 2FATH 4JM2C 1QVOA 3GO1L 4XNUL 1EV2E 2Z35B 3SPVA 4CU7A 5I2IB 3P11H 5D6DA 3O0RH 3MLUH 1OWRM 5JW5A 1T04A 3MFGB 4HXAH 1KEML 1MFBL 1Q9OB 3K4DA 1H15B 2IWGA 2NY2D 4ZODA 1MPAL 1XGTA 5I19L 3UTOA 1PGRB 2EKJA 1JRHI 4UINL 1BLNB 3W0WE 5BV7L 3R0NA 2F74B 2Y06H 1U8IB 1L9NA 4XVUC 4YHNB 3DYPA 5FYKU 4G6AC 3WIFA 5GGSA 1KELL 1YEKH 2EXWC 3HZMA 2IH3A 3MRKA 5MEPB 4L4VD 4KJYA 3ZTNL 2Y9RT 4X83A 4KV5E 3KPRB 5DJXB 5DJCB 3KPMB 5ICZB 1H5BC 1M05A 3EHBD 4ODWB 5FO7A 4NUGH 2IPKB 1N7ML 3ULUC 5EUOF 4PLJC 4YHPB 3K0WA 3RJDA 3VFVA 1IE5A 3EOTH 3NABH 3RGHA 1BFVH 1U8PB 1AD9A 4OF0A 3FOLB 2B4CH 3HE6D 5IGXL 4HJGA 4NQED 3AMLA 4P46A 4MD4A 2XICA 1SVZA 2HT2D 1EAPA 2EE3A 2DMCA 2FBOJ 2VXUL 4AH2B 3CLFL 4QRUA 3PXHA 3MRMB 4N8PA 5IK3A 3WIHL 1HDMB 4OTXL 4LSRH 5T1LA 3MCLL 3HG1B 4YDIH 1K8IA 4IJ3B 4DK3A 5CMAA 1Q0YH 4YGAB 1R3JB 4PG2A 4XHJD 3U36A 3L6FA 3CK0L 4NGHH 5EC1A 4NQTA 4XGZB 5IWLA 3W2DH 3GIVA 4HUUB 5D8JL 1GHFL 1EUUA 1SBSL 4C56D 3ZDYF 3MREB 2HKFL 3FO1B 1AC0A 3FFCA 5HI5D 4WFGD 4P5MA 3EDDA 3TH2T 3UJTL 1MPAH 1XFPA 4OCWH 1NANI 1JNHA 2FO4A 1GGUA 4G9FB 3OPZL 5BV7H 1IEAB 5FYLL 1N4XH 4NRYB 3TCLA 2F54A 3U6RA 5F6IB 3DX6A 3SGJA 3IT8D 4M48H 4AMKH 1DQDH 3QUMB 4LKCA 1JHKH 3O3BB 4KI5F 3MYZA 1XF2B 5IHZB 3IFLL 5IM7A 4PRPB 3PWJB 4Z0XA 1J10A 3CFJA 3FFCE 1J8HA 4P4KC 2AEWA 3U83A 1N7MH 1JWMA 4NT6B 3IDNB 1EFXB 5HHMD 5HYSB 3QCVH 4IOIA 3U30C 1N5AA 5T1KD 1BEYL 3RHWK 3HRZB 3N1FC 3KHQA 5IGXH 1BPVA 4AYFA 4J3XA 1CD1B 2OP4L 2NXYB 3HZKA 2XZCH 2CLZB 4EKXA 2HVJA 2WNGA 4UMGA 1E27A 5BZDA 4KROC 1H3UA 1NGPH 3KDMA 2EDFA 4U6VL 3GI9L 1A6ZA 4OTXH 2Y5EA 3B2UC 4F37K 3MCLH 3BD3A 4I3RL 2RAMA 1J8HE 1T03L 4UU9A 2CKBB 1MRCL 1I3GL 4KVCH 4MD0B 5EU7E 5FYLD 3QI9D 3CJJA 3S9DB 5DJAB 3OR6B 1U8OB 4X99B 3V5DA 2AW2A 2F15A 4MDIB 4QWWD 5TDOA 3EYSL 2NY2B 3P77B 4L3AA 3BUYB 4MNHB 1JVKA 2YBRA 5D8JH 3U48A 3D25A 1MNUH 4KKCC 3TVMD 2XPGA 2MMXA 3QCTL 3PP4L 3HI5L 1NFIA 3GMQB 5LAXA 3LKNB 5C2BL 3IDJA 4LLYA 4L4VB 3OPZH 1WBYB 1DDHA 5FYLH 1WIPA 1IGCL 4JKWA 4IDLA 4DN4L 1JWSA 4U49A 1KJ3L 1K8DA 1A6WH 4XWGH 5J0BA 1IEHA 3TNNA 3F58L 4M5YL 3G04B 4YK4B 1MI5D 5C0IB 3SKJH 4HIEA 4WW2C 5ALBL 1K3IA 3NFNA 3HE6B 4K7PY 4NQEB 1GAFL 1SJEB 3WYRA 2IPTL 3ALPA 3MCG1 3DV6A 5I1IL 2BSSA 4NQDD 4GLRH 3OKKB 1XH3B 1N26A 2AJSH 1X4YA 2EO1A 4GW5A 3U46B 5F1NA 2DQUL 2VWEE 5K9QG 3DXAA 3JSSA 2FHCA 4JE4B 5DJ0B 2OP4H 4YO0B 4LRNL 1Z2KA 5BOPA 5EU3B 4O4YL 3BGFB 3BGAA 4KZDL 1X4ZA 4L3ED 1F8TL 3K8KA 5BV7B 4XP6L 4JY6A 2VJXA 3QUXD 1OGTA 2LABA 3EDJA 4G42A 5DMGC 3OHXB 4BSWB 5F3HA 3QXVA 4I3RH 5LBSL 4L9DA 4LVHC 4WTWA 4C55A 2MCPH 2AV1A 3P0GB 4R7DB 1ACYL 4NQCD 4C56B 1G84A 2QADC 2CXGA 4O9HL 4JRYD 5HYJA 4Y5YC 1RZFH 2BZDA 3IJSB 2FLBT 3BKML 3DXAE 5IVXF 3MLWL 4CDGC 4NWUH 2MQCA 1Z9MA 3QCUL 3SE4C 5DK0B 5SV4A 2ZOKB 3PP4H 2L0DA 1CZ8H 3SE8L 3P2TA 5C2BH 3OKMB 4X7SH 3HS0B 4KXZH 2DMBA 2F53A 4HFWA 1U93A 3VGFA 4DN4H 2C4FT 5BS0A 5IIEB 3D0VB 3SGDI 2J6EH 5I8EB 2R1YB 2WW8A 4U7SA 1QP1A 4NO5B 5HHMB 1HINL 1ZS8A 4JFYB 5SWSD 4PV9A 3RIFK 5ALBH 1HH6A 1EVTC 4S1DD 5IMKA 2J2ZA 2WIIB 2BK8A 3WS6C 5C9JB 5FYJE 4D3CH 4N8VA 4RA3A 3ECBA 1NJ9A 3X3FH 5A2LH 2QLVB 2KL6A 5ENWA 1JFQH 1HQRA 4UZGA 5E9DA 5K93A 1VPOH 2F53E 1KPVA 4APQB 2WWMC 2GFBA 5D93C 2DQUH 3UMTA 4GH7B 5BS0E 3IU4L 4UT7L 4LCUB 1BBDL 3X11A 1BJMA 1Q9KB 1FZMB 3FQTA 4K3HA 2GTWB 3QI9B 1CT8A 4OV5B 3C60D 4CADA 4M7JL 1KCVL 5LBSH 1ITCA 4DGYL 3L3OB 3QIBA 5F89B 1KPRB 3HC3L 4ZPTB 1BF2A 3VI4F 3QEGL 4O51A 4MS8C 5C86A 1SY6A 5E9DE 5F88B 2AKRA 3BMWA 5D2LA 3BKMH 3S96A 2EH7H 1T66C 4KTEH 4IMKC 3OKLA 4NJAL 1PX3A 2NR6C 3QCUH 4ESKA 1QPPA 1FAKT 1HNFA 2FECI 4KDTA 4AT6A 3EW3B 3H7BA 3QJFA 4MJID 5LJYH 1W72A 3JTTB 2CUMA 1PEWA 1MI5B 4AIOA 1UVQB 4NKIH 3S37L 3STLB 1ZHNA 2V2TB 3QPXL 4YH6A 4HC1H 4RAUA 5D2LE 3HR6A 5F7LB 1ZWIB 5ABDE 3BP4B 3IDMA 4N5UA 1HN1A 4LNRB 3G5ZB 2VC2H 4NQDB 3B5GA 2CRYA 5DURD 1W0WA 1WT5C 5I18H 1SHMA 4GO6B 5J6GA 2JB6A 4HIJB 3O11A 3VFTB 4PGZA 2O5YH 1P4BL 2V5TA 2SEBA 5F6HI 1ZLSL 5DHVB 1RVFL 5DMJB 4P2CG 2R69L 4L3EB 1B0RA 5I8OH 1DLFL 3T2QA 1UCBH 2YK1H 1C1EL 1CR9L 1FE8H 3MA9H 1I1CA 1NGQL 1WCBB 3GSWB 3QQ9D 2WLZA 4FQIL 3SJVD 2EDYA 4NQCB 4JLRB 1BWMA 3BWUC 4R96B 4C59B 1V3MA 4JRYB 5GRJH 3S6CA 3GSNA 3GRWA 1W0YT 3AS3A 4E42A 3P4NB 4OD2A 2PW2A 1EIBA 4ZD3H 1TJHH 3IVKA 5ICXA 4JG1L 2XTJE 5TE7L 3ZKXB 4FMKA 4H25B 3ULVF 2P8MB 3IFPB 5HHPB 2QBWA 1KCRL 3AREA 3MRPB 4C58B 2FD6H 5HBBA 3ULSA 4BQCA 1SJXA 4UNVA 5EOCH 1LGVA 5FCSH 4XNMA 4ORZC 4NJAH 2C1PB 2X7LA 5I17B 4WW2A 3T65B 3PP3H 4ZS7L 4G6JL 3CVHL 3S34H 2NXZC 1RU9L 3E1F1 1A0QL 3DROA 2XYCA 2ZOLA 3QB7C 3WDHA 5JNYA 5HGAB 3LS5L 4ZUVB 4I9WE 4H20L 5BVPL 3L9RA 4LHUD 5CJ5A 2F8OA 5SWSB 4JFQB 2QQQA 1NCCH 4YIQA 3RDTD 2X1QA 4WGWB 3DX8A 4P2OA 5DVLA 4IHOB 4OB5L 3RPIB 2DI7A 3WJJC 1BVLA 4P5TB 3KPNB 3VFNA 2APFA 3P0VL 4X6DB 4ZS6C 2C26A 3MRBA 3MLYL 4KKNA 4M43H 4IRSA 4MAYC 2H6PB 1AH1A 5GJTL 3LIZH 3LKQA 5CEXA 2WBJB 4HUMB 3REWB 3VG9C 2R69H 4Y5YA 4X8JB 5KSVA 4F7CA 4U6XB 2E27L 4OLUH 1CR9H 2BXYA 5HY9B 1FN4A 2VN7A 4MA3B 5F9OL 1CXLA 4UT9L 2DBLL 4UV7L 5J4MA 5KANI 5J13C 4TN9A 1GOFA 4XNYL 4XRCB 1JPSL 2MSPA 1A1OB 1FPTH 1L6ZA 1MH5B 2JJTA 5C0EA 3OZ9H 1IEBA 3TBSB 3S35X 5IJKC 5LWYL 1PQZB 3I2CL 4JJ5A 2R2HA 3W0WD 4GUPA 3VJ6B 4MJIB 1S8DB 3D18A 3CZFB 4F7MA 5EFIA 5KTEL 1D5IL 4ZS7H 1FH5L 4HT1L 2OZ4H 1FNGB 1RU9H 3BO8B 1NFDA 4KMLB 5INDB 4DN3L 4JRXA 4PJDB 2FL5A 4DVBB 1QFWH 1TZIB 3TBWB 4H8WC 5BVPH 4Y5VA 4R6UA 1UKSA 5E95B 1PFCA 3P40A 1OTTC 3CMGA 2K1MA 5DURB 5T1DL 3SO3C 3VA2C 5DFVC 4Y5XB 3ZTJH 1IZJA 2J7LA 4JFOA 4NKMB 1KN2L 4NCC1 2XWJB 3MXWL 2WIMA 5E6IA 3RY6A 4B5EA 2A9NL 3DWTA 1IILE 1C12B 1NFDE 3M1BA 4JRXE 1R5VA 2ZPKH 1RJZA 1U95B 3FZUC 3QXDB 1A7PL 4PTTA 4QXWA 1IAOA 3SJVB 5CBAB 2XZZA 3AB0C 1RURL 3RBSA 3QUKA 5BW7C 5CZXD 3RWDB 4P59L 1RHHB 3AM8A 1F11A 1Q94B 5HHQA 1D5ZB 4WI3A 5F9OH 5KZCD 3LD8C 1X7QB 4UV7H 1PSKH 2P1YA 2NY6C 3FB6A 5DXWA 3TM6A 3F12B 3UTSE 5IG7B 4LLAA 4P46D 4Q2ZB 2IH1A 1OAUH 5SWZA 4BSVB 2R56H 4KK8C 3CFCL 1ZHBB 1HKFA 3A67H 4PJEF 5FFLA 3WFDL 2W0FA 3STZB 3BEVA 3G5YA 1JYXA 2IANA 5T1LD 3AVEA 4AIZB 4PLKC 4OFKA 2AJXL 4LCWA 5CIPA 5FKPA 5KTEH 1LK3L 3TYFA 3NPSB 4TNVF 4LHUB 2GUOB 3QG6A 1FGNH 1J05B 1B2WH 1XGUA 1JP5A 1N8ZA 3RDTB 2A0LC 5SWZE 4OFPA 4WIQA 1MHPH 4LFHG 3FFCD 5CKGA 3ZDZF 1OQXA 1SMOA 4XMLL 3DIFA 5SX4H 3MJ7A 1Z3GH 4TVPE 5DUML 4JHWL 1FYTA 2FX8L 3CX5J 4QXGL 2IANE 1ETZB 1I75A 2I07A 3C5ZD 4YNYB 4F57H 5DRNA 2P8PA 5A3ID 3SO5A 2VDPL 1U42A 3T3MF 4LCWE 1KN2H 4KY1L 5GGVL 2E3VA 4HWEL 3U0TA 2YPKA 4U1JB 1KJMB 5IR1A 1MUJA 3BMVA 1OAKH 1MJUL 1IBGL 4LCCB 4U1IA 4FMFA 4QRRA 1Z9OA 4P9HL 5ADOL 1U2CA 5I6XB 4W4NA 2AABH 4OZFA 2R2EB 3AROA 2J8UF 1J8HD 4UB0L 1UGNA 5HGBB 4P59H 5K9OA 2FDBP 1FYTE 3EO1A 5ITBH 4QKXB 4PJCA 4U1HB 4Z7WF 1AGDB 1S7TB 2ATPB 3HHRB 2E6QA 2ZUQB 1I1AC 2DQDL 4YEEA 3BAEH 3SDAB 2COQA 5M7QA 5EO0A 1YEEL 1E28B 4M7ZC 1CDBA 2H1PH 1I8KB 3W0WB 4ELKA 4DCQB 1LEIB 2DQGH 4QRRE 3JWDL 2E7BA 4HIIB 3WFDH 1P9MC 3G5VA 3QNZA 3L7FB 5JPNB 3IGAA 3MLTA 1DEEA 1QVOB 4MHHI 2XQYK 4M4PA 2EDJA 3SPVB 4G7YH 4LCYA 1BIIA 1EH9A 4RRPG 5KVMC 5E4EC 2AJXH 1LK3H 4PJCE 5JW5B 1T04B 1KENH 1IM9D 2G2RA 2AXJA 4L5FH 5E5UB 1M7IA 1XGTB 4QRTA 1JPGA 3CSGA 3S36X 2IBZY 3LMJH 1AGBA 4Y1AE 1I9EA 2UY7A 3KPLA 5DUMH 4JHWH 3IDUA 5GGSB 3WIFB 2FX8H 5CSZA 3HZMB 1CICC 2IH3B 3MRKB 3W11D 2Q3AA 1A7OH 4KJYB 4OCRH 5JXAL 1DBBL 3C08H 2KQMA 3TO4C 4HWEH 1M05B 2IMMA 3OX8A 1MIML 1RZ7H 4R7NA 3LN5A 5FO7B 2RIKA 4QO1A 2HFTA 3RVWC 4P9HH 1G0DA 2DOCA 3SCMA 1YQ2A 1H8NA 3VFVB 5J3HD 1TPXB 5KZCB 5FYJL 1AD9B 4FQJL 3OMZA 4HJGB 4PJXA 1VA9A 4P46B 3CH1A 4MD4B 4RQQA 3E2HB 4TRPL 1BQLH 5T1MA 1EAPB 4FFWC 1IARB 2VLLA 3HFML 1CTNA 2BRRH 1GIGH 4KU1A 4QRUB 3DMMA 3DXAD 2EYSA 5FUZH 1G9NL 5IK3B 5EORL 5T1LB 1K8IB 4WV1A 1WSST 4O58L 4MJ2A 4J4PA 1YA5A 4LNVA 4OBRA 3QRGL 5CMAB 2ED7A 3WNKA 5EO9A 2XT1B 1Q9LA 4P5KA 4AEFA 3U36B 3L6FB 4B7LA 5SWQA 5EC1B 5J12C 2K7PA 4AY0A 3EDFA 3GIVB 4X7FC 5EU5A 3DECA 4Z76A 1BJ1H 4Z95L 2YD8A 3FFCB 1NUGA 4NM8H 1J0JA 3WNOA 4P5MB 4M8QA 3UO1H 4BUGA 1IC4L 2XQYG 2D7QA 2VITA 1JNHB 2FO4B 3VMOA 2NPLX 4GAJL 4KKLD 2C3GA 4WFHE 2NMSA 1T5XA 3TCLB 2ENYA 1GOGA 5FYJD 2F54B 3U6RB 4RGOH 1S7XA 3DX6B 1MCBA 1L0QA 4LKCB 5HVHB 5JXAH 2F53D 1DBBH 5EPMA 5ITFA 1ZT4A 4K9EC 5JR1H 3AU1A 5IM7B 1SY6L 1JYVA 5BS0D 1EHNA 1P84K 4Z0XB 5DWUH 1IQWL 3CFJB 1MIMH 1J8HB 1JWMB 4FZ8H 3SDYH 4V1DA 5D96B 4WDIA 4IOIB 1NANH 4RWHA 1N5AB 3ULUH 1YECL 4ODBD 1FVDA 2V2XA 5C8JA 1UCTA 3UXFA 1W72L 4RWYH 4WI5A 3HZKB 3MCKA 3WUWG 3O8XC 2DQCL 4HZAA 2J5LB 2IGFL 3Q6FA 5E9DD 2HVJB 3NTCL 4Y4HA 1BOGA 1G0YR 1UM5L 1E27B 1MCKA 1HYSD 1PYWA 5BZDB 3KDMB 1FNEA 1I9RH 1FO0A 1A6ZB 4R4FL 1X5AA 4LGPB 3WFZA 5C0FA 4LDOB 3FT4A 1OAZL 4UU9B 1HNGA 3QRGH 3MNVA 4V1DE 3QPQC 2RFXA 4R26L 4U1GC 4Y8AA 3V5DB 1LE9A 3B9AA 4Q6IA 3PGDA 3RWGA 5TDOB 4HGWA 3TNMA 1ES0A 3QIBD 4M7LL 3S5LG 4X4YA 5AYQA 2YBRB 3DO3A 3D25B 2Q8BH 4Z95H 1JYNA 3PL6C 3BYYA 4F7EA 2XPGB 2VE6A 5CEZE 1IC4H 1NFIB 3H3PH 5LAXB 3WO4C 2R4RH 3NFSL 4PV8A 3IDJB 4LLYB 5EG6C 3ZE1F 4K71B 4PFEA 4X9HA 4UIMA 1DDHB 2XKNA 3OKOA 1FLRH 5EC2A 4PJHF 1YMHA 1HQ4A 3WFBL 5EA0L 1JWSB 5E2TL 3GSNL 3GRWL 3QIWD 1K8DB 3E6HA 1IGIH 4E0RA 3TNNB 4OZHF 3ORJA 3ROLA 4K7FA 4S0SD 3I50H 4ZFFA 4HIEB 2ZNWA 4PJAA 3NFNB 4CDHA 1JMZA 1FAIL 4ACPA 5AZ2L 4YFEA 3W5MA 3DV6B 2BSSB 1I85C 1P9MA 4MA1C 1I3UA 4GW5B 1YECH 3U7AA 5F1NB 4MD5A 2X9WA 3DXAB 3VWKA 4DQOL 3LRSA 2IGFH 2XTJD 1QSFA 4OGZA 5CGYC 2QEJA 1UM5H 4OJFH 1RK0A 3ILQC 1J87A 3ZKND 1VFMA 4JY6B 4O5LL 5CUSL 3MLRH 1OGTB 3THMH 4G42B 1AO7D 4PJAE 1E4XI 2GY5A 5F3HB 1WFUA 4LCIH 1JPFA 1OW0C 3QEQA 2Z4QA 4QF1A 2AV1B 2Q20A 2ERJB 4XPHH 4MX7A 5HYJB 3P0YH 4PJIA 4YWGH 4FZEL 3T2PA 4PB9H 2FEDC 4I9WD 5DJ2A 1OARL 4GT7A 4UTBH 5CGTA 2XWTA 5D2NC 4LSUL 2EDHA 4FQ1H 4FXLA 3QA3A 1JV5A 1QSFE 3GBMH 3ARED 4D2NA 4NN7C 5JW4N 1J1OL 2G75A 1ERNA 3NFSH 3FN3A 1ZE3C 3GB7A 2OI9C 3EFFA 5DQ9A 1G9ML 1MFDH 2F53B 4HFWB 4ETQA 1U93B 5FHAH 1SVCP 5BS0B 1BZ7A 2GTZA 1CVSC 5C08A 2IQ9H 3GRWH 5CS7A 4IDJH 2APTA 4PJIE 4OFYA 3WNMA 3BQUC 5TGBA 1ZS8B 4GFTB 3CDGA 5I1AA 4PV9B 1YEFL 4MXWH 5C70A 5FYKE 3QEHA 1HH6B 5IMKB 1FAIH 3LH2H 4P2OD 1K4DA 3GSVA 4JKMA 1J18A 4N8VB 3ECBB 1NJ9B 2YEZA 2R23A 2W1NA 2QQKL 5ENWB 1HQRB 5IBTL 3PHQA 4YDJA 4LPYA 5E9DB 2AI0L 1KPVB 4P4RA 3D69A 1DLHA 5T3XE 5HD8C 3BIBX 2GFBB 4GBXC 1YEHL 3K81A 4IRSD 4UBDC 2JE8A 3SKUD 1UJ3C 4WEUD 5C08E 1N0XL 3HN3A 4GRMA 1WV7T 1B90A 3V95A 1LHZA 1KN4H 3X11B 1DQMH 4LLQA 1LE5A 4X80H 3FQTB 7CGTA 2PNDA 4N0FA 3RAJL 2PXYC 1CT8B 5CUSH 1NMBL 4CADB 5JMOC 1IC7H 4Z8FL 1NPUA 5D7JA 3QIBB 3L3GA 2AEQH 2IC2A 1J7VR 4HDIA 2NZ9D 4Z7VA 3O3UN 4O51B 5JA9A 1G7PA 4BYHA 1R0AL 2X6MA 2AKRB 5D2LB 4OLXH 4DFHA 3S96B 3H9YA 4LSUH 5GS0C 2JJVA 3OKLB 3QQ3A 3LZFH 1X5IA 4L9LC 1BD2A 4FNLL 3NCYP 4ZPVA 3C5SA 1YMMA 4M3KB 3QULA 3G6JA 4JPVL 3WUZA 1RV6X 1J1OH 4AT6B 3H7BB 5AG9A 3QJFB 3ROOA 1W72B 1S7VA 3BXNA 4IIQC 4LQFH 4YBQC 4AL8L 5C6WH 5FF6A 2ADFL 4ODHH 4Z7VE 4J3VA 1ZHNB 1HI6A 3ARDA 4JRXD 3OV6A 1IT9L 2VQ1A 4RAUB 2GEEA 2HN7A 4XP5L 4C83A 4WEBH 2BSRA 1BWWA 2B1AL 4HS3A 3IDMB 2H2SC 4L1HA 1DFBH 1FC2D 1ZV5A 1W0WB 1BD2E 3LKOA 3BIAX 1YMME 5J6GB 2JB6B 3V2AR 3O11B 2DWEA 3G6JE 2SEBB 3UTSD 1P5UA 2LVCA 3O9WC 3RU8L 2XTJB 3SGKA 1LP9F 2CGRH 4WO4A 2AI0H 1LMKA 2YD9A 1B0RB 3MNWA 1YEHH 5E6ID 4WCYL 5F9WC 4C54A 4UNTA 3VXSA 1XF1A 2R4SL 2VO5A 2OK0L 2DJ4A 3FQNA 5DZLA 1S7UA 3L5WA 5E5MB 1V8HA 3AY4A 2ARJQ 3RA7H 1KTRL 3BZ4A 1M4KA 4XPTL 4KHTL 3GSNB 3IDYB 2OMNA 4E42B 1N5YH 3GHBH 1S5HA 4OD2B 5CWSA 3ZHKA 2CUHA 2PW2B 2C7UA 3IVKB 5ICXB 3P9MA 1QACA 1DL7L 3AREB 1TZGL 5SWZD 2A83A 3ULSB 5KSBF 3O2WH 2OL3A 3TN0C 3VXSE 1CL7I 1IMHC 2ESVA 4XNMB 3O41A 3IDXL 2X7LB 2BRQA 3IF1A 4WW2B 1ZLVK 4BSJA 4FNLH 1G7LA 1R24A 2IAND 2O93L 1GSMA 2VH5L 4XXDA 4KRLB 4QNPF 2JLLA 3DROB 1OP5K 1ZVYA 2ZOLB 4LCWD 5JNYB 4UNUA 3L9RB 1M71A 2X70A 3VWJA 4ZFOA 4EI5C 1NDGA 2ADFH 4PGJA 4LASL 4YIQB 5DRWA 3GM8A 4S1RH 4CN4A 1EA9C 3L3DA 3QBTB 3DX8B 4P2OB 1I1FA 1FIEA 1CFTA 3M45A 5EBWA 4TVPH 3H0TB 1NCBL 1BVLB 1YY9D 1ZHLA 3VH8G 3VFNB 1VESA 4J7RA 1FYTD 2FR4A 2IADA 3MRBB 3LOWA 4IRSB 2D7PA 3N0PB 4RMVA 1S3KH 2MPAH 4RIRA 1J1XH 3LKQB 3RU8H 3CSPA 5CEXB 4YBLC 4Y5YB 4HCRH 5KSVB 4F7CB 4JDZA 1BFOA 2DLHA 4QRRD 3WLWC 5GXBB 2OK0H 1FN4B 4Z9KB 2Y7QA 4U0QB 5D7KE 1T89A 2JJSA 1IRAY 4MA7L 3TFKD 4KQ4H 1GGCL 3JVGC 4ISVA 1MCCA 4XC3L 5FO9A 5ID1A 5C0EB 2FIKA 3WBDA 1IEBB 4OSUH 1L0XA 3ZDXF 1IL1B 3V8OA 1TZGH 2UZYB 4JJ5B 3HNTH 1H3PL 2R2HB 3V4VH 4HXBH 4XC1H 3EJYC 4GUPB 4Y1AD 1XCTA 1A9EA 1U0QA 3O6ML 3U0PA 4OZFH 3D18B 2FHBA 3IDXH 1IGYA 4F7MB 5EFIB 4HMDA 2YPLA 2YUVA 5H35A 5EUKA 1TENA 2GSIA 4KWUA 1NFDB 5BMFH 4YDKH 2YZ1A 4RFOL 3RUGF 3B4NA 4JRXB 2WQRA 4GXVH 1FRGH 1NUNB 4W6XB 5F21B 2FL5B 1ORQA 4Q9RL 4HFUL 3V5HA 5EUOA 1I7ZA 4Y5VB 5H2BA 5DTFA 5E99L 4QEGA 4TNWF 2GKIA 3UZQA 4LASH 3EZJB 1YEIH 4G5ZH 1Q1JH 1TNMA 4G6ML 4OF7A 4RISH 3ZE0F 4JFOB 2N7BA 4PY8J 1QYGH 3QDGA 2YPLE 1P1ZA 3BVNA 5E6IB 2V9RA 2IEPA 3M1BB 3DVNA 3VCLA 1FNLA 1R5VB 2VOTA 1TCRA 1IFHL 1RJZB 3D85A 4P3WA 4PTTB 5EUOE 1IAOB 4KKAC 2NY5C 3QXTA 3QUKB 2XZQH 3VD5A 3KS0J 1F11B 3BP7A 4R90L 3SCMD 5HHQB 1KCSL 1V7NH 3HC4L 4L8SA 3FB6B 4Y2DA 2OTWA 5T5FL 4TUJA 1OAXL 1RSFA 3VG0H 4MA7H 3QDGE 2IH1B 5SWZB 1GGCH 4KMTL 1AXTL 1CBVL 4H0HB 4XC3H 4MMZC 1ZHKA 1AJ7H 3DMMD 3P9LA 1T1ZA 2W0FB 3BEVB 1D6VH 3G5YB 2IANB 32C2A 4LSSL 1H3PH 5I1JH 4WFHD 4J4PD 4LCWB 2NZIA 5CIPB 5FKPB 3TYFB 3CVIL 2UZIL 3LB6D 4ZYKA 3QG6B 1XGUB 3ZDYE 4HZLA 5EU4A 5I0ZA 1N8ZB 1WUNT 3PDGA 4OZFG 1KB5H 2P4AB 5IB3A 4HKBA 5CEZL 7FABH 1FO0L 4QHUA 3DIFB 3T0WA 3MJ7B 4NNPH 4POYA 1FYTB 2XQBL 1U3HC 2EDLA 1EPFA 4OZ4A 2I07B 4H8WH 2VDQL 1WQVT 5DRNB 1PDKA 3K8MA 2P8PB 1U8HA 3BWAA 5LGHH 1KCUH 1QFWM 3U0TB 2YPKB 4KI5E 5IR1B 1NH6A 1MUJB 1WZ1L 4G8GA 3B3IA 4OLEA 4U1IB 2AV7A 4QRRB 5E00A 5C6TH 5E2UH 1IFHH 4OZFB 4JM4H 3LAFA 2A6IA 2OYPA 1K3ZA 4NZRL 5K9OB 2D3VA 3WXWL 2YPVH 4V1DD 1QFPA 4KV5F 3EO1B 4YE4H 1JYWA 4PJCB 3HC4H 4PGBA 4WWKA 4BFIA 3EGSA 3UJIL 2C3VA 3PWUA 5T5FH 1Q0XL 1H0DA 2D31A 5EO0B 3MV8A 4EUPA 1QKZH 4KMTH 3KJ4C 1CBVH 1Y6NR 4G8GE 1WZLA 5E0QA 4ELKB 2BOBA 1MCLA 3JWOC 4Y4HD 4R0LA 1UYWH 1X5HA 5CEZD 2R0ZL 2YD6A 3MRFA 3G5VB 3QNZB 1I9JH 3QH3A 4TPRL 4XNXH 3IGAB 3MLTB 2BY0A 4YUEH 1DEEB 3FT2A 3H42H 5DD1L 4LCYB 1BIIB 1P7HL 1NCDH 4W4OC 4Q7DA 3ZT5A 3RVVC 1QNZH 2G2RB 4MQ7A 5GRVL 2ADGA 2KPNA 3RGVC 1L7IL 1M7IB 1CK0L 4QRTB 4WHTA 1JPGB 3MV8E 5ERWA 5B21A 4BH7A 1AGBB 1C5BL 1CDJA 5B4MC 3DX9A 4FHBD 4G6FD 1UZ6F 3O6FC 1FNSH 3RVTD 5A2IH 2WUBL 1FO0H 3EOBA 3KPLB 3WIIL 3C8DA 5CSZB 4UTAL 2OJZH 3R8BB 2D9CA 4JO3L 3PG2A 5J13B 1RIVL 4D9RE 2WBKA 5E24E 3O6KH 3OX8B 2CIKA 4R7NB 3LN5B 1KBGH 5FCUH 2C3XA 2QQNL 5GPRA 5FYKL 3SCMB 1CLZL 4BQ6A 3EYQD 3I02A 2D7TH 4M6AA 5D6CA 4P49A 4PJXB 3CH1B 5DEGA 4RQQB 4QT5A 4XPGH 5T1MB 3UDWA 5CSBA 3TZVA 5T3XL 4HQQH 1KOAA 2VLLB 5IVXA 4OD1L 5DR5L 4LRIA 1Q0XH 2E9WA 3DMMB 1IAIL 2EYSB 4I3GA 4KHXL 3U0WH 1Y18A 3VWKD 3WDJA 1WICA 5ICYA 3HE7A 1LO4L 5AZEL 1A6UL 2LTQC 4WV1B 2IFFL 1QSFD 3V8CA 5IBLD 1JNNL 1F5WA 5D5MF 3OJDA 5EO9B 2R0ZH 1Q9LB 4P5KB 3A0OA 3WNNA 2UUDK 1FORH 5DYOA 1TVBA 4JO4H 5SWQB 1VFBA 4QY8A 4MB5A 3REVA 2OQJA 5EU5B 5CP3A 4Z76B 2H2PD 3QWRA 2HJLA 5D7LA 5I74B 5IVXE 2X05A 1U6AL 1T0PB 3LQMA 3PDDA 2IQAA 4JKPL 4M8QB 4YHOH 5DD3L 5DDHA 1CK0H 2VITB 1ZTXL 1I1RA 2YRZA 2GSGA 2Y1VA 5FYKD 1QPXA 1T5XB 5JDJA 3IU3A 4CW1A 1S7XB 3BPLC 4Z7UF 1I7RA 3OSKA 5DO2D 3ZYZA 4JO3H 5EPMB 5ITFB 1ZT4B 4NO3A 5T3XD 3AU1B 1RIVH 4U1NA 5C08D 3I6GA 5D7LE 1T83C 3EZ8A 3BRGC 2AJVH 5B39G 4OFYD 5JZ7C 4V1DB 4ZDHA 4WDIB 1CLZH 4H1LH 4ONOA 2VZSA 5D1ZC 1AY1L 1FVDB 2V2XB 5F1OB 5C8JB 3X12A 4PP2A 5DVNA 3LQAC 3MCKB 4YHYB 3Q6FB 1MEXL 4LVNB 1WF5A 4Y4HB 1BOGB 4N1CA 1TZHA 5DR5H 1PYWB 1CXFA 3VD7A 4KZEL 5D1QC 4KHXH 1FNEB 3RTQC 1FO0B 2ICEA 9CGTA 4EXPX 4QTIH 5C0FB 5EOQL 1A6UH 3FT4B 2IFFH 4NQXA 2BSTA 5E8EA 3DLQR 1JNNH 3MNVB 2RFXB 2BSED 4NIKB 5T3ZE 3H6JA 4Q6IB 1LE9B 3PGDB 3RWGB 4IOFD 5SX5K 5D7JD 5TF0A 4HGWB 3TNMB 3UX9B 1ES0B 3GM0A 3VI4E 3GMMA 4J6RL 4X4YB 2O5ZL 4A2LA 3OB0K 4OZIF 4R3SA 2BVOA 1MVUA 4F7EB 2VE6B 4OT1H 4JKPH 2V7HA 3DYMA 2Y5TA 1V3JA 4Y2OA 3NOIA 4PV8B 4DZBA 5GGTH 4QYOA 3FRPG 3AXLA 4UIMB 3SY0A 5C09A 3VRJA 1BD2D 2XKNB 3OKOB 5EC2B 4TUKH 1YMHB 1FGVL 1CU4H 1HQ4B 1YMMD 4KAQL 3P30L 2VZVA 2O26U 4Y16A 3E6HB 2XA8L 4ZAKC 1HHHA 4E0RB 3HAEH 1YNKL 3ROLB 4K7FB 5AWNL 5B22A 2P7TA 4ZFFB 4PJAB 3ARDD 4TSAL 1BREA 2OL3L 5D7IF 4ZXBA 3V0AC 4AQ1B 1QHOA 1MJ8L 2Y23A 3EDEA 1G6RA 1QRNA 5C09E 4CU6A 4MD5B 3QSKB 4I5BA 1NLBL 2GJZA 5JHDA 43CAA 5EIVA 3VWKB 3RVXC 3LRSB 1QSFB 1ZMYA 4ZFOL 4RGMC 4WO4D 4H1LG 2DQEL 1RK0B 2VDRL 4DGVL 1OM3L 3VXSD 4NZTL 2AERT 3RZCA 4TTDC 6FABH 1JPFB 3OL2A 3QEQB 2Z4QB 4QF1B 1MCEA 1N6UA 3P9WB 5CINL 1CS6A 4MX7B 1QRNE 4PJIB 1YUHA 2Y6SC 5DJ2B 1OAYH 4J6RH 1NGYA 1S9VA 2XWTB 2O5ZH 3NA9H 5JHDE 3ULVE 4PP1C 1ZSDA 3QA3B 4D0DA 2HTKD 4K8RC 1JV5B 5HXMA 1HH9A 1VEOA 1T2XA 3HUJF 2G75B 1NMAH 5DUPH 3MXVL 4P2YA 4L4JA 4QHKI 1KLGA 3GB7B 3WN5A 3OJVC 3EFFB 5DQ9B 4ETQB 3K3QA 1E6JH 1II4E 1CGUA 1P7QA 3MACH 1BZ7B 2GTZB 5C08B 3EAKA 2C5DC 5MP6L 1YPZF 3MRQA 5IT2L 2R39A 2XA8H 1DBMH 4L8BA 1LILA 4YZFF 4K23H 5F1SA 3D6GA 1JGEA 1YNKH 3H2WA 3Q6GL 5AWNH 5TGBB 3VWJD 5I1AB 3CDGB 1K85A 1TQBB 1LNUA 3QEHB 4HJ0C 1F6FB 2P5WA 3BPNB 4WI6A 1A2YA 2RJMA 1K4DB 3GSVB 4K3GA 5KW9H 2ZCHL 3GJFA 4RGNE 4NOBA 5D7KD 4PB0H 2YEZB 2R23B 3HAEG 4KK9C 5FV2A 1K4CA 3QXWA 3PHQB 4YDJB 3DV4A 4P4RB 3D69B 1DLHB 4IJ3C 1NLBH 4DGIH 2V7NA 4GRMB 4YDLB 1YN6A 3HLAA 3SE3C 3F7YA 2HKHL 4Z18A 4LLQB 1LE5B 4QHNA 5GQBA 4N0FB 2LV4A 2AEPL 4LAJH 2P5WE 2H45A 5D7JB 1OTSC 1YN7A 2NX5A 3L3GB 1YEDA 3DI3B 3Q5YA 5CINH 4HDIB 4Z7VB 5L2KE 1G7PB 2B2XL 1EGJH 2DTML 4JQXC 3WE6A 4J3TA 5CJQH 2I27N 4PJGF 3ES6A 2V9QA 5F6IC 3L3HA 3C8HA 4ALAL 1TVHA 4S1QH 5ALCH 3QQ3B 1BD2B 4ZPVB 3C5SB 4JN1L 1T83A 3V0VA 5I9QB 5JOFA 3QULB 5LQBL 3SGEI 3G6JB 3BSZH 5IB2A 3ROOB 2W9EL 1S7VB 3BXNB 4RZCA 2YPLD 2NX5E 5GRUH 5I75B 5FF6B 1VGEH 4PUBL 2ICES 2YXFA 2LVEA 1OLZA 1YDPA 1HI6B 3ARDB 1WFTA 4J3SA 3QDJA 2VQ1B 3EJJX 2HN7B 4C83B 1KCKA 2BSRB 4X9FA 4HS3B 3Q6GH 2X41A 2NXYC 4X6CF 4MZ3A 1ZVSA 3LKOB 4EOWL 2XNAA 3LKRA 3X3GH 4NHCL 2ZCHH 3GNMH 2FEEI 2DWEB 1I4FA 3PDOA 4JY4A 4XI5D 2DQJL 2VDNH 4I18C 2X4UA 1NGWA 4WO4B 3QDGD 3MNWB 4PJEA 4JG0L 4XVUD 3VXSB 2ICWJ 2EXWD 1IKFH 4M1GH 3FQNB 5DQDL 3QDJE 1S7UB 3I3DA 5JO5A 3L5WB 1L9MA 1GC1C 2VR4A 4FFYL 2NY2C 4ZOBA 3BZ4B 4U6YA 3SE9H 4P3CH 4NKQB 3VD9A 1MAML 1RK1A 1CE6A 4JHBA 4N0YH 1S5HB 5CWSB 1ORSA 4HPYH 4Y2DD 2C7UB 2L7UA 1BIHA 2PUQT 2AK4A 2VQUA 3P9MB 4F58H 5JQ6L 3N1PC 2A83B 1A7QL 4PJEE 1UWXH 2OL3B 1UWXK 4P23A 3MZGB 2ESVB 1YEGL 1UWGH 3BFOA 3O41B 1EEZA 3AUVA 3WXVL 3IF1B 3EHBC 1KGCE 4LAQH 1G7LB 1R24B 2FH6A 1MFCH 3HMWL 4JN1H 2GK0A 4YK4C 4XXDB 4RMSA 3PWLA 1Q38A 1JGLL 2EXYD 5GS0H 1RUAL 1FFRA 1U8MA 2KZWA 5JLZA 1JTOA 1BM3H 1SQ2N 4KI5D 3HE6C 2D9QB 4MA1B 4MB3A 1M71B 2X70B 3VWJB 4ZFOB 1NDGB 2VZTA 2HT2C 2AK4E 4WI9A 1RUKL 5DRWB 2VNCA 4YHLL 1R3IH 1CE1L 5T33L 2J8UA 3GHEH 3L3DB 3LRGA 4LLDA 1BZ9A 3ZDZE 1FZOA 1D5MA 1I1FB 1CFTB 5CJOH 5EBWB 4I0CC 1ZHLB 1QSVA 2DAVA 3A6OA 4Z7WA 3S35L 2FR4B 2IADB 4JKLA 4U6HA 3BGFC 1QBLL 3T3ME 2OMBA 3Q1SL 5BV7C 4RIRB 4GOSA 4XHJC 1GGYA 5H37H 2P44B 4JG0H 4G8GD 4L8DA 4QLRA 4JDZB 4X4XA 4RMTA 1BFOB 4UI2A 3VXRA 3AAZA 2D2OA 2YWZA 5EWIL 2J8UE 2ID5A 1MQKL 4KVNL 1G7JA 2Y7QB 3FONA 4ZOCA 5HI5C 5FUCC 2R29L 3UTTD 5DFTA 3WJLA 5JW3H 3DUSA 4XCYA 4Z7WE 5ETUA 3TT1H 5IW1A 3U1SH 4ISVB 1JI2A 3LKPA 1QFOA 4HWZA 5FO9B 1S7QA 4WWKD 5ID1B 2XKUA 1JGVH 5LGKA 4LARL 2YD3A 4QXTA 4M1CD 2FIKB 1DP0A 2ZCLL 3FN0H 5JQ6H 3MJ8A 3MV8D 3DETD 5LCVL 1G6VK 4XAWL 1A7QH 2R0WH 5IQ7L 1XCTB 1A9EB 3V7AE 5FUOH 3VXRE 3U0PB 5J89A 4EJ1C 1QLFA 1IGYB 4OIIH 3GMRA 3Q48A 2YPLB 1AR1D 1GGIH 3CMOL 5H35B 5JW4M 5EUKB 2GSIB 2FSEA 4LSTH 3E8UH 1RUAH 5T5NF 1ORQB 4D9RD 2VDML 3V5HB 5EUOB 1I7ZB 5H2BB 1VFAA 5DTFB 1L0YA 4EUPH 4MCZA 4OF3A 1YQVH 4YHLH 4RBPH 4RBPK 1OSZA 3RHWF 4Y89A 1CWVA 3VMNA 2X1XR 3TEUA 1QBMH 4IRJA 3QDGB 5K9QI 4JFHE 4MNQA 1A9BA 1P1ZB 3BVNB 4F15B 4AK1A 1V3KA 4XWOD 3QI9C 3DVNB 3VCLB 4F9PC 4LLMA 1TCRB 4QWWC 3D85B 1B4JH 1HEZA 1FL3A 1TXKA 4F37F 3HNSH 5EOTA 12E8L 2HA1A 3ZZ1A 3BP7B 5EWIH 3V0WH 3OWEA 1MQKH 4NCC2 5H37G 1RMFL 2CJUL 5F1KC 4O2FA 1KXQE 2R29H 4L8SB 4Y2DB 2OTWB 2F5BH 1DN0A 4TUJB 1A1NA 1TMCB 4R8WL 4J2XA 1FNHA 4XCCH 2DKSA 2RR3A 3U4AA 3I6KA 2C3HA 4MNQE 5F7EL 3FO0H 5CLWA 1ZHKB 2AEIT 4ZTOH 4EQ3A 3P9LB 5HHVL 1T1ZB 5BO1L 1H8OA 3UPRA 5IW3A 1XGRA 32C2B 3D48R 2WWKO 3HE7D 3DHMA 1F4XL 2DM4A 1REIA 5T3ZL 1P53A 2X4SA 5FGSA 4ZYKB 3CX5K 1I8LC 2FECL 3FN9A 2VERN 3WV0A 2ED9A 5EU4B 1DSFL 1KULA 3WLBA 1TETL 1UACL 1VENA 2IF7A 4ONGL 3WKMH 4I18A 3QWRD 2VDMH 3WD5L 4BH8A 5IB3B 5D7LD 1EUTA 4HKBB 1OWWA 1PG7X 5IV2A 4ONHA 1IAKA 1T7ZA 5I8CA 2X09A 1LO3L 4QHUB 2QADD 2HFEA 1OSPL 5LXGL 4FA8A 1FYHB 4JZNA 1F4WL 4OZ4B 3PGFL 5C9KA 4B53A 3VXUA 1U8HB 3QUXC 1OT1A 3ARTA 3BWAB 1F2XK 4EUPG 1RUQL 5GSVA 2VL5A 3MBXL 3MLPA 4NN6B 4G8GB 3B3IB 4M7KL 3T77A 2AV7B 5E00B 1A7NH 4GLRI 5IHBA 15C8L 3S4SA 2Q6WA 2EDNA 3QT2A 2A6IB 5GZOD 4WFEE 2BVTA 1XR9A 3DTXA 3ZKXC 3JZ7A 1H9VA 3S36L 4W68A 3VXUE 5T3ZD 1RMFH 4PGBB 2NY5H 4WWKB 3V5KA 4BFIB 3EGSB 4JREB 2I9TA 2C3VB 3PWUB 5I8KH 1H3GA 2BXZA 4XBPA 2D31B 1H0DB 3UC0H 4R8WH 3PJSA 2OTPA 4AG4L 3K80A 3ZL4H 3MV8B 2R0LH 3BT2H 4EUPB 4XT1C 1MCRA 3SDCA 2BOBB 4Y19A 4NC1E 4R0LB 3EYOA 2BY3A 3QHFL 4DW2L 4DKDC 5HHVH 3MRFB 3QH3B 4PJHA 3KYAA 4N90E 3FT2B 2IG2H 2VKXA 1PKOA 1JNLL 5I73B 4S1DC 4LVOB 4FQCH 1RAMA 3MMEA 3OGCA 4OZHA 4NBZB 4MQ7B 3ULVL 4LL9A 3NZHL 2ADGB 1JF1A 4P5TC 1DSFH 5ERWB 4WHTB 3MFFA 4JPWH 4KXZI 4ONGH 3RIFF 4BH7B 1MREL 5BXFA 1AIFA 3DX9B 4Y19E 1AKJA 5AD0A 3ZE1E 3K2MC 4J8RA 1NDMA 1X5ZA 3EOBB 1EO8H 4ODUA 1OSPH 5K59F 2HT3D 2RGSA 1FFOA 4PJHE 4S2SA 1UM4H 4GQ9H 1S7WA 5C09D 3S8WA 1YYML 3C60C 2BP3A 4LSQL 1T2QH 4CN6A 4Y16D 4NKOA 5IJVA 4TQEH 2CIKB 3MUJA 4OGYL 4OZHE 4PJ9A 4M7KH 3H9SA 3F7VA 3RKDD 2OR7A 15C8H 4F9LA 3I02B 1RIUH 4YHMH 3UTQA 4BQ8A 5D6CB 4ZXBD 5J1SC 3S98A 1QBAA 4KTDL 4H26A 5DEGB 1KJVA 3GI8L 1GPOL 4QT5B 4KI1A 2NY7L 3TZVB 5BQ7A 1QRND 5IVXB 3V4PL 5JHLL 3MLVH 1E4KC 5CGMA 1INQA 5JHDD 2DM2A 3ULVD 1Y18B 5ICYB 1MCDA 3ZKMD 3HE7B 5T1KA 3H9SE 1KIRA 5ID0A 3LEVL 3OJDB 4HK0A 4LEXL 3IAGC 2NY1D 5DYOB 1TVBB 3RZCD 1VFBB 1LDPH 2CO7B 3JWOH 4QY8B 4JO2L 1D5BA 1J88A 3REVB 4XCEA 1HKLH 4PS4H 4N68A 1UADC 3NFPA 1G6RH 2OQJB 1N3NA 4NP4L 4KRMB 3ARWA 4XVJL 2HJLB 1URLA 4Y5XC 5D7LB 5KS9F 1DEDA 1CGSH 2IQAB 3NZHH 5DDHB 3ISWA 3PE9A 1BZQK 3I84A 2GSGB 4CNIA 1WIOA 2X9YA 4UDUA 3CXHJ 4PGEA 3HTLX 1J86A 3SQOL 4LPXA 5KVFL 3IU3B 3D3VD 4CW1B 2EDEA 3G6DH 1X5YA 4RGND 1NSNH 4MAUL 1I7RB 3O2DA 3TVMA 3QQ9C 2W9DH 4K3DH 1WVZA 4NO3B 1EO5A 4LSQH 4U1NB 4OKVA 2G5RA 3I6GB 4HWUA 1UENA 3ZYOA 4S0TD 4K94L 3BKYL 4PRAA 1XCQA 3C6SA 3FRUA 3K2UL 4ZDHB 4FTVA 5E7FA 4XCFL 1A02N 3EDKA 2P5WD 4M62L 2W38A 3VA6A 3OKEA 4WI4A 5DLMH 5FGBA 3X12B 4DKEL 2EC9U 4PP2B 4L4TA 4JAMA 3C8KA 1GPOH 1VCAA 5L2KD 5I71B 2HMID 4Q9QL 2R8SL 4OUOA 3V4PH 1TZHB 1ZAGA 1KB9J 1HHGA 2ICEB 3C5JA 3BJ91 3NPSC 3T0EA 4NQXB 2BSTB 5E8EB 4DVRL 1J1PL 3RBGA 5DA4A 4ZFGL 3LEVH 2UWEF 4WUKH 3RDTC 4FTVE 3LCYA 5F9DC 2M2DA 3PHSA 4JO1L 1HHJA 5KJRH 3GJFH 5HI3D 2LU4A 3LPWA 3GMMB 2CDGA 1UB5A 3QUXA 4L4TE 4JGMA 4EN3A 2HRLA 1MFEL 4R3SB 1FSKB 2BVOB 1MVUB 3CIQA 1PD6A 2V7HB 2Y5TB 2ATKA 2HT4D 2GT9A 1QZ1A 2VZUA 2VQTA 1L7TL 4DZBB 4QYOB 1DBAL 2CQVA 2VYRE 2QQLL 3T0EE 3AXLB 1A3RL 2P43B 5C09B 3SY0B 3VRJB 3M8OH 4OCLC 4LCCC 3E6FA 3BZFA 3VFUA 2ZUWA 1EZVX 2O5XL 4OBSA 1LP9A 2Z31A 5I6XC 4Y16B 2PW1A 3S3SA 1HHHB 3MLSL 2AP2A 2LU7A 1IAMA 1ZEAH 1KT2A 3C2AL 4K3JH 2P7TB 5TQ0L 5JIHA 2YD7A 1CTOA 3QDJD 3BKYH 4ZXBB 2ZUQC 4DOHE 5I1HL 2X4OA 4M00A 4RX4D 3BIKA 4OIAA 3EYVA 4XCFH 1G6RB 1T7WA 1QRNB 3QP3A 1YNTA 1BMGA 4GKNA 3SDXF 4I5BB 2GJZB 3MOQA 1LP9E 5JHDB 5CJXC 43CAB 3BDBA 5KSBA 1EMTL 3QDAA 5IFJA 1F58H 4QXUL 4JZJC 1EEQA 5DD6A 2EDDA 4LEOA 3LQAH 4XTRD 2W91A 2MFNA 1RUPH 2NY1B 35C8L 3RZCB 5H94A 3MRRA 3QZWG 1JHLH 2VIRA 1J12A 1KGCD 4JFEA 4DVRH 1J1PH 4WVRA 3FQXA 3K74B 3AS0A 5J6HA 3ILPA 4XCNA 2E6PA 4RMUA 3QFDA 2BERA 1RULL 4JO1H 5FIEA 1YUHB 1NGYB 1S9VB 3C60A 1ZSDB 2AK4D 5KSBE 1KC5L 4D0DB 5E2VL 1HH9B 2M26A 3MOAH 5DMKA 4RGNB 4WHDA 4YHKL 3TBTA 4P23D 1KLGB 1QFWI 1FLTX 5CBEA 3WN5B 1XGYH 4JFEE 4QNPE 1P7QB 1ADQH 2KZ1B 5CZXC 5JW4R 3D39A 4TNVK 1S9YA 3FMGL 1O0VA 3R8QA 4HJJH 2PN5A 3MRQB 1TPXC 2FYYA 1S9XA 4L8BB 5DEFA 2I5YL 1JGEB 3SBWA 5I1GL 3QIUA 4P46C 3E2HC 2K9UA 4XP9H 1LNUB 2C9AA 1HILA 1JPTL 2P5WB 1A2YB 2ZCKL 4U7MA 1LO0L 3VE0A 3GJFB 1W2KT 1K4CB 2BVUA 5ACZA 3CD4A 3BISA 3DV4B 3IFNL 3D39E 5L9DH 4D9LL 2CRMA 2V7NB 1YN6B 3HLAB 4I3SL 4PG2C 5JMRA 3F7YB 4OQTH 3ME0A 4EDWH 1CIDA 3N9GH 4QXUH 1AC6A 2AGJL 5JQHC 4NZJA 5EZOH 4QHNB 5IWLC 3RX5A 4NJ9H 3VXRD 5CD3A 1B0WA 2ZZUT 1T6VN 1MJ7L 1YN7B 2NX5B 3WFCL 1YEDB 3RUGA 1A4JA 4KDWA 2FX9H 5I1CL 4KUZL 2OM5A 3HMXH 2DLTA 4UV4L 5A40E 5MEOA 1NC2A 2XXMB 3G08A 1MELA 3WE6B 25C8L 3BN9D 2J4WL 2EZ0D 3ES6B 1C8PA 3EUUA 3WNPA 3L3HB 2A74A 1TVHB 3SGJC 3ZDXE 4N0UA 4Z7QF 2FGWL 2NTFA 2HTLD 2WUCL 5HVHC 3V0VB 5JOFB 4XP4L 5FEBA 5IB2B 3KJ6H 4K8RH 4RZCB 1QFHA 4D9QE 4YPGA 2MQ3A 4JFHD 3RUGE 2B1HL 5SX4I 2HRPL 5EU7C 1YDPB 2OXGA 4QRQA 5D96C 5TE6L 4M6NH 5AUMA 4OM0L 3QDJB 1EFQA 1OPGH 2EIEA 1FFNA 5IB5A 5JA8B 5J11B 1F6LL 2EDKA 3WFHA 4XPAL 4GW1A 2JJWA 4U1MA 4N0UE 1ZVSB 3O3AA 2J5LC 4NWTH 2XNAB 1JPTH 3LKRB 3RP1A 3ZE0E 4U3HA 3ARUA 3TJEH 5HGGS 1DTUA 1I4FB 4OM1L 3PDOB 4JY4B 3LKSA 1XMWA 5CILL 1F2QA 5EBMA 2X4UB 1NGWB 4IRJD 5L7XL 5GZND 1DBJL 3GKWH 3IFNH 4OCYH 4PJEB 5F96H 2YKLL 3GSQA 5DZOA 2APVA 5JO5B 3BGMA 2DD8L 4XX1E 4U6YB 4OCXL 4P9HC 3TH4T 1RK1B 3WFEH 1U8JA 1FV1A 2GW5A 1MJ7H 1CE6B 4GSDL 1F90H 1P69B 5JOEA 1ORSB 3MUHL 5I1LA 4Q6YA 2AK4B 3R1GH 4M5ZL 4UV4H 1JZ6A 3W11C 4N5EC 4K71C 25C8H 3B8SA 3V6FA 4W6WB 2ADIA 2VWEC 4P23B 3CVHA 3D9AH 2QSCH 5F97E 3P4OA 1EEZB 2XRAH 5KAQG 4HF5H 2EH8H 3H8NA 1HXMA 2WUCH 1J9CT 2DIAA 2GK0B 4NPYA 2VISA 5F7WC 3PWLB 1A22B 4XP4H 5J3HC 4HWBH 3JWDC 4P2RA 4DWHA 1U8MB 3QUMH 5JLZB 3GMPA 4G9DA 2B1HH 3S88L 3TYGH 2HRPH 4LF3A 3CLEH 4N1EA 2J8UB 4GRWF 4NQSA 5TF1H 1BZ9B 1FZOB 1MF2L 1D5MB 5IB4A 4JZJA 4HBQA 4WFED 4OLVH 4Z7WB 5C0RH 4XMPL 2I9LA 2DQTL 1HSAA 5B38A 4U6HB 3VXUD 3MBEA 1BQSA 3T1FA 4P2RE 3QAZB 2B8OT 2KBGA 5DVKA 3HPJA 1CLOL 5C7XL 1DBJH 4X4XB 4L8DB 4UDTA 2ERJC 5IROA 1PG7W 1NGXA 4QGYA 3VXRB 4G7VH 3AAZB 5AYUL 4YX2H 4HD9A 1G7JB 2CKBH 3FONB 1IQDA 2EEDA 4N90D 4ODSL 3DUSB 5EIIA 1J0IA 4JVWA 4OCXH 4XCYB 5ETUB 5IW1B 5FO8A 1E4XL 4MWFA 4KKLC 4YEFA 1GC1H 4GSDH 4U1KA 3LKPB 4JFPA 2YUXA 2J88L 4HWZB 4PJ7F 5EZIL 1S7QB 4JM2F 1WK0A 4QXTB 2UVFA 2KH2B 3MJ8B 1T80A 3SDCD 2ICWA 4Y19D 4HX1A 3QG7H 1QLFB 4YFLI 1MCWM 3GMRB 3LDBB 1G9NC 5C3TA 4PG9A 5L88L 3NAAL 1GGBH 5J57B 2FSEB 2EC9T 1INDL 4XPFH 4Q9CA 2XXCB 3RPKA 2YXMA 5GRYA 2VR5A 1VFAB 3MNZA 4R9HA 1FDLH 1G1CA 4OF6A 2NW3A 4MCZB 3OAUH 5KVEL 3QWOA 2GAZA 4YXLL 4FN0A 4JRWA 1BVZA 3CXDL 1UZ6E 4FFZH 4NRXA 1ZLUH 1ZLUK 4Z5RA 1HYSC 1OSZB 2WLYA 3GO1H 1AKJD 4XNUH 3ULUF 4XMPH 1CDIA 4IRJB 1UA6L 4MNQB 1A9BB 3QNYA 4HGKC 3KS0H 2Z93A 5DGRA 1KEMH 1MFBH 5AAMA 3BD4A 3GJEA 3R4DA 3L3KA 2EDTA 2XA3A 4LLMB 1IC1A 5I19H 3Q5TA 3C5ZA 5HYSG 1KSRA 1HEZB 1FL3B 5D5MA 3QIBC 4UINH 4PJ9D 5EOTB 3H9SD 1IM3A 1T0MA 1MCHA 4Y4KA 5AYUH 4G3YL 1KELH 1QFUL 4I48A 4XXCA 4O2FB 5MI0B 2PO6A 3ZTNH 1FZKA 4PTUA 4ODSH 1DN0B 1A1NB 3N1MC 3O2DL 1B0GA 1CFVL 3RVUD 3DRTA 4YQXL 5F7YC 3I6KB 4HUKB 1A6AA 1SYSA 1S9KC 3C2SA 3QHZL 3P73A 3QIWC 4KDTC 3UPRB 1CLCA 1XGRB 2Y07L 1MWAA 5D5ME 1F3DJ 3NCFB 4ZMAT 3UP1A 3ZO0A 1S78D 3DSNA 4WRLA 2X4SB 5L6YL 4HG4K 2VXUH 1S9WA 3NAAH 4ERSL 1FHGA 3MLXL 3CLFH 3S7GA 3WLBB 1S5IL 3WIHH 1FFQA 4I18B 4BH8B 1XIWA 3MRJA 5IV2B 4I4WA 4ONHB 1IAKB 4PGDA 3RWJA 2E7MA 5I8CB 5KVEH 2HFEB 2XTJC 4JZNB 2EDRA 4WW1A 3VXUB 3CK0H 1JNJA 1IM9A 3WDIA 3ZKNC 3CFDA 3UPCA 4Z7UE 4ELMF 2G5BA 3BYTA 5GSVB 1GHFH 2VL5B 1UA6H 1SBSH 3PF2A 2HKFH 2JJUA 5CZVL 3T77B 1FQ9C 3WSQL 5DT1L 2ZUVA 3UJTH 5GS1A 2X1OA 1CXEA 3GGWA 4MSWA 5GIRA 1D9KA 3IDYC 4Y4FA 3ZHLA 5IF0A 4K7PL 3TLRA 3S4SB 4ODVL 2Q6WB 5GGRY 5TDPA 3KPQA 3RNQA 2P47B 5TH2A 1XR9B 2V17L 3DTXB 1A4KA 4HKJA 4MQSB 4FTVD 2AJYL 1IGML 3AREC 5FOJA 3V5KB 5MHSD 2I9TB 5IBUG 1BVKA 2VXVL 3IFLH 4XBPB 2A2QT 4OZIA 3PJSB 4HKXA 5ILTL 3LEYL 1CFVH 2LAGB 4L4TD 3DRQA 1OD7A 4YQXH 2VXSL 3VFOA 3MOBL 3LEXA 2F8VA 3SDCB 3QHZH 4Y19B 1JZ5A 3EYOB 2OTUA 3V4UL 5DD5L 1N6QL 4PJHB 2FCBA 4OQ1A 3T0ED 1BEYH 3X17A 4F3FA 1J8KA 1CL7L 1CGXA 3MMEB 3OGCB 4OZHB 4P2OC 4JPKL 5L6YH 3PXJA 1CGTA 5IBUB 1JF1B 4OZIE 1NL0L 4NC2B 3MFFB 4U6VH 4EN3D 3GI9H 5D7IA 1VKXA 2B20A 2DQFA 4IRSC 5BXFB 1AIFB 3VFGL 1T03H 1AKJB 4GAFB 5I0DA 5AD0B 1MRCH 4J8RB 1NDMB 1I3GH 4NZUL 2VDLL 2X4RA 4ODUB 4QGTA 1KACB 1FFOB 4S2SB 5E2WL 1NQBA 1S7WB 4E5XA 3EYSH 4BUHA 5DHVH 2Z31D 5JTWA 4NKOB 5IJVB 4PJ9B 2FWOA 5CZVH 3H9SB 4MJ6A 2Z8RA 3F7VB 1G9MC 2DICA 1ZA3A 2NZ9C 2CIIA 3QCTH 3HI5H 1ZKAA 4M93B 1R3HA 3BP6A 3UAJD 5D7IE 1XR8A 4K7PH 1UEYA 5E6YA 3TIDA 3UTQB 1IGCH 1EHAA 2NYYC 2PYEA 4NBXB 2JJTC 4H26B 3I3BA 1KJVB 5JPMA 2W9LA 1KJ3H 3U4EA 2AJYH 4A6YL 5BQ7B 1IGMH 2XOTA 2EE2A 2MNUA 3MRLA 3F58H 4M5YH 4O2CA 1RZJL 1UKQA 2VXVH 1U3ZA 1INQB 4KPHL 4FFVD 3LEYH 3ALWA 1QSZA 5T1KB 4NCDA 3GMOA 3HUJA 1KIRB 3TC9A 5ID0B 1MRFL 1WBXA 3OG4B 5ADPL 1GAFH 4HK0B 4YR6A 1W0VA 2IPTH 5E70A 5DD5H 5I1IH 4TUOA 4Y5VC 1D5BB 2PYEE 4JFED 4XCEB 4OI7A 1YPZA 5LG1A 1QEWA 3NFPB 1N3NB 4LRNH 5DMIL 1CI5A 4O4YH 3LS4L 2VZ1A 2YD2A 4KZDH 4PBWD 1QSED 1F8TH 4XP6H 4N0CD 2V2WA 5C0ND 4G43A 2WANA 4HBCL 4XP1L 4CNIB 3RI5K 4UDUB 3HUJE 3QXAA 5E6IC 3RY6C 4PGEB 2OCFD 3MRIA 4HIXL 3IDGA 1U92A 4NZUH 1ACYH 4F2MA 5E2WH 3DSFL 4EI6A 4O9HH 1LEGA 3JBG7 3TVMB 2WBWB 3BPOB 3QXUA 1YPZE 5E94A 3D39D 5TQ2L 3AM8C 4OKVB 5BCAA 4YZFE 3MLWH 3AS2A 2YA2A 1Z9SA 1B6UA 2BCKA 3G5XA 4PRAB 1SM3L 1T1XA 1XCQB 5E8OA 4FABL 3C6SB 3FRUB 5A1AA 5HHOA 3SE8H 3QIUD 2HWZL 3QIWA 4FTVB 1V7ML 1ND0A 5IKCA 2Q3ZA 4C4KT 1PW3A 4PREA 3T4YA 3OKEB 3IS1X 3QNXA 4L4TB 3C8KB 3CFKA 3SDDA 4XPBL 2DYPA 4PJGA 1XAUA 1RZJH 4KPHH 1HHGB 4MXVF 1HINH 4FQ2L 4M02A 3C5JB 5DJYA 3T0EB 4WHYH 2Q7NA 1EVUA 2ZUSA 2LFGA 3UBXA 4BZ2L 4X98A 5HHOE 2W92A 3ESVF 4C4KO 1Y0LA 2VAAA 1OAQL 4D9QD 1MCNA 4K2UL 1YY9C 2CDGB 4LMQI 1UB5B 3QUXB 3WNLA 1R3LA 3IU4H 4UT7H 5DD0L 1DANU 2X44D 4EN3B 1AO7A 5DMIH 1BBDH 3T2NL 1NC2D 4PJGE 4OKDA 3LS4H 2Y4SA 1R3KA 4DOHB 2ATKB 4X6CA 3EYFA 1UG9A 2GT9B 4HBCH 4M7JH 1KCVH 3RNKA 1FIGL 3I9GL 4DGYH 3E6FB 3BZFB 4HIXH 4KJQC 4KRPD 3HC3H 3VFUB 1LP9B 5EZJA 5ESVA 2Z31B 3O4OB 3QEGH 1CFQA 2PW1B 3NGBB 3QR2A 3U7WL 5J1AA 3U2SA 2V5MA 1KT2B 1H3XA 3TFKC 3IXTA 1AO7E 4DKFL 3PP3K 1SM3H 1ZGLM 3MV01 4OGXL 4XBEL 4X6CE 2X4OB 1WEJL 1KFAL 3BIKB 3EYVB 4Z7OF 5EZLA 1YNTB 4U1LB 4GKNB 5DVOA 3S37H 5EB9A 5KSBB 4XPBH 1TDQA 3HZVA 5IFJB 3QPXH 2W0KA 3G9AB 3MRGA 4DUVA 5DD6B 4LEOB 3SOBL 5EBLA 3NMEA 5H94B 3DOSA 3MRRB 3SKNA 2FX7L 2HJFA 1UH4A 2VIRB 3D0LA 3NBNA 4JFEB 2VLKA 5D7SL 3FQXB 4MVBD 1P4BH 5J6HB 3FO9A 3ILPB 3MYJA 3V6OE 3QO1A 4XCNB 4PJBF 1ZLSH 3QFDB 3WS3A 2P42B 1OAQH 1RVFH 4KKAD 4LSVL 4K2UH 1G0XA 1DLFH 1IC5L 5DD0H 3C60B 4R2GD 2AS5M 4RAVA 1C1EH 4ZUWA 5MERA 5B8CA 3T2NH 1NGQH 3F6LA 5AAWA 5DMKB 3IFOA 4FQIH 1OCWL 3TBTB 4B7IA 5GGQL 1VSCA 1INEL 1VFUA 1NUDA 5CBEB 4KKBD 5IFHL 5IW6A 1BOYA 1FIGH 2VLKE 3BEWA 4LHJB 4PJ8A 4CAGA 3QUYA 1TITA 4EEEA 2R9HD 3D39B 3SKOA 2EICA 1S9YB 1GXEA 3SCMC 1UXWA 4JG1H 4P2RD 5TE7H 2FYYB 1DUYA 1EHLL 1S9XB 1KCRH 5DEFB 3O3DA 1Q8MA 3NCBB 3QIUB 3CFIC 1HILB 5GRXG 4DKFH 1ZGLP 4H5SA 4G6JH 3CVHH 3IB4A 3VE0B 3DMMC 1A0QH 5ACZB 3M07A 4JCLA 4WNQA 2ZKHL 4WV1C 3LS5H 3J7HA 4AEHL 4H20H 5KN5A 4ODTL 4J4PC 2OR9L 4NOFA 1BJ8A 3MBED 2YC1A 2CSPA 3IAPA 4S1SL 3W9DA 3LB6C 5J56B 4OB5H 4BELD 1M7DA 1XEDA 4Z6AT 2ZP0T 1SBBA 3UTSA 2QHRL 1RJLA 4BFGA 5CD3B 3HI6L 3P0VH 2E7LC 2FX7H 1J0KA 5I74C 3MLYH 1NLDL 4GKZA 4WENB 4F80A 3RUGB 1A4JB 3MODL 1JE6A 3E3QE 1N0LA 5GJTH 5MEOB 4OLYL 2V9TA 3C09B 4RSVA 1NC2B 3G08B 8CGTA 2IJ0C 5MEQA 4LSVH 5E08L 2YSSA 3KPSA 2E27H 2A74B 4LLWA 2W0PA 3EO9L 1UWEL 4N0UB 1E4WL 5DA0B 2NTFB 1TJIL 4HW6A 4LHUG 4UT9H 4KRPB 4MDJA 2DBLH 1U9KA 1ED3A 2PR4L 3WHE1 3H7LA 3P4MA 1INEH 2Q87A 5HVGB 4YPGB 4XNYH 1AR2A 1JPSH 1F4YL 1GOHA 1GL4B 2QL1A 2FIRT 4QRQB 5AUMB 5LWYH 1OD9A 3I2CH 3IXAA 1MVFA 4J3UA 1FFNB 5IB5B 3EKCA 3TA3A 3WFHB 3KPSE 4GW1B 2DIJA 1NCAL 4YHYC 4U1MB 1MWAL 5F71A 3O3AB 2F58L 4LVNC 2X42A 4D0CA 1D5IH 4Y4HC 1FH5H 2A6JA 4HT1H 5D72L 1MFAL 1I9IL 4DN3H 2F19L 2Z92A 3LKSB 3ARRA 5EBMB 3T0BA 4AEHH 3PWPA 3GSQB 1BAFL 2IBBA 4Q6IC 5T1DH 3HNVL 4ODXA 4Q9BA 4LBEA 4YJZL 1RJYA 3BGMB 4MJ5A 5GRWA 1CYGA 2C1OA 5C6PB 4Y4KD 2H3NA 2D4DA 4OV6F 1JHTA 3EYUL 1U8JB 4JZOA 1FV1B 3IJYA 3ZYJA 5DS8A 3MXWH 3RVTC 2DN7A 2PO6D 2A9NH 5I1LB 3MODH 2CLRA 4R2GB 2CR3A 5FM4A 3ZTJG 3MGTA 2DBJA 3AGVA 3V6FB 1A7PH 4DUXA 2ADIB 2D4FA 2BVQA 2DF3A 3PWPE 1LDSA 5E08H 1RURH 3CVHB 3OR7A 4KJPD 2JCCF 3P4OB 2VR9A 3EO9H 1E4WH 1O7VA 1HXMB 4NPYB 2VLRA 2VISB 3TWCL 4P2RB 3I6LD 3EYQC 5GHWL 2ENSA 3FKUS 5HTSA 4FQHA 1H8SA 3GMPB 4WEMB 3CFCH 4G9DB 4Y1AA 1OQOA 5IHLB 4TSBL 4LF3B 1T20A 2JTDA 4BM7A 4NQSB 5D1XA 3D87B 5DHYA 1XIWD 5IB4B 4JZJB 1NBYA 3VWKC 1NCAH 2E9JA 4JVPA 2I9LB 1WLHA 2F58H 2H41A 1HSAB 5IBLC 5B38B 5CAYB 3PNWA 2EDQA 2VLRE 3MBEB 4I0KA 3T1FB 3MJ9L 3ARSA 2F19H 3IDIA 5DRZA 3HPJB 2VAJA 4ONFL 4ZO7A 4UDTB 3RFZC 3L95A 3DUHA 2VTFA 1NGXB 4A2MA 2H2PC 4XMLH 1RZKL 4QXGH 2CLVA 1D9KD 4Y4FD 1WZKA 4LOUC 5INCA 1IQDB 2CUIA 4X6FA 2VDPH 2A1WL 1O7SA 5EIIB 1YJDL 3EFDL 5FO8B 4KY1H 4MWFB 5GGVH 2J6EA 3EYUH 4JN2A 4AENA 2G60L 4U1KB 4JFPB 1U8LA 1MJUH 2MJWA 1IBGH 5FB8A 4OCMC 5TFSL 3KPOA 3O4LA 1J0HA 4RFEA 5ADOH 2UVEA 2EECA 5DO2C 1KF9B 3VXNA 2Y72A 5DC0A 2ICWB 4UB0H 5CJBA 5HYEA 4HX1B 1WITA 5DJ8A 4HAFA 4NO0A 5F6HJ 5FGCE 4X0KA 1FCGA 4PG9B 2DQDH 3TWCH 5D1QD 2P24A 4PD4J 4W70A 1YEEH 2DLFL 5GHWH 1TQBC 5TJWK 2ORBL 3BPNC 3TJHD 4N9OB 3MNZB 5AEAA 2APXA 5I1KL 4KH2A 3JWDH 2NW3B 3O4LE 3KR3L 3QWOB 2GAZB 3KGRA 4AM0A 1AHWA 4QRPA 1O5DT 4X5WA 4NRXB 2EEBA 4Z5RB 3HR5A 1T22A 5K59E 4YFDB 5CEYA 4YDLC 1QR1A 1SEQL 1HIML 3QNYB 2E7LA 3JWNC 2Z93B 4JDTL 3GJEB 1OP9A 3L3KB 1GRWA 2NW2A 2D0GA 2YA0A 1AP2A 5A2FA 3C5ZB 4M6ML 4IOFC 5F1IA 5D7JC 4MXQD 5HYQA 5D5MB 2B7DT 1IM3B 3OJMB 4YXKL 1T0MB 4Y4KB 4HWNA 4NFBA 4QRPE 4I48B 3CU7A 1F45A 2AXGA 2PO6B 4XZUA 4P57A 1FZKB 4PTUB 2PYED 3UCRA 3BKCL 4OZGF 1B0GB 3DRTB 2VKWA 5KS9A 4HC1A 1E4JA 1A6AB 1SYSB 1H3VA 3NCYS 5I9QC 4YC2B 3P73B 4DAGL 1U3YA 1F3JA 4X7EC 3MUGA 5JIIA 3T08A 4J1UA 1CD8A 1V3LA 1MWAB 5FYJH 5HHXL 4KGLA 5I75C 4FQJH 4KK5D 3NN8A 1MHEA 3UYRL 4TRPH 3ARDC 4DUWA 3VGGA 4IS6A 5CKAA 1S9WB 1OOAA 4HH9A 3DX7A 3HFMH 2HLAA 4NNYA 4TTDD 2PTTA 1G9NH 5KS9E 5TE4L 5EORH 1JGDA 1XIWB 3NPZB 1RD6A 3JV5A 2BFVL 2FH8A 3MRJB 4I4WB 3I85A 4O58H 4PGDB 3RWJB 3MLZL 3LPFA 1DQLL 2DQHL 3N1QC 4L29A 2OSLA 4OLWL 3SGKC 2Q76A 4WW1B 3VFPA 5FDWA 4WO4C 1CDCA 3RWIA 1IM9B 2ZUUA 3BE1L 3CFDB 2VDKL 5FGRA 4S11A 4S10A 1IGTA 3WEXA 1K6QL 2G5BB 5C0BA 1FNAA 1LO2L 2NY0D 4YHZL 4EDXA 3AY4C 4NN5B 2FB4L 5GS1B 1NKOA 4GMTL 1JF5A 3DARA 4LK4A 3GGWB 4MSWB 5GIRB 5IEKA 1D9KB 5IF0B 4Y4FB 4PRHA 3KNBA 4GAJH 1BBJA 2UWEA 5TDPB 1FBIL 3KPQB 3RNQB 3ARFA 5HHOD 5TH2B 5JIPA 2HTKC 1A4KB 2N4IA 4HKJB 4LPCA 4U31A 3VXOA 2C4FU 5HDQL 1EERB 2ITCA 2DLIA 4G80A 5TDNA 1BVKB 4OZIB 4HKXB 1SY6H 2A9ML 3BKCH 3VFSA 3DRQB 5C0BE 3SDDD 1IQWH 1Z0NA 4PRDA 3VFOB 2DYPD 1OB1A 5GISL 3LEXB 2IAMA 2HLFD 5FHBL 1E0OB 3N85L 4LP5A 5E7BA 2P49B 3GDBA 4UOW0 2OTUB 3ARGA 5DI8A 5JIKA 1X5LA 2YD4A 2FATL 1NEZA 4PRHE 4GJTB 1CG9A 4RFNC 3TPUA 2UWEE 3VWJC 3R06A 4NQVA 4F3FB 2QR0A 3P11L 1RZIA 1W72H 2DQCH 4NHUA 4AIXA 2W59A 1GJIA 2ZSWA 4PLNC 1T21A 3NTCH 2FHFA 2FJFA 5IUSA 4GRLA 5D7IB 1VKXB 4R4FH 2DQFB 1OAZH 3MV11 3DYOA 1YEKL 2X4RB 3V7MA 4R26H 3SDXA 3CAFA 1EBAA 4E5XB 5FDYA 2H32A 3BE1H 4PGCA 3VGBA 3VRIA 4M7LH 2R1XA 2PTUA 3OKNA 1Q9WA 2VSDA 1LO2H 1KXVC 2FWOB 1T89C 4MJ6B 2JJSC 1ZA3B 1QLRA 2CIIB 4N8VG 1J5OL 4IRZL 5C0AA 3EOTL 1R3HB 3BP6B 3NABL 2BY1A 5F9JA 1LQSR 1BFVL 5DK2A 1XR8B 2B4CL 3TIDB 1FBIH 2OZ4A 2PYEB 4LLUA 1EFXD 3WFBH 5EA0H 5JPMB 5E2TH 3U4EB 3B9KA 3GSNH 3SDXE 4ENED 3TIEA 5HDQH 3MRLB 4O2CB 2GQHA 4QCIA 4CBPA 4X9GA 1TTFA 2X4QA 1Q0YL 1KG0A 3GMOB 3HUJB 1C7SA 5FHBH 4OCSL 1WBXB 1DVFA 4FQXA 5C0AE 2AJ3A 4YR6B 4ZTPL 1W0VB 1WWWX 2K3TA 5AZ2H 4NGHL 4TUOB 3W2DL 3ARBA 2WV3A 2VLKD 2ZJSL 1YPZB 1QEWB 4U3XA 4MJ4A 3CXHK 4DQOH 2NNAA 1F6AA 1H3WM 3HZYA 5I1EL 4OCWL 4XI5C 2V2WB 4O5LH 4G43B 3KLHD 3VGAB 1N4XL 3PQYA 4F15C 3QXAB 3MRIB 3IDGB 4M48L 1U92B 4AMKL 1DQDL 3OJ2C 4F2MB 1JHKL 4YLQT 2NY0B 3NIFF 4EI6B 1LEGB 2E5EA 4FZEH 4RRPA 3NVQA 4PJ8D 3OKYA 1OARH 5E94B 3QUYD 4QRSA 5JXEA 2DLEA 2GCYA 4P0DA 2BCKB 3G5XB 1OP3H 1OP3K 4EIZC 1T1XB 4HH8A 1IKNA 4L8SC 4Y2DC 3UBXG 5E8OB 5HHOB 1J5OH 4IRZH 3EBAA 3QCVL 3QIWB 1X6NA 3JTSA 3PQYE 4NM4L 1ND0B 1KB9K 5IKCB 1G9MH 4PJFF 2ZG1A 4PREB 3HB3D 3C6LA 3T4YB 5KSAA 3JV6A 2XZCL 3QNXB 3CFKB 3FB5A 3SDDB 2DYPB 1MHCA 1C08A 2EYRA 4RCAA 5ELIA 4PJGB 2QTEA 3C87A 3ZT6A 1IGFL 2WINA 1NGPL 1QO3A 5DF0A 3BX7C 2EXYC 3ELAT 1MHHA 3B5HA 1YEFH 5DJYB 4KI5C 2BNRA 4KVCL 4OCSH 4K3EL 5B3NA 3TCXA 3UBXB 4X98B 3X14A 3S97C 4ZTPH 2QQKH 1Y0LB 4MA8L 5IBTH 5IVZA 2VAAB 43C9A 1DE4A 1MCOL 4HKZA 3PIQA 2ZJSH 5DJ6A 1BECA 3WKNA 1R3LB 1N0XH 1EZVY 1MNUL 4MZ2A 4LDEB 1AO7B 4BFBD 3STBA 2AQ1A 4Z7NF 5I1EH 3V79C 1R3KB 2GK2A 2MKLC 2DQIL 4RMRA 4X6CB 3RAJH 1NGZA 4Z7QE 3EYFB 3TH3T 2I24N 3KPSD 3MR9A 1NMBH 4CMMA 1KUMA 5ACLA 3GMNA 4Z8FH 2QSVA 3G6AA 3RNKB 4NN6C 2BNRE 4NUJA 1A6WL 1EEYA 5EZJB 4ZO9A 4XWGL 5ESVB 2YOCA 2JELL 1CFQB 4J3WA 4J3OC 3UPAA 5HGHA 1FG2A 3T8XA 1R0AH 5J1AB 4LHQB 3U2SB 1PZUB 3SKJL 1JN6A 3IXTB 3V6BR 1NCTA 2ADJA 4GW4A 3N50A 3RX8A 4WWKC 4OGAD 4JREC 2HAZA 5BZWA 4KK6D 4M1CC 3L3IA 3T0XA 1IGJA 3EJZD 2UZXB 2C4XA 4JPVH 3TA3D 1U8NA 5DQJA 2A77L 3DETC 3U9PL 2AJSL 5C0JA 2D7MA 3NA4A 3Q2CA 4NM4H 5EZLB 2F54E 4AL8H 5D71L 4R0LC 4HUXA 4I0PA 1AR1C 3HZVB 3VXTA 3C9NA 3WHXA 4APQD 2V5RA 1IT9H 3IRPX 1IGFH 4XP5H 3MRGB 3ABZA 3D5OF 1KYOJ 2RHEA 2B1AH 3PWPD 3B83A 5I73C 5EBLB 4LVOC 4ZOAA 4FRWA 3SKNB 2MCPL 2HJFB 3D0LB 2VLJA 2VLKB 1OF2A 2CKNA 4K3EH 4H88L 5FOBA 2CMRL 3FO9B 3MYJB 5CIPH 3QO1B 1RZFL 4MA8H 3WS3B 4I2XA 1NBQA 1MCOH 3ESUF 4YBHA 4WCYH 3WUWA 4HAGA 4NWUL 3UTPE 3QUZA 2R4SH 4RAVB 1RHFA 4ZUWB 3PWNA 5MERB 5B8CB 2CR6A 4XWOC 5IP4A 2DI8A 4GAGL 1CZ8L 1QOKA 3T04D 1KJ2A 3IFOB 2DQIH 1BF8A 2HP4A 4OFIA 4X7SL 1FVEA 4WU7A 4XPTH 4KHTH 5IW6B 5CFHA 1PKQA 2VLJE 4ZG1A 3BEWB 4R4BA 4PJ8B 3QUYB 2VLRD 3SKOB 4UQ2A 2J6EL 1UXWB 2JELH 4OUUA 3GUTA 1DUYB 4I2XE 1DL7H 2ZG3A 2X4PA 5E56A 4HUWA 3S5LA 3MZTA 2J3SA 1A14L 1CD0A 2NY4D 3O3DB 4GRWE 4MNGA 4U4BA 3UDWC 3TZVC 4JQVA 4D3CL 4H5SB 5D1XD 2I60L 3X3FL 5E6ZA 2VH5H 4LRIC 1JFQL 1G7QA 5T5NG 2A77H 1VPOL 1WAAF 1CLYL 3U82B 3U9PH 4PJ7A 4Y0GA 3HE7C 4WNQB 1PKQE 4JM2A 1HE7A 1PEZA 1FFPA 2X10A 4N9GA 4N1HB 4U0RB