3Q2GA

Adamts1 in complex with a novel n-hydroxyformamide inhibitors
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
296
structure length
282
Chain Sequence
SHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQDLCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASLNSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGTSYDANRQCQFTFGEDSKHCPTCSTLWCTGLVCQTKHFPWADGTSCGEGKWCINGKCVNKLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The design and synthesis of novel N-hydroxyformamide inhibitors of ADAM-TS4 for the treatment of osteoarthritis
pubmed doi rcsb
molecule keywords A disintegrin and metalloproteinase with thrombospondin moti
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
total genus 92
structure length 282
sequence length 296
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
A PF17771 ADAM_CR_2 ADAM cysteine-rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3q2gA01
1EAKA 1HV5A 3LILA 1Y8JA 1QIBA 2OZRA 1OM7A 4XCTA 1KUFA 5CUHA 4FXYP 3I7IA 2FV9A 1SATA 3F19A 1GXDA 1S4BP 3KWVC 5D2BA 1G05A 2DDFA 3I7GA 1UTTA 1QUAA 5LABA 1XFZA 2X3BA 1R1HA 3HDAP 1CAQA 1GE5A 3LJTA 4AIGA 1HOVA 3KMEA 3O64A 3KEJA 1PWVA 1ZTQA 3B8ZA 5D1SA 2WO8A 2TCLA 2W0DA 1MNCA 1R1IA 4JP4A 1UTZA 4JIJA 1H71P 5BOYA 1K7IA 1OO9A 4DPEA 4R3VA 2D1NA 1BKCI 4G9LA 3EDGA 4H76A 2AYKA 2OW9A 1CXVA 2V4BA 2OI0A 1ND1A 3LK8A 3DSLA 1XUCA 1K7QA 1EUBA 3RTTA 4DF9A 3P24A 3F1AA 4WKEA 1JH1A 2J0TA 1PWWA 1I1IP 456CA 1BUVM 3ZVSA 4Q1LA 3Q2GA 5I0LA 5I3MA 3L0TA 1USNA 1KUHA 1UMSA 2DDYA 3EDZA 3EWJA 3HY7A 2OVZA 3DL1A 4AYKA 1IADA 2L0RA 1R55A 1FBLA 4GUYA 1D7XA 1IACA 5I43A 1JANA 1CGEA 1G4KA 4FVLA 2SRTA 4L19A 4PKVA 4ZR5A 1XFUA 1KAPP 4GR3A 4PKTA 3OHLA 1Y0VA 2JT6A 3HY9A 4GR0A 1ZP5A 1JAOA 2MZIA 3V96B 1A86A 3F16A 1RM8A 1ZS0A 3DPFA 3LUMA 1BUDA 1QICA 4AXQA 1Y93A 2OXUA 1B3DA 1BIWA 1AYKA 2O36A 2DW1A 4H1QA 2W12A 1CIZA 3TVCA 4J4MA 4WK7A 2FV5A 1JKYA 5JMYA 2WO9A 1HFCA 3CKIA 2OXWA 4L6TA 4JPAA 3U1RA 1GE7A 1G9KA 1BQOA 2EROA 1QIAA 4GQLA 3TS4A 2X7MA 3EHXA 4ILWD 3LKAA 1BSWA 3SHIA 1R54A 4IJOA 2YB9A 1XFWA 2JNPA 5H8XA 2CLTA 4I35A 1JK3A 4WZVA 4GF1A 1MMPA 1JIZA 2Z2DA 1HY7A 1SU3A 1A85A 4PKUA 1XURA 1D5JA 2OY4A 1ROSA 4IN9A 2W15A 5I12A 1CQRA 3N2UA 2ERPA 1J7NA 5BPAA 1PWQA 4I03A 5CXAA 3P1VA 1JJ9A 2X3AA 3BA0A 3DNGA 4A3WA 2JT5A 5D1TA 4H82A 1R1JA 2XS4A 3K7LA 1UMTA 3LGPA 1KUKA 3KHIA 1MMBA 1CK7A 3WV2A 2W14A 2DW2A 3MA2A 2WOAA 4WF6A 3EDIA 3LUNA 4XM6A 1XUDA 3ZXHA 5B5PA 4CTHA 4H30A 2OW0A 4HX3A 1IAEA 1AKLA 3AYUA 1ZXVA 1B8YA 1OM8A 1C8TA 2DW0A 3LMCA 1MMRA 1BQQM 3VI1A 3AYKA 3LQBA 1SLNA 1GO8P 1BZSA 1D8FA 3KECA 4PKWA 4FU4A 5I2ZA 1YQYA 2MZHA 2OVXA 1KUGA 1I76A 1BKCE 1CGLA 5D1UA 3WV1A 1KUIA 1XFXA 4H84A 2HU6A 1AF0A 2RJQA 4IUWA 4XM8A 3TT4A 1HTDA 4JQGA 1L6JA 3DPEA 1JIWP 1G12A 4PKSA 4G0DA 2J83A 3KRYA 2RJPA 1FLSA 2K2GA 3O2XA 830CA 3F17A 4GWNA 2O3EA 1IABA 1QJIA 1XFYA 1O0QA 2JIHA 1ATLA 2E2DA 3G42A 1I73A 1C7KA 2E3XA 1ZVXA 5D3CA 5I4OA 1OS9A 3LEAA 3E8RA 1HFSA 4H49A 1KBCA 2USNA 2W13A 1JAPA 3VTGA 1PWPA 4QKZA 2MZEA 4L63A 4WKIA 4H2EA 1O0TA 2I47A 5CZMA 3LE9A 1IAGA 1YOUA 3F18A 2OY2A 3RTSA 1FM1A 1ASTA 1YP1A 1ZXCA 1SRPA 2X3CA 1DTHA 4HMAA 3EDHA 2POJA 1Q3AA 5L7FA 2JSDA 3DWBA 1C3IA 1PWUA 2AIGP 4DD8A 966CA 4H3XA 3B2ZA 5BOTA 1OMJA 1GO7P 3KEKA 3K7NA 1MMQA 4GWMA 4A7BA 1XFVA 1GKDA 1OS2A 2XS3A 4ON1A 3GBOA 2YIGA 3LJGA 3ELMA 1DMTA 3EHYA 1BKCA 3USNA 2Y6CA 3L0VA 5L79A 3G5CA 1Z3JA 3LIKA 2MLRA 2OXZA 3HBVP 3N2VA 1GE6A 3HYGA 2MLSA 1SLMA 2N8RA 3KMCA 2QPJA 1G49A 1EB6A 4DV8A 3NX7A 4JA1A 1IAAA 2K9CA 1RMZA 3HDBA 3LQ0A 3F15A 3LIRA 3LJZA 4PKQA 3HB2P 3TSKA 2CKIA 1YCMA 2OW2A 3ZUKA 1SMPA 1WNIA 1OM6A 1JAQA 4GR8A 2PJTA 3UVCA 3OHOA 1CGFA 2D1OA 5D7WA 2KRJA 3AIGA 4AUOA 3Q2HA 1K7GA 2Y6DA 3WV3A 2A8HA 3B92A 4PKRA 1GKCA 4XBHA 1D8MA 1QJJA 2ERQA 4EFSA 1UEAA 2OW1A 4FXQA 1BM6A 4XM7A 3HBUP 5B5OA
chains in the Genus database with same CATH superfamily
1EAKA 1HV5A 3LILA 1Y8JA 1QIBA 2OZRA 1OM7A 4XCTA 1KUFA 5CUHA 4FXYP 3DTIA 3I7IA 2FV9A 1SATA 3F19A 1GXDA 1S4BP 3KWVC 5D2BA 1G05A 2DDFA 3I7GA 1UTTA 1QUAA 5LABA 1XFZA 2X3BA 1R1HA 3HDAP 1CAQA 1GE5A 3LJTA 4AIGA 1HOVA 3DTEA 3KMEA 3O64A 3KEJA 1PWVA 1ZTQA 3B8ZA 5D1SA 2WO8A 2TCLA 2W0DA 1MNCA 1R1IA 4JP4A 1UTZA 4JIJA 1H71P 5BOYA 1K7IA 1OO9A 4DPEA 4R3VA 2D1NA 1BKCI 4G9LA 3EDGA 4H76A 3DTKA 2AYKA 2OW9A 1XAXA 1CXVA 2V4BA 2OI0A 1ND1A 3LK8A 3DSLA 1XUCA 1K7QA 1EUBA 3RTTA 4DF9A 3P24A 3F1AA 4WKEA 1JH1A 2J0TA 1PWWA 1I1IP 456CA 1BUVM 3ZVSA 4Q1LA 3Q2GA 5I0LA 5I3MA 3L0TA 1USNA 1KUHA 1UMSA 2DDYA 3EDZA 3EWJA 3HY7A 2OVZA 3DL1A 4AYKA 1IADA 2L0RA 1R55A 1FBLA 4GUYA 1D7XA 1IACA 5I43A 1JANA 1CGEA 1G4KA 4FVLA 2SRTA 4L19A 4PKVA 4ZR5A 1XFUA 1KAPP 4GR3A 4PKTA 3OHLA 1Y0VA 2JT6A 3HY9A 4GR0A 1ZP5A 1JAOA 2MZIA 1OZ9A 3V96B 1A86A 3F16A 1RM8A 1ZS0A 3DPFA 3LUMA 1BUDA 1QICA 4AXQA 1Y93A 2OXUA 1B3DA 1BIWA 1AYKA 2O36A 2DW1A 4H1QA 2W12A 1CIZA 3TVCA 4J4MA 4WK7A 2FV5A 1JKYA 5JMYA 2WO9A 1HFCA 3CKIA 2OXWA 4L6TA 4JPAA 3U1RA 1GE7A 1G9KA 1BQOA 2EROA 1QIAA 4GQLA 3TS4A 2X7MA 3EHXA 4ILWD 3LKAA 1BSWA 3SHIA 1R54A 4IJOA 2YB9A 1XFWA 2JNPA 5H8XA 2CLTA 4I35A 1JK3A 4WZVA 4GF1A 1MMPA 1JIZA 2Z2DA 1HY7A 1SU3A 1A85A 4PKUA 1XURA 1D5JA 2OY4A 1ROSA 4IN9A 2W15A 5I12A 1CQRA 3N2UA 2ERPA 1J7NA 1TVIA 5BPAA 1PWQA 4I03A 5CXAA 3P1VA 1JJ9A 2X3AA 3BA0A 3DNGA 4A3WA 2JT5A 5D1TA 4L7AA 4H82A 1R1JA 2YUFA 2XS4A 3K7LA 1UMTA 3LGPA 1KUKA 3KHIA 1MMBA 1CK7A 3WV2A 2W14A 2DW2A 3MA2A 2WOAA 4WF6A 3EDIA 3LUNA 4XM6A 1XUDA 3ZXHA 5B5PA 4CTHA 4H30A 2OW0A 4HX3A 1IAEA 1AKLA 3AYUA 1ZXVA 1B8YA 1OM8A 1C8TA 2DW0A 3LMCA 1MMRA 1BQQM 3VI1A 3AYKA 3LQBA 1SLNA 1GO8P 1BZSA 1D8FA 3KECA 4PKWA 4FU4A 5I2ZA 1YQYA 2MZHA 2OVXA 1KUGA 1I76A 1BKCE 1CGLA 5D1UA 3WV1A 1KUIA 1XFXA 4H84A 2HU6A 1AF0A 2RJQA 4IUWA 4XM8A 3TT4A 1HTDA 4JQGA 1L6JA 3DPEA 1JIWP 1G12A 4PKSA 4G0DA 2J83A 3KRYA 2RJPA 1FLSA 2K2GA 3O2XA 830CA 3F17A 4GWNA 2O3EA 1IABA 1QJIA 1XFYA 1O0QA 2JIHA 1ATLA 2E2DA 3G42A 1I73A 1C7KA 2E3XA 1ZVXA 5D3CA 5I4OA 1OS9A 3LEAA 3E8RA 1HFSA 4H49A 1KBCA 2USNA 2W13A 1JAPA 3VTGA 1PWPA 4QKZA 2MZEA 4L63A 4WKIA 4H2EA 1O0TA 2I47A 5CZMA 3LE9A 1IAGA 1YOUA 3F18A 2OY2A 3RTSA 1FM1A 1ASTA 1YP1A 1ZXCA 1SRPA 2X3CA 1DTHA 4HMAA 3EDHA 2POJA 1Q3AA 5L7FA 2JSDA 3DWBA 1C3IA 1PWUA 2AIGP 4DD8A 966CA 4H3XA 3B2ZA 1XM5A 5BOTA 1OMJA 1GO7P 3KEKA 3K7NA 1MMQA 4GWMA 4A7BA 1XFVA 1GKDA 1OS2A 2XS3A 4ON1A 3GBOA 2YIGA 3LJGA 3ELMA 1DMTA 3EHYA 1BKCA 3USNA 2Y6CA 3L0VA 5L79A 3G5CA 1Z3JA 3LIKA 2MLRA 2OXZA 3HBVP 3N2VA 1GE6A 3HYGA 2MLSA 1SLMA 2N8RA 3KMCA 2QPJA 1G49A 1EB6A 4DV8A 3NX7A 4JA1A 1IAAA 2K9CA 1RMZA 3HDBA 3LQ0A 3F15A 3LIRA 3LJZA 4PKQA 3HB2P 3TSKA 2CKIA 1YCMA 2OW2A 3ZUKA 1SMPA 1WNIA 1OM6A 1JAQA 4GR8A 2PJTA 3UVCA 3OHOA 1CGFA 2D1OA 5D7WA 2KRJA 3AIGA 4AUOA 3Q2HA 1K7GA 2Y6DA 3WV3A 2A8HA 3B92A 4PKRA 1GKCA 4XBHA 1D8MA 1QJJA 2ERQA 4EFSA 1UEAA 2OW1A 4FXQA 1BM6A 4XM7A 3HBUP 5B5OA
chains in the Genus database with same CATH topology
1EAKA 1HV5A 3LILA 1Y8JA 1QIBA 2OZRA 1OM7A 4XCTA 1KUFA 5CUHA 4FXYP 3DTIA 3I7IA 2FV9A 1SATA 3F19A 1GXDA 1S4BP 3KWVC 5D2BA 1G05A 2DDFA 3I7GA 1UTTA 1QUAA 5LABA 1XFZA 2X3BA 1R1HA 3HDAP 1CAQA 1GE5A 3LJTA 4AIGA 1HOVA 3DTEA 3KMEA 3O64A 3KEJA 1PWVA 1ZTQA 3B8ZA 5D1SA 2WO8A 2TCLA 2W0DA 1MNCA 1R1IA 4JP4A 1UTZA 4JIJA 1H71P 5BOYA 1K7IA 1OO9A 4DPEA 4R3VA 2D1NA 1BKCI 4G9LA 3EDGA 4H76A 3DTKA 2AYKA 2OW9A 1CXVA 2V4BA 2OI0A 1ND1A 3LK8A 3DSLA 1XUCA 1K7QA 1EUBA 3RTTA 4DF9A 3P24A 3F1AA 4WKEA 1JH1A 2J0TA 1PWWA 1I1IP 456CA 1BUVM 3ZVSA 4Q1LA 3Q2GA 5I0LA 5I3MA 3L0TA 1USNA 1KUHA 1UMSA 2DDYA 3EDZA 3EWJA 3HY7A 2OVZA 3DL1A 4AYKA 1IADA 2L0RA 1R55A 1FBLA 4GUYA 1D7XA 1IACA 5I43A 1JANA 1CGEA 1G4KA 4FVLA 2SRTA 4L19A 4PKVA 4ZR5A 1XFUA 1KAPP 4GR3A 4PKTA 3OHLA 1Y0VA 2JT6A 3HY9A 4GR0A 1ZP5A 1JAOA 2MZIA 3V96B 1A86A 3F16A 1RM8A 1ZS0A 3DPFA 3LUMA 1BUDA 1QICA 4AXQA 1Y93A 2OXUA 1B3DA 1BIWA 1AYKA 2O36A 2DW1A 4H1QA 2W12A 1CIZA 3TVCA 4J4MA 4WK7A 2FV5A 1JKYA 5JMYA 2WO9A 1HFCA 3CKIA 2OXWA 4L6TA 4JPAA 3U1RA 1GE7A 1G9KA 1BQOA 2EROA 1QIAA 4GQLA 3TS4A 2X7MA 3EHXA 4ILWD 3LKAA 1BSWA 3SHIA 1R54A 4IJOA 2YB9A 1XFWA 2JNPA 5H8XA 2CLTA 4I35A 1JK3A 4WZVA 4GF1A 1MMPA 1JIZA 2Z2DA 1HY7A 1SU3A 1A85A 4PKUA 1XURA 1D5JA 2OY4A 1ROSA 4IN9A 2W15A 5I12A 1CQRA 3N2UA 2ERPA 1J7NA 5BPAA 1PWQA 4I03A 5CXAA 3P1VA 1JJ9A 2X3AA 3BA0A 3DNGA 4A3WA 2JT5A 5D1TA 4L7AA 4H82A 1R1JA 2YUFA 2XS4A 3K7LA 1UMTA 3LGPA 1KUKA 3KHIA 1MMBA 1CK7A 3WV2A 2W14A 2DW2A 3MA2A 2WOAA 4WF6A 3EDIA 3LUNA 4XM6A 1XUDA 3ZXHA 5B5PA 4CTHA 4H30A 2OW0A 4HX3A 1IAEA 1AKLA 3AYUA 1ZXVA 1B8YA 1OM8A 1C8TA 2DW0A 3LMCA 1MMRA 1BQQM 3VI1A 3AYKA 3LQBA 1SLNA 1GO8P 1BZSA 1D8FA 3KECA 4PKWA 4FU4A 5I2ZA 1YQYA 2MZHA 2OVXA 1KUGA 1I76A 1BKCE 1CGLA 5D1UA 3WV1A 1KUIA 1XFXA 4H84A 2HU6A 1AF0A 2RJQA 4IUWA 4XM8A 3TT4A 1HTDA 4JQGA 1L6JA 3DPEA 1JIWP 1G12A 4PKSA 4G0DA 2J83A 3KRYA 2RJPA 1FLSA 2K2GA 3O2XA 830CA 3F17A 4GWNA 2O3EA 1IABA 1QJIA 1XFYA 1O0QA 2JIHA 1ATLA 2E2DA 3G42A 1I73A 1C7KA 2E3XA 1ZVXA 5D3CA 5I4OA 1OS9A 3LEAA 3E8RA 1HFSA 4H49A 1KBCA 2USNA 2W13A 1JAPA 3VTGA 1PWPA 4QKZA 2MZEA 4L63A 4WKIA 4H2EA 1O0TA 2I47A 5CZMA 3LE9A 1IAGA 1YOUA 3F18A 2OY2A 3RTSA 1FM1A 1ASTA 1YP1A 1ZXCA 1SRPA 2X3CA 1DTHA 4HMAA 3EDHA 2POJA 1Q3AA 5L7FA 2JSDA 3DWBA 1C3IA 1PWUA 2AIGP 4DD8A 966CA 4H3XA 3B2ZA 5BOTA 1OMJA 1GO7P 3KEKA 3K7NA 1MMQA 4GWMA 4A7BA 1XFVA 1GKDA 1OS2A 2XS3A 4ON1A 3GBOA 2YIGA 3LJGA 3ELMA 1DMTA 3EHYA 1BKCA 3USNA 2Y6CA 3L0VA 5L79A 3G5CA 1Z3JA 3LIKA 2MLRA 2OXZA 3HBVP 3N2VA 1GE6A 3HYGA 2MLSA 1SLMA 2N8RA 3KMCA 2QPJA 1G49A 1EB6A 4DV8A 3NX7A 4JA1A 1IAAA 2K9CA 1RMZA 3HDBA 3LQ0A 3F15A 3LIRA 3LJZA 4PKQA 3HB2P 3TSKA 2CKIA 1YCMA 2OW2A 3ZUKA 1SMPA 1WNIA 1OM6A 1JAQA 4GR8A 2PJTA 3UVCA 3OHOA 1CGFA 2D1OA 5D7WA 2KRJA 3AIGA 4AUOA 3Q2HA 1K7GA 2Y6DA 3WV3A 2A8HA 3B92A 4PKRA 1GKCA 4XBHA 1D8MA 1QJJA 2ERQA 4EFSA 1UEAA 2OW1A 4FXQA 1BM6A 4XM7A 3HBUP 5B5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAK A;  1HV5 A;  3LIL A;  1Y8J A;  1QIB A;  2OZR A;  1OM7 A;  4XCT A;  1KUF A;  5CUH A;  4FXY P;  3I7I A;  2FV9 A;  1SAT A;  3F19 A;  1GXD A;  1S4B P;  3KWV C;  5D2B A;  1G05 A;  2DDF A;  3I7G A;  1UTT A;  1QUA A;  5LAB A;  1XFZ A;  2X3B A;  1R1H A;  3HDA P;  1CAQ A;  1GE5 A;  3LJT A;  4AIG A;  1HOV A;  3KME A;  3O64 A;  3KEJ A;  1PWV A;  1ZTQ A;  3B8Z A;  5D1S A;  2WO8 A;  2TCL A;  2W0D A;  1MNC A;  1R1I A;  4JP4 A;  1UTZ A;  4JIJ A;  1H71 P;  5BOY A;  1K7I A;  1OO9 A;  4DPE A;  4R3V A;  2D1N A;  1BKC I;  4G9L A;  3EDG A;  4H76 A;  2AYK A;  2OW9 A;  1CXV A;  2V4B A;  2OI0 A;  1ND1 A;  3LK8 A;  3DSL A;  1XUC A;  1K7Q A;  1EUB A;  3RTT A;  4DF9 A;  3P24 A;  3F1A A;  4WKE A;  1JH1 A;  2J0T A;  1PWW A;  1I1I P;  456C A;  1BUV M;  3ZVS A;  4Q1L A;  3Q2G A;  5I0L A;  5I3M A;  3L0T A;  1USN A;  1KUH A;  1UMS A;  2DDY A;  3EDZ A;  3EWJ A;  3HY7 A;  2OVZ A;  3DL1 A;  4AYK A;  1IAD A;  2L0R A;  1R55 A;  1FBL A;  4GUY A;  1D7X A;  1IAC A;  5I43 A;  1JAN A;  1CGE A;  1G4K A;  4FVL A;  2SRT A;  4L19 A;  4PKV A;  4ZR5 A;  1XFU A;  1KAP P;  4GR3 A;  4PKT A;  3OHL A;  1Y0V A;  2JT6 A;  3HY9 A;  4GR0 A;  1ZP5 A;  1JAO A;  2MZI A;  3V96 B;  1A86 A;  3F16 A;  1RM8 A;  1ZS0 A;  3DPF A;  3LUM A;  1BUD A;  1QIC A;  4AXQ A;  1Y93 A;  2OXU A;  1B3D A;  1BIW A;  1AYK A;  2O36 A;  2DW1 A;  4H1Q A;  2W12 A;  1CIZ A;  3TVC A;  4J4M A;  4WK7 A;  2FV5 A;  1JKY A;  5JMY A;  2WO9 A;  1HFC A;  3CKI A;  2OXW A;  4L6T A;  4JPA A;  3U1R A;  1GE7 A;  1G9K A;  1BQO A;  2ERO A;  1QIA A;  4GQL A;  3TS4 A;  2X7M A;  3EHX A;  4ILW D;  3LKA A;  1BSW A;  3SHI A;  1R54 A;  4IJO A;  2YB9 A;  1XFW A;  2JNP A;  5H8X A;  2CLT A;  4I35 A;  1JK3 A;  4WZV A;  4GF1 A;  1MMP A;  1JIZ A;  2Z2D A;  1HY7 A;  1SU3 A;  1A85 A;  4PKU A;  1XUR A;  1D5J A;  2OY4 A;  1ROS A;  4IN9 A;  2W15 A;  5I12 A;  1CQR A;  3N2U A;  2ERP A;  1J7N A;  5BPA A;  1PWQ A;  4I03 A;  5CXA A;  3P1V A;  1JJ9 A;  2X3A A;  3BA0 A;  3DNG A;  4A3W A;  2JT5 A;  5D1T A;  4H82 A;  1R1J A;  2XS4 A;  3K7L A;  1UMT A;  3LGP A;  1KUK A;  3KHI A;  1MMB A;  1CK7 A;  3WV2 A;  2W14 A;  2DW2 A;  3MA2 A;  2WOA A;  4WF6 A;  3EDI A;  3LUN A;  4XM6 A;  1XUD A;  3ZXH A;  5B5P A;  4CTH A;  4H30 A;  2OW0 A;  4HX3 A;  1IAE A;  1AKL A;  3AYU A;  1ZXV A;  1B8Y A;  1OM8 A;  1C8T A;  2DW0 A;  3LMC A;  1MMR A;  1BQQ M;  3VI1 A;  3AYK A;  3LQB A;  1SLN A;  1GO8 P;  1BZS A;  1D8F A;  3KEC A;  4PKW A;  4FU4 A;  5I2Z A;  1YQY A;  2MZH A;  2OVX A;  1KUG A;  1I76 A;  1BKC E;  1CGL A;  5D1U A;  3WV1 A;  1KUI A;  1XFX A;  4H84 A;  2HU6 A;  1AF0 A;  2RJQ A;  4IUW A;  4XM8 A;  3TT4 A;  1HTD A;  4JQG A;  1L6J A;  3DPE A;  1JIW P;  1G12 A;  4PKS A;  4G0D A;  2J83 A;  3KRY A;  2RJP A;  1FLS A;  2K2G A;  3O2X A;  830C A;  3F17 A;  4GWN A;  2O3E A;  1IAB A;  1QJI A;  1XFY A;  1O0Q A;  2JIH A;  1ATL A;  2E2D A;  3G42 A;  1I73 A;  1C7K A;  2E3X A;  1ZVX A;  5D3C A;  5I4O A;  1OS9 A;  3LEA A;  3E8R A;  1HFS A;  4H49 A;  1KBC A;  2USN A;  2W13 A;  1JAP A;  3VTG A;  1PWP A;  4QKZ A;  2MZE A;  4L63 A;  4WKI A;  4H2E A;  1O0T A;  2I47 A;  5CZM A;  3LE9 A;  1IAG A;  1YOU A;  3F18 A;  2OY2 A;  3RTS A;  1FM1 A;  1AST A;  1YP1 A;  1ZXC A;  1SRP A;  2X3C A;  1DTH A;  4HMA A;  3EDH A;  2POJ A;  1Q3A A;  5L7F A;  2JSD A;  3DWB A;  1C3I A;  1PWU A;  2AIG P;  4DD8 A;  966C A;  4H3X A;  3B2Z A;  5BOT A;  1OMJ A;  1GO7 P;  3KEK A;  3K7N A;  1MMQ A;  4GWM A;  4A7B A;  1XFV A;  1GKD A;  1OS2 A;  2XS3 A;  4ON1 A;  3GBO A;  2YIG A;  3LJG A;  3ELM A;  1DMT A;  3EHY A;  1BKC A;  3USN A;  2Y6C A;  3L0V A;  5L79 A;  3G5C A;  1Z3J A;  3LIK A;  2MLR A;  2OXZ A;  3HBV P;  3N2V A;  1GE6 A;  3HYG A;  2MLS A;  1SLM A;  2N8R A;  3KMC A;  2QPJ A;  1G49 A;  1EB6 A;  4DV8 A;  3NX7 A;  4JA1 A;  1IAA A;  2K9C A;  1RMZ A;  3HDB A;  3LQ0 A;  3F15 A;  3LIR A;  3LJZ A;  4PKQ A;  3HB2 P;  3TSK A;  2CKI A;  1YCM A;  2OW2 A;  3ZUK A;  1SMP A;  1WNI A;  1OM6 A;  1JAQ A;  4GR8 A;  2PJT A;  3UVC A;  3OHO A;  1CGF A;  2D1O A;  5D7W A;  2KRJ A;  3AIG A;  4AUO A;  3Q2H A;  1K7G A;  2Y6D A;  3WV3 A;  2A8H A;  3B92 A;  4PKR A;  1GKC A;  4XBH A;  1D8M A;  1QJJ A;  2ERQ A;  4EFS A;  1UEA A;  2OW1 A;  4FXQ A;  1BM6 A;  4XM7 A;  3HBU P;  5B5O A; 
#chains in the Genus database with same CATH topology
 1EAK A;  1HV5 A;  3LIL A;  1Y8J A;  1QIB A;  2OZR A;  1OM7 A;  4XCT A;  1KUF A;  5CUH A;  4FXY P;  3DTI A;  3I7I A;  2FV9 A;  1SAT A;  3F19 A;  1GXD A;  1S4B P;  3KWV C;  5D2B A;  1G05 A;  2DDF A;  3I7G A;  1UTT A;  1QUA A;  5LAB A;  1XFZ A;  2X3B A;  1R1H A;  3HDA P;  1CAQ A;  1GE5 A;  3LJT A;  4AIG A;  1HOV A;  3DTE A;  3KME A;  3O64 A;  3KEJ A;  1PWV A;  1ZTQ A;  3B8Z A;  5D1S A;  2WO8 A;  2TCL A;  2W0D A;  1MNC A;  1R1I A;  4JP4 A;  1UTZ A;  4JIJ A;  1H71 P;  5BOY A;  1K7I A;  1OO9 A;  4DPE A;  4R3V A;  2D1N A;  1BKC I;  4G9L A;  3EDG A;  4H76 A;  3DTK A;  2AYK A;  2OW9 A;  1XAX A;  1CXV A;  2V4B A;  2OI0 A;  1ND1 A;  3LK8 A;  3DSL A;  1XUC A;  1K7Q A;  1EUB A;  3RTT A;  4DF9 A;  3P24 A;  3F1A A;  4WKE A;  1JH1 A;  2J0T A;  1PWW A;  1I1I P;  456C A;  1BUV M;  3ZVS A;  4Q1L A;  3Q2G A;  5I0L A;  5I3M A;  3L0T A;  1USN A;  1KUH A;  1UMS A;  2DDY A;  3EDZ A;  3EWJ A;  3HY7 A;  2OVZ A;  3DL1 A;  4AYK A;  1IAD A;  2L0R A;  1R55 A;  1FBL A;  4GUY A;  1D7X A;  1IAC A;  5I43 A;  1JAN A;  1CGE A;  1G4K A;  4FVL A;  2SRT A;  4L19 A;  4PKV A;  4ZR5 A;  1XFU A;  1KAP P;  4GR3 A;  4PKT A;  3OHL A;  1Y0V A;  2JT6 A;  3HY9 A;  4GR0 A;  1ZP5 A;  1JAO A;  2MZI A;  1OZ9 A;  3V96 B;  1A86 A;  3F16 A;  1RM8 A;  1ZS0 A;  3DPF A;  3LUM A;  1BUD A;  1QIC A;  4AXQ A;  1Y93 A;  2OXU A;  1B3D A;  1BIW A;  1AYK A;  2O36 A;  2DW1 A;  4H1Q A;  2W12 A;  1CIZ A;  3TVC A;  4J4M A;  4WK7 A;  2FV5 A;  1JKY A;  5JMY A;  2WO9 A;  1HFC A;  3CKI A;  2OXW A;  4L6T A;  4JPA A;  3U1R A;  1GE7 A;  1G9K A;  1BQO A;  2ERO A;  1QIA A;  4GQL A;  3TS4 A;  2X7M A;  3EHX A;  4ILW D;  3LKA A;  1BSW A;  3SHI A;  1R54 A;  4IJO A;  2YB9 A;  1XFW A;  2JNP A;  5H8X A;  2CLT A;  4I35 A;  1JK3 A;  4WZV A;  4GF1 A;  1MMP A;  1JIZ A;  2Z2D A;  1HY7 A;  1SU3 A;  1A85 A;  4PKU A;  1XUR A;  1D5J A;  2OY4 A;  1ROS A;  4IN9 A;  2W15 A;  5I12 A;  1CQR A;  3N2U A;  2ERP A;  1J7N A;  1TVI A;  5BPA A;  1PWQ A;  4I03 A;  5CXA A;  3P1V A;  1JJ9 A;  2X3A A;  3BA0 A;  3DNG A;  4A3W A;  2JT5 A;  5D1T A;  4L7A A;  4H82 A;  1R1J A;  2YUF A;  2XS4 A;  3K7L A;  1UMT A;  3LGP A;  1KUK A;  3KHI A;  1MMB A;  1CK7 A;  3WV2 A;  2W14 A;  2DW2 A;  3MA2 A;  2WOA A;  4WF6 A;  3EDI A;  3LUN A;  4XM6 A;  1XUD A;  3ZXH A;  5B5P A;  4CTH A;  4H30 A;  2OW0 A;  4HX3 A;  1IAE A;  1AKL A;  3AYU A;  1ZXV A;  1B8Y A;  1OM8 A;  1C8T A;  2DW0 A;  3LMC A;  1MMR A;  1BQQ M;  3VI1 A;  3AYK A;  3LQB A;  1SLN A;  1GO8 P;  1BZS A;  1D8F A;  3KEC A;  4PKW A;  4FU4 A;  5I2Z A;  1YQY A;  2MZH A;  2OVX A;  1KUG A;  1I76 A;  1BKC E;  1CGL A;  5D1U A;  3WV1 A;  1KUI A;  1XFX A;  4H84 A;  2HU6 A;  1AF0 A;  2RJQ A;  4IUW A;  4XM8 A;  3TT4 A;  1HTD A;  4JQG A;  1L6J A;  3DPE A;  1JIW P;  1G12 A;  4PKS A;  4G0D A;  2J83 A;  3KRY A;  2RJP A;  1FLS A;  2K2G A;  3O2X A;  830C A;  3F17 A;  4GWN A;  2O3E A;  1IAB A;  1QJI A;  1XFY A;  1O0Q A;  2JIH A;  1ATL A;  2E2D A;  3G42 A;  1I73 A;  1C7K A;  2E3X A;  1ZVX A;  5D3C A;  5I4O A;  1OS9 A;  3LEA A;  3E8R A;  1HFS A;  4H49 A;  1KBC A;  2USN A;  2W13 A;  1JAP A;  3VTG A;  1PWP A;  4QKZ A;  2MZE A;  4L63 A;  4WKI A;  4H2E A;  1O0T A;  2I47 A;  5CZM A;  3LE9 A;  1IAG A;  1YOU A;  3F18 A;  2OY2 A;  3RTS A;  1FM1 A;  1AST A;  1YP1 A;  1ZXC A;  1SRP A;  2X3C A;  1DTH A;  4HMA A;  3EDH A;  2POJ A;  1Q3A A;  5L7F A;  2JSD A;  3DWB A;  1C3I A;  1PWU A;  2AIG P;  4DD8 A;  966C A;  4H3X A;  3B2Z A;  1XM5 A;  5BOT A;  1OMJ A;  1GO7 P;  3KEK A;  3K7N A;  1MMQ A;  4GWM A;  4A7B A;  1XFV A;  1GKD A;  1OS2 A;  2XS3 A;  4ON1 A;  3GBO A;  2YIG A;  3LJG A;  3ELM A;  1DMT A;  3EHY A;  1BKC A;  3USN A;  2Y6C A;  3L0V A;  5L79 A;  3G5C A;  1Z3J A;  3LIK A;  2MLR A;  2OXZ A;  3HBV P;  3N2V A;  1GE6 A;  3HYG A;  2MLS A;  1SLM A;  2N8R A;  3KMC A;  2QPJ A;  1G49 A;  1EB6 A;  4DV8 A;  3NX7 A;  4JA1 A;  1IAA A;  2K9C A;  1RMZ A;  3HDB A;  3LQ0 A;  3F15 A;  3LIR A;  3LJZ A;  4PKQ A;  3HB2 P;  3TSK A;  2CKI A;  1YCM A;  2OW2 A;  3ZUK A;  1SMP A;  1WNI A;  1OM6 A;  1JAQ A;  4GR8 A;  2PJT A;  3UVC A;  3OHO A;  1CGF A;  2D1O A;  5D7W A;  2KRJ A;  3AIG A;  4AUO A;  3Q2H A;  1K7G A;  2Y6D A;  3WV3 A;  2A8H A;  3B92 A;  4PKR A;  1GKC A;  4XBH A;  1D8M A;  1QJJ A;  2ERQ A;  4EFS A;  1UEA A;  2OW1 A;  4FXQ A;  1BM6 A;  4XM7 A;  3HBU P;  5B5O A; 
#chains in the Genus database with same CATH homology
 1EAK A;  1HV5 A;  3LIL A;  1Y8J A;  1QIB A;  2OZR A;  1OM7 A;  4XCT A;  1KUF A;  5CUH A;  4FXY P;  3DTI A;  3I7I A;  2FV9 A;  1SAT A;  3F19 A;  1GXD A;  1S4B P;  3KWV C;  5D2B A;  1G05 A;  2DDF A;  3I7G A;  1UTT A;  1QUA A;  5LAB A;  1XFZ A;  2X3B A;  1R1H A;  3HDA P;  1CAQ A;  1GE5 A;  3LJT A;  4AIG A;  1HOV A;  3DTE A;  3KME A;  3O64 A;  3KEJ A;  1PWV A;  1ZTQ A;  3B8Z A;  5D1S A;  2WO8 A;  2TCL A;  2W0D A;  1MNC A;  1R1I A;  4JP4 A;  1UTZ A;  4JIJ A;  1H71 P;  5BOY A;  1K7I A;  1OO9 A;  4DPE A;  4R3V A;  2D1N A;  1BKC I;  4G9L A;  3EDG A;  4H76 A;  3DTK A;  2AYK A;  2OW9 A;  1CXV A;  2V4B A;  2OI0 A;  1ND1 A;  3LK8 A;  3DSL A;  1XUC A;  1K7Q A;  1EUB A;  3RTT A;  4DF9 A;  3P24 A;  3F1A A;  4WKE A;  1JH1 A;  2J0T A;  1PWW A;  1I1I P;  456C A;  1BUV M;  3ZVS A;  4Q1L A;  3Q2G A;  5I0L A;  5I3M A;  3L0T A;  1USN A;  1KUH A;  1UMS A;  2DDY A;  3EDZ A;  3EWJ A;  3HY7 A;  2OVZ A;  3DL1 A;  4AYK A;  1IAD A;  2L0R A;  1R55 A;  1FBL A;  4GUY A;  1D7X A;  1IAC A;  5I43 A;  1JAN A;  1CGE A;  1G4K A;  4FVL A;  2SRT A;  4L19 A;  4PKV A;  4ZR5 A;  1XFU A;  1KAP P;  4GR3 A;  4PKT A;  3OHL A;  1Y0V A;  2JT6 A;  3HY9 A;  4GR0 A;  1ZP5 A;  1JAO A;  2MZI A;  3V96 B;  1A86 A;  3F16 A;  1RM8 A;  1ZS0 A;  3DPF A;  3LUM A;  1BUD A;  1QIC A;  4AXQ A;  1Y93 A;  2OXU A;  1B3D A;  1BIW A;  1AYK A;  2O36 A;  2DW1 A;  4H1Q A;  2W12 A;  1CIZ A;  3TVC A;  4J4M A;  4WK7 A;  2FV5 A;  1JKY A;  5JMY A;  2WO9 A;  1HFC A;  3CKI A;  2OXW A;  4L6T A;  4JPA A;  3U1R A;  1GE7 A;  1G9K A;  1BQO A;  2ERO A;  1QIA A;  4GQL A;  3TS4 A;  2X7M A;  3EHX A;  4ILW D;  3LKA A;  1BSW A;  3SHI A;  1R54 A;  4IJO A;  2YB9 A;  1XFW A;  2JNP A;  5H8X A;  2CLT A;  4I35 A;  1JK3 A;  4WZV A;  4GF1 A;  1MMP A;  1JIZ A;  2Z2D A;  1HY7 A;  1SU3 A;  1A85 A;  4PKU A;  1XUR A;  1D5J A;  2OY4 A;  1ROS A;  4IN9 A;  2W15 A;  5I12 A;  1CQR A;  3N2U A;  2ERP A;  1J7N A;  5BPA A;  1PWQ A;  4I03 A;  5CXA A;  3P1V A;  1JJ9 A;  2X3A A;  3BA0 A;  3DNG A;  4A3W A;  2JT5 A;  5D1T A;  4L7A A;  4H82 A;  1R1J A;  2YUF A;  2XS4 A;  3K7L A;  1UMT A;  3LGP A;  1KUK A;  3KHI A;  1MMB A;  1CK7 A;  3WV2 A;  2W14 A;  2DW2 A;  3MA2 A;  2WOA A;  4WF6 A;  3EDI A;  3LUN A;  4XM6 A;  1XUD A;  3ZXH A;  5B5P A;  4CTH A;  4H30 A;  2OW0 A;  4HX3 A;  1IAE A;  1AKL A;  3AYU A;  1ZXV A;  1B8Y A;  1OM8 A;  1C8T A;  2DW0 A;  3LMC A;  1MMR A;  1BQQ M;  3VI1 A;  3AYK A;  3LQB A;  1SLN A;  1GO8 P;  1BZS A;  1D8F A;  3KEC A;  4PKW A;  4FU4 A;  5I2Z A;  1YQY A;  2MZH A;  2OVX A;  1KUG A;  1I76 A;  1BKC E;  1CGL A;  5D1U A;  3WV1 A;  1KUI A;  1XFX A;  4H84 A;  2HU6 A;  1AF0 A;  2RJQ A;  4IUW A;  4XM8 A;  3TT4 A;  1HTD A;  4JQG A;  1L6J A;  3DPE A;  1JIW P;  1G12 A;  4PKS A;  4G0D A;  2J83 A;  3KRY A;  2RJP A;  1FLS A;  2K2G A;  3O2X A;  830C A;  3F17 A;  4GWN A;  2O3E A;  1IAB A;  1QJI A;  1XFY A;  1O0Q A;  2JIH A;  1ATL A;  2E2D A;  3G42 A;  1I73 A;  1C7K A;  2E3X A;  1ZVX A;  5D3C A;  5I4O A;  1OS9 A;  3LEA A;  3E8R A;  1HFS A;  4H49 A;  1KBC A;  2USN A;  2W13 A;  1JAP A;  3VTG A;  1PWP A;  4QKZ A;  2MZE A;  4L63 A;  4WKI A;  4H2E A;  1O0T A;  2I47 A;  5CZM A;  3LE9 A;  1IAG A;  1YOU A;  3F18 A;  2OY2 A;  3RTS A;  1FM1 A;  1AST A;  1YP1 A;  1ZXC A;  1SRP A;  2X3C A;  1DTH A;  4HMA A;  3EDH A;  2POJ A;  1Q3A A;  5L7F A;  2JSD A;  3DWB A;  1C3I A;  1PWU A;  2AIG P;  4DD8 A;  966C A;  4H3X A;  3B2Z A;  5BOT A;  1OMJ A;  1GO7 P;  3KEK A;  3K7N A;  1MMQ A;  4GWM A;  4A7B A;  1XFV A;  1GKD A;  1OS2 A;  2XS3 A;  4ON1 A;  3GBO A;  2YIG A;  3LJG A;  3ELM A;  1DMT A;  3EHY A;  1BKC A;  3USN A;  2Y6C A;  3L0V A;  5L79 A;  3G5C A;  1Z3J A;  3LIK A;  2MLR A;  2OXZ A;  3HBV P;  3N2V A;  1GE6 A;  3HYG A;  2MLS A;  1SLM A;  2N8R A;  3KMC A;  2QPJ A;  1G49 A;  1EB6 A;  4DV8 A;  3NX7 A;  4JA1 A;  1IAA A;  2K9C A;  1RMZ A;  3HDB A;  3LQ0 A;  3F15 A;  3LIR A;  3LJZ A;  4PKQ A;  3HB2 P;  3TSK A;  2CKI A;  1YCM A;  2OW2 A;  3ZUK A;  1SMP A;  1WNI A;  1OM6 A;  1JAQ A;  4GR8 A;  2PJT A;  3UVC A;  3OHO A;  1CGF A;  2D1O A;  5D7W A;  2KRJ A;  3AIG A;  4AUO A;  3Q2H A;  1K7G A;  2Y6D A;  3WV3 A;  2A8H A;  3B92 A;  4PKR A;  1GKC A;  4XBH A;  1D8M A;  1QJJ A;  2ERQ A;  4EFS A;  1UEA A;  2OW1 A;  4FXQ A;  1BM6 A;  4XM7 A;  3HBU P;  5B5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...