3Q2IA

Crystal structure of the wlba dehydrognase from chromobactrium violaceum in complex with nadh and udp-glcnaca at 1.50 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
352
structure length
345
Chain Sequence
b'MIVIPPITDRKIRFALVGCGRIANNHFGALEKHADRAELIDVCDIDPAALKAAVERTGARGHASLTDMLAQTDADIVILTTPSGLHPTQSIECSEAGFHVMTEKPMATRWEDGLEMVKAADKAKKHLFVVKQNRRNATLQLLKRAMQEKRFGRIYMVNVNVFWTRPQEYYDAAGWRGTWEFDGGAFMNQASHYVDLLDWLIGPVESVQAYTATLARNIEVEDTGTVSVKWRSGALGSMNVTMLTYPKNLEGSITILGEKGSVRVGGVAVNEIQHWEFSEPHAMDEEIKDASGFGHPLYYDNVIKTMRGEATPETDGREGLKSLELLIAMYLSARDGRRVSLPLDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dehydrogenase
publication title Biochemical and Structural Characterization of WlbA from Bordetella pertussis and Chromobacterium violaceum: Enzymes Required for the Biosynthesis of 2,3-Diacetamido-2,3-dideoxy-d-mannuronic Acid.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Oxidoreductase
total genus 132
structure length 345
sequence length 352
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3q2iA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3q2iA01
1PEDA 1E3JA 3IOYA 1LJ8A 3DMYA 5K6AC 2RH8A 3DBVO 4B7UA 1IPEA 4WCFC 3TJRA 4QECA 4YAKA 1RM0A 1ZH8A 5CDUA 3B6ZA 2OGUA 3V5NA 1KVRA 2BFAA 3HN7A 2VWQA 3GC6A 3I9KA 1H9BA 5A02A 1GTMA 3BA1A 1LUAA 4A2CA 5BNIA 5L7TA 2GDZA 1PGPA 2DM6A 3JQGA 4IS2A 5CPFA 3AJRA 3L07A 3KSDO 4IDDA 4FR5A 4BNHA 1Y8QB 4W7IA 4OL9A 3F6YA 4U0KA 5G0UA 1ZSVA 3KEOA 4LW8A 2NNLD 2JD0A 1GEEA 4RJTA 4EW6A 3MWEB 4QO7A 6LDHA 2B69A 3C3XA 4FFPA 4UAGA 1T24A 2NUAA 3WSWA 2E37A 1DJQA 3AY3A 2VHYA 1RPNA 1QYDA 1MX3A 3I4CA 2GN8A 2NTNA 1ID1A 1DSSG 2O3JA 3BHMA 3F3SA 4DBVO 1JKJA 5DULA 1U3VA 4J4HA 3T4XA 3QWHA 4GKBA 1R12A 1JKFA 4XR4A 5HTOA 1QR6A 1Y6JA 4B3JA 5B4UA 1KEUA 3ZWAA 2NTJA 3PIIA 3WBBA 5AXAA 4RPHA 4DXHA 1PR9A 1DLIA 5G4LA 4E12A 4EITA 1B2LA 1T25A 4IXWA 2Y99A 5C37A 2DVMA 1BXGA 1P1HA 3TRIA 2B4TO 2NLOA 4JROA 4Q3NA 3LLVA 3IKVA 4YAJA 5K6AA 3Q1LA 2GASA 3BMNB 3K2EA 4WCFA 2D5CA 3E6AA 4C7JA 2C07A 5B1YA 2FP4A 4LVUA 4A03A 5L9AA 1SEPA 3D1LA 4B3IA 1QYCA 2WD7B 4IDGA 4D43A 3K2BA 3EY4A 1VM6A 3AUTA 5I7VA 1OC4A 1RYDA 1DHRA 5CEEA 3JCZA 1QXSA 3ENNA 4YJGB 4BNWA 5A05A 4DMMA 4PLCA 2O23A 4Y6RA 4BHTA 1NVMB 3T4EA 3PWSA 3EMKA 3T7EA 4UEJA 2PGDA 3GA0A 4LSMA 4IJVA 5TJ9A 3RWBA 3GZ4A 4BMVA 3VPGA 5DCUA 1BW9B 5B12A 2HLPA 3RASA 1NQ5A 3PYMA 3JTMA 2GLXA 3UW3A 1EDOA 2BFOA 2Y68A 3CINA 4OO3A 4BNVA 3H9EO 1AXGA 1O95A 3AM3A 4AJKA 1RM4A 4M1QA 4ND2A 3K73O 1ZMTA 2DBVO 4LCEA 2O3UA 3W8DA 3RAJA 4BO8A 1EQUA 1MFZA 2GRAA 2P5UA 3GUCA 3I5MA 3GFBA 2W90A 3DL2A 2OFPA 3RC7A 2X58A 2ZYDA 2Q2WA 2CDCA 2W8ZA 1ENOA 3GRKA 3Q2IA 3SLKA 2G17A 5TS3A 3WGTA 3K92A 3PLNA 5TRTA 3RUCA 2PH5A 1U7TA 3KZVA 4J1NA 1N5DA 3LC7O 3ITDA 4RF4A 4WPGA 4Q3EA 1P0FA 4HV4A 3VC7A 2PZKA 4A5OA 1B0AA 3BMOA 1NWCA 4YACA 1UDAA 4C4OA 3ZW8A 5B4VA 4NI5A 4J1TA 1YDEA 1XQ6A 3JYNA 4BO4A 4FSHA 1EVZA 4DBZA 4PLTA 2NM0A 3ONDA 3PHLA 4KQXA 3DMTC 3UXYA 1UP4A 1WWKA 2DU8A 4E5KA 1SEVA 3OM9A 1DB3A 1LDMA 3UCEA 3EVTA 1MFPA 2AXQA 1GV0A 2B35A 5COAA 5IZ4A 3F9IA 3WGIA 4RV9A 2W4QA 5I9NA 1JAYA 1NPYA 4OSPA 1B8PA 4N7RA 4DYDA 1DPGA 5EERA 5FYDA 4RPJA 3V2UA 4W82A 1SB8A 4ID9A 3UF0A 3SEFA 2CFCA 5F5NA 1C0KA 3GDGA 4ALJA 2VCYA 1H2BA 3DTTA 3OJOA 4LN1A 4N5MA 4GI2A 5TGDA 3P19A 3WX0A 3G0OA 4OGWA 1K6JA 1PZFA 4ALLA 1YL7A 4OYRA 5TT1A 1ZFNA 3EAGA 4GX1A 4J2HA 1LLUA 2A35A 1ZZEA 2EP7A 2YHIB 1XELA 1GEGA 1QYXA 3ZU2A 2PNFA 3ICCA 1M67A 4K6CA 1PJQA 3DZFA 4LMPA 1GZ4A 5KJEA 4QX6A 1U8FO 3MTJA 1WW8A 2X4GA 1KEPA 4IIUA 4HFJA 3OMLA 3L6DA 4KTTE 3LVFO 1EZ4A 1NAHA 3NDRA 5FF9A 2HJRA 3OJFA 1I2BA 4UUOA 3ZHZA 1AN9A 1DHTA 4FDAA 1YBVA 3DFUA 2X5OA 1DRUA 3ADOA 3I6QA 4B4VA 1X14A 2BI8A 4JXKA 4RVFA 1DC3A 4IGEA 4XQ9A 1XSEA 4IQ0A 3OBBA 1P3DA 2BRUA 1KS9A 1Q7CA 4IPTA 3KETA 5THQA 2R00C 2Z1NA 3AFNA 3GY0A 1Z6ZA 2RBEA 4BV8A 5C3MA 4J3FA 4MVJM 1T2CA 4DRYA 5H82A 3GN1A 4BL5A 1HEUA 4BGEA 5L4NA 2BMAA 2Y1OA 2RHCA 4PIVA 4CV1A 4CLRA 1O0SA 2VWGA 1H0KA 4Z3KA 2WMDA 1TA4A 1A9ZA 4OOEA 3MCVA 1PL8A 2DPHA 2YDYA 1MGOA 4P8RA 4G81A 5T57A 1YH3A 4EJ6A 4YQYA 1QP8A 4CLOB 1MC4A 3D3WB 3F4LA 4XIYA 5ER6A 1P45A 3UAGA 1F06A 1ISFA 2J3JA 1HSZA 2Q50A 3C24A 1OMOA 4B8ZA 1NFQA 4CR7A 4J49A 4E3ZA 3PWKA 3PP8A 2HRZA 2RHRA 4BB6A 1GYPA 1I30A 2IEDA 4LMRA 4XA8A 9LDBA 1GZ3A 3HE3A 1NFFA 3LT4A 1SO8A 1I5RA 3RBVA 2B5WA 4BOYA 4TVBA 1NR1A 1KY5A 3B70A 4TROA 2IRWA 3FTPA 4R41A 1Q0HA 2WE8A 2P4HX 1A72A 1HDOA 1HZJA 3CEAA 3PYLA 3GGGA 4E5PA 3TZ6A 4Z0HO 3LT0A 1DFHA 1QYWA 2JHGA 2UVDA 3DAFA 3QP9A 3OJEA 4D3FA 1XGKA 1PZGA 3AU9A 5G0WA 2A94A 2AEFA 4O63O 3TNLA 4EZBA 4UEKA 2R00A 1ISIA 1I36A 2AHRA 1C1XA 3AW9A 2PZMA 1NVTA 1R4MB 3K9QO 1LC3A 4UULA 2O3SA 1X7GA 1NBOA 1VKOA 3PHHA 4UVGA 4W7HA 1B7GO 1K0UA 1K6XA 1U3UA 3HN2A 4ZVVA 3UFXA 2EJWA 1TT7A 4LRTB 4KZPA 3B1JA 1LDGA 4HFRA 1DIGA 2VOJA 4EJ0A 1V3TA 1MG5A 4YT5A 1VSVA 4KP7A 3WWYA 4OQYA 2VHZA 2VZ0A 2YHUA 3AY6A 1E7QA 4HNHA 1PL7A 3ON5A 1ADCA 2W2LA 4ALKA 1PL6A 4ZD6A 3A28A 2EGHA 2J3KA 3V2GA 3EUWA 2O7QA 2FY8A 1WDLA 2DQ4A 3W4IA 3WJAA 3ZHXA 4DTIA 4UUPA 2A4KA 1P9LA 4GGPA 4CM4A 2AQ8A 2QRLA 4WNIA 3OP4A 3H5RA 2AEMA 2IE0A 1QORA 4PLVA 4CMAA 3RQSA 1P44A 4OQZA 4WASA 5TT0A 2PKRA 1NPDA 4NHEA 2EG9A 8LDHA 3GG2A 3PFWO 4O0LA 4CMEC 1YB5A 3AOEC 3M1LA 1KVQA 1UXGA 3OJ0A 4E5MA 5IG2A 1ZEMA 4E0BA 1JAXA 4XZ3A 2GSDA 5CFZA 2VHVA 4RVDA 4MPDA 1X1EA 3VPXA 3WDSA 1BXZA 5F1PA 4AL4A 2CF6A 3WLEA 2IZ0A 2RH4A 3UCFA 5LDHA 4WGGA 4JNKA 5JCXA 4IDFA 4QSMA 2GCGA 3LYLA 3WGYA 3VH4A 2OO5A 1JQBA 1PGNA 2O7SA 2GERA 4TZKA 4WLOA 3BTVA 3VH1A 4YA6A 3S55A 5FFFA 1AGNA 4IXTA 5GMOA 1Y8QA 4NMHA 1EVYA 3K31A 1Z75A 3DBRB 5CP8A 1DJNA 1E7YA 3BTSA 5AQ1A 2CY0A 2ET6A 1PJLA 3VH3A 1V35A 1YL6A 3C1TA 5A9SB 3QVXA 1VLLA 4Z6KA 3LLSA 2DUWA 1KERA 4PLWA 3ANLA 3AUSA 3CMMA 2DAPA 2X86A 3C7AA 3H9JA 5IJZA 5HS6A 1DAPA 2BKAA 2PGJA 1P1RA 1D7OA 4CM8A 5FWNA 2VNAA 5BSFA 3VH2A 1O9BA 4BO1A 2B36A 2DFDA 4PLZA 2EGGA 2OHXA 3WXBA 2HK8A 1LRKA 4OJNA 1WZIA 4BNLA 5MGBA 1PS9A 1AE1A 3HG7A 2XF8A 3KSZO 4J6FA 1C3VA 4PGFA 4IINA 3G1UA 3AU8A 1YDWA 4EYEA 4CMEA 1HRDA 1UAGA 3E9NA 2VNSA 1PJTA 2V6BA 2X8LA 4RVUA 4FIZA 4YDRA 4J91A 2D4AA 3NEPX 3BMQB 4BO6A 3RIHA 4GMFA 1K5HA 4M89A 5TX7A 2C82A 3BMNA 4CMGA 3N58A 1OZAA 1EBFA 1HYEA 3A06A 4FOOA 1FF9A 4TRRA 5JC1A 3JQAB 3JYLA 2EP5A 3ZGYA 2WD7A 4RPLA 3E82A 1XDWA 3M2PA 4DMLA 4GX0A 1Y5MA 2G1UA 4YJGA 3JD2A 4PCVA 1MB4A 2CZCA 3GNSA 4IBOA 4FN4A 9LDTA 2RAFA 2UUPA 4GGOA 4K1LA 5EQDA 1K2WA 1YKFA 2ZTUA 2OXIA 1MG0A 2EIHA 3HWRA 1GCUA 4OMUA 1YS4A 1HDCA 1HDXA 2H63A 4AJHA 1BW9A 1LLQA 1UDCA 2Z1MA 1U3WA 5DF1A 2FR8A 5U4QA 3RD5A 4WEOA 3PJDA 3DHEA 4OKNA 2HSDA 5L53A 1E7RA 4DA9A 5CEJA 5I7SA 2YV1A 5IXSA 3TSCA 2E6UX 3ROKA 4CM5A 3IIEA 3WLFA 3A4VA 2VWHA 4GMGA 4YAIA 2BHLA 3NJ4A 2Q45A 4O1MA 5ITWA 3GNQA 1ZK4A 2EW2A 1UXIA 4IDEA 3C1AA 1K3TA 1XG5A 1UDBA 3NT5A 2QG4A 3ICPA 3KYBA 3L4SO 1IOLA 2P2SA 3NT2A 3AWDA 1N9GB 3GFGA 4CV0A 3HDQA 5M6DA 1QLHA 1E1MA 1LRJA 5TNXA 5H83A 1CJCA 3H3FA 3RUHA 4AG3A 4GSLA 2UYYA 3HSKA 2O4UX 1HZZA 3PK0A 4ILKA 3CH6A 4NR0A 4WLUA 2VT2A 4XIJA 1F14A 4NG5A 1P0CA 3ZWMA 1XU9A 3I1JA 4W9NC 1HSOA 5JAQA 3IQDB 4KDFA 3RROA 2VUUA 4BQPA 4FBGA 5TLSA 1V9LA 5L4LA 1NPTO 1SPXA 1ZMOA 2WEKA 4GBJA 3W8EA 3V1YA 4HUJA 2I99A 3RBZA 2P4QA 3RFTA 1GCOA 4K6FA 3TZKA 4NH4A 1AUPA 1S6YA 3H5AA 4AJ4A 4YPOA 3LF1A 4Z0PA 4FJ1A 5T6BA 4EJMA 4PLYA 3TOXA 4WUVA 2GO1A 4XWYA 2EKPA 2YFHA 1VL0A 4BQRA 3FPLA 4L0QA 2QRKA 1OFGA 2WM3A 3D3EA 3MJCA 4PLFA 4R1UA 1UZMA 2Y05A 3A14A 3ANNA 3Q6IA 1MLDA 4HBGA 2A9FA 2ZTMA 1DOHA 4NZ9A 4CMHA 3U0BA 5CG2A 1HE4A 1EDZA 2Y0DA 1NQTA 2H9IA 3AFMA 3F1LA 4YJHB 2P91A 3TN7A 4CQLB 4A27A 3QVWA 1KYQA 1MUUA 1U2GA 2LDXA 3HADA 3PGJA 5DCYA 5I7EA 2V7PA 1T26A 3PPIA 4CMBA 3IUPA 4ZQFA 1PQPA 3BMCB 5A3JA 4A10A 2X9NA 1SMKA 4MVJF 1DFGA 4W4TA 2Y67A 4Y6SA 3WG9A 4FPXA 3GEGA 1XYGA 4J1QA 3PJFA 3SBOA 2C20A 2GN6A 3AUUA 4FGWA 7ADHA 3PEFA 1YBMA 2WYVA 4IDBA 1JWBB 1LRLA 5JAIA 3W4KA 5BNFA 3HJAA 3U9LA 5KVQA 1YB1A 1GAEO 2NQ8A 5EIOA 4IJUA 2O3RA 4XRRA 2JL1A 4ZGWA 2Y93A 4WOKA 5GZ3A 1GR0A 5I8ZA 4AJNA 4HADA 2Y1GA 1XA0A 1ZCJA 3ROMA 2ZIZA 3WSVA 5JDIC 2VRBA 3TDKA 5EJ2A 3DZJA 1GD1O 3DOCA 4J43A 3I3OA 1EK5A 4UUMA 5KJ6A 4Z9FA 3B1KA 2RCYA 5L4SA 2PKQO 2O4CA 4CM7A 3F4BA 4GSKA 4XDZA 1A4IA 4L4XA 4FFLA 4BGUA 5AXBA 5EINA 4INAA 4CLOA 3DTYA 2O3QA 3D3WA 4AJ2A 1XIVA 3GT0A 2ZTVA 1XHLA 4XYEA 1DIHA 1GQ2A 2Z95A 1E3IA 4JBHA 3RFVA 2WDZA 4XB1A 1K89A 1PZEA 4J7XA 1HXHA 3ZZNA 3I83A 1TLTA 4NK5A 2VWPA 4RGBA 1KOLA 4BNZA 1H94A 4JJFA 4NJMB 4RF3A 4RDHA 3FR8A 3B1FA 3ITKA 3FNHA 4L9RA 3OECA 1E3SA 5DN9A 1ISJA 2HO5A 3Q2KA 1OOEA 1ZSNA 2FZEA 2HMVA 3N7UA 3RJ5A 1ONNA 4AJPA 2HCTA 4KUHA 3VDRA 1Q7GA 4LVCA 3ABIA 4XGNA 2E82A 4GVXA 2WJPA 4TRMA 3DXFA 1FXSA 4UVIA 4B7XA 4N18A 3AI3A 4DIFA 3UKOA 1XU7A 3RKUA 1PJCA 5AXDA 4Y6PA 1QV7A 3GG9A 5L3ZA 4UEOA 4ZRMA 2J5KA 4L8VA 1PIWA 2QW8A 4A26A 3C8MA 1FJHA 2WE7A 2UUOA 3QQPA 5AYVA 5HA5A 3WYEA 4CLXA 2VRCA 4GH5A 4QO8A 5IN4A 3NTRA 2QZZA 4I5DA 4RLSA 3DZHA 4FOSA 3LF2A 1R4MA 2NU7A 4F3YA 2I66A 2O2YA 5JDIA 2Q46A 5U9CA 4BO9A 4J0FA 4RCVA 1XQ1A 1PQUA 5ITVA 2BH9A 1X15A 3E9MA 4RL6A 1QRRA 3GNTA 1XLTA 2Z5LA 3JQ7B 1Z73A 1ZW1A 3RUEA 4E5YA 4HY3A 1YJ8A 1ENYA 5DNAA 1SCUA 4LSWA 4DIBA 3GPDG 1CEQA 2DLDA 3OF2A 1LLCA 1R4NB 2X9VA 4L4SA 3P7MA 2G5CA 1R37A 3FWZA 2IXBA 1A4UA 3FD8A 3I6IA 4RF2A 2P68A 1P1IA 2PY6A 4BS9A 4D0SA 1K6IA 2O2SA 4PG6A 4I9UA 3U62A 3WQSB 2EF1A 4DREA 1NX6A 2D3TA 3DONA 4J7CA 3EC7A 4MVJG 1IULA 4YJDA 1HE3A 4E33A 1MXFA 2VTDA 3JQ8A 5IFLA 3IL2A 4UVHA 3P2OA 3GDFA 3KHUA 4K28A 3ASVA 1T1SA 3U4HA 2BFMA 3WYCA 3OQBA 1B26A 1BGVA 3GPIA 5HM8A 4Q9NA 2EKLA 3VZPA 5B4TA 3HB5X 1J5PA 3S2FA 3LDHA 2GZ2A 3H7AA 1N7GA 2I6TA 4DLLA 2Q3EA 1FMCA 5COBA 3GN2A 1P1JA 3WMXA 5EL0A 1E7MA 2B37A 2AE2A 5I8WA 4DQVA 3GR6A 1FDWA 1N2SA 5BT9A 1JW9B 1TT5B 4J2OA 2GUGA 4B7CA 5IDQA 1RWBA 4R9RA 2IZZA 3F1KA 2PD3A 4PVCA 4YT4A 3DAGA 5A03A 3DBHA 5G2OA 3IMFA 4R01A 3ETGA 4BUCA 3FCOA 5CPBA 4CM3A 2QHXA 4CR6A 2A92A 4WOJA 3E03A 3WGQA 5KVSA 3DBRA 4JJIA 5JYFA 1FK8A 5FI5A 3JQAD 5A9SA 4GPD1 4H15A 1RKXA 4BNXA 2VOEA 4RLHA 1PWXA 1VJ0A 4E2WA 4EEXA 3ORFA 3K30A 5A9TA 2Y1CA 1WXDA 4E4YA 2H5LA 2IZ1A 3E5MA 3GGOA 4OXNA 2G76A 2VHWA 2WYUA 4DGSA 3OFSA 5JYEA 2JJYA 3JD4A 4RORA 2YV2A 1HDGO 1P1KA 2FSVA 3QJ5A 3SX2A 3W6ZA 4ESOA 1WMAA 5L7YA 4CQMD 2AQKA 1NHGA 3DR3A 4WE3A 1LQTA 5C7OO 3UICA 3VVCA 1LDEA 3AUAA 3QRWA 4GAEA 2X5JO 3OH8A 4M8SA 1JDJA 3INRA 5IAAA 4AJEA 2GYYA 1A27A 4MKRA 2R6JA 4QFCA 4KTVE 3BMQA 5AOVA 1H93A 2NTVA 4NBRA 1I3KA 4AVYA 2VTEA 3JYPA 2AA3A 4E2XA 4ZU3A 3W6UA 1KETA 3PVZA 1UR5A 5KCZA 3JQAA 2NVUB 1GY8A 3OQ1A 3FR7A 4EGFA 5TC4A 2PGLA 3PWZA 3GF4A 4DC0A 1PZHA 1PX0A 1IL0A 3KM0A 1TI7A 4JCOA 1ADBA 2Q1WA 3IJRA 4AJ1A 1CWUA 2FHSA 2H6EA 1BDMA 2FRDA 3FRJA 5JE8A 3O26A 3VOSA 2CF5A 3DWFA 3RC2A 1E92A 5DOVA 4YAEA 3TOZA 1ZXBA 3F47A 3JD0A 2I65A 4R4JA 1VPDA 2I3GA 3PGXA 3ZWVA 4II3A 2ZQYA 2GD1O 1NVGA 1Q7BA 2VUSA 3L6EA 3BZUA 4R9SA 1LSJA 1M2WA 1Y1PA 4JLWA 4M86A 4YJFB 5IDXA 4WJZA 2Q4EA 4LCJA 4FCCA 3RBXA 5CEFA 1C0PA 1T4DA 2BD0A 3CXRA 1KVUA 4RQUA 3FF4A 3AI2A 2AW5A 3ZV3A 2DTXA 3DMTA 2O3TA 2NACA 5I9MA 2D0IA 3SC4A 3EW7A 5A3VA 1E3LA 2FWMX 2ZB7A 1N8KA 4ND5A 2V6FA 3FPCA 3CKYA 5U1PA 3ZWPA 3SVTA 2DTEA 1N9GA 1YB4A 1SBYA 2XXBA 3WFJA 2HU2A 2Q1UA 1HE5A 3O8QB 2X23A 4J0EA 1U7HA 4MO2A 3NYWA 1E7SA 1DC5A 1HLDA 4UVDA 1EBUA 3OA0A 4BMSA 1XCBA 2CSUA 4AJOA 2IEBA 3ENKA 4DLBA 1L7EA 3HFSA 4MIEA 3DHNA 1JVBA 4PLGA 1A5ZA 4N5LA 3MJ4A 1V3VA 1WVGA 3DZGA 2GZ3A 2GN9A 1EUZA 3ROPA 2I3AA 5ICMA 4S1VA 3E8XA 4BO0A 4OM8A 4NU5A 1DXYA 2DUUA 4XRGA 3LC1O 3DHYA 3N74A 3EZLA 4GLLA 4RO0A 4FC7A 2CD9A 4I5GA 2DTDA 4A0SA 3QVOA 4L73A 3IP3A 2BELA 4BNTA 5F1OA 2AQIA 4UREA 5JMPA 2HKIA 4F45A 4L75A 4JP2A 1OI7A 2EKQA 2Q2VA 1WMBA 3VTFA 4NBWA 4ROSA 1M75A 4I5FA 4YB8A 1NR7A 1VC2A 3OHSX 4YJHA 2BI7A 5DZSA 4CQLA 1JWAB 4WK6A 1X0VA 1YOVB 5LC1A 2XOXA 4EUHA 1NAIA 3KRTA 1EEHA 4DVJA 4E30A 1NWHA 1YO6A 2YUTA 4DL9A 3BMCA 2C59A 1YQDA 3WGZA 1QYVA 2Y66A 1IB6A 2Y1FA 6ADHA 2ILTA 4CV2A 1Y81A 1YJQA 2JCYA 1BXKA 4QT0A 4Q3DA 2DBRA 3W1VA 1Y5RA 1GL3A 2Y1EA 3ADPA 3JQGB 1G1AA 1MP0A 2JD2A 1LBEA 1ULSA 4S3MA 4XR9A 5JY1A 2FMUA 1U28A 2HUNA 4ND3A 1QSGA 4B4OA 1HWYA 4BO2A 4FD3A 3ZU3A 4JQCA 4XGKA 5DCWA 1UXJA 4WLNA 1ZXLA 4XEHA 4TWRA 3ZV4A 3GMSA 1FDUA 1I32A 1LQUA 1ENZA 2ZCUA 1R16A 3VZQA 4FC6A 5B37A 3TFOA 1I33A 2HJSA 1I2ZA 2HK9A 4NQZA 2JFFA 3FBGA 3L0DA 3K8ZA 1N1EA 5DBGA 1P1FA 3I9NA 1IHYA 3MZ0A 3JQFC 3X2FA 3BTUA 1BG6A 1MXHA 1PSDA 4IY1A 4D41A 1IY8A 2H1SA 2ZB8A 2VQ3A 3ZU5A 3AI1A 1SOVA 3GZNA 1GUYA 4WLEA 4BO3A 1A7KA 1Y8RA 1LDNA 1H5QA 4YBZA 4AJJA 3E1KA 5KIAA 3G49A 4PZEA 2FSSA 2AG8A 3ZNPA 2Q22A 2GGSA 1X13A 1KY4A 3C85A 1H6BA 3CSDA 3DZBA 4OSOA 1LDYA 4BNFA 1ARZA 3K96A 3PJEA 3EK2A 3QY9A 4JK3A 2EV9A 1B8VA 2C2XA 1PR3A 3BTOA 2HMWA 1SAYA 1O6ZA 7MDHA 2ZK7A 3U4CA 1DDOA 4AFNA 1CQIA 1SNYA 2FPPA 4NJMA 3S8MA 1HE2A 1RYEA 5ER9A 4GQAA 1YQXA 2OP1A 3MWDB 4I9NA 4YRDA 1J0XO 4GL4A 4OXYA 2VYVD 3CE6A 4XYGA 3GMDA 5H81A 3PTZA 1O5IA 2NVWA 4FQ8A 3OIGA 3WGOA 4D3DA 5IF3A 1MA0A 4J9VA 2CMDA 2AE1A 4CJXA 2GN4A 1E3EA 4D46A 4FS3A 1YL5A 5JAMA 3QV1A 5EN4A 5BQFA 3Q0EA 3JQFA 5EQFA 5THKA 3INTA 5BNTA 5TIIA 4BV9A 2FZWA 4PZCA 3FHLA 4KQWA 1E5QA 4XYBA 1HTBA 4IMPA 5JFOA 1ZO8A 2IYPA 3MEQA 4CLDA 3LU1A 1NQOA 3JQ7A 3PLRA 1GQQA 2PK3A 4Y8VA 2ZYGA 3JQ6A 3AOEA 2EXXA 2RIRA 2X22A 4M55A 1VL8A 4YYZA 3PDJA 1X7DA 3GVHA 2GZ1A 5ENDA 1ZJZA 2HRBA 3ZWXA 2X0JA 3WFIA 4RF5A 1O89A 3ASUA 2OP0A 2E4AA 4J4TA 4E21A 1B15A 1Y7TA 3AK4A 3KB6A 4J90A 1KBZA 3MOIA 5KJ1A 1B3BA 3QIVA 3EVNA 4QUKA 8ADHA 3AY7A 4UUNA 3QWBA 1DIBA 4MINA 3PQDA 3RUIA 4IQGA 4MVJE 1NP3A 1RJWA 2C5AA 4RPGA 4MVJI 4E13A 1B3RA 1H6DA 2WD8A 3GUYA 1H6AA 1GUFA 5T67A 1D3AA 4IDAA 4TVOA 4XJSA 3GAFA 2J5QA 3RC1A 4JP3A 4O59O 2QYTA 4TKMA 1LU9A 1X7HA 4YTEA 4CQMB 1TT5A 2C54A 4GWKA 3E5RA 5JMWA 4NIMA 3WQQA 3FN4A 3WB9A 1TVEA 1LTHR 3EDMA 4D44A 2PH3A 4R16A 3IS3A 1E0DA 4J4BA 2OZPA 1G0OA 2F00A 5TJHA 4L74A 4CLEA 2Q1TA 4NBVA 3R6DA 4XDYA 1JKIA 3WBFA 1R15A 5HBRA 1MV8A 4DQXA 2PV7A 4ALMA 4PLHA 4YQZA 1E3WB 5IN5A 4DQUA 5A06A 3T7CA 1T1RA 5L95A 1AXEA 4WCDA 3KXDA 5EMHA 2YV3A 3JYQA 3S1LA 3D4PA 4NPCA 5JSFA 1U4OA 3L77A 5FI3A 1EVJA 1S7CA 3RCBA 4NNJA 4RQTA 5F21A 3I23A 4PLPA 3H3JA 2FR1A 5KKCA 3U4DA 3OIDA 4XJTA 3OICA 3VPFA 3ZW9A 2X0NA 1LSUA 1U9JA 5A1TA 1R0SA 3AOGA 3TZCA 2CNBA 4XD2A 1LEHA 5TQVA 3QHAA 4F46A 1NM5A 3ZHYA 4XB2A 2CUKA 4TRJA 3RJ9A 3NT4A 3VTZA 2VZ9A 1ENPA 4ZN6A 1I8TA 1X0XA 3VHRA 3DOJA 1PU2A 3RU9A 3S2GA 2I76A 5C7IO 2NU9A 4ZQGA 1XR3A 1EMDA 1F8FA 3PDUA 2FR0A 3PXXA 3UN1A 4YRBA 1Z7BA 2NVUA 2ZKLA 4D3SA 5ADHA 1SOWA 4WKGA 4BIIA 1GU7A 4DIOA 3CTMA 4P38A 4B4UA 2XAAA 1KC3A 3M2TA 3KTDA 3WGGA 1U8XX 3EYWA 4E6PA 3ZNOA 3O38A 2QRJA 4URFA 3SXPA 4MP6A 4Z3DA 1RM5A 1E77A 4BNKA 5A4DA 1VJ1A 1JLLA 1QV6A 1L7DA 2VYND 5T64A 4BNIA 3RC9A 2AG5A 2EWMA 2YHIA 4NK4A 3KBOA 2CVOA 3NGXA 4X54A 1JA9A 4EDFA 4Z0TA 5G4KB 4E2ZA 1VI2A 3I9JA 4I5EA 4R1NA 4W9NA 1BRMA 2PLAA 4CV3A 1OC2A 3S2EA 4YJFA 1DIAA 3R0IA 1LXCA 3FI9A 3LZ6A 1GUZA 1PS8A 4CMJA 1HDRA 2HMSA 2TMDA 3C1OA 3V1TC 1CETA 4FJ2A 3AM5A 4JIGA 3NX4A 2J6IA 4ZQEA 5JAZA 4P22A 3OA2A 2EHDA 1UXKA 1ULUA 5G0TA 3GRPA 3PHJA 3RI3A 3U4IA 2C0CA 4CMCA 5L40A 1V6AA 3RU7A 3HQ4O 2YDXA 3O8QA 2NU6A 4LRSB 1Q2XA 2ZJ0A 1T4BA 4EI2A 3GH3A 3W8FA 4NDNE 3IDSA 1B14A 3H9UA 3PRJA 1LNQA 4GVLA 4XQEA 1AHHA 3O9ZA 3G79A 3TZHA 4B8WA 4IMRA 3QA9A 3JQ9C 4D42A 2Y0EA 1GYQA 5KOIA 2VYNA 3LC2O 5GZ6A 3M6IA 3KLMX 3SJ7A 4MDHA 4K9DA 5DBFA 2G82A 2B4QA 3P5SA 3GQVA 3U3XA 2FPGA 4I9HA 3LQFA 4PFJA 4CMIB 4RVGA 4TSKA 2FN7A 4B3HA 1G0NA 3H2SA 1UAYA 4RZIA 3D4OA 1U1IA 3BHIA 4LK3A 2I67A 2J3HA 2OMEA 3PHGA 1O8CA 1H9AA 1ZNQO 2GNAA 1ISHA 2D2IA 3UOGA 1JVSA 1NHWA 2PR2A 5DOZA 2DFVA 3ROQA 4FJ0A 1P33A 3KLPX 3QLJA 4D7AA 1YOVA 3A1NA 2B5VA 2P9EA 3G17A 2ZB4A 3K5PA 4MP3A 4R5MA 5G0SA 1ZK1A 2JD1A 1GDHA 4QTZA 4U6SA 2BLLA 3WGHA 4G5HA 3WWZA 2QIOA 3TWOA 2YZ7A 4BGIA 4IZIA 1VSUA 3VPSA 4YRAA 3NRCA 3WTCA 2P9GA 2UV8A 4Z9XA 4EEZA 1A9YA 3Q9UA 3D0OA 4HP8A 4IGFA 1D1SA 5JS6A 1N7HA 4TRNA 5JLAA 1N1GA 4LGVA 4ZRNA 4CR8A 2YYYA 1EQ2A 2ZTLA 1P31A 2V6MA 4KUGA 3U5TA 3KSUA 3VDQA 5GZ1A 1ZJYA 1GQYA 4DPLA 4TZTA 1H6CA 4LISA 4PVDA 3F46A 1BMDA 1DLJA 2P5YA 2PKQP 2ZJ1A 2B4RO 3JQ9A 3EZYA 1NYTA 4R3NA 2WYWA 1ZKMA 3W4JA 4FFRA 2PA3A 4ND1A 4OXKA 3TF5A 4E5NA 5JYDA 1Z74A 3ZU4A 2JCVA 4ZQBA 4DPMA 1IUKA 4CM8B 4BNJA 4YVFA 2CDAA 3JQDA 2Q4BA 1I0ZA 1BDBA 1ZK2A 3WS7A 4FFNA 4BKRA 1WAMA 4IQ8A 3GEDA 3BXXA 3G1TA 5AXCA 2BGKA 1CF2O 2NQTA 3F5QA 5A9RA 4FFMA 4HX5A 1B16A 4MKXA 4Q39A 5JY6A 4XKJA 4C7KA 3K6JA 4PG8A 1HETA 3JQBC 1E5LA 2Q2QA 3JSAA 1T2DA 5K0ZA 3DDNA 3UGKA 1LLDA 4CUJA 4YWJA 4CM9D 2EERA 2V65A 4Z9YA 2ZATA 4U0JA 2QZ9A 3JYOA 4BO7A 1DO8A 2IDZA 4N5NA 4YCAA 1NQAO 3WQRA 3PJGA 1U2DA 3ZNNA 1LSSA 5KNLA 3TPCA 4J9UE 4TMFA 4EBFA 1M66A 4FB5A 3FNFA 3NTQA 4JN6B 1R6DA 4JX8A 3KYDB 5IDWA 3VKVA 3OSUA 2O50A 1IYZA 4BKUA 2G0TA 3CIFA 2UAGA 4CM6A 2PD6A 2DT5A 4O5OA 3O03A 5LDGA 3DZKA 1NFRA 1YXMA 3D5TA 2I9PA 1GYRA 1I3NA 1UP6A 3MJEA 1QKIA 2JAHA 3IKTA 3H5NA 3RUDA 2J8ZA 1W8DA 3JQEA 3ZDFA 4HWKA 4R1SA 3H8VA 4E2YA 3FNEA 1A7AA 4A7PA 4PN3A 3GHHA 4RVHA 4CM9A 3G3EA 3QWAA 5L45A 4PRKA 3WMWA 1NASA 2C7VA 5ILOA 5J23A 3KVOA 4U8GA 2YW9A 2EJVA 2AMFA 3JD1A 3KOUA 3JQBA 3QVSA 3MTGA 2BF7A 5KJCA 4PG7A 1FDTA 3DZIA 2E48A 3DBLB 3IAHA 5KVVA 4FFOA 3LT1A 3L4BC 1VKNA 1LI4A 3R3JA 1YVEI 3TL2A 1ZUD1 1ZSYA 3IP1A 2D5AA 4U7WA 1TB4A 3OQ6A 4EUFA 3GVPA 1DAOA 2XPCA 1QMGA 1PJSA 1SC6A 4FGSA 3V2HA 4J7UA 4II2A 4IIVA 4WEQA 5CDSA 4W99A 4BKQA 3D64A 4ALIA 4BNMA 3I9OA 2NWQA 4RZHA 5J9GA 4YEDA 1HKUA 2OBNA 1KEWA 1DBVO 3GLQA 4KWIA 5F5LA 5KVCA 1NXQA 4AICA 5K9ZA 4HFMA 2Q1SA 3FWNA 1W73A 4F6CA 3C7DB 2GR9A 4MIYA 5DP1A 4YXFA 3ZN2A 3WYBA 4Q3CA 4CQMA 4TKLA 3RKRA 3STHA 1F12A 3UCXA 1E6EA 4BNGA 1RM3A 3R1IA 1E1KA 2C29D 2NVBA 4GX5A 1F17A 3TZQA 4YT8A 1KEVA 1UZLA 1ONOA 2YJZA 3SJUA 1DC4A 3ZNQA 1N92A 4Q3AA 1M6HA 1ZK0A 2WWRA 2JHFA 1UP7A 1PQWA 3V8BA 3CUKA 1GPJA 4R69A 1UZNA 2FPIA 3UUWA 1I01A 1E3WA 1DIRA 3RSHA 1DEHA 1ADGA 2B0JA 2EEZA 4CL3A 1BTOA 1PS0A 3E9QA 1KIFA 1Q1NA 4D79A 4XGIA 5FEUA 4R54A 1HYHA 5ICSA 1EVIA 1G6KA 4QFDA 1EE9A 2PZJA 3L4BA 5T73A 3ZH2A 2DC1A 3CPSA 3ANMA 3QE3A 3I9LA 2TMGA 5BSEA 2W2KB 2HDHA 3C7CB 3H4VA 1YONA 4MOWA 3KYCB 1LDBA 1OAAA 3UH1A 2I5PO 3L9XA 1ORRA 2C7GA 5HWSA 4HFNA 2WSBA 3CZMA 1I2CA 5DT9A 4R68A 1HLPA 2X0RA 1H2HA 1Q0QA 3UHAA 3DO5A 3A9WA 3CZRA 1YE3A 2BGMA 1Z45A 3BAZA 4RPKA 1C1DB 1CDOA 4MP8A 1I3MA 3NJ8A 1W0CA 2PZLA 3I4FA 4KMSA 3PIDA 1PWZA 3NDJA 5I9LA 3ZHBA 4XQCA 2PTGA 2PD4A 4OOFA 1GV1A 3QW2A 1R66A 4W6ZA 1UXHA 4H3VA 2D1YA 4DYVA 2X1HA 1E1NA 2DPGA 4IM7A 2W2LD 3FNGA 3QWIA 2VN8A 4WLFA 3U09A 4OKIA 3PQFA 3GAZA 5EPOA 1PJBA 4E31A 1WZEA 3PHIA 3D7LA 3WNVA 3VPHA 2ZB3A 5G4KA 4CL8A 1P77A 1DRVA 3HHPA 1VJTA 3I52A 3PZBA 2OBYA 2CVQA 5F1KA 3WJ7A 3HDJA 5F3RA 4B79A 1BSVA 1I3LA 3RUAA 1CQJA 3S2IA 4K26A 1F8GA 5BR7A 5DBIA 2UDPA 1BVRA 1ZIDA 1GPDG 4ZJUA 4BNNA 3WICA 4KWHA 4XCVA 4NJOA 2J5RA 5JO9A 1EUDA 2NU8A 1ZEJA 1HF3A 1Y9EA 1YRLA 3PYXA 3QSGA 3GVCA 3D4NA 3D5QA 1ISGA 2QX7A 1HL3A 4E32A 5JNLA 3INGA 1HDYA 1BXGB 1I24A 3HUDA 3ZV5A 5MDHA 1XEAA 3L6OO 1FDVA 4G65A 4KDEA 4R3WA 1PTJA 3OEYA 3E48A 2IXAA 3GVXA 3Q3CA 1E6WA 2DBZA 3PFFA 4MVJD 4GWGA 4NU6A 4WCFB 4YT2A 2HQ1A 1WDKA 3GHYA 4J16A 3ZWCA 4BB5A 1KC1A 1IPFA 2ZQZA 4R51A 1LA2A 3ZWWA 3JQ8B 4KOAA 4ZHSA 3L9WA 4XX0A 4NFYA 2JKVA 5JXWA 1R0KA 4IUYA 4YR9A 4CMIA 2HMUA 4M54A 1M76A 1XWFA 3KUXA 3DB2A 5COQA 1ZK3A 3JV7A 3TFQA 2HMTA 4DPKA 3NDIA 5JDCC 4XYLA 2AQHA 5JCJD 2R2GA 5CDYA 3PZRA 3ZI0A 2DKNA 5BSGA 4MVJP 1U4SA 4IJWA 1Z82A 2FOIA 2YQ4A 3NV9A 1WDMA 5EESA 1U5AA 5T5QA 4CMKA 4CPDA 4ITUA 5IDYA 2F1KA 4JBIA 4G2NA 3MOGA 4EUEA 1W4ZA 1FDSA 3RVDA 4CUZA 3DBHB 3BYZA 4OIMA 4QQRA 5DDIP 1SZJG 4BNYA 4H16A 3GK3A 3OEWA 5JO0A 1CRWG 5JPIA 5C5IA 5KJFA 1BWSA 4MVJA 3ZWOA 1DRWA 1QLJA 5CAEA 1V8BA 4XQGA 5C7LO 4BKPA 4DUPA 3ONEA 2VT3A 4CODB 3LK7A 4L4RA 3TQHA 1U3TA 1ZVMA 2GF2A 3ETDA 2NV6A 4NBTA 1R4NA 3B20A 3BMOB 4M87A 2OOSA 3H2ZA 1EFKA 1E6UA 4OAQA 2PFGA 3WNQA 2VYVA 4CUKA 1ML3A 1R0LA 5JCJA 1NTOA 3TL3A 1IZ0A 3ZWYA 4N54A 4F6LA 1DC6A 2HAEA 4AJLA 5DP2A 3QWFA 4CLHA 3MJVA 1WLYA 3BHJA 1LC0A 4MJLA 4D0RA 3UVEA 5L51A 1V3UA 1PGJA 2AEJA 3DQPA 3BIOA 4TQGA 5JDCA 1UH5A 1B8UA 1D8AA 2OORA 2X5KO 1EFLA 4BVAA 4RVSA 1TEHA 2ZCVA 4CM1A 4B4WA 1JTVA 5KTKA 2CVZA 2NADA 3U49A 2IYOA 3ZWBA 2C5EA 5I7FA 3KV3O 4PG4A 2JFHA 2ZYAA 3FTNA 4BNUA 3H6KA 5TSDA 4JBGA 1XKQA 3VZRA 2CDBA 2Y1DA 1P74A 3V1UA 1UJMA 1SB9A 2EW8A 2JAPA 4R5HA 4BMNA 3ETEA 2O48X 2OL4A 3GVIA 3HB4X 4IJKA 4DLAA 3NAQA 2YFQA 3WR5A 3IJPA 1V0JA 3AM4A 4NFHA 3DC2A 3JD3A 3KYDA 3X2EA 1D1TA 4U6QA 1X1TA 2OUIA 5JC8A 3R3SA 2VZ8A 3KEQA 3H9QA 4ZQHA 4BKOA 1OBFO 4DWVA 2BGLA 2SCUA 1J49A 4I8XA 2D59A 1CYDA 4MKZA 1BHSA 4DC1A 3KO8A 1PJ3A 2LDBA 1C14A 1YGYA 3GGPA 2NSDA 1KVTA 3ST7A 5ENVA 5ILGA 1F0YA 2WTBA 1T2AA 3DEYX 1CERA 1J4AA 4MVJH 3DFZA 4ONEA 1I10A 1WP4A 5CDTA 2E49A 4KUEA 1M6WA 1UUFA 2QYSA 4L76A 1WPQA 3ZCXA 2V6GA 1ONPA 4U5QA 5IZCC 3HZZA 5G0VA 3LSYA 2D8AA 2J3IA 1TXGA 3QVTA 2C2YA 1ADFA 1MC5A 1ZBQA 1PJ4A 4HXYA 4CLRB 3NUGA 4R1TA 3M1AA 1W6UA 3E18A 2W98A 5KKAA 2Q99A 4FW8A 3DBLA 3HNPA 3CMCO 4IDCA 3HDYA 3Q9NA 4P4LA 3H65A 5T8KC 1YWGO 2X7HA 3DAPA 2DBQA 1T2EA 4ZA2A 2YQ5A 3VAZA 3H9GA 2BFPA 3COSA 4QEDA 1GADO 2HK7A 4ND4A 3WIDA 4BO5A 1ISMA 4PRLA 1E7WA 5HS4A 3VZSA 2B83A 3ZWNA 4P4GA 3HFGA 1E1LA 1VL6A 3MJSA 3NTOA 1LX6A 5CDGA 5KWEA 4QXMA 4WECA 3DOOA 3GEMA 3VKUA 5ES3A 3WTBA 4Y98A 5IXYA 1BVUA 4ALNA 3GDOA 1GFSA 1PJ2A 4A73A 1DFIA 3OETA 3EHEA 4PZDA 3WIEA 4BGVA 4ZICA 5A04A 5JYAA 2PWZA 1L1FA 4JJGA 1C0LA 1KVSA 5A5FA 2JCXA 2POQX 5L7WA 3OIFA 3WOHA 2IODA 4IS3A 3O4RA 1IE3A 3F5SA 1EE2A 1PGOA 5GY7A 3PQEA 3EGOA 5HRUA 3GOHA 2GPTA 1D4FA 4PG5A 2VHXA 2JFGA 4JGBA 1PGQA 3NGLA 2VUTA 1IZ9A 1C1XB 3IUSA 3VVBA 2Q49A 4NBUA 1YQGA 1LSOA 4WLVA 1NNUA 2XXJA 3ZV6A 4AJIA 3MJTA 4RDIA 5IZCA 1YBAA 3LT2A 3HDHA 4MIOA 2YY7A 5TF4A 1IHXA 3RFXA 3P2YA 3Q11A 3OJLA 1HYGA 2P9CA 4HKTA 5LCXA 1GZ6A 5T8KA 1Y9AA 4XYMA 3RUFA 1QG6A 4I1IA 1Z7EA 1WNTA 1EK6A 4Y67A 4IZHA 4I08A 1VE9A 2W2KA 4O6VA 5CG1A 1J6UA 2X0IA 4J1SA 1T2FA 3ULKA 2X6TA 3NKLA 1C0IA 3KYCA 4HNGA 4D45A 4YAGA 1A71A 1Q0LA 4GKVA 1U5CA 4GX2A 4UVEA 3I9MA 1HT0A 3GZNB 5CHEA 1Y8RB 4NFSA 4CM4B 5JBIA 2X9GA 3PI7A 4Y9DA 3IC5A 5AVOA 3SC6A 5A5EA 1HDZA 1VRWA 4M49A 2VRCD 1EUCA 3FBTA 4P4NA 2Y0CA 3ONFA 4OHUA 4WNCA 4GLOA 1JN0A 4H7PA 1C1DA 5JW6A 1AHIA 3FSRA 4OH1A 4Q3BA 1JU9A 3SLGA 1CIVA 3JQCA 2QQ5A 5BSHA 1O94A
chains in the Genus database with same CATH superfamily
2J48A 1LJ8A 1VJGA 3HWX1 2GBLA 3TJRA 4QOJA 3IULA 5HF8A 1ZH8A 3EYAA 1QFMA 2OGUA 3V5NA 3BS4A 3QUCA 4C89A 4DJEC 3A2KA 2YW2A 4CN8A 3F7TA 3SR0A 1Z0ZA 3N8GA 2VWQA 5FTWA 2Z2IA 3LX5A 2YVLA 4HQOA 1JEQB 5AUOB 1LUAA 1ND5A 3SQDA 3ICQB 5L7TA 2AF4C 4RZQA 1PGPA 3IT2A 4IDDA 3L07A 4UMVA 2JI4A 2K87A 2DQKA 2EOAA 4PE5B 3M4YA 1RWNA 2AVDA 1HA3A 3N0TA 4HAUA 4U0KA 3OTQA 1XDUA 2XKAA 2ERYA 2YN4A 1JJAA 3GH1A 3L0CA 4LWQA 4PWZA 1O03A 3DDSA 1ZLXA 2XDAA 3G7UA 4LW8A 4EFKA 5JAHA 4J8PA 4EW6A 1IQPA 1FYXA 1S2NA 4QO7A 2P78A 1Z6GA 5IMSA 3KQHA 3BUSA 4UAGA 1T24A 2B7CA 4QPNA 5D3MA 3RTBA 3WSWA 1YMUA 3A1DA 5LQNA 2ZSBA 4FT2A 2R0QC 1IBKB 2VHYA 1RHJA 4MR7B 1FMFA 1IN6A 1S9HA 3I4CA 3MILA 1JHAA 5DM60 3NVAA 1EESA 3X44A 3EH1A 4JC0A 4JUFA 2Z9BA 3FZGA 4NCIA 2CLCX 3EDRA 4DBVO 1JKJA 2Q5QA 1S3GA 3KQVA 2C2BA 3H1BA 3PQ8A 4TPKA 1L5HA 1KDOA 4JUAA 5T3YA 1R12A 1NY5A 5BSRA 4RD2A 1TD1A 1GM5A 1FTWA 1QR6A 5SICE 3AR8A 3GL9A 4B3JA 1NLUA 4O4LF 3CRNA 4TTIA 5IKMA 2AI2A 2NTJA 3ZJ4A 3A27A 3Q12A 1Z3CA 3I9V6 4J2TA 4CFYA 4B3RB 2QXUA 3P9XA 4EITA 3B3GA 1X7YB 1P2BA 1AUQA 1ZA2A 2IYWA 1DV1A 2VYCA 1BXGA 3INNA 4IXWA 2Z5VA 4L8FA 2CHGA 2NLOA 3ICVA 4JROA 5HF6A 3TRIA 4CTJA 2W42A 4XE5A 3LUFA 3OLXA 1SCJA 1K3FA 3TS1A 4RDXA 3IKVA 4C2TA 1KDZA 2W4IA 5IVHA 1ES9A 2F9LA 2XVYA 4HWPA 4O2AB 3K2EA 1B00A 2O2JA 2D5CA 4WCFA 2WM8A 4Y2UA 4FI3C 2WT9A 4LVUA 3PQ2A 4A03A 3QE9Y 3S70A 3D1LA 2C1ZA 4HAYA 2VSQA 2VI5A 1QYCA 1VBKA 5JQGA 2BDEA 3K2BA 4D43A 5HFNA 3QKUA 1VM6A 4YP1A 3AUTA 3PU6A 1OC4A 2C7OA 1DHRA 2B21A 2ES4A 2Q6TA 1VE7A 2O23A 4Y6LA 2P11A 2PMDA 3ZGNA 2FLVA 2ACKA 1PT5A 3H5IA 1XVAA 2RGYA 3A4LA 3FWYA 1OT5A 2H48A 3PWSA 3RSSA 3HB0A 4C0QC 4P81A 1S3IA 3EMKA 3V7UA 2QAGB 3JZDA 4H18A 4R1OA 4UEJA 3ZIDA 5TJ9A 2VRWA 1XRNA 1B0UA 3BGDA 1VCNA 3DCYA 3PGVA 5FTLA 3F6CA 2FX5A 2HLPA 2OPBA 2JZOA 2WSIA 5FULA 3CF4G 3RASA 4DMFA 4ENSA 2FDCA 1C1YA 1H8HA 1WUKS 2XECA 3TIIA 2RARA 1Y5IA 1JSCA 1EK1A 1P19A 2JFUA 3H9EO 1HLGA 1AXGA 2XDWA 1GPKA 1JYFA 1XX6A 3AM3A 4HAVA 1RM4A 4I6JA 4M1QA 4AJKA 4EJSA 3LPDA 1JHOA 2BISA 3KTAA 3I04A 3SKYA 4HLUA 2D62A 5B6IA 4P34A 3D6UA 4ZT4A 3I5MA 2D00A 1EWKA 2IF0A 4QWWA 3RC7A 1KBOA 1QZZA 2ZYDA 3GLUA 3IEKA 2Q2WA 3IUEA 2C3UA 3KJIA 3IR7A 3BGOS 4CTMA 4R1QA 5KS2A 1SCKA 3NKFA 2G17A 5TS3A 3M3DA 2WFMA 2FPRA 3I01M 2WHPB 3MGAA 1QIMA 3BFKA 3IPLA 1W93A 3KZVA 4B6OA 4WACA 3LC7O 3O84A 3ITDA 2IOQA 1DTWB 3IUQA 4R9VA 4X6YA 3M3HA 4P5PA 2BCJQ 3AR4A 1WV1A 2OXRA 1SD2A 1U0NA 1B0AA 3BMOA 1BCSB 2HA0A 3DCIA 3GAAA 4YACA 5AKLA 1TK3A 1F7VA 2VDRB 2WF5A 1REQB 4J1TA 1NDQA 4YRSA 1B2RA 1XQ6A 1YDEA 2ZBFA 3M8KA 4GQBA 1ZD1A 2JLCA 4BO4A 4YNBA 4IR7A 1TZBA 4ZK2A 2BM9A 4KAAA 4PZ9A 3U7FB 1XZJA 2BFFA 5KOHA 5IT0A 2J5XA 3MT8A 4L22A 4PXAA 3TCNA 1B73A 2ZJYA 4FXPA 4KQXA 1PZMA 1XZQA 1RRMA 5B58C 2E4UA 3R0XA 1AQUA 4RU1A 2DU8A 1Z6YA 2XAUA 4YAFA 4I50A 1SEVA 2JHAA 3LGSA 1JFTA 3K0AA 3D6HA 4LF4B 1T1IA 2QX6A 1PVDA 4URVR 5IZ4A 1Z0IA 2C95A 1LBTA 1OX6A 3F9IA 3O8DA 2Z43A 1RE1A 2EZ4A 4L50A 3QOXA 4H6WA 1JAYA 1E64A 4RV9A 2RHHA 3SSMA 1JPVA 4P83A 1B8PA 1RW4A 1TADA 1U2TA 2DRIA 4N7RA 4UDOA 4DYDA 1DPGA 2COEA 3B1ZA 3PNYA 4MUJA 3ANSA 1TQ2A 1JI3A 3O2JA 1AZTA 4W82A 2QJWA 1MKYA 1CHDA 2GPBA 3OCCA 1SB8A 5GONA 3UUEA 5A6SB 5JCZA 3OKAA 4L0CA 3UC5A 5CXSA 1PG2A 2CFCA 5JSZA 4R83A 2N9UA 1Z47A 5IVDA 1BMTA 3CKMA 4N5MA 5F51A 1V2HE 5TGDA 3WX0A 1T13A 3PUJA 3CH4B 2W93A 3TUZC 3UXMA 1GZVA 3FCSB 3IILA 3EAGA 2W2VA 3QFTA 4GX1A 3SZOA 4OEHA 3WK7A 4NXNB 1VHDA 1KAQA 2J30A 2A35A 1BMFA 3H2GA 1RPTA 1WB9A 4MQBA 5JJLA 1WO8A 3L8CA 3S44A 1D0VA 4BZQA 1XELA 1G17A 2V54A 1K92A 2HADA 2PNFA 1AO3A 2CNLA 3ICCA 4F7DA 1RRGA 1PJQA 3P0JA 3DZFA 5EJGA 5KO2A 4OY3A 1Z0JA 2BKXA 4WKCA 3MTJA 1O87A 3TB6A 3NBYC 3NM6B 1X8LA 2B82A 2BTOA 1XTSA 3VC1A 3VR6H 4YHHB 4HFJA 3L6DA 4UATA 3BCRA 3ZVNA 4GC5A 4MARA 3D7NA 1Z22A 4QU9A 4HBZA 2NTYC 4P7GA 4F4HA 3PBKA 1A7JA 3I6QA 1DRUA 4UMDA 1I4EB 3GRAA 4B4VA 1X14A 3OZWA 3EXEB 4G1BA 2WC1A 3N53A 4HAZA 4AWAA 2IS2A 2YBDA 1SHLA 1NNLA 4KK4A 4LJSA 1K8ZB 4RVFA 4QKQA 2VDOB 2PL3A 4MKGA 4Q9LA 3FB1A 1XSEA 2V03A 5LP6A 3TUJC 3CN9A 3BG5A 5E7IA 3KXKA 3JWGA 2OCPA 4QG7A 4V39A 1Y89A 3EXIA 4JELA 1RE0A 5SZIA 5TVKA 1AKVA 1AGRA 2RBEA 3KKOA 1I7LA 4AMGA 4LZAA 5KYWB 1SUWA 3ND5A 2JFZA 2RGDA 1OHHD 3ZQKA 2CV2A 2AFIE 5IX8A 3GN1A 1HEUA 2W6QA 4TQAA 4CRWB 3P2KA 1EIWA 4G9EA 1TO1E 3B6JA 4KO3S 5IJAA 5CLGA 1V95A 4R7ZA 2KLHA 3MCVA 1PL8A 3R41A 2Q0SA 3VYUB 4ZDIA 4P8RA 3BQMB 3LHKA 2NP6A 1KI7A 1ZRNA 4LHEA 1QP8A 3OESA 4IDNA 3FNIA 3MJFA 3D3WB 2DCUA 2OYCA 4XIYA 1XZFA 4HUQA 4C0XA 1P45A 4FWIB 3WGKA 5A4AA 3G5AA 1C7ZA 1KPHA 1QRDA 4K9LA 1WZUA 4LV8B 4B8ZA 5AHKA 1NFQA 3TKLA 2XNJA 4CR7A 1EUQA 1MHMB 1GGHA 2IP2A 2A9OA 2JFXA 2IH5A 2RHRA 3VPCA 4BB6A 1GIAA 1I30A 4MWEA 4BYMA 4LMRA 4Q37A 5FUVA 3WK8A 1N3YA 3HYSA 3QMWA 1NFFA 5EJIA 3V1MA 3EY9A 4RM3A 4UTOA 4KV7A 3RTDA 4BOYA 3VOTA 1NR1A 2QRUA 4F0JA 3TAUA 2Q6IA 5CD1A 3HVUA 2CZQA 3FTPA 3SS9X 3DMDA 1JH8A 1Q0HA 1BD3A 3GJ3A 1U8TA 4W5WA 1V1MB 2P4HX 3CTPA 1YHYA 1A72A 3BSYA 5D84A 1BNCA 5ITZA 1QDUA 1QCCA 1C3JA 3PYLA 1YIAA 3OX4A 1NW7A 4URUR 4E5PA 4EGAA 2CEAA 3LT0A 1TVCA 4HLDA 1DFHA 3TIVA 4Z8YA 3KK0A 1U31A 4IHKA 4TL6A 4IL5A 1T3TA 4D3FA 1JQKA 3OJEA 4KEAA 2I2XB 4NCHA 3M5DA 3HCBA 1C3EA 2JGJA 1GAJA 1F6DA 3AU9A 3ONWA 1YE8A 5G0WA 3QKRA 1UJ2A 2WRZA 3EIOA 3QJGA 2A94A 3KQYA 5MN4A 4N3AA 4K88A 4WXPA 1ISIA 3MT0A 4V0KA 4MVCA 4QHTA 1XF1A 2VJKA 2PZMA 3ROFA 1M2JA 2V7VA 2OO5C 2KBEA 2H65A 4N9WA 4UULA 3UT5B 4URXR 2R85A 3GXBA 2VAVA 2CE2X 3PHHA 3PUZA 4UVGA 1Y5LA 4W7HA 4R2WA 2LRHA 1JAZA 4BU1A 1K0UA 1V6CA 1U3UA 3RVKA 3GRUA 3H16A 3BD9A 4JL8A 3BVPA 1DIGA 1R7RA 2VOJA 1RLOA 1V3TA 3E22A 3H9BA 1MG5A 4J76A 2WJHA 4PAQA 4N3NA 4PSCA 4YT5A 3G2MA 5CIQA 3SM9A 1VSVA 2A86A 3UHFA 4KP7A 2VZ0A 2PX4A 2YHUA 3WRVA 3HCNA 4B9EA 4KYUA 1VLZA 2JGKA 1CUZA 2E3JA 1YQTA 2GSWA 1PL7A 2VJOA 1PN3A 1NBMA 1Q83A 1RAAA 2OD9A 3ON5A 4H0FA 1J2RA 4OMDA 4ALKA 4QELA 2EGHA 2J3KA 1ZNYA 1ZW6A 1H2RS 2AR9A 3CRW1 5DX1A 3V2GA 1EUYA 4ZWNA 1PDVA 4MQ5A 2BMEA 1JV2B 2FY8A 4MKFA 3UUFA 3H9CA 3WJAA 2P9JA 3D2LA 4X7BA 3HI6A 2QU7A 3HCCA 4UUPA 3WK6A 1P9LA 4AYWA 4DTIA 4D4HA 5CFPA 2CB0A 4BDTA 1LPNA 4B2PA 5LJIA 1KAOA 1JXAA 1IHDA 3W06A 2Z57A 1MX1A 1W7AA 5TT0A 4ITRC 4XFDA 2C0PA 2FDRA 3JRWA 4K9SA 1NPDA 1ABFA 4NHEA 1C5KA 1C9JA 1Y33E 2BMJA 2EG9A 4O29A 5DTIA 4W63A 3BL6A 1N9KA 4PAMA 2C57A 2M32A 5FNVF 4DR2B 4E5MA 1ZEMA 5GGYA 5AI6A 1JAXA 3K9WA 4RELA 4W5QA 1SHTX 5DGXA 2ZB2A 1B6RA 1AUXA 3KOXA 1AOXA 1IHOA 4AL4A 1BD4A 2PU5A 3M6XA 3HU2A 4JKOA 3SX4A 3WLEA 1NUPA 4YV2A 5LN1A 4QEKA 4CXMA 4JNKA 4QOGA 3VXKA 3EEQA 1S5PA 2X76A 4QSMA 2GCGA 3G88A 4AKTA 4B5KA 3N2IA 5C8YF 3VH4A 4DJAA 1JQBA 1PGNA 1Y8CA 4DQLA 3H3XA 4C03A 3K9GA 4PYMA 1M3SA 3DOFA 1R3UA 3VH1A 3MAAC 3GJTA 2P8SA 3QYFA 2HA3A 2HGSA 2P5TB 4I9GA 4AX4A 3LTNC 1AGNA 1RZVA 2XWJI 5K8JB 4H7EA 3IPXA 3VA7A 4XVCA 2BW0A 1QHXA 5IJWA 1EVYA 1PDWA 2X2EA 3NM4A 1UT5A 5CP8A 3IT3A 1DJNA 1X7ZB 3BTSA 4TMZA 3VH3A 2XW6A 1NG1A 2FKAA 4GXTA 5A9SB 5HFJA 4H4EA 2PU7A 3LLSA 3HM2A 1T4CA 4EB6B 1JPNA 1TO2E 3M82A 3CSSA 4MA4A 3WKAA 3BH6A 4RABA 2QN7A 5DMXA 4YRJA 1J09A 3CMMA 1QFZA 2OSVA 3C7AA 4R05A 3H9JA 1HEYA 1NW5A 1YFZA 5FPQA 3O47A 5IVKA 3T7AA 1VZ3A 1VFPA 4JHXA 3MVEA 2BUAA 4X20A 2VNAA 4L9AA 2L18A 3MGBA 3S81A 4AY4A 2NP7A 1Q0SA 5DCLA 2DFDA 4Z0NA 2R6AA 2V4ZA 4MR8B 2ERXA 3BGSA 4TTVA 3RSQA 4C4PA 3QYAA 2ASVA 3CSUA 5C2JB 1JLMA 1WZIA 4G63A 4OGFA 3ZJTA 1C1HA 1G2OA 2PWYA 1DBRA 1US8A 5DIZA 4PGFA 3U19A 3RJZA 4IINA 1J22A 3MXTA 3T4PA 1IXSB 1XEXB 3PXGA 1YDWA 4YCJA 4EKNB 2I2AA 2ZXFA 3L8DA 4N0QA 2IHBA 2HL6A 2VNSA 2X8LA 1TCVA 1ZU5A 4FIZA 4XLZA 3CFYA 3WJ1A 4IQ4A 1XTRA 4MEAA 3VNUA 4P93A 3RAEC 3BK1A 1A9XB 4BO6A 3LYAA 4M89A 5TX7A 2C82A 3D4BA 3K9BA 1ZN2A 2BKEA 1XCPA 1EBFA 4QBHA 4DLXA 4EGQA 3E9YA 3UJPA 4RTNA 4LYYA 4QUAA 3RYIA 3K94A 4OJQA 1QP7A 4NZYA 2QVZX 2WD7A 3ZGYA 1FP4B 1E8NA 4D8TA 3IX7A 3AO0B 4UM9D 4E5DA 3IERA 2CLSA 2FFAA 1RI4A 3BOSA 4YJGA 3KR9A 3QTBA 4BMCA 5BYBA 4C6TA 3GNSA 2CZCA 1ZKDA 1SELA 4F06A 5C52B 1WUHS 2Y6UA 4K1LA 9LDTA 5EQDA 5ANRB 1K2WA 2ZTUA 1DE0A 4WN3A 5K3DA 4FZJA 1O5TA 2OXIA 1BXRA 2D6FA 1FRFS 4IJQA 1GCUA 3A9TA 4RC9A 4GYWA 4PRYA 2AUMA 1QH8B 1IBRA 1HDXA 4UARA 3X3HA 1UDCA 3OLZA 1JT2A 2YVUA 3PJDA 1Q15A 3DHEA 2WB4A 1YDFA 3DT8A 4OKNA 3RT7A 4B80A 4V2IA 4KGVA 4F5ZA 5HKAA 3TSZA 4EYOA 3AL2A 2E6UX 4BNDB 4X1YB 5FI1B 4BMDA 4AS3A 1L4MA 1D2AA 4M9CA 1TTPB 1XYYA 1I2AA 2VWHA 2LKCA 3RK0A 5LJLA 3OIWA 2Q45A 3FLEA 4M9SA 5HCUA 5ITWA 5K3EA 3I61A 1SBHA 1ZK4A 4JASB 2OUKA 1Z4OA 4NYMQ 1G20E 4IDEA 4UHEA 4L4YA 4XOIA 3O2QB 1XG5A 2QG4A 3WLTA 1UBKS 2Q6KA 3KYBA 3L4SO 3NG1A 4JCCA 1ZC3A 1K86A 4KGZA 2JGDA 2P2SA 4EA8A 4MV6A 3TX2A 3GP5A 1RSZA 4ECEA 2H0RA 1MJFA 3LPLA 3ZTYA 2EFCB 3GFSA 2QN1A 4AU1A 3ETCA 1B76A 2YY6A 4JBXA 4GSLA 2UYYA 1HFJA 5T4EA 4NR0A 1AQYA 3LNTA 4HOYA 2XB8A 4XIJA 1E9FA 1F14A 1P0CA 1XU9A 3CGGA 5JAQA 5TLSA 3ZDDA 3AQ4A 4KDFA 3SYKA 3WMFA 3JU3A 1D6SA 3I76A 1GTL1 4BC1A 3VNAA 3TVYA 2IEZA 4WZBE 1NPTO 1RCFA 1B43A 2A7QA 1PR2A 4RSMA 3D54D 1DMRA 1OQAA 4EPTA 4HUJA 3ZWQA 4HWOA 2OHIA 2P4QA 3NHZA 4LZWA 2UYQA 3GD7A 3H5TA 2H1HA 4K6FA 3V32A 4ASUD 3FE2A 3IR6A 3Q7PA 1P2GA 4HK4A 4NH4A 4OB6A 2PZAA 5TQJA 1GSOA 1F4PA 2FEOA 1F8UA 5T6BA 1XDSA 3V1LA 1U8AA 2BGJA 4WUVA 4M37A 1CULC 1IDN1 3KVRA 2OV8A 2FW6A 3ASZA 3OZVA 4MQLA 3RANA 3SF0A 1YHNA 4L0QA 1OFGA 1Z0UA 2BC9A 2GD2A 2WD9A 2PGXA 3D3EA 1JHRA 4PPNA 4QD3A 4R1UA 3RUPA 3TLCA 1YR8A 1PUXA 4MYUA 1CY2A 5IU6A 5IWAB 5ERXA 3ETLA 2OC4A 4F3RA 5CG2A 1HE4A 4DRZA 1DOZA 4N3BA 3JQQA 1G66A 3PT5A 3TN7A 4A8JA 3BGVA 3HADA 3W7AA 2GK3A 1QHHA 1E1QA 2FK7A 2IW1A 3QVJA 5I7EA 3HO8A 2XUPA 4D8YA 5DX0A 3I5YA 5AW0A 3KNZA 2VXCA 3C8HA 4PR0A 4QICA 1PK8A 2RH9B 1Q20A 1CR6A 4M46A 4A10A 4A82A 5A6VA 3AIIA 3ZHUA 5LD2B 3U7GA 4Z4GA 4O1HA 4H6VA 1FVFA 1J0EA 2G08A 4UBIA 4Y6SA 3GEGA 2Q7OE 2J3MA 4AN0A 3LLMA 4ZYTA 5ECWA 3T9FA 3L6BA 3PDWA 4GZ3A 3LUDA 3RV4A 5ALKA 4C0JA 1R8JA 2VJBA 5AQEA 1G3UA 5FD8A 1SZPA 2VRNA 4GXRA 4FGWA 1QQ6A 2A0YA 1QCZA 3HB9A 4HAIA 1EJ6A 5CX4A 2X0DA 5AESA 1ZGGA 3PEFA 4QXRA 5F12A 5CFMA 4WKBA 2RI0A 4OFXA 1U0LA 1FX0B 3FLBA 5EHZA 4A9AA 3OOSA 4NE2A 5K4GA 1UM9A 1UFRA 5JAIA 3FWKA 2Q9CA 1WIWA 5JRJA 3LPAA 2GEKA 3A6FA 2R8OA 1FB5A 1MQAA 1VIAA 3BJEA 5EIOA 4MDEA 2EATA 2O3RA 2P69A 2VPQA 1A76A 4RMNA 3P32A 3I04M 1K8RA 4KX3A 4WOKA 5DT2A 4US2R 3FDZB 3DZ7B 1FU7A 4AY3A 2WF6A 2Q4DA 3ROMA 5F7ZA 4I6EA 4M7WA 2C7BA 3WSVA 1NZJA 2BH2A 2VRBA 3D6VA 1WB5A 1EUDB 2F64A 2YNMD 1HQCA 3ND6A 3DOCA 4MH0R 2FOLA 3D7SA 4UUMA 1BN6A 3B7PA 5GGXA 3UXHA 3TX6A 2J0UA 2UZ3A 1RPZA 3LSTA 3OOYA 5K4AA 1RNLA 1Z88A 1DGQA 1UBLS 3F4BA 4HG2A 1MC8A 1VYUA 1GHTA 2O20A 5F73A 4BGUA 1EVQA 5AVVA 3EG5A 1ELOA 1L5SA 2O3QA 5BSTA 1G9SA 2NG1A 1D0SA 1EJ2A 1Q0PA 2CC2A 2MHCA 2ZRKA 1FYVA 2ZTVA 3GEPA 3AF3A 3O8OB 1QQ7A 1GQ2A 4JBHA 1E3IA 4P1ZA 3HXKA 4FWBA 1QOZA 2OM2A 2PPLA 1JIJA 4YV7A 1MEOA 2BIFA 3Q41A 4HGPA 5H70A 1H23A 3II6X 2R1UA 1KDYA 4BVLA 1U2QA 4RGBA 5BYAA 2O8BB 3B3JA 1XA4A 4ETNA 2FUNB 4C08A 5KX5B 2PEZA 2DH5A 4BLWA 1U2SA 4ZI7F 5KU7A 4A6DA 1VGVA 4RHXA 3OECA 5EKTA 4F3KA 1FLNA 4BO7A 1OOEA 1FP1D 3Q2KA 3N7UA 3MS4A 2Z98A 1ONNA 4G37A 4GO1A 2DWCA 1Q7GA 1DO0A 2N46A 4PTYA 3ABIA 4EI7A 2E82A 3KR2A 4GVXA 4K6GA 4TRMA 4O8CA 1MEJA 1FXSA 3T9DA 4E5UA 4DIFA 1H5UA 3STWA 1JALA 4C04A 2YNMA 1F3OA 3JVVA 1QV7A 4IEIA 1DNPA 4MB0A 5L3ZA 2V58A 5JANA 4AZ0A 2HNBA 1UEXC 5EZYA 1PIWA 2XTMA 1TYDE 1NQXA 2XUFA 5JLJA 1DX9A 3QQPA 2QJTA 1W0JD 2G36A 3R75A 4D4LA 4DJDC 3FYUB 5IN4A 3PQ6A 4DV2B 1PYGA 4P4SA 1OH8A 3E9EA 4FDLA 1HM5A 2I66A 3CO0S 1WHTA 3A1VA 3R7WB 4BV2A 3PGA1 3FTDA 2VK1A 3GYGA 3HA5A 2WINI 1PQUA 1M7HA 1W34A 5HKKD 2WHQA 2ZUSA 5I4IA 5ITVA 2Q3MA 1Z8FA 4QM7A 3E9MA 2ZT5A 3GRRA 5DNDA 5EY5B 4Y6GB 1NBEA 1XLTA 1CZUA 1ZW1A 1R9NA 4JD5A 4QHSA 1WABA 4X84A 1YJ8A 4AIRA 4MRSA 4ZMRA 3UANA 2GK6A 4LSWA 2R8RA 2JHCA 3P8ZA 3GPDG 1SU4A 2QENA 4INZA 4F6RB 2JATA 3L49A 3N86A 5JMOA 2WQ7A 1LLCA 4LTNA 4ENUA 3ZGOA 3FWZA 3PCXA 4FX2A 4OA5A 2P68A 1P1IA 2WWGA 4D0SA 1HOXA 4RHTA 2X40A 4RY2A 4KIJA 4BX2A 4C1NA 2C99A 3R4VA 1DJMA 3FPSA 4JV5B 3I09A 4YJDA 3DONA 4AS1A 3EC7A 3K0FA 2EX4A 3K1ZA 1A98A 5I7HA 4KQ1A 4R40A 3LC0A 2ZBRA 3JQ8A 1YS2X 2IYQA 2SNIE 3EPJA 1JZTA 2FXVA 3PE3A 1T3ZA 4Z4HA 2BMFA 3KHUA 4B1FA 4AO8A 1T1SA 1L8QA 5J5VA 1C3LA 3U4HA 1ZUHA 4LXGA 2BFMA 4RMIA 3B1YA 4B44A 1B26A 3EUFA 4FBMA 3THOA 4BEVA 5G02A 2QTZA 3GPIA 2ZE7A 2EKLA 2QTTA 3LPMA 1W0JA 5CJPA 4HRYA 3ZDQA 4ZJPA 2C8JA 1J5PA 2HJWA 4GPZA 1DAHA 5EKDA 1W85A 3JY6A 3H7AA 3LDHA 4URYR 2I6TA 4DLLA 5EIXA 1XMVA 4DT1B 3TZBA 4N12A 3GN2A 4NU8X 3QLUA 1Z08A 4Q7LA 2MINA 5EI5A 5HKKA 1ANKA 4YCNA 2G6BA 2JJQA 1L7QA 4RHCA 2GM9A 2EF0A 1FDWA 1JQ5A 2WJIA 5J40A 5BT9A 1T9KA 3CN7A 2JNWA 3CG4A 2PUJA 5IDQA 4CKEA 2YIVX 3K8OE 2Z1DA 4EUKA 1ZH4A 2BJVA 1J2JA 4X91A 4TLEA 4E51A 1U81A 3DAGA 1M2KA 1M6VB 1P7PA 3OY2A 3RWOA 2OT3B 1DTEA 2W58A 3DMGA 1QVVA 4R01A 3EOZA 3ETGA 4GOKA 4MAAA 2NVOA 2QHXA 2JANA 3IEUA 3ZCTA 3E03A 4EI8A 2LZ0A 4NARA 3QIAA 2SCUB 4FLMA 4FE7A 3T0FA 4IAOA 5FI5A 4LRWA 5K0FA 2XX3A 4L8GA 3PXEA 1XD2A 3GLRA 4WA8A 3NHPA 1JA0A 4HMOA 4L08A 4AD8A 4UFPA 4BNXA 4M0FA 1RYBA 3REOA 4V1CI 3CX3A 1VJ0A 2PKCA 4E03A 5A9TA 4CDMA 1WXDA 3EQ6A 3AHCA 1UJNA 2ZJ5A 2GXSA 3FUXA 3PD1A 2R8ZA 2Q4TA 3E5MA 4MCJA 3ZDEA 3PENA 2G76A 3TINA 2COUA 2VDQB 1XAJA 3KE8A 1XXHB 4OUDB 4DQDA 5JYEA 3A1CA 3S7TA 3Q7EA 1MO6A 3T3GA 3WIOA 1FNNA 4ESOA 2R6HA 3K1TA 1F6WA 4A92A 1ZITA 1WMAA 4MRVA 3H11A 4K81B 3RYCA 4RJ2A 1OTXA 5LM3A 2A57A 1W36D 4GHWA 2FMTA 1XEFA 4NRDA 3FOZA 2I1VB 3O8BA 1L6RA 1KJJA 2R62A 3OH8A 4IG9A 2GNPA 4B7AA 1JDJA 1NJ5A 3INRA 4H1HA 4MGIR 3SR3A 1M0SA 2JFWA 2ZVJA 3B12A 3Q7QA 4LFCB 2PNJA 3A2MA 2I1LA 4RJIA 1VPLA 5ENZA 3ZY6A 1XZNA 5L3QA 1I7DA 4FM9A 2AA3A 1RLUA 4BE7B 1C4WA 4O5AA 1OBCA 4ZU3A 3T34A 1WB4A 1KETA 1ZOPA 2QMZA 3PVZA 1OAOC 3QVGA 1UR5A 5TGTA 3S2SA 2HMYB 3WL8A 5BUZA 5CB8A 1CUXA 1GY8A 2DQSA 3GDWA 1CF4A 3FR7A 2PGLA 3GF4A 1KH3A 4DC0A 1PZHA 3CUSA 3KM0A 4FR0A 3QELB 3HDGA 2QI9F 4FOPA 4R2LA 4TLMB 2EBUA 3D02A 3WA6A 4QQFA 1BE6A 3CKLA 5FFNA 2IUUA 2Y1LA 2QUBA 2FRDA 5EUCA 2WAAA 2B8EA 2HA4A 4DIKA 1AHPA 2D5LA 4M9QA 1NU6A 1OWNA 1XU4A 1E92A 2GUWA 1TYEB 2BUCA 1BEEA 3ZDZB 3SZLA 3TOZA 3TTWA 1NQVA 2P35A 3JD0A 3HEAA 3UKDA 2ZR0A 4G4SP 3MT7A 4CTKA 1VPDA 2I3GA 4MYDA 1QMIA 2ZSKA 2ZWVA 2P77A 4MNTA 1NI5A 3ZWVA 5CA1A 3LP6A 2J85A 3HYNA 4OQXA 1EK0A 4BJ6A 4F97A 4RMGA 1Q7BA 3DPUA 3BZUA 2WPDA 3CLUD 2OWDA 2N75A 3LFTA 1Q0RA 1G8AA 1RVDA 1L7XA 4Y1RA 4YJKA 4CF7A 4JJ6A 2GM5A 2Q4EA 1QHGA 5IDXA 5SYNA 1EGHA 1KRXA 1G5TA 1TKBA 2RI6A 2ZIGA 4B32A 2L82A 5KUTA 1GQFA 3AI2A 3JVUA 4Y2PA 1TKRA 5CVDA 2JGIA 4EA6A 1RI5A 2PHZA 4IMIB 4L9WA 4U39A 4W8HA 4JXXA 3DMTA 3ESZA 1X7WB 4I3FA 2Z4SA 4FU0A 4LMAA 4C7XA 5JJ5A 3D0RA 1GTSA 2I3ZA 3AWIA 1N8KA 2X2OA 6YASA 5LQKA 1YUNA 3ZWPA 3SVTA 1SIWA 3A9SA 4UCFA 5AK5A 3KJNA 1OXXK 1SBYA 3EXHC 3NR2A 1EU1A 4NAUA 3RGWS 2HU2A 2REQA 4MQEA 2P65A 2Q1UA 4B35A 1KDRA 2HLNA 2NU6B 4J0EA 1U7HA 3NYWA 1F6BA 1DC5A 3N8IA 1FRVA 2I2DA 3K2IA 4F9FA 2BBSA 4BMSA 1XCBA 1FPMA 1EVLA 2CB9A 4O89A 2I4MA 4FFVA 4TMXA 5CIWA 4NBSA 1IY1A 4HPWA 3A6JA 1WLSA 4L85A 4CL2A 5K0BA 1OV4A 1HMYA 1ZJ5A 3DHNA 3M6UA 3ESDA 1A5ZA 4HF7A 3IPYA 2E0IA 4PLGA 1J23A 4N5LA 4RXTA 3FDXA 1V3VA 2OAEA 1QGUA 2ZTHA 3DF7A 4MLZA 4E09A 5K01A 1CUFA 4IQFA 4ME6A 1TDJA 2QL7A 4LWZA 1W35A 3CZPA 5AOCA 1UQUA 5JD3A 3DHYA 4MKHA 3EZLA 4GLLA 4OQNA 5JJIA 4FC7A 1K6MA 2CD9A 2DTDA 3LUPA 1U1DA 5DM1A 1SRRA 1LI7A 3DTVD 3I2HA 3MAGA 2ZE8A 4MQFA 2O1XA 5TY0A 3DTNA 3KXPA 5CD9A 2G40A 4KXFB 4HC4A 3EP7B 3ESCA 4L75A 5KQGA 4X3PA 1WMBA 3VTFA 4ROSA 5I4KA 2WWFA 3LX4A 4BQNA 4XWOA 4GKKB 4YB8A 1NR7A 1E61A 4EWLA 1DP4A 1N32B 4X7PA 3OJWA 4PQRA 3BJZA 1Y1SA 2JIZA 4UHJA 3VVLA 1NAIA 1RWPA 4Q4LA 3IE1A 5AKZA 4E30A 1NYLA 3DA8A 3K53A 2FQ1A 1QCYA 1JH9A 2WZQA 3BMCA 2C2KA 5E2IA 2FW8A 4LQDA 5C1BA 4Q1BA 2Y66A 1U4NA 1Y81A 3M6LA 3OCUA 3VPBA 5KTPA 2DBRA 3EN0A 3GPBA 1GL3A 5JY1A 3AF2A 3PA8A 1MP0A 4S3MA 1ULSA 4XR9A 2XMSA 5LQRA 1OYWA 3WKEA 3ADDA 4ND3A 1QSGA 1NONA 2J6HA 1HWYA 5IJ0B 4BO2A 4FD3A 4GYJA 2RHBA 3ZU3A 3NXSA 1T9AA 2WW8A 3HVHA 4JQCA 3V8EA 3L0IB 3WLIA 1ZXLA 2LTAA 4M8NE 4DNQA 2B6NA 3GMSA 2ZCUA 3DDWA 3IPRA 1DG1G 1R16A 5JAUA 4FC6A 3RIEA 2HK9A 4NQZA 3GRVA 3ZK8A 3K8ZA 3WFZA 1MW9X 3WLOA 3IPAA 3KZKA 2AOWA 4TXLA 3VMMA 3F7MA 3S1SA 2WZCA 3MZ0A 2CNDA 4I4TA 3BTUA 2F43A 1R00A 1X92A 2OXCA 4F11A 4QRDA 1MXHA 2DR3A 1UKVY 3KSBC 1AQJA 2H31A 1ZXXA 2D54A 1VP3A 2FZ5A 2H1SA 2ZB8A 3AI1A 3GZNA 3JWJA 3GLHE 3RF6A 1GUYA 1W88B 1Z16A 2Q3JA 4BO3A 1A7KA 1BOFA 3FDFA 5EA2A 4LF8B 1H5QA 1E8DA 4YBZA 5E4YA 4WY5A 3ZVMA 1TC2A 2IYUA 3G49A 4UXHA 3JASB 1KORA 3ZXUB 3QKIA 4U2DA 2CYBA 1C41A 2Q07A 4X7RA 3FTEA 2BF4A 2GF0A 5B7PA 2Q22A 1HR0B 1FIUA 1GNRA 2BUBA 1H6BA 4FYHA 5DO9A 5EHIA 4E1VA 3LP8A 5JD4A 1HG0A 3OQHA 2I6UA 1QS0B 1G6HA 3QY9A 5C81A 2EV9A 3AP1A 5LQDA 1N78A 3G8DA 2ATEA 4DJJA 3B2EA 4PSAA 2HMWA 3T5CA 1SVKA 4FINA 3PNLA 4M21A 7MDHA 3EBOA 3U4CA 3PC8C 3L82B 2WOJA 3S6JA 3IODA 2C9OA 1QRTA 1LBSA 3D1VA 2ROQA 4C6HA 3DE0X 5AIAA 4A6PA 3OPQA 2OP1A 3PUKA 4XYGA 2QVBA 2XBUA 1NIJA 4J0DA 1X9HA 2NVWA 2QZJA 4HEQA 5FKJA 3A25A 2JKZA 4MPTA 2CBXA 2HRRA 1EFDN 4WOCA 1KGSA 2B1QA 3VNRA 5IF3A 4RTOA 1MA0A 2GZMA 3MWKA 4PQYA 5EWLA 5IAEA 4DRXA 1X94A 4CDRA 2FF7A 3A05A 4J0QA 5LA6F 4U7HA 2GN4A 4ZI3A 4N03A 1E3EA 4P0QB 2JIRA 3M83A 2KX7A 4FS3A 1G98A 3V2IA 4HNAB 4GM0A 1AQIA 4KN5A 5F4ZA 4M1TA 5EN4A 5FIUA 4DLVA 5BQFA 2ORIA 5JAMA 4GD3Q 4JQSA 5B5SA 1ORTA 3INTA 3GFPA 4QYTA 1W76A 1I7NA 1IHUA 2DPYA 3FHLA 4EHNA 3T5PA 5JJCA 1HTBA 5HCNA 1UBHS 4TZ0A 3W04A 1VPTA 3U3KA 3OEHA 2IYPA 2VK8A 3CX6A 1KK3A 4G8CA 4MGYR 4HQNA 3SHFA 2PWAA 3G1WA 3CB2A 4JHLA 4P86A 5AVYA 4L2IB 2XVMA 3PPXA 1SOAA 3CIOA 1CLEA 3ZE2B 4C7MA 1YK1A 3S2ZA 4H3KB 4DSUA 4QUDA 3NYIA 5ENDA 3GVHA 1Z34A 3EGXA 3FGOA 4XM2A 3VNSA 4EVQA 3CVVA 1IHPA 2M98A 3AB8A 1OIWA 1M2NA 1XDBA 3HYLA 3NHMA 4GOOD 4J03A 3WFIA 4IYRA 4X65B 2HHJA 1O89A 3FYDA 4R2MA 2IHNA 1JT9A 4RHUA 4YJ2A 2J87A 2HBYA 3AGQA 5BWCA 3NVKI 1B15A 1VG0B 4LTMA 1AURA 4X64B 3CF4A 3SAJA 3KB6A 1DUIA 2YS7A 4NCKA 2FHPA 1N2CA 2WF9A 2ZLBA 2Y2UA 3AY7A 1DBWA 3K0KA 4J0KA 3T7DA 8ADHA 1EPUA 1T43A 3OTOB 2QTMA 1YA8A 3ZIAD 2XBMA 5JRDS 4G5RA 2NT3A 3I8OA 4ZDKA 1H6DA 3U1BA 1GUFA 1QNFA 2AFIB 1D3AA 3D9QX 4IDAA 1JEYB 2A14A 4QUIA 3GJ6A 3SSOA 2J1LA 1B8NA 4DGQA 4QDOA 1X9GA 2B2XA 2C2WA 2ZUEA 2MR5A 2A3NA 1NP6A 3MRSA 2O57A 4J0CA 1VCMA 3HBAA 3K35A 4GPTA 4GWKA 4BP8A 1ORVA 3LKDA 3K0SA 3B3QA 1NDUA 1IXZA 1LTHR 1JB1A 3EDMA 3LOQA 1SCAA 2PH3A 4IV0A 1F38A 3MGKA 2QW0X 4X8OA 1ZUNA 1Z28A 4PGAA 1E0DA 2XQVA 2XZTA 2NYUA 1HORA 1G0OA 1E1YA 1CJMA 1SCNE 2F00A 4MKIA 1KZGB 2Q1TA 4IO0A 4NBVA 4QDXA 5EXSA 1IU9A 2FG6C 2XTAA 2G4LA 3WBFA 3VYRB 3CF0A 4EIWA 1NX9A 1Z2DA 1A1SA 2IGBA 5CFRA 5LNK1 4TS3A 4IFEA 1NSTA 3KAPA 4PLHA 3WMGA 3C16C 1YGPA 2PQMA 4FHFA 3IAS6 4K9NA 5ABPA 2PO7A 4PC6A 3AM1A 3SE0A 2JVIA 3JYQA 1P6XA 3DE1X 3JVEA 1H22A 1U4OA 3W1WA 1TJ4A 3B9BA 2XVZA 4Q48A 3TDNA 2XKBA 4MW4A 3RIGA 1RWVA 2OK8A 5J2TB 4HATA 3H3JA 1E96A 1Z0DA 5LUAA 3U4DA 2VUIB 2YWJA 4IOMA 3HVIA 3UMVA 2P6NA 1V8PA 2HLDD 2QQGA 4XJTA 2J3LA 5FJJA 3ZW9A 1MGPA 4EHBA 4K9RA 1L4GA 4HXGA 5CLQA 3HCDA 3AOGA 4GT1A 1OVGA 3CY6A 1LEHA 3QHAA 2A58A 2A3RA 2FB9A 1GT6A 1NM5A 1V3QE 4G0OA 2YXNA 3GJZA 4FQ7A 4K8RB 3NT4A 3EPPA 4O4LA 3RJ9A 3P2JA 4OB7A 2XCOA 5F2KA 1I8TA 1F2VA 1TAQA 3HBNA 4KQCA 5LSAA 3DOJA 5HK8A 1PU2A 4REQB 5HZKA 3ESAA 4LJRA 2A6PA 3QITA 2UVPB 3WA7A 1RPJA 1UBFA 3ZHSA 2IS1A 1ZCFA 1XR3A 5TQ2A 1I13A 2QUHA 2C9CA 1FYFA 3HR7A 2NVUA 2ZKLA 4NZMA 5AM5A 3TLKA 1WCIA 4FS8A 4IVQA 5FUMA 2ZOSA 5JNUA 3U7IA 1BWPA 3QY0A 3CV3A 1DWOA 4K3UA 4X24A 4H6XA 3QNWA 1I2MA 2YZMA 1L8AA 3ISJA 1GU7A 2ZIVB