3Q2EA

Crystal structure of the second bromodomain of human bromodomain and wd repeat-containing protein 1 isoform a (wdr9)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
107
structure length
107
Chain Sequence
NWKKQCKELVNLIFQCEDSEPFRQPVDLVEYPDYRDIIDTPMDFGTVRETLDAGNYDSPLEFCKDIRLIFSNAKAYTPNKRSKIYSMTLRLSALFEEKMKKISSDFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain and WD repeat-containing protein 1
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 41
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3q2eA00
5DFCA 5FB1A 2YW5A 1JM4B 5TB6A 4YK0A 4NXJA 3DWYA 3JVKA 5EU1A 4E96A 4Z1QA 1JSPB 4NR7A 5D3PA 5CUGA 5DKHA 2KTBB 4NRBA 4ZC9A 2OO1A 4A9NA 2D82A 5FFWA 4CUQA 4IR6A 4CUUA 5FE3A 4BW3A 5EK9A 2DVSA 5E9IA 2DATA 4QBMA 2RO1A 5LJ0A 2L85A 4CFKA 5JI8A 2D9EA 4YATA 2GRCA 4XY8A 5F1LA 4J1PA 3P1CA 4NRCA 3O36A 2RS9B 4CLBA 4N4GA 3QZSA 3IU6A 5A82A 5FE7A 4QEUA 4Y03A 5ENBA 5FDZA 5LKXA 5AMFA 5EPBA 5C85A 4GPJA 3U5OA 3JVMA 4A9IA 5AD2A 1E6IA 5LKZA 5D3JA 4QSWA 4NUEA 5I7XA 4CUSA 4DONA 5CRMA 5ETBA 4YY6A 4TS8A 5C8GA 2YEMA 4NS5A 4YAXA 2YQDA 2DKWA 3Q2FA 4O7CA 4TU4A 3U5NA 5FG6A 5LVRA 4J0RA 5C87A 5II2A 5D3HA 5K29A 5I80A 4UIWA 5FH6A 5HM0A 4YYGA 3O34A 4QYDA 5CQ8A 4YYIA 5CQ7A 4RVRA 4LRGA 5EICA 5I29A 2I7KA 3U5PA 5CUDA 4Z6IA 2FSAA 5CUEA 4UYFB 5E0RA 3UVXA 4N4HA 5I1QA 4XUBA 2R0YA 4NR6A 5ENCA 4IOOA 5FB0A 5HLSA 3MQMA 4MEOA 5L99A 5FE8A 4QSPA 2F6NA 5ENHA 5FH7A 3S92A 4QC3A 5DKCA 2F6JA 5BT4A 5CP5A 5HQ5A 4QY4A 5DLZA 4UIZA 2YELA 5ENGA 2R0SA 5E73A 4CUTA 5A5PA 5D7XA 1X0JA 4NQMA 5G4RA 5DYXA 4HXSA 4LZ2A 5C89A 3UV5A 3LJWA 4MENA 5E9YA 4KCXA 3D7CA 4ALHA 3HMEA 5FG5A 3UV4A 5HJCA 4Z6HA 5EP7A 5F36A 3U5MA 4J3IA 5HRXA 5FFVA 4NR5A 5G4SA 4LYWA 4OUFA 5EQ1A 5DFDA 4A9OA 5A5RA 4QSVA 5I83A 5EPSA 4YABA 5EA1A 3DAIA 4WHUA 5HELA 3O37A 5F60A 5CQAA 4Q0OA 4QR5A 4KV4A 5DKDA 3U5LA 4QSXA 5L8TA 4OGJA 4A9EA 5FE5A 5CZGA 4O71A 5KTWA 3MB4A 4O75A 5EWCA 5D3SA 4O7BA 5CY9A 5ENEA 5IIDA 5D3NA 4TU6A 5L98A 5ACYA 3P1DA 4IR4A 4Q0NA 4A9MA 3I3JA 5FE6A 3ZYUA 2E7OA 4YH4A 4YH3A 5CUAA 4J0SA 4A9JA 5F2PA 5A5OA 4PKLA 5LJ2A 5E9MA 4QSSA 4TZ2A 4QUUA 2E7NA 4C67A 5FE2A 5EGUA 2NXBA 4O72A 5HFRA 5E3DA 3GG3A 4KV1A 4PCIA 5FH8A 4Z93A 4BW2A 4YC9A 5LJ1A 4LZRA 3MXFA 4HBWA 2YYNA 5I89A 1ZS5A 4YBSA 5EWHA 3UVYA 4NUCA 3TLPA 4QR4A 5IGMA 4CL9A 3G0JA 1WUGA 4MR6A 5CQ4A 5DX4A 4O70A 4A9HA 2RNYA 4O77A 5CGPA 5CTLA 5CQTA 3UVWA 3S91A 4TT2A 5E9LA 5EWVA 4MR3A 2YEKA 2DWWA 4LDFA 5H1TA 2WP1A 3QZTA 3LQJA 5J0DA 2LSPB 4QZSA 5LKTA 3UV2A 3JVLA 5HQ6A 4YYKA 4N3WA 4XYAA 5D24A 5DW2A 4PTBA 5ETDA 4A9LA 4NYVA 2WP2A 1F68A 3O33A 5EVAA 5I7YA 5FG4A 4TZ8A 2G4AA 5A5QA 4UYHA 4UYEA 5FE1A 4A9FA 4QSRA 4QUTA 2RFJA 4X2IA 5IGNA 4AKNA 5CQ5A 5DBMA 5EPRA 5DY7A 4CUPA 3HMHA 5IGKA 4O78A 4TTEA 5LKUA 5CQ3A 4LR6A 5CFWA 4XUAA 2RI7A 4HXLA 3IU5A 2RNXA 5A83A 4YYNA 2OSSA 4UITA 5DYAA 4NYXA 5EWDA 3SVFA 4CURA 4NRAA 4MEQA 1WUMA 5DLXA 5KTXA 4WIVA 5KTUA 5AD3A 3LQIA 5CUCA 5H1VA 3P5OA 3K2JA 2OUOA 5F61A 5A85A 4BW4A 3MB3A 2L5EA 4HBXA 5COIA 5I40A 5I88A 2DVRA 3U5JA 5E74A 5D0CA 3SVGA 4WHWA 5A81A 4IR3A 5ENJA 5KO4A 4BJXA 3LQHA 4PY6A 5I86A 4YYJA 3JVJA 5A5SA 5IBNA 5HQ7A 4YBMA 4HXNA 5ENIA 4QNSA 2L84A 5DYUA 4Z1SA 4LC2A 3NXBA 5E3GA 4IORA 5CQ6A 4NR9A 5DYCA 5L97A 3AQAA 5AMEA 3HMFA 4IOQA 3P1EA 4UIXA 4QR3A 4QSUA 3O35A 4QB3A 4N4FA 5II1A 5E9VA 5CPEA 4MEPA 4NR4A 4QEVA 5D3TA 4ALGA 4UYFA 4FLPA 5FFYA 5HCLA 4HXRA 4HXPA 4LZSA 5FE9A 5DFBA 5FE4A 2YDWA 4XY9A 4HXOA 4LYSA 5HFQA 4N4IA 4QSQA 5BT5A 5F62A 3MULA 5EM3A 2MJVB 2DVVA 4QYLA 5D3LA 3U5KA 4C66A 4CFLA 2N9GA 5F5ZA 5BT3A 4YADA 4YYMA 5IG6A 5HENA 1EQFA 4ZW1A 5F3AA 1N72A 5CUBA 4A9KA 5KU3A 2R10A 4BW1A 4BHWA 4TT6A 5F1HA 4UYDA 5JWMA 4UIVA 4HXKA 4O74A 5E9KA 5HEMA 3MUKA 2E3KA 5KHMA 3RCWA 5FBXA 4TT4A 4HBYA 4O7FA 5D26A 4UYGA 5IGLA 4ZQLA 3UVDA 5D25A 3QZVA 3P1FA 5L8UA 2H60A 3UW9A 5EV9A 5A5NA 4OGIA 5F25A 5DW1A 5TCMA 4UIUA 5LVQA 3AADA 3FKMX 4IR5A 4NR8A 5FE0A 4PCEA 2R0VA 5E7DA 5ENFA 3SVHA 3LXJA 4YBTA 5CU8A 4YY4A 3G0LA 4LYIA 4NUDA 4NYWA 4QC1A 5H1UA 5HRVA 4NQNA 4F3IA 2I8NA 4O7EA 2RNWA 4PS5A 4TQNA 4UIYA 2DVQA 5EISA 5LUUA 4YYDA 5HRWA 5D3RA 5EWWA 4QSTA 4TYLA 5C4QA 4HXMA 4HBVA 5CRZA 5L96A 3Q2EA 4O7AA 5CS8A 3ONIA 5EI4A 5H85A 5A7CA 4YYHA 4QEWA 5C7NA 4MR5A 4MR4A 4O76A 5F63A
chains in the Genus database with same CATH superfamily
5DFCA 5FB1A 2YW5A 1JM4B 5TB6A 4YK0A 4NXJA 3DWYA 3JVKA 5EU1A 4E96A 4Z1QA 1JSPB 4NR7A 5D3PA 5CUGA 5DKHA 2KTBB 4NRBA 4ZC9A 2OO1A 4A9NA 2D82A 5FFWA 4CUQA 4IR6A 4CUUA 5FE3A 4BW3A 5EK9A 2DVSA 5E9IA 2DATA 4QBMA 2RO1A 5LJ0A 2L85A 4CFKA 5JI8A 2D9EA 4YATA 2GRCA 4XY8A 3D1DA 5F1LA 4J1PA 3P1CA 4NRCA 3O36A 2RS9B 4CLBA 4N4GA 3QZSA 3IU6A 5A82A 5FE7A 4QEUA 3ERRA 4Y03A 5ENBA 5FDZA 5LKXA 5AMFA 5EPBA 5C85A 4GPJA 3U5OA 3JVMA 4A9IA 5AD2A 1E6IA 5LKZA 5D3JA 4QSWA 4NUEA 5I7XA 4CUSA 4DONA 5CRMA 5ETBA 4YY6A 4TS8A 5C8GA 2YEMA 4NS5A 4YAXA 2YQDA 2DKWA 3Q2FA 4O7CA 4TU4A 3U5NA 4AKHA 5FG6A 5LVRA 4J0RA 5C87A 5II2A 5D3HA 5K29A 5I80A 4UIWA 5FH6A 5HM0A 2EJNA 4YYGA 3O34A 4QYDA 5CQ8A 4YYIA 5CQ7A 4RVRA 4LRGA 5EICA 5I29A 2I7KA 3U5PA 5CUDA 4Z6IA 2FSAA 5CUEA 4UYFB 5E0RA 3UVXA 4N4HA 5I1QA 4XUBA 2R0YA 4NR6A 5ENCA 4IOOA 5FB0A 5HLSA 3MQMA 4MEOA 5L99A 5FE8A 4QSPA 2F6NA 5ENHA 5FH7A 3S92A 4QC3A 5DKCA 2F6JA 5BT4A 5CP5A 5HQ5A 4QY4A 5DLZA 4UIZA 2YELA 5ENGA 2R0SA 5E73A 4CUTA 5A5PA 5D7XA 1ZKRA 1X0JA 4NQMA 5G4RA 5DYXA 4HXSA 4LZ2A 5C89A 3UV5A 3LJWA 4MENA 5E9YA 4KCXA 3D7CA 4ALHA 3HMEA 5FG5A 3UV4A 5HJCA 4Z6HA 5EP7A 5F36A 3U5MA 4J3IA 5HRXA 5FFVA 4NR5A 5G4SA 4LYWA 4OUFA 5EQ1A 5DFDA 4A9OA 5A5RA 4QSVA 5I83A 5EPSA 4YABA 5EA1A 3DAIA 4WHUA 5HELA 3O37A 5F60A 5CQAA 4Q0OA 4QR5A 4KV4A 4AKGA 3VKGA 5DKDA 3U5LA 4QSXA 5L8TA 4OGJA 4A9EA 5FE5A 5CZGA 4O71A 5KTWA 3MB4A 4O75A 5EWCA 5D3SA 4O7BA 5CY9A 1PUOA 5ENEA 5IIDA 5D3NA 4TU6A 5L98A 5ACYA 3P1DA 4IR4A 4Q0NA 4A9MA 3I3JA 5FE6A 3ZYUA 2E7OA 4YH4A 4YH3A 5CUAA 4J0SA 4A9JA 5F2PA 5A5OA 4PKLA 5LJ2A 5E9MA 4QSSA 4TZ2A 4QUUA 2E7NA 4C67A 5FE2A 5EGUA 2NXBA 4O72A 5HFRA 5E3DA 3GG3A 4KV1A 4PCIA 5FH8A 4Z93A 4BW2A 4YC9A 5LJ1A 4LZRA 3MXFA 4HBWA 2YYNA 5I89A 1ZS5A 4YBSA 5EWHA 3UVYA 4NUCA 3TLPA 4QR4A 5IGMA 4CL9A 3G0JA 1WUGA 4MR6A 5CQ4A 5DX4A 4O70A 4A9HA 2RNYA 4O77A 5CGPA 5CTLA 5CQTA 3UVWA 3S91A 4TT2A 5E9LA 5EWVA 3D1BA 4MR3A 2YEKA 2DWWA 4LDFA 5H1TA 2WP1A 3QZTA 3LQJA 5J0DA 2LSPB 4QZSA 5LKTA 3UV2A 3JVLA 5HQ6A 4YYKA 4N3WA 4XYAA 5D24A 5DW2A 4PTBA 5ETDA 4A9LA 4NYVA 2WP2A 1F68A 3O33A 5EVAA 5I7YA 5FG4A 4TZ8A 2G4AA 5A5QA 4UYHA 4UYEA 5FE1A 4A9FA 4QSRA 4QUTA 2RFJA 4X2IA 5IGNA 4AKNA 5CQ5A 5DBMA 5EPRA 5DY7A 4CUPA 3HMHA 5IGKA 4O78A 4TTEA 5LKUA 5CQ3A 4LR6A 5CFWA 4XUAA 2RI7A 4HXLA 3IU5A 2RNXA 5A83A 4YYNA 2OSSA 4UITA 5DYAA 4NYXA 5EWDA 3SVFA 4CURA 4NRAA 4MEQA 1WUMA 5DLXA 5KTXA 4WIVA 5KTUA 5AD3A 3LQIA 5CUCA 5H1VA 3P5OA 3K2JA 2OUOA 5F61A 5A85A 4BW4A 3MB3A 2L5EA 4HBXA 5COIA 5I40A 5I88A 2DVRA 3U5JA 5E74A 5D0CA 3SVGA 4WHWA 5A81A 4IR3A 5ENJA 5KO4A 4BJXA 3LQHA 4PY6A 5I86A 4YYJA 3JVJA 5A5SA 5IBNA 5HQ7A 4YBMA 4HXNA 5ENIA 4QNSA 2L84A 5DYUA 4Z1SA 4LC2A 3NXBA 5E3GA 4IORA 5CQ6A 4NR9A 5DYCA 5L97A 3AQAA 5AMEA 3HMFA 4IOQA 3P1EA 4UIXA 4QR3A 4QSUA 3O35A 4QB3A 4N4FA 5II1A 5E9VA 5CPEA 4MEPA 4NR4A 4QEVA 5D3TA 4ALGA 4UYFA 4FLPA 5FFYA 5HCLA 4HXRA 4HXPA 4LZSA 5FE9A 5DFBA 5FE4A 2YDWA 4XY9A 4HXOA 4LYSA 5HFQA 4N4IA 4QSQA 5BT5A 5F62A 3MULA 4AKIA 5EM3A 2MJVB 2DVVA 4QYLA 5D3LA 3U5KA 4C66A 4CFLA 2N9GA 5F5ZA 5BT3A 4YADA 4YYMA 5IG6A 5HENA 4AI6A 1EQFA 4ZW1A 5F3AA 1N72A 5CUBA 4A9KA 5KU3A 2R10A 4BW1A 4BHWA 4TT6A 5F1HA 4UYDA 5JWMA 4UIVA 4HXKA 4O74A 5E9KA 5HEMA 3MUKA 2E3KA 5KHMA 3RCWA 5FBXA 4TT4A 4HBYA 4O7FA 5D26A 4UYGA 5IGLA 4ZQLA 3UVDA 5D25A 3QZVA 3P1FA 5L8UA 2H60A 3UW9A 5EV9A 5A5NA 4OGIA 5F25A 5DW1A 5TCMA 4UIUA 5LVQA 3AADA 3FKMX 4IR5A 4NR8A 5FE0A 4PCEA 2R0VA 5E7DA 5ENFA 3SVHA 3LXJA 4YBTA 5CU8A 4YY4A 3G0LA 4LYIA 4NUDA 4NYWA 4QC1A 5H1UA 5HRVA 4NQNA 3VKHA 4F3IA 2I8NA 4O7EA 2RNWA 4PS5A 4TQNA 4UIYA 2DVQA 5EISA 5LUUA 4YYDA 5HRWA 5D3RA 5EWWA 4QSTA 4TYLA 5C4QA 4HXMA 4HBVA 5CRZA 5L96A 3Q2EA 4O7AA 5CS8A 3ONIA 5EI4A 5H85A 5A7CA 4YYHA 4QEWA 5C7NA 4MR5A 4MR4A 4O76A 5F63A
chains in the Genus database with same CATH topology
5DFCA 5FB1A 2YW5A 1JM4B 5TB6A 4YK0A 4NXJA 3DWYA 3JVKA 5EU1A 4E96A 4Z1QA 1JSPB 4NR7A 5D3PA 5CUGA 5DKHA 2KTBB 4NRBA 4ZC9A 2OO1A 4A9NA 2D82A 5FFWA 4CUQA 4IR6A 4CUUA 5FE3A 4BW3A 5EK9A 2DVSA 5E9IA 2DATA 4QBMA 2RO1A 5LJ0A 2L85A 4CFKA 5JI8A 2D9EA 4YATA 2GRCA 4XY8A 5F1LA 4J1PA 3P1CA 4NRCA 3O36A 2RS9B 4CLBA 4N4GA 3QZSA 3IU6A 5A82A 5FE7A 4QEUA 4Y03A 5ENBA 5FDZA 5LKXA 5AMFA 5EPBA 5C85A 4GPJA 3U5OA 3JVMA 4A9IA 5AD2A 1E6IA 5LKZA 5D3JA 4QSWA 4NUEA 5I7XA 4CUSA 4DONA 5CRMA 5ETBA 4YY6A 4TS8A 5C8GA 2YEMA 4NS5A 4YAXA 2YQDA 2DKWA 3Q2FA 4O7CA 4TU4A 3U5NA 5FG6A 5LVRA 4J0RA 5C87A 5II2A 5D3HA 5K29A 5I80A 4UIWA 5FH6A 5HM0A 4YYGA 3O34A 4QYDA 5CQ8A 4YYIA 5CQ7A 4RVRA 4LRGA 5EICA 5I29A 2I7KA 3U5PA 5CUDA 4Z6IA 2FSAA 5CUEA 4UYFB 5E0RA 3UVXA 4N4HA 5I1QA 4XUBA 2R0YA 4NR6A 5ENCA 4IOOA 5FB0A 5HLSA 3MQMA 4MEOA 5L99A 5FE8A 4QSPA 2F6NA 5ENHA 5FH7A 3S92A 4QC3A 5DKCA 2F6JA 5BT4A 5CP5A 5HQ5A 4QY4A 5DLZA 4UIZA 2YELA 5ENGA 2R0SA 5E73A 4CUTA 5A5PA 5D7XA 1X0JA 4NQMA 5G4RA 5DYXA 4HXSA 4LZ2A 5C89A 3UV5A 3LJWA 4MENA 5E9YA 4KCXA 3D7CA 4ALHA 3HMEA 5FG5A 3UV4A 5HJCA 4Z6HA 5EP7A 5F36A 3U5MA 4J3IA 5HRXA 5FFVA 4NR5A 5G4SA 4LYWA 4OUFA 5EQ1A 5DFDA 4A9OA 5A5RA 4QSVA 5I83A 5EPSA 4YABA 5EA1A 3DAIA 4WHUA 5HELA 3O37A 5F60A 5CQAA 4Q0OA 4QR5A 4KV4A 5DKDA 3U5LA 4QSXA 5L8TA 4OGJA 4A9EA 5FE5A 5CZGA 4O71A 5KTWA 3MB4A 4O75A 5EWCA 5D3SA 4O7BA 5CY9A 5ENEA 5IIDA 5D3NA 4TU6A 5L98A 5ACYA 3P1DA 4IR4A 4Q0NA 4A9MA 3I3JA 5FE6A 3ZYUA 2E7OA 4YH4A 4YH3A 5CUAA 4J0SA 4A9JA 5F2PA 5A5OA 4PKLA 5LJ2A 5E9MA 4QSSA 4TZ2A 4QUUA 2E7NA 4C67A 5FE2A 5EGUA 2NXBA 4O72A 5HFRA 5E3DA 3GG3A 4KV1A 4PCIA 5FH8A 4Z93A 4BW2A 4YC9A 5LJ1A 4LZRA 3MXFA 4HBWA 2YYNA 5I89A 1ZS5A 4YBSA 5EWHA 3UVYA 4NUCA 3TLPA 4QR4A 5IGMA 4CL9A 3G0JA 1WUGA 4MR6A 5CQ4A 5DX4A 4O70A 4A9HA 2RNYA 4O77A 5CGPA 5CTLA 5CQTA 3UVWA 3S91A 4TT2A 5E9LA 5EWVA 4MR3A 2YEKA 2DWWA 4LDFA 5H1TA 2WP1A 3QZTA 3LQJA 5J0DA 2LSPB 4QZSA 5LKTA 3UV2A 3JVLA 5HQ6A 4YYKA 4N3WA 4XYAA 5D24A 5DW2A 4PTBA 5ETDA 4A9LA 4NYVA 2WP2A 1F68A 3O33A 5EVAA 5I7YA 5FG4A 4TZ8A 2G4AA 5A5QA 4UYHA 4UYEA 5FE1A 4A9FA 4QSRA 4QUTA 2RFJA 4X2IA 5IGNA 4AKNA 5CQ5A 5DBMA 5EPRA 5DY7A 4CUPA 3HMHA 5IGKA 4O78A 4TTEA 5LKUA 5CQ3A 4LR6A 5CFWA 4XUAA 2RI7A 4HXLA 3IU5A 2RNXA 5A83A 4YYNA 2OSSA 4UITA 5DYAA 4NYXA 5EWDA 3SVFA 4CURA 4NRAA 4MEQA 1WUMA 5DLXA 5KTXA 4WIVA 5KTUA 5AD3A 3LQIA 5CUCA 5H1VA 3P5OA 3K2JA 2OUOA 5F61A 5A85A 4BW4A 3MB3A 2L5EA 4HBXA 5COIA 5I40A 5I88A 2DVRA 3U5JA 5E74A 5D0CA 3SVGA 4WHWA 5A81A 4IR3A 5ENJA 5KO4A 4BJXA 3LQHA 4PY6A 5I86A 4YYJA 3JVJA 5A5SA 5IBNA 5HQ7A 4YBMA 4HXNA 5ENIA 4QNSA 2L84A 5DYUA 4Z1SA 4LC2A 3NXBA 5E3GA 4IORA 5CQ6A 4NR9A 5DYCA 5L97A 3AQAA 5AMEA 3HMFA 4IOQA 3P1EA 4UIXA 4QR3A 4QSUA 3O35A 4QB3A 4N4FA 5II1A 5E9VA 5CPEA 4MEPA 4NR4A 4QEVA 5D3TA 4ALGA 4UYFA 4FLPA 5FFYA 5HCLA 4HXRA 4HXPA 4LZSA 5FE9A 5DFBA 5FE4A 2YDWA 4XY9A 4HXOA 4LYSA 5HFQA 4N4IA 4QSQA 5BT5A 5F62A 3MULA 5EM3A 2MJVB 2DVVA 4QYLA 5D3LA 3U5KA 4C66A 4CFLA 2N9GA 5F5ZA 5BT3A 4YADA 4YYMA 5IG6A 5HENA 1EQFA 4ZW1A 5F3AA 1N72A 5CUBA 4A9KA 5KU3A 2R10A 4BW1A 4BHWA 4TT6A 5F1HA 4UYDA 5JWMA 4UIVA 4HXKA 4O74A 5E9KA 5HEMA 3MUKA 2E3KA 5KHMA 3RCWA 5FBXA 4TT4A 4HBYA 4O7FA 5D26A 4UYGA 5IGLA 4ZQLA 3UVDA 5D25A 3QZVA 3P1FA 5L8UA 2H60A 3UW9A 5EV9A 5A5NA 4OGIA 5F25A 5DW1A 5TCMA 4UIUA 5LVQA 3AADA 3FKMX 4IR5A 4NR8A 5FE0A 4PCEA 2R0VA 5E7DA 5ENFA 3SVHA 3LXJA 4YBTA 5CU8A 4YY4A 3G0LA 4LYIA 4NUDA 4NYWA 4QC1A 5H1UA 5HRVA 4NQNA 4F3IA 2I8NA 4O7EA 2RNWA 4PS5A 4TQNA 4UIYA 2DVQA 5EISA 5LUUA 4YYDA 5HRWA 5D3RA 5EWWA 4QSTA 4TYLA 5C4QA 4HXMA 4HBVA 5CRZA 5L96A 3Q2EA 4O7AA 5CS8A 3ONIA 5EI4A 5H85A 5A7CA 4YYHA 4QEWA 5C7NA 4MR5A 4MR4A 4O76A 5F63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DFC A;  5FB1 A;  2YW5 A;  1JM4 B;  5TB6 A;  4YK0 A;  4NXJ A;  3DWY A;  3JVK A;  5EU1 A;  4E96 A;  4Z1Q A;  1JSP B;  4NR7 A;  5D3P A;  5CUG A;  5DKH A;  2KTB B;  4NRB A;  4ZC9 A;  2OO1 A;  4A9N A;  2D82 A;  5FFW A;  4CUQ A;  4IR6 A;  4CUU A;  5FE3 A;  4BW3 A;  5EK9 A;  2DVS A;  5E9I A;  2DAT A;  4QBM A;  2RO1 A;  5LJ0 A;  2L85 A;  4CFK A;  5JI8 A;  2D9E A;  4YAT A;  2GRC A;  4XY8 A;  5F1L A;  4J1P A;  3P1C A;  4NRC A;  3O36 A;  2RS9 B;  4CLB A;  4N4G A;  3QZS A;  3IU6 A;  5A82 A;  5FE7 A;  4QEU A;  4Y03 A;  5ENB A;  5FDZ A;  5LKX A;  5AMF A;  5EPB A;  5C85 A;  4GPJ A;  3U5O A;  3JVM A;  4A9I A;  5AD2 A;  1E6I A;  5LKZ A;  5D3J A;  4QSW A;  4NUE A;  5I7X A;  4CUS A;  4DON A;  5CRM A;  5ETB A;  4YY6 A;  4TS8 A;  5C8G A;  2YEM A;  4NS5 A;  4YAX A;  2YQD A;  2DKW A;  3Q2F A;  4O7C A;  4TU4 A;  3U5N A;  5FG6 A;  5LVR A;  4J0R A;  5C87 A;  5II2 A;  5D3H A;  5K29 A;  5I80 A;  4UIW A;  5FH6 A;  5HM0 A;  4YYG A;  3O34 A;  4QYD A;  5CQ8 A;  4YYI A;  5CQ7 A;  4RVR A;  4LRG A;  5EIC A;  5I29 A;  2I7K A;  3U5P A;  5CUD A;  4Z6I A;  2FSA A;  5CUE A;  4UYF B;  5E0R A;  3UVX A;  4N4H A;  5I1Q A;  4XUB A;  2R0Y A;  4NR6 A;  5ENC A;  4IOO A;  5FB0 A;  5HLS A;  3MQM A;  4MEO A;  5L99 A;  5FE8 A;  4QSP A;  2F6N A;  5ENH A;  5FH7 A;  3S92 A;  4QC3 A;  5DKC A;  2F6J A;  5BT4 A;  5CP5 A;  5HQ5 A;  4QY4 A;  5DLZ A;  4UIZ A;  2YEL A;  5ENG A;  2R0S A;  5E73 A;  4CUT A;  5A5P A;  5D7X A;  1X0J A;  4NQM A;  5G4R A;  5DYX A;  4HXS A;  4LZ2 A;  5C89 A;  3UV5 A;  3LJW A;  4MEN A;  5E9Y A;  4KCX A;  3D7C A;  4ALH A;  3HME A;  5FG5 A;  3UV4 A;  5HJC A;  4Z6H A;  5EP7 A;  5F36 A;  3U5M A;  4J3I A;  5HRX A;  5FFV A;  4NR5 A;  5G4S A;  4LYW A;  4OUF A;  5EQ1 A;  5DFD A;  4A9O A;  5A5R A;  4QSV A;  5I83 A;  5EPS A;  4YAB A;  5EA1 A;  3DAI A;  4WHU A;  5HEL A;  3O37 A;  5F60 A;  5CQA A;  4Q0O A;  4QR5 A;  4KV4 A;  5DKD A;  3U5L A;  4QSX A;  5L8T A;  4OGJ A;  4A9E A;  5FE5 A;  5CZG A;  4O71 A;  5KTW A;  3MB4 A;  4O75 A;  5EWC A;  5D3S A;  4O7B A;  5CY9 A;  5ENE A;  5IID A;  5D3N A;  4TU6 A;  5L98 A;  5ACY A;  3P1D A;  4IR4 A;  4Q0N A;  4A9M A;  3I3J A;  5FE6 A;  3ZYU A;  2E7O A;  4YH4 A;  4YH3 A;  5CUA A;  4J0S A;  4A9J A;  5F2P A;  5A5O A;  4PKL A;  5LJ2 A;  5E9M A;  4QSS A;  4TZ2 A;  4QUU A;  2E7N A;  4C67 A;  5FE2 A;  5EGU A;  2NXB A;  4O72 A;  5HFR A;  5E3D A;  3GG3 A;  4KV1 A;  4PCI A;  5FH8 A;  4Z93 A;  4BW2 A;  4YC9 A;  5LJ1 A;  4LZR A;  3MXF A;  4HBW A;  2YYN A;  5I89 A;  1ZS5 A;  4YBS A;  5EWH A;  3UVY A;  4NUC A;  3TLP A;  4QR4 A;  5IGM A;  4CL9 A;  3G0J A;  1WUG A;  4MR6 A;  5CQ4 A;  5DX4 A;  4O70 A;  4A9H A;  2RNY A;  4O77 A;  5CGP A;  5CTL A;  5CQT A;  3UVW A;  3S91 A;  4TT2 A;  5E9L A;  5EWV A;  4MR3 A;  2YEK A;  2DWW A;  4LDF A;  5H1T A;  2WP1 A;  3QZT A;  3LQJ A;  5J0D A;  2LSP B;  4QZS A;  5LKT A;  3UV2 A;  3JVL A;  5HQ6 A;  4YYK A;  4N3W A;  4XYA A;  5D24 A;  5DW2 A;  4PTB A;  5ETD A;  4A9L A;  4NYV A;  2WP2 A;  1F68 A;  3O33 A;  5EVA A;  5I7Y A;  5FG4 A;  4TZ8 A;  2G4A A;  5A5Q A;  4UYH A;  4UYE A;  5FE1 A;  4A9F A;  4QSR A;  4QUT A;  2RFJ A;  4X2I A;  5IGN A;  4AKN A;  5CQ5 A;  5DBM A;  5EPR A;  5DY7 A;  4CUP A;  3HMH A;  5IGK A;  4O78 A;  4TTE A;  5LKU A;  5CQ3 A;  4LR6 A;  5CFW A;  4XUA A;  2RI7 A;  4HXL A;  3IU5 A;  2RNX A;  5A83 A;  4YYN A;  2OSS A;  4UIT A;  5DYA A;  4NYX A;  5EWD A;  3SVF A;  4CUR A;  4NRA A;  4MEQ A;  1WUM A;  5DLX A;  5KTX A;  4WIV A;  5KTU A;  5AD3 A;  3LQI A;  5CUC A;  5H1V A;  3P5O A;  3K2J A;  2OUO A;  5F61 A;  5A85 A;  4BW4 A;  3MB3 A;  2L5E A;  4HBX A;  5COI A;  5I40 A;  5I88 A;  2DVR A;  3U5J A;  5E74 A;  5D0C A;  3SVG A;  4WHW A;  5A81 A;  4IR3 A;  5ENJ A;  5KO4 A;  4BJX A;  3LQH A;  4PY6 A;  5I86 A;  4YYJ A;  3JVJ A;  5A5S A;  5IBN A;  5HQ7 A;  4YBM A;  4HXN A;  5ENI A;  4QNS A;  2L84 A;  5DYU A;  4Z1S A;  4LC2 A;  3NXB A;  5E3G A;  4IOR A;  5CQ6 A;  4NR9 A;  5DYC A;  5L97 A;  3AQA A;  5AME A;  3HMF A;  4IOQ A;  3P1E A;  4UIX A;  4QR3 A;  4QSU A;  3O35 A;  4QB3 A;  4N4F A;  5II1 A;  5E9V A;  5CPE A;  4MEP A;  4NR4 A;  4QEV A;  5D3T A;  4ALG A;  4UYF A;  4FLP A;  5FFY A;  5HCL A;  4HXR A;  4HXP A;  4LZS A;  5FE9 A;  5DFB A;  5FE4 A;  2YDW A;  4XY9 A;  4HXO A;  4LYS A;  5HFQ A;  4N4I A;  4QSQ A;  5BT5 A;  5F62 A;  3MUL A;  5EM3 A;  2MJV B;  2DVV A;  4QYL A;  5D3L A;  3U5K A;  4C66 A;  4CFL A;  2N9G A;  5F5Z A;  5BT3 A;  4YAD A;  4YYM A;  5IG6 A;  5HEN A;  1EQF A;  4ZW1 A;  5F3A A;  1N72 A;  5CUB A;  4A9K A;  5KU3 A;  2R10 A;  4BW1 A;  4BHW A;  4TT6 A;  5F1H A;  4UYD A;  5JWM A;  4UIV A;  4HXK A;  4O74 A;  5E9K A;  5HEM A;  3MUK A;  2E3K A;  5KHM A;  3RCW A;  5FBX A;  4TT4 A;  4HBY A;  4O7F A;  5D26 A;  4UYG A;  5IGL A;  4ZQL A;  3UVD A;  5D25 A;  3QZV A;  3P1F A;  5L8U A;  2H60 A;  3UW9 A;  5EV9 A;  5A5N A;  4OGI A;  5F25 A;  5DW1 A;  5TCM A;  4UIU A;  5LVQ A;  3AAD A;  3FKM X;  4IR5 A;  4NR8 A;  5FE0 A;  4PCE A;  2R0V A;  5E7D A;  5ENF A;  3SVH A;  3LXJ A;  4YBT A;  5CU8 A;  4YY4 A;  3G0L A;  4LYI A;  4NUD A;  4NYW A;  4QC1 A;  5H1U A;  5HRV A;  4NQN A;  4F3I A;  2I8N A;  4O7E A;  2RNW A;  4PS5 A;  4TQN A;  4UIY A;  2DVQ A;  5EIS A;  5LUU A;  4YYD A;  5HRW A;  5D3R A;  5EWW A;  4QST A;  4TYL A;  5C4Q A;  4HXM A;  4HBV A;  5CRZ A;  5L96 A;  3Q2E A;  4O7A A;  5CS8 A;  3ONI A;  5EI4 A;  5H85 A;  5A7C A;  4YYH A;  4QEW A;  5C7N A;  4MR5 A;  4MR4 A;  4O76 A;  5F63 A; 
#chains in the Genus database with same CATH topology
 5DFC A;  5FB1 A;  2YW5 A;  1JM4 B;  5TB6 A;  4YK0 A;  4NXJ A;  3DWY A;  3JVK A;  5EU1 A;  4E96 A;  4Z1Q A;  1JSP B;  4NR7 A;  5D3P A;  5CUG A;  5DKH A;  2KTB B;  4NRB A;  4ZC9 A;  2OO1 A;  4A9N A;  2D82 A;  5FFW A;  4CUQ A;  4IR6 A;  4CUU A;  5FE3 A;  4BW3 A;  5EK9 A;  2DVS A;  5E9I A;  2DAT A;  4QBM A;  2RO1 A;  5LJ0 A;  2L85 A;  4CFK A;  5JI8 A;  2D9E A;  4YAT A;  2GRC A;  4XY8 A;  3D1D A;  5F1L A;  4J1P A;  3P1C A;  4NRC A;  3O36 A;  2RS9 B;  4CLB A;  4N4G A;  3QZS A;  3IU6 A;  5A82 A;  5FE7 A;  4QEU A;  3ERR A;  4Y03 A;  5ENB A;  5FDZ A;  5LKX A;  5AMF A;  5EPB A;  5C85 A;  4GPJ A;  3U5O A;  3JVM A;  4A9I A;  5AD2 A;  1E6I A;  5LKZ A;  5D3J A;  4QSW A;  4NUE A;  5I7X A;  4CUS A;  4DON A;  5CRM A;  5ETB A;  4YY6 A;  4TS8 A;  5C8G A;  2YEM A;  4NS5 A;  4YAX A;  2YQD A;  2DKW A;  3Q2F A;  4O7C A;  4TU4 A;  3U5N A;  4AKH A;  5FG6 A;  5LVR A;  4J0R A;  5C87 A;  5II2 A;  5D3H A;  5K29 A;  5I80 A;  4UIW A;  5FH6 A;  5HM0 A;  2EJN A;  4YYG A;  3O34 A;  4QYD A;  5CQ8 A;  4YYI A;  5CQ7 A;  4RVR A;  4LRG A;  5EIC A;  5I29 A;  2I7K A;  3U5P A;  5CUD A;  4Z6I A;  2FSA A;  5CUE A;  4UYF B;  5E0R A;  3UVX A;  4N4H A;  5I1Q A;  4XUB A;  2R0Y A;  4NR6 A;  5ENC A;  4IOO A;  5FB0 A;  5HLS A;  3MQM A;  4MEO A;  5L99 A;  5FE8 A;  4QSP A;  2F6N A;  5ENH A;  5FH7 A;  3S92 A;  4QC3 A;  5DKC A;  2F6J A;  5BT4 A;  5CP5 A;  5HQ5 A;  4QY4 A;  5DLZ A;  4UIZ A;  2YEL A;  5ENG A;  2R0S A;  5E73 A;  4CUT A;  5A5P A;  5D7X A;  1ZKR A;  1X0J A;  4NQM A;  5G4R A;  5DYX A;  4HXS A;  4LZ2 A;  5C89 A;  3UV5 A;  3LJW A;  4MEN A;  5E9Y A;  4KCX A;  3D7C A;  4ALH A;  3HME A;  5FG5 A;  3UV4 A;  5HJC A;  4Z6H A;  5EP7 A;  5F36 A;  3U5M A;  4J3I A;  5HRX A;  5FFV A;  4NR5 A;  5G4S A;  4LYW A;  4OUF A;  5EQ1 A;  5DFD A;  4A9O A;  5A5R A;  4QSV A;  5I83 A;  5EPS A;  4YAB A;  5EA1 A;  3DAI A;  4WHU A;  5HEL A;  3O37 A;  5F60 A;  5CQA A;  4Q0O A;  4QR5 A;  4KV4 A;  4AKG A;  3VKG A;  5DKD A;  3U5L A;  4QSX A;  5L8T A;  4OGJ A;  4A9E A;  5FE5 A;  5CZG A;  4O71 A;  5KTW A;  3MB4 A;  4O75 A;  5EWC A;  5D3S A;  4O7B A;  5CY9 A;  1PUO A;  5ENE A;  5IID A;  5D3N A;  4TU6 A;  5L98 A;  5ACY A;  3P1D A;  4IR4 A;  4Q0N A;  4A9M A;  3I3J A;  5FE6 A;  3ZYU A;  2E7O A;  4YH4 A;  4YH3 A;  5CUA A;  4J0S A;  4A9J A;  5F2P A;  5A5O A;  4PKL A;  5LJ2 A;  5E9M A;  4QSS A;  4TZ2 A;  4QUU A;  2E7N A;  4C67 A;  5FE2 A;  5EGU A;  2NXB A;  4O72 A;  5HFR A;  5E3D A;  3GG3 A;  4KV1 A;  4PCI A;  5FH8 A;  4Z93 A;  4BW2 A;  4YC9 A;  5LJ1 A;  4LZR A;  3MXF A;  4HBW A;  2YYN A;  5I89 A;  1ZS5 A;  4YBS A;  5EWH A;  3UVY A;  4NUC A;  3TLP A;  4QR4 A;  5IGM A;  4CL9 A;  3G0J A;  1WUG A;  4MR6 A;  5CQ4 A;  5DX4 A;  4O70 A;  4A9H A;  2RNY A;  4O77 A;  5CGP A;  5CTL A;  5CQT A;  3UVW A;  3S91 A;  4TT2 A;  5E9L A;  5EWV A;  3D1B A;  4MR3 A;  2YEK A;  2DWW A;  4LDF A;  5H1T A;  2WP1 A;  3QZT A;  3LQJ A;  5J0D A;  2LSP B;  4QZS A;  5LKT A;  3UV2 A;  3JVL A;  5HQ6 A;  4YYK A;  4N3W A;  4XYA A;  5D24 A;  5DW2 A;  4PTB A;  5ETD A;  4A9L A;  4NYV A;  2WP2 A;  1F68 A;  3O33 A;  5EVA A;  5I7Y A;  5FG4 A;  4TZ8 A;  2G4A A;  5A5Q A;  4UYH A;  4UYE A;  5FE1 A;  4A9F A;  4QSR A;  4QUT A;  2RFJ A;  4X2I A;  5IGN A;  4AKN A;  5CQ5 A;  5DBM A;  5EPR A;  5DY7 A;  4CUP A;  3HMH A;  5IGK A;  4O78 A;  4TTE A;  5LKU A;  5CQ3 A;  4LR6 A;  5CFW A;  4XUA A;  2RI7 A;  4HXL A;  3IU5 A;  2RNX A;  5A83 A;  4YYN A;  2OSS A;  4UIT A;  5DYA A;  4NYX A;  5EWD A;  3SVF A;  4CUR A;  4NRA A;  4MEQ A;  1WUM A;  5DLX A;  5KTX A;  4WIV A;  5KTU A;  5AD3 A;  3LQI A;  5CUC A;  5H1V A;  3P5O A;  3K2J A;  2OUO A;  5F61 A;  5A85 A;  4BW4 A;  3MB3 A;  2L5E A;  4HBX A;  5COI A;  5I40 A;  5I88 A;  2DVR A;  3U5J A;  5E74 A;  5D0C A;  3SVG A;  4WHW A;  5A81 A;  4IR3 A;  5ENJ A;  5KO4 A;  4BJX A;  3LQH A;  4PY6 A;  5I86 A;  4YYJ A;  3JVJ A;  5A5S A;  5IBN A;  5HQ7 A;  4YBM A;  4HXN A;  5ENI A;  4QNS A;  2L84 A;  5DYU A;  4Z1S A;  4LC2 A;  3NXB A;  5E3G A;  4IOR A;  5CQ6 A;  4NR9 A;  5DYC A;  5L97 A;  3AQA A;  5AME A;  3HMF A;  4IOQ A;  3P1E A;  4UIX A;  4QR3 A;  4QSU A;  3O35 A;  4QB3 A;  4N4F A;  5II1 A;  5E9V A;  5CPE A;  4MEP A;  4NR4 A;  4QEV A;  5D3T A;  4ALG A;  4UYF A;  4FLP A;  5FFY A;  5HCL A;  4HXR A;  4HXP A;  4LZS A;  5FE9 A;  5DFB A;  5FE4 A;  2YDW A;  4XY9 A;  4HXO A;  4LYS A;  5HFQ A;  4N4I A;  4QSQ A;  5BT5 A;  5F62 A;  3MUL A;  4AKI A;  5EM3 A;  2MJV B;  2DVV A;  4QYL A;  5D3L A;  3U5K A;  4C66 A;  4CFL A;  2N9G A;  5F5Z A;  5BT3 A;  4YAD A;  4YYM A;  5IG6 A;  5HEN A;  4AI6 A;  1EQF A;  4ZW1 A;  5F3A A;  1N72 A;  5CUB A;  4A9K A;  5KU3 A;  2R10 A;  4BW1 A;  4BHW A;  4TT6 A;  5F1H A;  4UYD A;  5JWM A;  4UIV A;  4HXK A;  4O74 A;  5E9K A;  5HEM A;  3MUK A;  2E3K A;  5KHM A;  3RCW A;  5FBX A;  4TT4 A;  4HBY A;  4O7F A;  5D26 A;  4UYG A;  5IGL A;  4ZQL A;  3UVD A;  5D25 A;  3QZV A;  3P1F A;  5L8U A;  2H60 A;  3UW9 A;  5EV9 A;  5A5N A;  4OGI A;  5F25 A;  5DW1 A;  5TCM A;  4UIU A;  5LVQ A;  3AAD A;  3FKM X;  4IR5 A;  4NR8 A;  5FE0 A;  4PCE A;  2R0V A;  5E7D A;  5ENF A;  3SVH A;  3LXJ A;  4YBT A;  5CU8 A;  4YY4 A;  3G0L A;  4LYI A;  4NUD A;  4NYW A;  4QC1 A;  5H1U A;  5HRV A;  4NQN A;  3VKH A;  4F3I A;  2I8N A;  4O7E A;  2RNW A;  4PS5 A;  4TQN A;  4UIY A;  2DVQ A;  5EIS A;  5LUU A;  4YYD A;  5HRW A;  5D3R A;  5EWW A;  4QST A;  4TYL A;  5C4Q A;  4HXM A;  4HBV A;  5CRZ A;  5L96 A;  3Q2E A;  4O7A A;  5CS8 A;  3ONI A;  5EI4 A;  5H85 A;  5A7C A;  4YYH A;  4QEW A;  5C7N A;  4MR5 A;  4MR4 A;  4O76 A;  5F63 A; 
#chains in the Genus database with same CATH homology
 5DFC A;  5FB1 A;  2YW5 A;  1JM4 B;  5TB6 A;  4YK0 A;  4NXJ A;  3DWY A;  3JVK A;  5EU1 A;  4E96 A;  4Z1Q A;  1JSP B;  4NR7 A;  5D3P A;  5CUG A;  5DKH A;  2KTB B;  4NRB A;  4ZC9 A;  2OO1 A;  4A9N A;  2D82 A;  5FFW A;  4CUQ A;  4IR6 A;  4CUU A;  5FE3 A;  4BW3 A;  5EK9 A;  2DVS A;  5E9I A;  2DAT A;  4QBM A;  2RO1 A;  5LJ0 A;  2L85 A;  4CFK A;  5JI8 A;  2D9E A;  4YAT A;  2GRC A;  4XY8 A;  5F1L A;  4J1P A;  3P1C A;  4NRC A;  3O36 A;  2RS9 B;  4CLB A;  4N4G A;  3QZS A;  3IU6 A;  5A82 A;  5FE7 A;  4QEU A;  4Y03 A;  5ENB A;  5FDZ A;  5LKX A;  5AMF A;  5EPB A;  5C85 A;  4GPJ A;  3U5O A;  3JVM A;  4A9I A;  5AD2 A;  1E6I A;  5LKZ A;  5D3J A;  4QSW A;  4NUE A;  5I7X A;  4CUS A;  4DON A;  5CRM A;  5ETB A;  4YY6 A;  4TS8 A;  5C8G A;  2YEM A;  4NS5 A;  4YAX A;  2YQD A;  2DKW A;  3Q2F A;  4O7C A;  4TU4 A;  3U5N A;  5FG6 A;  5LVR A;  4J0R A;  5C87 A;  5II2 A;  5D3H A;  5K29 A;  5I80 A;  4UIW A;  5FH6 A;  5HM0 A;  4YYG A;  3O34 A;  4QYD A;  5CQ8 A;  4YYI A;  5CQ7 A;  4RVR A;  4LRG A;  5EIC A;  5I29 A;  2I7K A;  3U5P A;  5CUD A;  4Z6I A;  2FSA A;  5CUE A;  4UYF B;  5E0R A;  3UVX A;  4N4H A;  5I1Q A;  4XUB A;  2R0Y A;  4NR6 A;  5ENC A;  4IOO A;  5FB0 A;  5HLS A;  3MQM A;  4MEO A;  5L99 A;  5FE8 A;  4QSP A;  2F6N A;  5ENH A;  5FH7 A;  3S92 A;  4QC3 A;  5DKC A;  2F6J A;  5BT4 A;  5CP5 A;  5HQ5 A;  4QY4 A;  5DLZ A;  4UIZ A;  2YEL A;  5ENG A;  2R0S A;  5E73 A;  4CUT A;  5A5P A;  5D7X A;  1X0J A;  4NQM A;  5G4R A;  5DYX A;  4HXS A;  4LZ2 A;  5C89 A;  3UV5 A;  3LJW A;  4MEN A;  5E9Y A;  4KCX A;  3D7C A;  4ALH A;  3HME A;  5FG5 A;  3UV4 A;  5HJC A;  4Z6H A;  5EP7 A;  5F36 A;  3U5M A;  4J3I A;  5HRX A;  5FFV A;  4NR5 A;  5G4S A;  4LYW A;  4OUF A;  5EQ1 A;  5DFD A;  4A9O A;  5A5R A;  4QSV A;  5I83 A;  5EPS A;  4YAB A;  5EA1 A;  3DAI A;  4WHU A;  5HEL A;  3O37 A;  5F60 A;  5CQA A;  4Q0O A;  4QR5 A;  4KV4 A;  5DKD A;  3U5L A;  4QSX A;  5L8T A;  4OGJ A;  4A9E A;  5FE5 A;  5CZG A;  4O71 A;  5KTW A;  3MB4 A;  4O75 A;  5EWC A;  5D3S A;  4O7B A;  5CY9 A;  5ENE A;  5IID A;  5D3N A;  4TU6 A;  5L98 A;  5ACY A;  3P1D A;  4IR4 A;  4Q0N A;  4A9M A;  3I3J A;  5FE6 A;  3ZYU A;  2E7O A;  4YH4 A;  4YH3 A;  5CUA A;  4J0S A;  4A9J A;  5F2P A;  5A5O A;  4PKL A;  5LJ2 A;  5E9M A;  4QSS A;  4TZ2 A;  4QUU A;  2E7N A;  4C67 A;  5FE2 A;  5EGU A;  2NXB A;  4O72 A;  5HFR A;  5E3D A;  3GG3 A;  4KV1 A;  4PCI A;  5FH8 A;  4Z93 A;  4BW2 A;  4YC9 A;  5LJ1 A;  4LZR A;  3MXF A;  4HBW A;  2YYN A;  5I89 A;  1ZS5 A;  4YBS A;  5EWH A;  3UVY A;  4NUC A;  3TLP A;  4QR4 A;  5IGM A;  4CL9 A;  3G0J A;  1WUG A;  4MR6 A;  5CQ4 A;  5DX4 A;  4O70 A;  4A9H A;  2RNY A;  4O77 A;  5CGP A;  5CTL A;  5CQT A;  3UVW A;  3S91 A;  4TT2 A;  5E9L A;  5EWV A;  4MR3 A;  2YEK A;  2DWW A;  4LDF A;  5H1T A;  2WP1 A;  3QZT A;  3LQJ A;  5J0D A;  2LSP B;  4QZS A;  5LKT A;  3UV2 A;  3JVL A;  5HQ6 A;  4YYK A;  4N3W A;  4XYA A;  5D24 A;  5DW2 A;  4PTB A;  5ETD A;  4A9L A;  4NYV A;  2WP2 A;  1F68 A;  3O33 A;  5EVA A;  5I7Y A;  5FG4 A;  4TZ8 A;  2G4A A;  5A5Q A;  4UYH A;  4UYE A;  5FE1 A;  4A9F A;  4QSR A;  4QUT A;  2RFJ A;  4X2I A;  5IGN A;  4AKN A;  5CQ5 A;  5DBM A;  5EPR A;  5DY7 A;  4CUP A;  3HMH A;  5IGK A;  4O78 A;  4TTE A;  5LKU A;  5CQ3 A;  4LR6 A;  5CFW A;  4XUA A;  2RI7 A;  4HXL A;  3IU5 A;  2RNX A;  5A83 A;  4YYN A;  2OSS A;  4UIT A;  5DYA A;  4NYX A;  5EWD A;  3SVF A;  4CUR A;  4NRA A;  4MEQ A;  1WUM A;  5DLX A;  5KTX A;  4WIV A;  5KTU A;  5AD3 A;  3LQI A;  5CUC A;  5H1V A;  3P5O A;  3K2J A;  2OUO A;  5F61 A;  5A85 A;  4BW4 A;  3MB3 A;  2L5E A;  4HBX A;  5COI A;  5I40 A;  5I88 A;  2DVR A;  3U5J A;  5E74 A;  5D0C A;  3SVG A;  4WHW A;  5A81 A;  4IR3 A;  5ENJ A;  5KO4 A;  4BJX A;  3LQH A;  4PY6 A;  5I86 A;  4YYJ A;  3JVJ A;  5A5S A;  5IBN A;  5HQ7 A;  4YBM A;  4HXN A;  5ENI A;  4QNS A;  2L84 A;  5DYU A;  4Z1S A;  4LC2 A;  3NXB A;  5E3G A;  4IOR A;  5CQ6 A;  4NR9 A;  5DYC A;  5L97 A;  3AQA A;  5AME A;  3HMF A;  4IOQ A;  3P1E A;  4UIX A;  4QR3 A;  4QSU A;  3O35 A;  4QB3 A;  4N4F A;  5II1 A;  5E9V A;  5CPE A;  4MEP A;  4NR4 A;  4QEV A;  5D3T A;  4ALG A;  4UYF A;  4FLP A;  5FFY A;  5HCL A;  4HXR A;  4HXP A;  4LZS A;  5FE9 A;  5DFB A;  5FE4 A;  2YDW A;  4XY9 A;  4HXO A;  4LYS A;  5HFQ A;  4N4I A;  4QSQ A;  5BT5 A;  5F62 A;  3MUL A;  5EM3 A;  2MJV B;  2DVV A;  4QYL A;  5D3L A;  3U5K A;  4C66 A;  4CFL A;  2N9G A;  5F5Z A;  5BT3 A;  4YAD A;  4YYM A;  5IG6 A;  5HEN A;  1EQF A;  4ZW1 A;  5F3A A;  1N72 A;  5CUB A;  4A9K A;  5KU3 A;  2R10 A;  4BW1 A;  4BHW A;  4TT6 A;  5F1H A;  4UYD A;  5JWM A;  4UIV A;  4HXK A;  4O74 A;  5E9K A;  5HEM A;  3MUK A;  2E3K A;  5KHM A;  3RCW A;  5FBX A;  4TT4 A;  4HBY A;  4O7F A;  5D26 A;  4UYG A;  5IGL A;  4ZQL A;  3UVD A;  5D25 A;  3QZV A;  3P1F A;  5L8U A;  2H60 A;  3UW9 A;  5EV9 A;  5A5N A;  4OGI A;  5F25 A;  5DW1 A;  5TCM A;  4UIU A;  5LVQ A;  3AAD A;  3FKM X;  4IR5 A;  4NR8 A;  5FE0 A;  4PCE A;  2R0V A;  5E7D A;  5ENF A;  3SVH A;  3LXJ A;  4YBT A;  5CU8 A;  4YY4 A;  3G0L A;  4LYI A;  4NUD A;  4NYW A;  4QC1 A;  5H1U A;  5HRV A;  4NQN A;  4F3I A;  2I8N A;  4O7E A;  2RNW A;  4PS5 A;  4TQN A;  4UIY A;  2DVQ A;  5EIS A;  5LUU A;  4YYD A;  5HRW A;  5D3R A;  5EWW A;  4QST A;  4TYL A;  5C4Q A;  4HXM A;  4HBV A;  5CRZ A;  5L96 A;  3Q2E A;  4O7A A;  5CS8 A;  3ONI A;  5EI4 A;  5H85 A;  5A7C A;  4YYH A;  4QEW A;  5C7N A;  4MR5 A;  4MR4 A;  4O76 A;  5F63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...