3Q2EA

Crystal structure of the second bromodomain of human bromodomain and wd repeat-containing protein 1 isoform a (wdr9)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
107
structure length
107
Chain Sequence
NWKKQCKELVNLIFQCEDSEPFRQPVDLVEYPDYRDIIDTPMDFGTVRETLDAGNYDSPLEFCKDIRLIFSNAKAYTPNKRSKIYSMTLRLSALFEEKMKKISSDFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
molecule keywords Bromodomain and WD repeat-containing protein 1
molecule tags Signaling protein
source organism Homo sapiens
total genus 41
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3q2eA00
5EWCA 5FE3A 4KV1A 4YY6A 4O78A 5HM0A 4YK0A 5EI4A 5DYAA 5IGLA 1E6IA 3IU5A 2DVRA 5ENCA 4Z1SA 5AMFA 5CQ4A 5I40A 3DAIA 4XY9A 5IG6A 4HBYA 4LZRA 4AKNA 3HMHA 2YQDA 2YELA 3O35A 5IBNA 5KO4A 3O37A 5C7NA 5II1A 2WP2A 4MENA 5E9VA 4QSVA 5HJCA 5FE1A 5E3DA 1JSPB 5HRXA 3U5JA 4A9FA 4A9HA 5LKUA 4BW1A 4WIVA 3S92A 5A5NA 3UVYA 5FFWA 5I86A 4WHUA 5D26A 5E9YA 4A9JA 4CUTA 5FE5A 5C87A 5AMEA 5HQ5A 5F63A 4HXNA 4O71A 5L8UA 2YDWA 4MEPA 3FKMX 5A5SA 4Z6HA 5DX4A 5ENJA 4MR5A 4IOQA 5D24A 4UYGA 5FBXA 3MQMA 5I88A 3O36A 4QSSA 5EU1A 5CRZA 1F68A 3UVDA 4PY6A 4UIXA 4YYKA 5FB1A 5FFYA 4NYVA 4NR7A 5C4QA 3O33A 4QEVA 5CGPA 4QSUA 4MR6A 4XUBA 2I8NA 5CS8A 5DKDA 4ALHA 4TYLA 4QBMA 4UYHA 3UV5A 4MR3A 5IGKA 4HBXA 4O75A 3QZVA 5D3LA 2L5EA 4E96A 3P1DA 5COIA 5ENFA 4QNSA 4CFKA 2R0VA 5ENHA 4NS5A 3MB4A 5DY7A 4QR5A 5IGMA 5DFCA 4BW2A 2OSSA 5E9IA 4C66A 2F6JA 3MB3A 4CLBA 4QZSA 5I29A 5I83A 5A83A 5LKXA 3LXJA 4QSQA 5CRMA 5DFBA 3UV4A 2D9EA 4DONA 5L96A 4A9EA 4CFLA 4C67A 5HQ6A 5IGNA 4N4GA 5HFRA 4QR3A 3QZTA 4NR8A 5CQ8A 4XYAA 5EA1A 3P5OA 4HXOA 5F60A 5CQTA 3O34A 5H85A 5F25A 5DYUA 5CP5A 5EWHA 4J0RA 4NRCA 4QSWA 5HEMA 4A9IA 3P1CA 5H1TA 4CUSA 1JM4B 5EVAA 5I89A 5EV9A 4LYSA 4XUAA 4MR4A 4UIVA 5TCMA 5K29A 5FE0A 4Q0NA 5FH7A 5HQ7A 5LJ0A 5LKTA 1EQFA 4YATA 5KU3A 5A5QA 5DW2A 4TTEA 2RNWA 5CUAA 5D3HA 3U5PA 4YAXA 3SVGA 4QC3A 3RCWA 4LRGA 3UVWA 4KV4A 5D3SA 4QSTA 5I7XA 4A9KA 5ENIA 4NUEA 4HXMA 4YBMA 5EQ1A 4RVRA 4LZSA 4NR4A 4GPJA 5H1VA 4QEWA 5E3GA 5A82A 4UIWA 5KTWA 5CFWA 4MEQA 5CQ5A 2KTBB 4QY4A 5CY9A 4NRBA 5A85A 5FB0A 5FE7A 5F5ZA 5D25A 4NQMA 3G0LA 2WP1A 4O7EA 5L99A 5CQ6A 5DLZA 1WUGA 4LC2A 3AQAA 3ONIA 3SVHA 4UITA 4YYIA 5H1UA 4CUPA 5FE2A 3Q2FA 5FE8A 5LKZA 4PTBA 2E7OA 4IR4A 3UVXA 5LUUA 4J3IA 5IIDA 2RFJA 3LQHA 5EWVA 2OUOA 5ENBA 5I80A 4UIZA 2R10A 2RI7A 4TT6A 5EWDA 5L98A 4TZ2A 5CU8A 5FE6A 5I1QA 2YEMA 5DKCA 4A9OA 2DVVA 1N72A 5DBMA 2DKWA 5E9LA 3U5KA 2NXBA 4TU6A 5CUCA 5DYCA 4PS5A 5DYXA 3ZYUA 4NYXA 5EK9A 5CZGA 5AD3A 2DATA 5A5PA 3IU6A 3HMEA 3LJWA 5DFDA 5C85A 5FH6A 5E9KA 3U5LA 4A9MA 3LQJA 3U5MA 3U5NA 4YH4A 5TB6A 3NXBA 4NR5A 1X0JA 4UYFB 5E9MA 2L85A 5DW1A 4QC1A 5A81A 4F3IA 5ENGA 5L8TA 4O76A 5JWMA 4PCEA 5E73A 4CL9A 3S91A 4WHWA 3TLPA 5FE9A 5KTXA 5D0CA 5F62A 3UW9A 4QSRA 4QUTA 4YBTA 4MEOA 5F61A 5HENA 5BT5A 5C89A 4J1PA 4UYDA 5ACYA 5J0DA 2RNYA 4QR4A 5I7YA 4N4IA 4O70A 4CURA 4YC9A 3DWYA 4Z93A 2MJVB 4BW4A 3K2JA 2YYNA 4Q0OA 5E0RA 4QYDA 4N4HA 2RO1A 5L97A 2LSPB 5JI8A 4XY8A 5FG6A 4TT4A 3JVJA 3P1FA 4OUFA 2RS9B 5HELA 4IOOA 2RNXA 5G4SA 5HCLA 5FG5A 4IR5A 4TS8A 5F1LA 5F2PA 4CUUA 5LVRA 5FH8A 3MUKA 2E3KA 2DVSA 5ENEA 2I7KA 5BT4A 4IR6A 4NR6A 4O77A 4QYLA 5C8GA 4NUCA 3HMFA 4J0SA 5EPBA 4N4FA 2YW5A 4O7CA 5EPSA 5F36A 4LR6A 4A9NA 2D82A 3D7CA 5EWWA 4QB3A 4TT2A 4BW3A 2FSAA 4Z1QA 4ZC9A 4QUUA 3MXFA 4OGJA 5D3TA 2L84A 5FDZA 5LVQA 1ZS5A 2GRCA 5CTLA 4TQNA 2YEKA 4KCXA 4OGIA 4UIUA 5BT3A 4Z6IA 3I3JA 3Q2EA 3JVKA 2DVQA 4A9LA 5D3RA 2OO1A 4YYGA 5CQ3A 2N9GA 4UYFA 5CUGA 4X2IA 4TZ8A 4YY4A 4NQNA 4QEUA 4HBWA 3JVMA 5LJ2A 5EICA 4YH3A 2DWWA 4O7AA 5D3NA 5HFQA 4HBVA 5II2A 4N3WA 4O7BA 3SVFA 4HXSA 5D7XA 5KHMA 4IORA 5EP7A 5G4RA 5CUDA 4ZQLA 4YYJA 4NXJA 4ZW1A 5CPEA 3MULA 3LQIA 4YABA 5LJ1A 3U5OA 4HXPA 5HLSA 4NYWA 4O7FA 3QZSA 4NR9A 4UIYA 5D3JA 5F1HA 2R0YA 4ALGA 5DKHA 3GG3A 5F3AA 4QSXA 4BJXA 5E74A 4UYEA 4PKLA 5D3PA 4YYHA 5ETBA 4LYIA 2F6NA 4HXLA 5CUEA 5AD2A 5A5RA 5ETDA 3G0JA 4YYNA 4TU4A 5A7CA 5KTUA 5E7DA 2R0SA 4IR3A 4YBSA 5HRWA 5EGUA 3UV2A 2H60A 4Y03A 5EPRA 5FE4A 2G4AA 5FG4A 4YYDA 4O74A 4LZ2A 3JVLA 5FFVA 5DLXA 4BHWA 4YYMA 4NRAA 4CUQA 5HRVA 4NUDA 4YADA 5CUBA 4HXKA 4PCIA 3AADA 4O72A 5CQ7A 3P1EA 1WUMA 5EM3A 4LDFA 4QSPA 5EISA 5CQAA 4LYWA 5A5OA 2E7NA 4HXRA 4FLPA
chains in the Genus database with same CATH superfamily
5EWCA 5FE3A 4KV1A 4YY6A 4O78A 5HM0A 4YK0A 5EI4A 5DYAA 5IGLA 1E6IA 3IU5A 2DVRA 5ENCA 4Z1SA 5AMFA 5CQ4A 5I40A 3DAIA 4XY9A 5IG6A 4HBYA 4LZRA 4AKNA 3HMHA 2YQDA 2YELA 3O35A 5IBNA 5KO4A 3O37A 5C7NA 5II1A 2WP2A 4MENA 5E9VA 4QSVA 5HJCA 5FE1A 5E3DA 1JSPB 5HRXA 3U5JA 4A9FA 4A9HA 5LKUA 4BW1A 4WIVA 3S92A 5A5NA 3UVYA 5FFWA 5I86A 4WHUA 5D26A 5E9YA 4A9JA 4CUTA 5FE5A 5C87A 5AMEA 5HQ5A 5F63A 4HXNA 4O71A 5L8UA 2YDWA 4MEPA 3FKMX 5A5SA 4Z6HA 5DX4A 5ENJA 4MR5A 4IOQA 5D24A 4UYGA 5FBXA 3MQMA 5I88A 3O36A 4QSSA 5EU1A 5CRZA 1F68A 3UVDA 4PY6A 4UIXA 4YYKA 4AKGA 5FB1A 5FFYA 4NYVA 4NR7A 5C4QA 3O33A 4QEVA 5CGPA 4QSUA 4MR6A 4XUBA 2I8NA 5CS8A 5DKDA 4ALHA 4TYLA 4QBMA 4UYHA 3UV5A 4MR3A 5IGKA 4HBXA 4O75A 3QZVA 5D3LA 2L5EA 4E96A 3P1DA 5COIA 4AI6A 5ENFA 4QNSA 4CFKA 2R0VA 5ENHA 4NS5A 3MB4A 5DY7A 4QR5A 5IGMA 5DFCA 4BW2A 2OSSA 5E9IA 4C66A 2F6JA 3MB3A 4CLBA 4QZSA 5I29A 5I83A 5A83A 5LKXA 3LXJA 4QSQA 5CRMA 5DFBA 3UV4A 2D9EA 3D1BA 4DONA 5L96A 4A9EA 4CFLA 4C67A 5HQ6A 5IGNA 4N4GA 5HFRA 4QR3A 3QZTA 4NR8A 5CQ8A 4XYAA 5EA1A 3P5OA 4HXOA 5F60A 5CQTA 3O34A 5H85A 5F25A 5DYUA 5CP5A 5EWHA 4J0RA 4NRCA 4QSWA 5HEMA 4A9IA 3P1CA 5H1TA 1ZKRA 4CUSA 1JM4B 5EVAA 5I89A 5EV9A 4LYSA 4XUAA 4MR4A 4UIVA 5TCMA 5K29A 5FE0A 4Q0NA 5FH7A 5HQ7A 5LJ0A 5LKTA 1EQFA 4YATA 5KU3A 5A5QA 5DW2A 4TTEA 2RNWA 5CUAA 5D3HA 3U5PA 4YAXA 4AKIA 3SVGA 4QC3A 3RCWA 4LRGA 3UVWA 4KV4A 5D3SA 4QSTA 5I7XA 4A9KA 5ENIA 4NUEA 4HXMA 4YBMA 5EQ1A 4RVRA 4LZSA 4NR4A 4GPJA 5H1VA 4QEWA 5E3GA 5A82A 4UIWA 5KTWA 5CFWA 4MEQA 5CQ5A 2KTBB 4QY4A 5CY9A 4NRBA 5A85A 5FB0A 5FE7A 5F5ZA 5D25A 4NQMA 3VKHA 3G0LA 2WP1A 4O7EA 5L99A 5CQ6A 5DLZA 1WUGA 4LC2A 3AQAA 3ONIA 3SVHA 4UITA 4YYIA 5H1UA 4CUPA 5FE2A 3Q2FA 5FE8A 5LKZA 4PTBA 2E7OA 4IR4A 3UVXA 5LUUA 4J3IA 5IIDA 2RFJA 3LQHA 5EWVA 2OUOA 5ENBA 5I80A 4UIZA 2R10A 2RI7A 4TT6A 5EWDA 5L98A 4TZ2A 5CU8A 5FE6A 5I1QA 2YEMA 5DKCA 4A9OA 2DVVA 1N72A 5DBMA 2DKWA 5E9LA 3U5KA 2NXBA 4TU6A 5CUCA 5DYCA 4PS5A 5DYXA 3ZYUA 4NYXA 5EK9A 5CZGA 5AD3A 2DATA 5A5PA 3IU6A 3HMEA 3LJWA 5DFDA 5C85A 5FH6A 5E9KA 3U5LA 4A9MA 3LQJA 3U5MA 3U5NA 4YH4A 5TB6A 3NXBA 4NR5A 1X0JA 4UYFB 5E9MA 2L85A 5DW1A 4QC1A 5A81A 4F3IA 5ENGA 5L8TA 4O76A 5JWMA 4PCEA 5E73A 4CL9A 3S91A 4WHWA 3TLPA 5FE9A 5KTXA 5D0CA 5F62A 3UW9A 4QSRA 4QUTA 4YBTA 4MEOA 5F61A 5HENA 5BT5A 5C89A 4J1PA 4UYDA 5ACYA 5J0DA 2RNYA 4QR4A 5I7YA 4N4IA 4O70A 4CURA 4YC9A 3DWYA 4Z93A 2MJVB 4BW4A 3K2JA 2YYNA 4Q0OA 5E0RA 4QYDA 4N4HA 2RO1A 5L97A 2LSPB 5JI8A 4XY8A 5FG6A 4TT4A 3JVJA 3P1FA 4OUFA 2RS9B 5HELA 4IOOA 2RNXA 5G4SA 5HCLA 5FG5A 4IR5A 4TS8A 5F1LA 5F2PA 4CUUA 5LVRA 5FH8A 3MUKA 2E3KA 2DVSA 5ENEA 4AKHA 2I7KA 5BT4A 4IR6A 4NR6A 4O77A 4QYLA 5C8GA 4NUCA 3HMFA 4J0SA 5EPBA 4N4FA 2YW5A 4O7CA 5EPSA 5F36A 4LR6A 4A9NA 2D82A 3D7CA 5EWWA 4QB3A 4TT2A 4BW3A 2FSAA 4Z1QA 4ZC9A 4QUUA 3MXFA 4OGJA 5D3TA 2L84A 5FDZA 5LVQA 1ZS5A 2GRCA 5CTLA 4TQNA 2YEKA 4KCXA 4OGIA 4UIUA 5BT3A 4Z6IA 3I3JA 3Q2EA 3JVKA 2DVQA 4A9LA 5D3RA 2OO1A 3D1DA 5CQ3A 4YYGA 2N9GA 4UYFA 5CUGA 4X2IA 4TZ8A 4YY4A 4NQNA 4QEUA 4HBWA 3JVMA 5LJ2A 5EICA 4YH3A 2DWWA 4O7AA 5D3NA 5HFQA 4HBVA 5II2A 4N3WA 4O7BA 3SVFA 4HXSA 5D7XA 5KHMA 4IORA 5EP7A 5G4RA 5CUDA 4ZQLA 4YYJA 4NXJA 4ZW1A 3VKGA 5CPEA 3MULA 3LQIA 4YABA 5LJ1A 3U5OA 4HXPA 5HLSA 4NYWA 4O7FA 3QZSA 4NR9A 4UIYA 5D3JA 5F1HA 2R0YA 4ALGA 5DKHA 3GG3A 5F3AA 4QSXA 4BJXA 5E74A 4UYEA 4PKLA 5D3PA 4YYHA 5ETBA 4LYIA 2F6NA 4HXLA 5CUEA 5AD2A 5A5RA 5ETDA 3G0JA 4YYNA 4TU4A 5A7CA 5KTUA 5E7DA 2R0SA 4IR3A 4YBSA 5HRWA 5EGUA 3UV2A 2H60A 4Y03A 5EPRA 5FE4A 2G4AA 5FG4A 4YYDA 4O74A 4LZ2A 3JVLA 5FFVA 5DLXA 3ERRA 4BHWA 4YYMA 4NRAA 4CUQA 5HRVA 4NUDA 4YADA 5CUBA 4HXKA 4PCIA 2EJNA 3AADA 4O72A 5CQ7A 3P1EA 1WUMA 5EM3A 4LDFA 1PUOA 4QSPA 5EISA 5CQAA 4LYWA 5A5OA 2E7NA 4HXRA 4FLPA
chains in the Genus database with same CATH topology
5EWCA 5FE3A 4KV1A 4YY6A 4O78A 5HM0A 4YK0A 5EI4A 5DYAA 5IGLA 1E6IA 3IU5A 2DVRA 5ENCA 4Z1SA 5AMFA 5CQ4A 5I40A 3DAIA 4XY9A 5IG6A 4HBYA 4LZRA 4AKNA 3HMHA 2YQDA 2YELA 3O35A 5IBNA 5KO4A 3O37A 5C7NA 5II1A 2WP2A 4MENA 5E9VA 4QSVA 5HJCA 5FE1A 5E3DA 1JSPB 5HRXA 3U5JA 4A9FA 4A9HA 5LKUA 4BW1A 4WIVA 3S92A 5A5NA 3UVYA 5FFWA 5I86A 4WHUA 5D26A 5E9YA 4A9JA 4CUTA 5FE5A 5C87A 5AMEA 5HQ5A 5F63A 4HXNA 4O71A 5L8UA 2YDWA 4MEPA 3FKMX 5A5SA 4Z6HA 5DX4A 5ENJA 4MR5A 4IOQA 5D24A 4UYGA 5FBXA 3MQMA 5I88A 3O36A 4QSSA 5EU1A 5CRZA 1F68A 3UVDA 4PY6A 4UIXA 4YYKA 5FB1A 5FFYA 4NYVA 4NR7A 5C4QA 3O33A 4QEVA 5CGPA 4QSUA 4MR6A 4XUBA 2I8NA 5CS8A 5DKDA 4ALHA 4TYLA 4QBMA 4UYHA 3UV5A 4MR3A 5IGKA 4HBXA 4O75A 3QZVA 5D3LA 2L5EA 4E96A 3P1DA 5COIA 5ENFA 4QNSA 4CFKA 2R0VA 5ENHA 4NS5A 3MB4A 5DY7A 4QR5A 5IGMA 5DFCA 4BW2A 2OSSA 5E9IA 4C66A 2F6JA 3MB3A 4CLBA 4QZSA 5I29A 5I83A 5A83A 5LKXA 3LXJA 4QSQA 5CRMA 5DFBA 3UV4A 2D9EA 4DONA 5L96A 4A9EA 4CFLA 4C67A 5HQ6A 5IGNA 4N4GA 5HFRA 4QR3A 3QZTA 4NR8A 5CQ8A 4XYAA 5EA1A 3P5OA 4HXOA 5F60A 5CQTA 3O34A 5H85A 5F25A 5DYUA 5CP5A 5EWHA 4J0RA 4NRCA 4QSWA 5HEMA 4A9IA 3P1CA 5H1TA 4CUSA 1JM4B 5EVAA 5I89A 5EV9A 4LYSA 4XUAA 4MR4A 4UIVA 5TCMA 5K29A 5FE0A 4Q0NA 5FH7A 5HQ7A 5LJ0A 5LKTA 1EQFA 4YATA 5KU3A 5A5QA 5DW2A 4TTEA 2RNWA 5CUAA 5D3HA 3U5PA 4YAXA 3SVGA 4QC3A 3RCWA 4LRGA 3UVWA 4KV4A 5D3SA 4QSTA 5I7XA 4A9KA 5ENIA 4NUEA 4HXMA 4YBMA 5EQ1A 4RVRA 4LZSA 4NR4A 4GPJA 5H1VA 4QEWA 5E3GA 5A82A 4UIWA 5KTWA 5CFWA 4MEQA 5CQ5A 2KTBB 4QY4A 5CY9A 4NRBA 5A85A 5FB0A 5FE7A 5F5ZA 5D25A 4NQMA 3G0LA 2WP1A 4O7EA 5L99A 5CQ6A 5DLZA 1WUGA 4LC2A 3AQAA 3ONIA 3SVHA 4UITA 4YYIA 5H1UA 4CUPA 5FE2A 3Q2FA 5FE8A 5LKZA 4PTBA 2E7OA 4IR4A 3UVXA 5LUUA 4J3IA 5IIDA 2RFJA 3LQHA 5EWVA 2OUOA 5ENBA 5I80A 4UIZA 2R10A 2RI7A 4TT6A 5EWDA 5L98A 4TZ2A 5CU8A 5FE6A 5I1QA 2YEMA 5DKCA 4A9OA 2DVVA 1N72A 5DBMA 2DKWA 5E9LA 3U5KA 2NXBA 4TU6A 5CUCA 5DYCA 4PS5A 5DYXA 3ZYUA 4NYXA 5EK9A 5CZGA 5AD3A 2DATA 5A5PA 3IU6A 3HMEA 3LJWA 5DFDA 5C85A 5FH6A 5E9KA 3U5LA 4A9MA 3LQJA 3U5MA 3U5NA 4YH4A 5TB6A 3NXBA 4NR5A 1X0JA 4UYFB 5E9MA 2L85A 5DW1A 4QC1A 5A81A 4F3IA 5ENGA 5L8TA 4O76A 5JWMA 4PCEA 5E73A 4CL9A 3S91A 4WHWA 3TLPA 5FE9A 5KTXA 5D0CA 5F62A 3UW9A 4QSRA 4QUTA 4YBTA 4MEOA 5F61A 5HENA 5BT5A 5C89A 4J1PA 4UYDA 5ACYA 5J0DA 2RNYA 4QR4A 5I7YA 4N4IA 4O70A 4CURA 4YC9A 3DWYA 4Z93A 2MJVB 4BW4A 3K2JA 2YYNA 4Q0OA 5E0RA 4QYDA 4N4HA 2RO1A 5L97A 2LSPB 5JI8A 4XY8A 5FG6A 4TT4A 3JVJA 3P1FA 4OUFA 2RS9B 5HELA 4IOOA 2RNXA 5G4SA 5HCLA 5FG5A 4IR5A 4TS8A 5F1LA 5F2PA 4CUUA 5LVRA 5FH8A 3MUKA 2E3KA 2DVSA 5ENEA 2I7KA 5BT4A 4IR6A 4NR6A 4O77A 4QYLA 5C8GA 4NUCA 3HMFA 4J0SA 5EPBA 4N4FA 2YW5A 4O7CA 5EPSA 5F36A 4LR6A 4A9NA 2D82A 3D7CA 5EWWA 4QB3A 4TT2A 4BW3A 2FSAA 4Z1QA 4ZC9A 4QUUA 3MXFA 4OGJA 5D3TA 2L84A 5FDZA 5LVQA 1ZS5A 2GRCA 5CTLA 4TQNA 2YEKA 4KCXA 4OGIA 4UIUA 5BT3A 4Z6IA 3I3JA 3Q2EA 3JVKA 2DVQA 4A9LA 5D3RA 2OO1A 4YYGA 5CQ3A 2N9GA 4UYFA 5CUGA 4X2IA 4TZ8A 4YY4A 4NQNA 4QEUA 4HBWA 3JVMA 5LJ2A 5EICA 4YH3A 2DWWA 4O7AA 5D3NA 5HFQA 4HBVA 5II2A 4N3WA 4O7BA 3SVFA 4HXSA 5D7XA 5KHMA 4IORA 5EP7A 5G4RA 5CUDA 4ZQLA 4YYJA 4NXJA 4ZW1A 5CPEA 3MULA 3LQIA 4YABA 5LJ1A 3U5OA 4HXPA 5HLSA 4NYWA 4O7FA 3QZSA 4NR9A 4UIYA 5D3JA 5F1HA 2R0YA 4ALGA 5DKHA 3GG3A 5F3AA 4QSXA 4BJXA 5E74A 4UYEA 4PKLA 5D3PA 4YYHA 5ETBA 4LYIA 2F6NA 4HXLA 5CUEA 5AD2A 5A5RA 5ETDA 3G0JA 4YYNA 4TU4A 5A7CA 5KTUA 5E7DA 2R0SA 4IR3A 4YBSA 5HRWA 5EGUA 3UV2A 2H60A 4Y03A 5EPRA 5FE4A 2G4AA 5FG4A 4YYDA 4O74A 4LZ2A 3JVLA 5FFVA 5DLXA 4BHWA 4YYMA 4NRAA 4CUQA 5HRVA 4NUDA 4YADA 5CUBA 4HXKA 4PCIA 3AADA 4O72A 5CQ7A 3P1EA 1WUMA 5EM3A 4LDFA 4QSPA 5EISA 5CQAA 4LYWA 5A5OA 2E7NA 4HXRA 4FLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EWC A;  5FE3 A;  4KV1 A;  4YY6 A;  4O78 A;  5HM0 A;  4YK0 A;  5EI4 A;  5DYA A;  5IGL A;  1E6I A;  3IU5 A;  2DVR A;  5ENC A;  4Z1S A;  5AMF A;  5CQ4 A;  5I40 A;  3DAI A;  4XY9 A;  5IG6 A;  4HBY A;  4LZR A;  4AKN A;  3HMH A;  2YQD A;  2YEL A;  3O35 A;  5IBN A;  5KO4 A;  3O37 A;  5C7N A;  5II1 A;  2WP2 A;  4MEN A;  5E9V A;  4QSV A;  5HJC A;  5FE1 A;  5E3D A;  1JSP B;  5HRX A;  3U5J A;  4A9F A;  4A9H A;  5LKU A;  4BW1 A;  4WIV A;  3S92 A;  5A5N A;  3UVY A;  5FFW A;  5I86 A;  4WHU A;  5D26 A;  5E9Y A;  4A9J A;  4CUT A;  5FE5 A;  5C87 A;  5AME A;  5HQ5 A;  5F63 A;  4HXN A;  4O71 A;  5L8U A;  2YDW A;  4MEP A;  3FKM X;  5A5S A;  4Z6H A;  5DX4 A;  5ENJ A;  4MR5 A;  4IOQ A;  5D24 A;  4UYG A;  5FBX A;  3MQM A;  5I88 A;  3O36 A;  4QSS A;  5EU1 A;  5CRZ A;  1F68 A;  3UVD A;  4PY6 A;  4UIX A;  4YYK A;  5FB1 A;  5FFY A;  4NYV A;  4NR7 A;  5C4Q A;  3O33 A;  4QEV A;  5CGP A;  4QSU A;  4MR6 A;  4XUB A;  2I8N A;  5CS8 A;  5DKD A;  4ALH A;  4TYL A;  4QBM A;  4UYH A;  3UV5 A;  4MR3 A;  5IGK A;  4HBX A;  4O75 A;  3QZV A;  5D3L A;  2L5E A;  4E96 A;  3P1D A;  5COI A;  5ENF A;  4QNS A;  4CFK A;  2R0V A;  5ENH A;  4NS5 A;  3MB4 A;  5DY7 A;  4QR5 A;  5IGM A;  5DFC A;  4BW2 A;  2OSS A;  5E9I A;  4C66 A;  2F6J A;  3MB3 A;  4CLB A;  4QZS A;  5I29 A;  5I83 A;  5A83 A;  5LKX A;  3LXJ A;  4QSQ A;  5CRM A;  5DFB A;  3UV4 A;  2D9E A;  4DON A;  5L96 A;  4A9E A;  4CFL A;  4C67 A;  5HQ6 A;  5IGN A;  4N4G A;  5HFR A;  4QR3 A;  3QZT A;  4NR8 A;  5CQ8 A;  4XYA A;  5EA1 A;  3P5O A;  4HXO A;  5F60 A;  5CQT A;  3O34 A;  5H85 A;  5F25 A;  5DYU A;  5CP5 A;  5EWH A;  4J0R A;  4NRC A;  4QSW A;  5HEM A;  4A9I A;  3P1C A;  5H1T A;  4CUS A;  1JM4 B;  5EVA A;  5I89 A;  5EV9 A;  4LYS A;  4XUA A;  4MR4 A;  4UIV A;  5TCM A;  5K29 A;  5FE0 A;  4Q0N A;  5FH7 A;  5HQ7 A;  5LJ0 A;  5LKT A;  1EQF A;  4YAT A;  5KU3 A;  5A5Q A;  5DW2 A;  4TTE A;  2RNW A;  5CUA A;  5D3H A;  3U5P A;  4YAX A;  3SVG A;  4QC3 A;  3RCW A;  4LRG A;  3UVW A;  4KV4 A;  5D3S A;  4QST A;  5I7X A;  4A9K A;  5ENI A;  4NUE A;  4HXM A;  4YBM A;  5EQ1 A;  4RVR A;  4LZS A;  4NR4 A;  4GPJ A;  5H1V A;  4QEW A;  5E3G A;  5A82 A;  4UIW A;  5KTW A;  5CFW A;  4MEQ A;  5CQ5 A;  2KTB B;  4QY4 A;  5CY9 A;  4NRB A;  5A85 A;  5FB0 A;  5FE7 A;  5F5Z A;  5D25 A;  4NQM A;  3G0L A;  2WP1 A;  4O7E A;  5L99 A;  5CQ6 A;  5DLZ A;  1WUG A;  4LC2 A;  3AQA A;  3ONI A;  3SVH A;  4UIT A;  4YYI A;  5H1U A;  4CUP A;  5FE2 A;  3Q2F A;  5FE8 A;  5LKZ A;  4PTB A;  2E7O A;  4IR4 A;  3UVX A;  5LUU A;  4J3I A;  5IID A;  2RFJ A;  3LQH A;  5EWV A;  2OUO A;  5ENB A;  5I80 A;  4UIZ A;  2R10 A;  2RI7 A;  4TT6 A;  5EWD A;  5L98 A;  4TZ2 A;  5CU8 A;  5FE6 A;  5I1Q A;  2YEM A;  5DKC A;  4A9O A;  2DVV A;  1N72 A;  5DBM A;  2DKW A;  5E9L A;  3U5K A;  2NXB A;  4TU6 A;  5CUC A;  5DYC A;  4PS5 A;  5DYX A;  3ZYU A;  4NYX A;  5EK9 A;  5CZG A;  5AD3 A;  2DAT A;  5A5P A;  3IU6 A;  3HME A;  3LJW A;  5DFD A;  5C85 A;  5FH6 A;  5E9K A;  3U5L A;  4A9M A;  3LQJ A;  3U5M A;  3U5N A;  4YH4 A;  5TB6 A;  3NXB A;  4NR5 A;  1X0J A;  4UYF B;  5E9M A;  2L85 A;  5DW1 A;  4QC1 A;  5A81 A;  4F3I A;  5ENG A;  5L8T A;  4O76 A;  5JWM A;  4PCE A;  5E73 A;  4CL9 A;  3S91 A;  4WHW A;  3TLP A;  5FE9 A;  5KTX A;  5D0C A;  5F62 A;  3UW9 A;  4QSR A;  4QUT A;  4YBT A;  4MEO A;  5F61 A;  5HEN A;  5BT5 A;  5C89 A;  4J1P A;  4UYD A;  5ACY A;  5J0D A;  2RNY A;  4QR4 A;  5I7Y A;  4N4I A;  4O70 A;  4CUR A;  4YC9 A;  3DWY A;  4Z93 A;  2MJV B;  4BW4 A;  3K2J A;  2YYN A;  4Q0O A;  5E0R A;  4QYD A;  4N4H A;  2RO1 A;  5L97 A;  2LSP B;  5JI8 A;  4XY8 A;  5FG6 A;  4TT4 A;  3JVJ A;  3P1F A;  4OUF A;  2RS9 B;  5HEL A;  4IOO A;  2RNX A;  5G4S A;  5HCL A;  5FG5 A;  4IR5 A;  4TS8 A;  5F1L A;  5F2P A;  4CUU A;  5LVR A;  5FH8 A;  3MUK A;  2E3K A;  2DVS A;  5ENE A;  2I7K A;  5BT4 A;  4IR6 A;  4NR6 A;  4O77 A;  4QYL A;  5C8G A;  4NUC A;  3HMF A;  4J0S A;  5EPB A;  4N4F A;  2YW5 A;  4O7C A;  5EPS A;  5F36 A;  4LR6 A;  4A9N A;  2D82 A;  3D7C A;  5EWW A;  4QB3 A;  4TT2 A;  4BW3 A;  2FSA A;  4Z1Q A;  4ZC9 A;  4QUU A;  3MXF A;  4OGJ A;  5D3T A;  2L84 A;  5FDZ A;  5LVQ A;  1ZS5 A;  2GRC A;  5CTL A;  4TQN A;  2YEK A;  4KCX A;  4OGI A;  4UIU A;  5BT3 A;  4Z6I A;  3I3J A;  3Q2E A;  3JVK A;  2DVQ A;  4A9L A;  5D3R A;  2OO1 A;  4YYG A;  5CQ3 A;  2N9G A;  4UYF A;  5CUG A;  4X2I A;  4TZ8 A;  4YY4 A;  4NQN A;  4QEU A;  4HBW A;  3JVM A;  5LJ2 A;  5EIC A;  4YH3 A;  2DWW A;  4O7A A;  5D3N A;  5HFQ A;  4HBV A;  5II2 A;  4N3W A;  4O7B A;  3SVF A;  4HXS A;  5D7X A;  5KHM A;  4IOR A;  5EP7 A;  5G4R A;  5CUD A;  4ZQL A;  4YYJ A;  4NXJ A;  4ZW1 A;  5CPE A;  3MUL A;  3LQI A;  4YAB A;  5LJ1 A;  3U5O A;  4HXP A;  5HLS A;  4NYW A;  4O7F A;  3QZS A;  4NR9 A;  4UIY A;  5D3J A;  5F1H A;  2R0Y A;  4ALG A;  5DKH A;  3GG3 A;  5F3A A;  4QSX A;  4BJX A;  5E74 A;  4UYE A;  4PKL A;  5D3P A;  4YYH A;  5ETB A;  4LYI A;  2F6N A;  4HXL A;  5CUE A;  5AD2 A;  5A5R A;  5ETD A;  3G0J A;  4YYN A;  4TU4 A;  5A7C A;  5KTU A;  5E7D A;  2R0S A;  4IR3 A;  4YBS A;  5HRW A;  5EGU A;  3UV2 A;  2H60 A;  4Y03 A;  5EPR A;  5FE4 A;  2G4A A;  5FG4 A;  4YYD A;  4O74 A;  4LZ2 A;  3JVL A;  5FFV A;  5DLX A;  4BHW A;  4YYM A;  4NRA A;  4CUQ A;  5HRV A;  4NUD A;  4YAD A;  5CUB A;  4HXK A;  4PCI A;  3AAD A;  4O72 A;  5CQ7 A;  3P1E A;  1WUM A;  5EM3 A;  4LDF A;  4QSP A;  5EIS A;  5CQA A;  4LYW A;  5A5O A;  2E7N A;  4HXR A;  4FLP A; 
#chains in the Genus database with same CATH topology
 5EWC A;  5FE3 A;  4KV1 A;  4YY6 A;  4O78 A;  5HM0 A;  4YK0 A;  5EI4 A;  5DYA A;  5IGL A;  1E6I A;  3IU5 A;  2DVR A;  5ENC A;  4Z1S A;  5AMF A;  5CQ4 A;  5I40 A;  3DAI A;  4XY9 A;  5IG6 A;  4HBY A;  4LZR A;  4AKN A;  3HMH A;  2YQD A;  2YEL A;  3O35 A;  5IBN A;  5KO4 A;  3O37 A;  5C7N A;  5II1 A;  2WP2 A;  4MEN A;  5E9V A;  4QSV A;  5HJC A;  5FE1 A;  5E3D A;  1JSP B;  5HRX A;  3U5J A;  4A9F A;  4A9H A;  5LKU A;  4BW1 A;  4WIV A;  3S92 A;  5A5N A;  3UVY A;  5FFW A;  5I86 A;  4WHU A;  5D26 A;  5E9Y A;  4A9J A;  4CUT A;  5FE5 A;  5C87 A;  5AME A;  5HQ5 A;  5F63 A;  4HXN A;  4O71 A;  5L8U A;  2YDW A;  4MEP A;  3FKM X;  5A5S A;  4Z6H A;  5DX4 A;  5ENJ A;  4MR5 A;  4IOQ A;  5D24 A;  4UYG A;  5FBX A;  3MQM A;  5I88 A;  3O36 A;  4QSS A;  5EU1 A;  5CRZ A;  1F68 A;  3UVD A;  4PY6 A;  4UIX A;  4YYK A;  4AKG A;  5FB1 A;  5FFY A;  4NYV A;  4NR7 A;  5C4Q A;  3O33 A;  4QEV A;  5CGP A;  4QSU A;  4MR6 A;  4XUB A;  2I8N A;  5CS8 A;  5DKD A;  4ALH A;  4TYL A;  4QBM A;  4UYH A;  3UV5 A;  4MR3 A;  5IGK A;  4HBX A;  4O75 A;  3QZV A;  5D3L A;  2L5E A;  4E96 A;  3P1D A;  5COI A;  4AI6 A;  5ENF A;  4QNS A;  4CFK A;  2R0V A;  5ENH A;  4NS5 A;  3MB4 A;  5DY7 A;  4QR5 A;  5IGM A;  5DFC A;  4BW2 A;  2OSS A;  5E9I A;  4C66 A;  2F6J A;  3MB3 A;  4CLB A;  4QZS A;  5I29 A;  5I83 A;  5A83 A;  5LKX A;  3LXJ A;  4QSQ A;  5CRM A;  5DFB A;  3UV4 A;  2D9E A;  3D1B A;  4DON A;  5L96 A;  4A9E A;  4CFL A;  4C67 A;  5HQ6 A;  5IGN A;  4N4G A;  5HFR A;  4QR3 A;  3QZT A;  4NR8 A;  5CQ8 A;  4XYA A;  5EA1 A;  3P5O A;  4HXO A;  5F60 A;  5CQT A;  3O34 A;  5H85 A;  5F25 A;  5DYU A;  5CP5 A;  5EWH A;  4J0R A;  4NRC A;  4QSW A;  5HEM A;  4A9I A;  3P1C A;  5H1T A;  1ZKR A;  4CUS A;  1JM4 B;  5EVA A;  5I89 A;  5EV9 A;  4LYS A;  4XUA A;  4MR4 A;  4UIV A;  5TCM A;  5K29 A;  5FE0 A;  4Q0N A;  5FH7 A;  5HQ7 A;  5LJ0 A;  5LKT A;  1EQF A;  4YAT A;  5KU3 A;  5A5Q A;  5DW2 A;  4TTE A;  2RNW A;  5CUA A;  5D3H A;  3U5P A;  4YAX A;  4AKI A;  3SVG A;  4QC3 A;  3RCW A;  4LRG A;  3UVW A;  4KV4 A;  5D3S A;  4QST A;  5I7X A;  4A9K A;  5ENI A;  4NUE A;  4HXM A;  4YBM A;  5EQ1 A;  4RVR A;  4LZS A;  4NR4 A;  4GPJ A;  5H1V A;  4QEW A;  5E3G A;  5A82 A;  4UIW A;  5KTW A;  5CFW A;  4MEQ A;  5CQ5 A;  2KTB B;  4QY4 A;  5CY9 A;  4NRB A;  5A85 A;  5FB0 A;  5FE7 A;  5F5Z A;  5D25 A;  4NQM A;  3VKH A;  3G0L A;  2WP1 A;  4O7E A;  5L99 A;  5CQ6 A;  5DLZ A;  1WUG A;  4LC2 A;  3AQA A;  3ONI A;  3SVH A;  4UIT A;  4YYI A;  5H1U A;  4CUP A;  5FE2 A;  3Q2F A;  5FE8 A;  5LKZ A;  4PTB A;  2E7O A;  4IR4 A;  3UVX A;  5LUU A;  4J3I A;  5IID A;  2RFJ A;  3LQH A;  5EWV A;  2OUO A;  5ENB A;  5I80 A;  4UIZ A;  2R10 A;  2RI7 A;  4TT6 A;  5EWD A;  5L98 A;  4TZ2 A;  5CU8 A;  5FE6 A;  5I1Q A;  2YEM A;  5DKC A;  4A9O A;  2DVV A;  1N72 A;  5DBM A;  2DKW A;  5E9L A;  3U5K A;  2NXB A;  4TU6 A;  5CUC A;  5DYC A;  4PS5 A;  5DYX A;  3ZYU A;  4NYX A;  5EK9 A;  5CZG A;  5AD3 A;  2DAT A;  5A5P A;  3IU6 A;  3HME A;  3LJW A;  5DFD A;  5C85 A;  5FH6 A;  5E9K A;  3U5L A;  4A9M A;  3LQJ A;  3U5M A;  3U5N A;  4YH4 A;  5TB6 A;  3NXB A;  4NR5 A;  1X0J A;  4UYF B;  5E9M A;  2L85 A;  5DW1 A;  4QC1 A;  5A81 A;  4F3I A;  5ENG A;  5L8T A;  4O76 A;  5JWM A;  4PCE A;  5E73 A;  4CL9 A;  3S91 A;  4WHW A;  3TLP A;  5FE9 A;  5KTX A;  5D0C A;  5F62 A;  3UW9 A;  4QSR A;  4QUT A;  4YBT A;  4MEO A;  5F61 A;  5HEN A;  5BT5 A;  5C89 A;  4J1P A;  4UYD A;  5ACY A;  5J0D A;  2RNY A;  4QR4 A;  5I7Y A;  4N4I A;  4O70 A;  4CUR A;  4YC9 A;  3DWY A;  4Z93 A;  2MJV B;  4BW4 A;  3K2J A;  2YYN A;  4Q0O A;  5E0R A;  4QYD A;  4N4H A;  2RO1 A;  5L97 A;  2LSP B;  5JI8 A;  4XY8 A;  5FG6 A;  4TT4 A;  3JVJ A;  3P1F A;  4OUF A;  2RS9 B;  5HEL A;  4IOO A;  2RNX A;  5G4S A;  5HCL A;  5FG5 A;  4IR5 A;  4TS8 A;  5F1L A;  5F2P A;  4CUU A;  5LVR A;  5FH8 A;  3MUK A;  2E3K A;  2DVS A;  5ENE A;  4AKH A;  2I7K A;  5BT4 A;  4IR6 A;  4NR6 A;  4O77 A;  4QYL A;  5C8G A;  4NUC A;  3HMF A;  4J0S A;  5EPB A;  4N4F A;  2YW5 A;  4O7C A;  5EPS A;  5F36 A;  4LR6 A;  4A9N A;  2D82 A;  3D7C A;  5EWW A;  4QB3 A;  4TT2 A;  4BW3 A;  2FSA A;  4Z1Q A;  4ZC9 A;  4QUU A;  3MXF A;  4OGJ A;  5D3T A;  2L84 A;  5FDZ A;  5LVQ A;  1ZS5 A;  2GRC A;  5CTL A;  4TQN A;  2YEK A;  4KCX A;  4OGI A;  4UIU A;  5BT3 A;  4Z6I A;  3I3J A;  3Q2E A;  3JVK A;  2DVQ A;  4A9L A;  5D3R A;  2OO1 A;  3D1D A;  5CQ3 A;  4YYG A;  2N9G A;  4UYF A;  5CUG A;  4X2I A;  4TZ8 A;  4YY4 A;  4NQN A;  4QEU A;  4HBW A;  3JVM A;  5LJ2 A;  5EIC A;  4YH3 A;  2DWW A;  4O7A A;  5D3N A;  5HFQ A;  4HBV A;  5II2 A;  4N3W A;  4O7B A;  3SVF A;  4HXS A;  5D7X A;  5KHM A;  4IOR A;  5EP7 A;  5G4R A;  5CUD A;  4ZQL A;  4YYJ A;  4NXJ A;  4ZW1 A;  3VKG A;  5CPE A;  3MUL A;  3LQI A;  4YAB A;  5LJ1 A;  3U5O A;  4HXP A;  5HLS A;  4NYW A;  4O7F A;  3QZS A;  4NR9 A;  4UIY A;  5D3J A;  5F1H A;  2R0Y A;  4ALG A;  5DKH A;  3GG3 A;  5F3A A;  4QSX A;  4BJX A;  5E74 A;  4UYE A;  4PKL A;  5D3P A;  4YYH A;  5ETB A;  4LYI A;  2F6N A;  4HXL A;  5CUE A;  5AD2 A;  5A5R A;  5ETD A;  3G0J A;  4YYN A;  4TU4 A;  5A7C A;  5KTU A;  5E7D A;  2R0S A;  4IR3 A;  4YBS A;  5HRW A;  5EGU A;  3UV2 A;  2H60 A;  4Y03 A;  5EPR A;  5FE4 A;  2G4A A;  5FG4 A;  4YYD A;  4O74 A;  4LZ2 A;  3JVL A;  5FFV A;  5DLX A;  3ERR A;  4BHW A;  4YYM A;  4NRA A;  4CUQ A;  5HRV A;  4NUD A;  4YAD A;  5CUB A;  4HXK A;  4PCI A;  2EJN A;  3AAD A;  4O72 A;  5CQ7 A;  3P1E A;  1WUM A;  5EM3 A;  4LDF A;  1PUO A;  4QSP A;  5EIS A;  5CQA A;  4LYW A;  5A5O A;  2E7N A;  4HXR A;  4FLP A; 
#chains in the Genus database with same CATH homology
 5EWC A;  5FE3 A;  4KV1 A;  4YY6 A;  4O78 A;  5HM0 A;  4YK0 A;  5EI4 A;  5DYA A;  5IGL A;  1E6I A;  3IU5 A;  2DVR A;  5ENC A;  4Z1S A;  5AMF A;  5CQ4 A;  5I40 A;  3DAI A;  4XY9 A;  5IG6 A;  4HBY A;  4LZR A;  4AKN A;  3HMH A;  2YQD A;  2YEL A;  3O35 A;  5IBN A;  5KO4 A;  3O37 A;  5C7N A;  5II1 A;  2WP2 A;  4MEN A;  5E9V A;  4QSV A;  5HJC A;  5FE1 A;  5E3D A;  1JSP B;  5HRX A;  3U5J A;  4A9F A;  4A9H A;  5LKU A;  4BW1 A;  4WIV A;  3S92 A;  5A5N A;  3UVY A;  5FFW A;  5I86 A;  4WHU A;  5D26 A;  5E9Y A;  4A9J A;  4CUT A;  5FE5 A;  5C87 A;  5AME A;  5HQ5 A;  5F63 A;  4HXN A;  4O71 A;  5L8U A;  2YDW A;  4MEP A;  3FKM X;  5A5S A;  4Z6H A;  5DX4 A;  5ENJ A;  4MR5 A;  4IOQ A;  5D24 A;  4UYG A;  5FBX A;  3MQM A;  5I88 A;  3O36 A;  4QSS A;  5EU1 A;  5CRZ A;  1F68 A;  3UVD A;  4PY6 A;  4UIX A;  4YYK A;  5FB1 A;  5FFY A;  4NYV A;  4NR7 A;  5C4Q A;  3O33 A;  4QEV A;  5CGP A;  4QSU A;  4MR6 A;  4XUB A;  2I8N A;  5CS8 A;  5DKD A;  4ALH A;  4TYL A;  4QBM A;  4UYH A;  3UV5 A;  4MR3 A;  5IGK A;  4HBX A;  4O75 A;  3QZV A;  5D3L A;  2L5E A;  4E96 A;  3P1D A;  5COI A;  5ENF A;  4QNS A;  4CFK A;  2R0V A;  5ENH A;  4NS5 A;  3MB4 A;  5DY7 A;  4QR5 A;  5IGM A;  5DFC A;  4BW2 A;  2OSS A;  5E9I A;  4C66 A;  2F6J A;  3MB3 A;  4CLB A;  4QZS A;  5I29 A;  5I83 A;  5A83 A;  5LKX A;  3LXJ A;  4QSQ A;  5CRM A;  5DFB A;  3UV4 A;  2D9E A;  4DON A;  5L96 A;  4A9E A;  4CFL A;  4C67 A;  5HQ6 A;  5IGN A;  4N4G A;  5HFR A;  4QR3 A;  3QZT A;  4NR8 A;  5CQ8 A;  4XYA A;  5EA1 A;  3P5O A;  4HXO A;  5F60 A;  5CQT A;  3O34 A;  5H85 A;  5F25 A;  5DYU A;  5CP5 A;  5EWH A;  4J0R A;  4NRC A;  4QSW A;  5HEM A;  4A9I A;  3P1C A;  5H1T A;  4CUS A;  1JM4 B;  5EVA A;  5I89 A;  5EV9 A;  4LYS A;  4XUA A;  4MR4 A;  4UIV A;  5TCM A;  5K29 A;  5FE0 A;  4Q0N A;  5FH7 A;  5HQ7 A;  5LJ0 A;  5LKT A;  1EQF A;  4YAT A;  5KU3 A;  5A5Q A;  5DW2 A;  4TTE A;  2RNW A;  5CUA A;  5D3H A;  3U5P A;  4YAX A;  3SVG A;  4QC3 A;  3RCW A;  4LRG A;  3UVW A;  4KV4 A;  5D3S A;  4QST A;  5I7X A;  4A9K A;  5ENI A;  4NUE A;  4HXM A;  4YBM A;  5EQ1 A;  4RVR A;  4LZS A;  4NR4 A;  4GPJ A;  5H1V A;  4QEW A;  5E3G A;  5A82 A;  4UIW A;  5KTW A;  5CFW A;  4MEQ A;  5CQ5 A;  2KTB B;  4QY4 A;  5CY9 A;  4NRB A;  5A85 A;  5FB0 A;  5FE7 A;  5F5Z A;  5D25 A;  4NQM A;  3G0L A;  2WP1 A;  4O7E A;  5L99 A;  5CQ6 A;  5DLZ A;  1WUG A;  4LC2 A;  3AQA A;  3ONI A;  3SVH A;  4UIT A;  4YYI A;  5H1U A;  4CUP A;  5FE2 A;  3Q2F A;  5FE8 A;  5LKZ A;  4PTB A;  2E7O A;  4IR4 A;  3UVX A;  5LUU A;  4J3I A;  5IID A;  2RFJ A;  3LQH A;  5EWV A;  2OUO A;  5ENB A;  5I80 A;  4UIZ A;  2R10 A;  2RI7 A;  4TT6 A;  5EWD A;  5L98 A;  4TZ2 A;  5CU8 A;  5FE6 A;  5I1Q A;  2YEM A;  5DKC A;  4A9O A;  2DVV A;  1N72 A;  5DBM A;  2DKW A;  5E9L A;  3U5K A;  2NXB A;  4TU6 A;  5CUC A;  5DYC A;  4PS5 A;  5DYX A;  3ZYU A;  4NYX A;  5EK9 A;  5CZG A;  5AD3 A;  2DAT A;  5A5P A;  3IU6 A;  3HME A;  3LJW A;  5DFD A;  5C85 A;  5FH6 A;  5E9K A;  3U5L A;  4A9M A;  3LQJ A;  3U5M A;  3U5N A;  4YH4 A;  5TB6 A;  3NXB A;  4NR5 A;  1X0J A;  4UYF B;  5E9M A;  2L85 A;  5DW1 A;  4QC1 A;  5A81 A;  4F3I A;  5ENG A;  5L8T A;  4O76 A;  5JWM A;  4PCE A;  5E73 A;  4CL9 A;  3S91 A;  4WHW A;  3TLP A;  5FE9 A;  5KTX A;  5D0C A;  5F62 A;  3UW9 A;  4QSR A;  4QUT A;  4YBT A;  4MEO A;  5F61 A;  5HEN A;  5BT5 A;  5C89 A;  4J1P A;  4UYD A;  5ACY A;  5J0D A;  2RNY A;  4QR4 A;  5I7Y A;  4N4I A;  4O70 A;  4CUR A;  4YC9 A;  3DWY A;  4Z93 A;  2MJV B;  4BW4 A;  3K2J A;  2YYN A;  4Q0O A;  5E0R A;  4QYD A;  4N4H A;  2RO1 A;  5L97 A;  2LSP B;  5JI8 A;  4XY8 A;  5FG6 A;  4TT4 A;  3JVJ A;  3P1F A;  4OUF A;  2RS9 B;  5HEL A;  4IOO A;  2RNX A;  5G4S A;  5HCL A;  5FG5 A;  4IR5 A;  4TS8 A;  5F1L A;  5F2P A;  4CUU A;  5LVR A;  5FH8 A;  3MUK A;  2E3K A;  2DVS A;  5ENE A;  2I7K A;  5BT4 A;  4IR6 A;  4NR6 A;  4O77 A;  4QYL A;  5C8G A;  4NUC A;  3HMF A;  4J0S A;  5EPB A;  4N4F A;  2YW5 A;  4O7C A;  5EPS A;  5F36 A;  4LR6 A;  4A9N A;  2D82 A;  3D7C A;  5EWW A;  4QB3 A;  4TT2 A;  4BW3 A;  2FSA A;  4Z1Q A;  4ZC9 A;  4QUU A;  3MXF A;  4OGJ A;  5D3T A;  2L84 A;  5FDZ A;  5LVQ A;  1ZS5 A;  2GRC A;  5CTL A;  4TQN A;  2YEK A;  4KCX A;  4OGI A;  4UIU A;  5BT3 A;  4Z6I A;  3I3J A;  3Q2E A;  3JVK A;  2DVQ A;  4A9L A;  5D3R A;  2OO1 A;  4YYG A;  5CQ3 A;  2N9G A;  4UYF A;  5CUG A;  4X2I A;  4TZ8 A;  4YY4 A;  4NQN A;  4QEU A;  4HBW A;  3JVM A;  5LJ2 A;  5EIC A;  4YH3 A;  2DWW A;  4O7A A;  5D3N A;  5HFQ A;  4HBV A;  5II2 A;  4N3W A;  4O7B A;  3SVF A;  4HXS A;  5D7X A;  5KHM A;  4IOR A;  5EP7 A;  5G4R A;  5CUD A;  4ZQL A;  4YYJ A;  4NXJ A;  4ZW1 A;  5CPE A;  3MUL A;  3LQI A;  4YAB A;  5LJ1 A;  3U5O A;  4HXP A;  5HLS A;  4NYW A;  4O7F A;  3QZS A;  4NR9 A;  4UIY A;  5D3J A;  5F1H A;  2R0Y A;  4ALG A;  5DKH A;  3GG3 A;  5F3A A;  4QSX A;  4BJX A;  5E74 A;  4UYE A;  4PKL A;  5D3P A;  4YYH A;  5ETB A;  4LYI A;  2F6N A;  4HXL A;  5CUE A;  5AD2 A;  5A5R A;  5ETD A;  3G0J A;  4YYN A;  4TU4 A;  5A7C A;  5KTU A;  5E7D A;  2R0S A;  4IR3 A;  4YBS A;  5HRW A;  5EGU A;  3UV2 A;  2H60 A;  4Y03 A;  5EPR A;  5FE4 A;  2G4A A;  5FG4 A;  4YYD A;  4O74 A;  4LZ2 A;  3JVL A;  5FFV A;  5DLX A;  4BHW A;  4YYM A;  4NRA A;  4CUQ A;  5HRV A;  4NUD A;  4YAD A;  5CUB A;  4HXK A;  4PCI A;  3AAD A;  4O72 A;  5CQ7 A;  3P1E A;  1WUM A;  5EM3 A;  4LDF A;  4QSP A;  5EIS A;  5CQA A;  4LYW A;  5A5O A;  2E7N A;  4HXR A;  4FLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...