3Q2IA

Crystal structure of the wlba dehydrognase from chromobactrium violaceum in complex with nadh and udp-glcnaca at 1.50 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
352
structure length
345
Chain Sequence
MIVIPPITDRKIRFALVGCGRIANNHFGALEKHADRAELIDVCDIDPAALKAAVERTGARGHASLTDMLAQTDADIVILTTPSGLHPTQSIECSEAGFHVMTEKPMATRWEDGLEMVKAADKAKKHLFVVKQNRRNATLQLLKRAMQEKRFGRIYMVNVNVFWTRPQEYYDAAGWRGTWEFDGGAFMNQASHYVDLLDWLIGPVESVQAYTATLARNIEVEDTGTVSVKWRSGALGSMNVTMLTYPKNLEGSITILGEKGSVRVGGVAVNEIQHWEFSEPHAMDEEIKDASGFGHPLYYDNVIKTMRGEATPETDGREGLKSLELLIAMYLSARDGRRVSLPLDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Characterization of WlbA from Bordetella pertussis and Chromobacterium violaceum: Enzymes Required for the Biosynthesis of 2,3-Diacetamido-2,3-dideoxy-d-mannuronic Acid.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Oxidoreductase
molecule keywords dehydrogenase
total genus 132
structure length 345
sequence length 352
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3q2iA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3q2iA01
2PH5A 2D0IA 3GPIA 1T26A 2AG5A 4LSMA 1HE5A 4UVDA 1PGOA 2CF6A 4Z9YA 1GUFA 1GUZA 1ZEMA 4DLAA 1PZGA 4GSKA 4AJEA 2DKNA 1VL0A 2XXBA 4I1IA 5AXAA 4G81A 1A7KA 4RVHA 3LC2O 4IQGA 1YJ8A 5DP2A 1WZEA 2UDPA 1HDYA 2G17A 1BW9A 4JLWA 1IY8A 4J1SA 3AOEA 3FR8A 4ZD6A 2J6IA 1H2BA 2DU8A 2Q1SA 2HK9A 3ADOA 3RC9A 3OMLA 4HXYA 1U7HA 2P5UA 3WGGA 1PWXA 3WDSA 3MJSA 1K6JA 1NNUA 4DQXA 4W4TA 2R2GA 4XJSA 1ZSVA 3C7CB 1J6UA 1ZJYA 1GL3A 1N1GA 4OQYA 2FZEA 2BKAA 2PGLA 3S2IA 2CSUA 3NX4A 2HMUA 2BGMA 3OA2A 1ZZEA 3ZU5A 2RH4A 3GZNA 1E3IA 3RC1A 1X7GA 1QYVA 1ZXLA 4IDFA 1GZ6A 2X0IA 2O7QA 4BO9A 4N7RA 1V0JA 4O6VA 3SEFA 1KS9A 1X15A 3CZMA 2AQKA 3OJ0A 3JTMA 1BWSA 2PKQP 1G6KA 2E49A 1NPDA 2HMVA 1MC5A 3FTNA 4PLYA 1F12A 1NVGA 3UXYA 5G0VA 4PG8A 1HE2A 5CPFA 1B16A 3F1KA 2BHLA 5A5EA 4CLOA 1Z6ZA 2TMDA 3IC5A 4RV9A 3X2EA 5GY7A 3SJUA 3DC2A 3JQGB 5DNAA 3DZJA 4CUZA 1SPXA 1WPQA 3GVHA 2ZQYA 4D42A 4J3FA 1I3KA 1LLCA 2H5LA 3NDRA 4NNJA 5IAAA 2NWQA 2VNSA 4CR6A 4II3A 3EMKA 3QVSA 3WGOA 3KUXA 2NQ8A 3KV3O 5TF4A 1ZSNA 2EP7A 1E3JA 4YBZA 4K26A 3UCXA 1T4BA 2IRWA 3CIFA 1B3BA 1ADGA 3K9QO 4I9NA 3GGGA 3LF2A 3WFIA 1SEPA 5KWEA 4KDFA 1E7QA 4UUMA 3DAFA 4TKMA 5L7TA 3H65A 4NJOA 2IXBA 2VHWA 5JBIA 4R69A 1PJBA 3O38A 1NAHA 4R1SA 4UULA 4Z0PA 3DQPA 4QEDA 2QHXA 3HWRA 4QO8A 1L1FA 5JCJD 2AQHA 2VN8A 3GC6A 4KDEA 3F1LA 2R00C 3G1TA 3UN1A 5KKAA 1I3NA 4AFNA 1T25A 3BAZA 4GSLA 1CQJA 1N9GA 2NACA 2WDZA 3GR6A 3ZU4A 2B69A 3QVOA 3WJ7A 4AJNA 1Q0LA 3INGA 1YRLA 1PJSA 1IUKA 4P22A 5C3MA 1DAOA 3I5MA 2HJRA 3LC1O 1IOLA 2Q2QA 2Z1MA 3WLFA 4KQXA 3GMSA 2CFCA 4NBWA 3ZWBA 5ENVA 2VWQA 5A02A 4EEXA 3U62A 4PIVA 2G82A 2X4GA 4Y98A 4UEKA 4BQRA 2GCGA 2ZTMA 5M6DA 3ZU2A 1X1EA 1LSSA 2AHRA 2JFGA 3L9XA 4Q3CA 2Q1TA 4WCDA 3D3EA 2B5WA 1U4SA 4XIYA 3CXRA 4FIZA 3FRJA 1F06A 3KRTA 2JL1A 3JD2A 3ICPA 3K96A 4FOSA 2VUSA 1HETA 4YT8A 3WSWA 2NSDA 3EGOA 5JO0A 3PPIA 3PXXA 1D1SA 1H9AA 1DC4A 3PI7A 1KETA 3HE3A 3H3FA 4NQZA 5TLSA 5T5QA 1UXKA 1EE2A 2R6JA 2JHGA 1HDGO 1ZJZA 3IS3A 5H82A 4IIUA 3W6ZA 4CLRA 4AJPA 1XGKA 3KO8A 1K6IA 1X7DA 1A9YA 4JNKA 1JU9A 1RJWA 5MDHA 4CQLB 4ONEA 3VKVA 4OXNA 4BQPA 4XKJA 1GCOA 2E4AA 4IDGA 5TIIA 4LSWA 2NV6A 1LXCA 3DBLA 5COBA 3N58A 4K9DA 2EP5A 1YL6A 4YXFA 3TZHA 1KVRA 1ZK2A 3HB4X 2P2SA 2O23A 3BYZA 4XWYA 3AOEC 3I9NA 3S2FA 1GCUA 2IZ0A 3ORFA 4E2ZA 5A03A 4CUKA 3QVTA 4MJLA 1Q0HA 3VH2A 2NTJA 2Y1EA 3H8VA 3TZKA 3FNHA 3BHMA 4PLZA 5BQFA 1V8BA 2VOEA 4CMIA 2VT2A 3IQDB 2VWPA 3V2HA 5DBFA 4C7KA 4HBGA 4XYMA 2DUWA 5JDIC 5L3ZA 5C5IA 5TC4A 1EFLA 1N1EA 2PLAA 4BB6A 3VPGA 1GDHA 1T2FA 5DCUA 1YOVA 3PTZA 4FFLA 4R41A 8LDHA 1V3UA 2WEKA 1CYDA 2I65A 4PG7A 2DBQA 1MUUA 4BOYA 1YGYA 2YY7A 3LT4A 4UUOA 1NR1A 4MVJM 3ZHBA 2Y1DA 5CPBA 1UH5A 1E1MA 2XPCA 2HUNA 4YQZA 4CMIB 3DOJA 4XDYA 1T2EA 5A3JA 3VZRA 3ZGYA 3PJEA 4I08A 4OOEA 4X54A 1P33A 4PRKA 4AICA 1MP0A 2CD9A 3DWFA 5GZ6A 5ER9A 1H9BA 4W7IA 3KLMX 2EJWA 4DL9A 5JYFA 2X23A 2VWGA 1XIVA 4PZDA 3VVBA 3F46A 2BELA 1ENZA 3GQVA 2GRAA 2ZJ1A 5COQA 1FDSA 2J5KA 4ZRMA 3U4IA 3B1FA 1C1XA 3GGOA 2X0JA 1GADO 3ETDA 2QQ5A 2YQ4A 1JDJA 3U5TA 1JVBA 3EUWA 2GN4A 1HYGA 2J3JA 4CJXA 1CQIA 4WCFB 4R4JA 3RI3A 1WMBA 1NVMB 2PA3A 3JQEA 4HFRA 1BXGA 2JJYA 4PCVA 2PK3A 3KYCB 1ZNQO 4ND2A 1EUCA 1P74A 1PJTA 3ZWAA 2VTEA 5JMPA 3P5SA 5F1KA 5F5NA 4OSOA 1NHWA 1V9LA 1MFZA 3ASUA 3PWKA 2QX7A 4DVJA 1ORRA 3I9KA 1B8PA 4PLCA 1BTOA 4IJUA 2R00A 3L6DA 4TSKA 3RUAA 1LRKA 5KJCA 1SOWA 1LSJA 4KWHA 1PJ3A 5B4VA 2DLDA 2TMGA 4L75A 4EGFA 4YJHB 1IZ0A 2QRKA 2GPTA 5HA5A 1DO8A 1PU2A 3WBBA 3EDMA 1O89A 4OKNA 5F21A 1HDCA 1VJ0A 3NTRA 3WYEA 1O5IA 3JQ8B 3HDYA 4LISA 5COAA 1E7SA 4MVJP 3OQ6A 3DOCA 4MP8A 3NKLA 2EWMA 4M49A 1ZIDA 1SAYA 1QG6A 2IYPA 1A5ZA 3D0OA 3RJ9A 5FWNA 1EDZA 3ZW9A 1EK6A 3WTCA 2X0NA 4MIYA 2VRCD 3AM3A 2YV3A 1B8UA 2FY8A 3BZUA 3KSDO 5JYEA 1CETA 5G0WA 1H2HA 3QSGA 4R54A 4U7WA 1KERA 1GFSA 3Q9NA 3VC7A 3JQ8A 3KETA 1KVQA 4FFOA 4GX0A 3JQ7B 1XEAA 4JN6B 3VZQA 2O4UX 5C7OO 3WLEA 1ML3A 4IDCA 4RGBA 4IY1A 3MWEB 3INTA 4YJFA 2JAHA 4NBTA 4FFPA 3RJ5A 1MX3A 4M55A 1C1DB 1U3UA 3DZBA 5C37A 2I67A 4YVFA 3ST7A 2C82A 2Q3EA 1DLIA 1VRWA 3VZPA 3ZW8A 4NFHA 4B3HA 1A71A 4G65A 3K31A 3KVOA 3GMDA 2FWMX 1L7DA 1H94A 1C14A 2X5OA 1GR0A 1RM0A 1BRMA 5JPIA 3DTTA 3AOGA 2RBEA 3D3WA 3LT2A 4OYRA 2IE0A 1C0LA 2FRDA 1BSVA 3MTGA 2Y0DA 1MGOA 4FCCA 3TOZA 4RF5A 2OFPA 3WG9A 5IN5A 3TOXA 1W8DA 3O03A 3MOIA 4GVXA 5JXWA 2QRLA 5K6AA 3DBHA 4JK3A 2EGHA 4HX5A 3WX0A 1VJ1A 1QSGA 1HYHA 3ZHZA 2EEZA 3JD1A 2DBRA 4E32A 3W4JA 4R3NA 1NQ5A 1ZFNA 4NBUA 3KYDB 5KVQA 4D7AA 4WCFC 5BSGA 4U0JA 1JQBA 2EV9A 4L76A 2HK7A 2I66A 1QYCA 4IDDA 5EINA 4GGOA 5IDQA 5T73A 1T2AA 1X0XA 2O3SA 1XG5A 2ZB8A 2CMDA 2YZ7A 5A1TA 4LCJA 2J5QA 3DDNA 2JAPA 3F5SA 3O26A 3VOSA 4ZHSA 4MINA 4FD3A 5T6BA 4WJZA 4AJHA 1G0OA 2YYYA 2OMEA 2VHYA 5G4KB 1SOVA 3VDQA 1NX6A 1YXMA 4RVFA 2C07A 4RL6A 3Q11A 3AU8A 4BNHA 2ET6A 2EKPA 3ITKA 1DRWA 4FSHA 1QV7A 3D4NA 4H15A 3JCZA 1WDMA 4YDRA 5B37A 1OZAA 3WS7A 4E4YA 3E82A 5KCZA 3ZH2A 1EMDA 4TKLA 3W8EA 4OJNA 4O0LA 1A72A 1PJ4A 2OBNA 2Y93A 2YUTA 3QWAA 4BO0A 4I9HA 3ONEA 1B26A 4HNGA 4CL3A 3CMCO 2PNFA 1DXYA 4EYEA 1HE4A 4L9RA 1Y1PA 2D5AA 5L4LA 4K6FA 2H6EA 1YL7A 1EK5A 3G17A 4WUVA 5KJ1A 4FQ8A 4GGPA 1W73A 2NU9A 4D46A 4GL4A 4E5YA 4J9UE 3JQAA 3NDIA 1HDOA 1ENYA 4NFSA 4LK3A 3GH3A 3E48A 3GZNB 3Q6IA 2J3HA 1KEPA 4BO3A 1BXKA 3EVTA 1UXHA 1Y6JA 4EJMA 5JYDA 2PKRA 2O2SA 3WGHA 1I24A 3K6JA 2PR2A 4DRYA 3LSYA 2ZTLA 3RFVA 4GX2A 2CVQA 1XWFA 1PQUA 1GY8A 2OBYA 2A4KA 2FN7A 3GVPA 4N5NA 2GO1A 3EYWA 3ZU3A 2B0JA 1PS8A 3TZ6A 1E7WA 4CM8A 4GKVA 3PK0A 2GGSA 1OMOA 3TL2A 3KYBA 3OECA 1H93A 1H5QA 1LNQA 1T2CA 4BGIA 3V1UA 5JMWA 4WEOA 5B4TA 4II2A 3TL3A 4CM5A 1NBOA 3S55A 5CG2A 1FDTA 3DZFA 1DFIA 4N18A 2VNAA 1Z73A 1I5RA 5EPOA 3JQDA 1SNYA 3HADA 4EW6A 4CR8A 1VI2A 3AUAA 4AJIA 4ALNA 1O95A 1K2WA 1LSUA 1AE1A 3G79A 3ZWWA 4P8RA 4W7HA 1X14A 1N2SA 3DBLB 2I99A 5EL0A 4AJJA 2CY0A 1UP6A 3DR3A 4JCOA 4CM9A 3H6KA 5BR7A 3CH6A 1PGQA 1U3TA 3PLNA 2UUPA 4RLHA 4ZVVA 2WYVA 3H9QA 1Q0QA 2O50A 4GKBA 3FBTA 3ZWPA 4BNGA 2JFFA 2VYVA 5KJ6A 2YDXA 5ICMA 3JQ9A 3ITDA 5B1YA 1WXDA 5HS4A 2GD1O 1KYQA 4JXKA 4FGWA 5JCJA 3L07A 3R3JA 4W9NC 3ZNQA 4BO7A 4L4RA 3TFQA 2IEDA 3KSZO 1HDXA 3RKRA 1NVTA 1EBUA 2D2IA 5THKA 4CMKA 1E3EA 3WYBA 5TSDA 4R1TA 1NQOA 1SB9A 3O4RA 1LUAA 1CWUA 4RZIA 1Y8RA 4KTTE 4BO2A 3HDQA 1PGPA 3HN7A 3OIDA 1U2GA 3UKOA 4WLOA 3F47A 1M67A 3STHA 4KP7A 2GZ1A 3N74A 5ES3A 4CODB 3QHAA 5TS3A 5K6AC 1QV6A 1ISGA 3L0DA 2X86A 4E2YA 2NLOA 2Q46A 2WYUA 1UR5A 4CQMD 2FOIA 3T4EA 5I7EA 4RPKA 1ISHA 1MXHA 1ONNA 1LI4A 5TQVA 5J9GA 2JD1A 5AXCA 3AK4A 1U4OA 4ILKA 4DGSA 1EDOA 1MG0A 1XDWA 1HZJA 1WAMA 3VPXA 3DBRA 3OEWA 4O1MA 4UVEA 5F5LA 3ANNA 3QQPA 2PZLA 4HY3A 4XB1A 2OXIA 3D4OA 3RCBA 1KEUA 2FR8A 3ZWYA 2NU7A 4YRAA 5JW6A 4R68A 1DPGA 1ULSA 4CPDA 1XQ1A 1DBVO 4IQ8A 1BXGB 1WVGA 1NTOA 2HMWA 2W8ZA 3GY0A 3H9UA 4ZQBA 2DFDA 5T8KA 3VVCA 4FC7A 5BNIA 1JAXA 1J5PA 3OM9A 4IJVA 5JAMA 3VTZA 1DJNA 2D1YA 4ZICA 4CV1A 3LK7A 3GK3A 2C0CA 6ADHA 1R6DA 1XHLA 3WNQA 4OXYA 3I6IA 1ADCA 1ID1A 3GN1A 3OJFA 4WKGA 1NFRA 3W6UA 1MB4A 2PZJA 4CLRB 1TB4A 2ZTVA 3JYNA 4D41A 1PR3A 2B37A 4FW8A 3IOYA 4LVCA 3GRKA 1SEVA 2NADA 4CM1A 4XYBA 3BHJA 2E37A 2NQTA 1IB6A 3PQFA 4WOKA 5U4QA 3PRJA 3B6ZA 1AXGA 1AHHA 4C7JA 4GX1A 3TJRA 4CM7A 3RBVA 4NDNE 1M76A 3DHNA 4PG5A 4R5HA 1NR7A 2EIHA 2X8LA 1MC4A 3O8QA 1BMDA 1YKFA 1IHYA 1WLYA 4J4TA 1AHIA 4RQTA 3NT5A 3PHJA 4UVHA 5L4SA 3JQBA 4W6ZA 3VH3A 3UAGA 4TMFA 4CM9D 1R4MB 4PLWA 3RVDA 3PJFA 2FZWA 3WTBA 3QRWA 3MOGA 3I1JA 1SZJG 4DPMA 4NBRA 3E1KA 4Y6PA 3NAQA 4WGGA 3I9MA 1ZK3A 4YAKA 1I33A 1FJHA 1FK8A 5EESA 4BKOA 4MVJH 3QE3A 1U2DA 4R9SA 2PD4A 4E21A 1E7YA 1JKJA 4B4UA 3GFGA 5H83A 3DMYA 4MP6A 5IG2A 2A92A 1U5CA 3NJ8A 1IL0A 4J49A 5CFZA 1S6YA 3NGXA 2V6BA 5GMOA 4ALLA 3QWFA 1HKUA 3D5QA 3MJ4A 4FS3A 3JYOA 3B20A 1DDOA 5L7YA 1U1IA 1U7TA 4CV3A 3F6YA 4ND5A 3D3WB 1UP7A 2HMSA 2YHIA 4FR5A 3HFGA 1EVZA 2DM6A 2EKQA 4FJ0A 1TI7A 4IGEA 4A26A 1KVTA 1P3DA 3VH4A 4XZ3A 1YBAA 2A9FA 2BI8A 3ZHYA 2BFMA 2VYNA 1HXHA 2CVZA 2ZB7A 4ALJA 1WZIA 3M2PA 4CV2A 1ZW1A 4A03A 3V2GA 4DQUA 3WQSB 4EJ0A 3I6QA 3AFNA 3GUYA 4YJHA 1XSEA 2RHRA 5ENDA 3LYLA 5C7IO 4PZEA 3JQ9C 1Q1NA 4CV0A 5JDCC 2DC1A 3FNGA 4BV8A 3OQBA 1DC5A 1E3WB 4MKXA 3ZDFA 3ROQA 1I8TA 4W9NA 4B3IA 5IXYA 5HWSA 3TDKA 3BHIA 2RAFA 4MVJI 4B7CA 4Q39A 1E1LA 3WNVA 1QMGA 5KJFA 2O48X 5BSEA 1BW9B 4FPXA 3DB2A 5G4KA 1LDMA 1ZK1A 4NZ9A 5AVOA 3GF4A 3E6AA 3IJPA 2XF8A 3ON5A 4CM6A 1MLDA 2CVOA 1GYQA 4BGEA 1HSZA 2VRBA 5F1PA 4JBGA 1GZ4A 5I8ZA 3RUDA 5L45A 4YTEA 3H9JA 1LEHA 4TVOA 1EFKA 4Y8VA 1PGJA 5GZ3A 3S2GA 4DTIA 2G0TA 4DLLA 3ENKA 3JQ7A 4A2CA 5BNTA 1KOLA 4AL4A 2DVMA 4CM4A 1XQ6A 1HRDA 4IUYA 1F14A 3W8DA 2GNAA 4PLGA 1VKOA 1N8KA 4NK5A 4YWJA 4ZN6A 5IF3A 1M6WA 4JGBA 4ITUA 1YL5A 1DLJA 1H6BA 1Z7BA 4B4VA 3JD3A 4PFJA 2W2KA 4YR9A 1QORA 3PIDA 1ZMOA 4D3SA 4CLOB 2GASA 2JFHA 2AMFA 4Q3AA 3DAPA 3ZHXA 5LDGA 5IZCC 1YBMA 3F4LA 4HKTA 2Y0EA 1ZH8A 2EF1A 2HRBA 3CSDA 3VZSA 3SJ7A 1C0IA 1ZK4A 3DONA 3DZIA 5CEFA 5T8KC 1GPJA 1R4NB 1UZNA 2IEBA 3BA1A 1KY5A 4HNHA 3PJGA 3U0BA 3F3SA 4U0KA 1R12A 1A4IA 4NBVA 1H6CA 4UUPA 4GMFA 1B8VA 2WTBA 3DFUA 5KIAA 4OSPA 1LQTA 2A94A 1LBEA 3DHYA 3RFXA 2AE2A 1HZZA 4U6QA 2JD2A 1KIFA 3OA0A 2QW8A 1EE9A 4DIBA 3X2FA 3ZWNA 2YFQA 3KXDA 4AVYA 1F17A 1AXEA 1A9ZA 1PWZA 3HZZA 4PVDA 5KKCA 2E6UX 4JQCA 1NYTA 2Y66A 4HFMA 5DT9A 3C1AA 2HQ1A 3QWIA 3KEOA 1DB3A 3EC7A 2VHZA 5A9TA 4DBZA 3RROA 2V7PA 4CQMB 1P44A 5EERA 1F8GA 3BIOA 2EG9A 3CUKA 5A3VA 4QSMA 3GEMA 1HYEA 2VYVD 4UVIA 3JQBC 3PHGA 3RUFA 4WECA 3HHPA 5ITVA 4UUNA 1LJ8A 1E7MA 5U1PA 3MWDB 2WM3A 5BSHA 1LQUA 1ISIA 3GAZA 3KYDA 3RU9A 3WR5A 3AWDA 3UCFA 1NPYA 1BG6A 4W99A 4RPJA 1TT5A 1BDBA 1HT0A 1YE3A 4E6PA 1X13A 1P1RA 4PGFA 2I3AA 1T1SA 1U5AA 4NMHA 3PYXA 1P45A 4GI2A 5FI3A 2BLLA 5CG1A 1WDLA 3P2YA 2W98A 3IP1A 4BMSA 1WP4A 5IN4A 2NTVA 3V5NA 2BF7A 3ENNA 1TVEA 1P1FA 4Y6RA 1PTJA 1NWCA 4LCEA 5G0TA 1Y8RB 1PZHA 1WWKA 5JY1A 3MJVA 2UVDA 4J0FA 1JAYA 2AW5A 1OC4A 4AG3A 5JAZA 3GG9A 3WGTA 3LC7O 3WGZA 1W6UA 4ALKA 2GSDA 4LN1A 4XD2A 4CMAA 3JSAA 1PJLA 4BO6A 3PJDA 3GN2A 3OJOA 4A73A 1SMKA 3SLGA 1Y5MA 5IDXA 3MJEA 4XX0A 1KVUA 1E92A 3ZNOA 4Q3DA 4ZQEA 5TGDA 1PR9A 4FGSA 5BT9A 1DIGA 1VLLA 4BO5A 5JDCA 2VT3A 5JO9A 3VDRA 3RBZA 4AJOA 3T7EA 1VC2A 3WBFA 3UHAA 3UCEA 3A28A 3WFJA 1FDUA 4YRDA 4BNKA 3HG7A 2PWZA 3FNFA 5K0ZA 3V2UA 5KTKA 4J4HA 1E3LA 2B4RO 4YA6A 2P9CA 2HK8A 1ZVMA 1Q2XA 2Q99A 3OIFA 1NPTO 1W4ZA 4PLTA 3PQDA 1CERA 1TA4A 2Y1CA 3ZV6A 1IHXA 5A5FA 4RPLA 1YONA 5ITWA 3ROMA 2ZB4A 1Z7EA 3GHHA 2W2LD 1QR6A 2Y0CA 3S1LA 5JCXA 5KNLA 4M8SA 1RKXA 4OL9A 4OMUA 3UOGA 4YYZA 4BMVA 1RPNA 2AEFA 3S8MA 4A7PA 1YDEA 3ZWOA 4J2OA 1ZKMA 4ALMA 2BFOA 3PLRA 2ZK7A 3AJRA 4LRTB 4GH5A 3PVZA 3B70A 1R15A 1SB8A 4QO7A 1FF9A 1E0DA 4YACA 3ZZNA 4B4WA 3ETGA 1H6DA 3PDUA 2VOJA 1K3TA 2VZ9A 3U4CA 4HFNA 2C2XA 3PYLA 3CINA 3QLJA 1P31A 4JBIA 2DUUA 1CJCA 5CEJA 4D0SA 5IZCA 2Q1UA 1P1KA 5HS6A 4EUHA 5BSFA 2JCYA 5DBIA 4GBJA 4MVJF 4TZKA 1CRWG 2WE7A 4OOFA 3BTSA 1U8XX 1V3TA 5AYVA 1C1XB 1I2BA 1RYDA 4GPD1 4N54A 4M54A 3DMTC 3A9WA 2FPGA 3HSKA 3MTJA 2O3RA 2ZYAA 4AJ2A 3HNPA 3RC2A 1DOHA 4JBHA 1ZUD1 1HLDA 1N7HA 1YBVA 5EN4A 4MVJE 1ENOA 3TZCA 3JQ6A 4QFCA 5JDIA 3AY6A 2OP0A 4AJ4A 4QQRA 3IDSA 1MG5A 2CNBA 2F1KA 4RVGA 3C7AA 1B15A 1FDVA 1R37A 1UZMA 3F4BA 2UAGA 2X5KO 3PHLA 4Y67A 3ONFA 4TQGA 2QRJA 1O8CA 3G3EA 5T57A 4P4NA 1D7OA 3NT4A 1ZCJA 4PLHA 1YVEI 3H5NA 4ZQGA 2AEMA 2PD6A 4RLSA 4R01A 4XCVA 3WQRA 1Z45A 5A9RA 1E1KA 4GLLA 4YJDA 3LDHA 1E7RA 5DOVA 2YFHA 1J49A 5HRUA 2X9NA 1QXSA 4BNTA 2PTGA 3H2ZA 3QJ5A 4BVAA 3TPCA 1JN0A 1Q7GA 5DOZA 2QYSA 2Y1FA 2EHDA 3QIVA 4E5KA 1JLLA 2P9EA 4FN4A 2PV7A 4RDHA 4N5LA 4E5PA 3AUSA 1H0KA 4P38A 3ANMA 4RDIA 3WMXA 3PGJA 4E31A 4F3YA 5DF1A 3IP3A 4BV9A 1PJQA 1Y9AA 4J7XA 1E3SA 1YS4A 4BNWA 1EUDA 4XR9A 5HM8A 4BNVA 3WMWA 5B4UA 5LCXA 3ZI0A 2AEJA 1VPDA 2EJVA 1BVRA 4DQVA 1PJ2A 2XOXA 3C3XA 3CPSA 3GEGA 4J16A 3FN4A 4MOWA 2VWHA 4BO1A 2Y99A 5TJHA 4EJ6A 1QP8A 4MVJA 4IXTA 3ZV5A 4M87A 4OGWA 3TFOA 1YQDA 2ZTUA 5G0UA 2SCUA 3RKUA 2O3TA 3NT2A 2AQ8A 2DTXA 2B4QA 4URFA 4XQEA 4CM4B 4GX5A 4JJFA 1XU9A 4WLUA 4YT5A 1PQPA 4DIOA 1HL3A 3E9NA 5IZ4A 3GVXA 5FFFA 4ALIA 4XQCA 3ZWXA 1LLUA 2XXJA 4B7XA 5I7FA 2O3UA 4YT4A 3K92A 1RYEA 2NU6A 3QVXA 1K89A 1JVSA 4XGIA 3VHRA 4N5MA 5CAEA 1DHTA 1V3VA 2IZZA 2DBVO 1E77A 3PFWO 3GZ4A 1CIVA 3ICCA 4CM3A 4IDEA 1LC0A 2YJZA 1B14A 3PEFA 4MKRA 5LC1A 1PS9A 2DPGA 1LDGA 3DOOA 4UREA 3KHUA 1R66A 2DTDA 1N5DA 1DAPA 4DPKA 3V1TC 3UVEA 4E2XA 2RH8A 3EAGA 3WB9A 4TRRA 5DCYA 2Q2WA 4U5QA 2HAEA 3KB6A 4WNCA 4XYGA 3VAZA 1GEGA 5TT0A 4PLPA 4NHEA 4W82A 5AQ1A 3A1NA 1TT7A 4OHUA 4OIMA 2NU8A 1V35A 5A04A 2BD0A 2GUGA 2D3TA 2EW2A 3ADPA 4PZCA 1JTVA 3FWZA 3U4DA 1E3WA 2EXXA 4YAGA 2PGJA 1T2DA 3PP8A 2YHIB 2HRZA 5AXBA 2DPHA 2GLXA 4BL5A 2OO5A 3DL2A 4M1QA 4OQZA 5I7VA 1QKIA 1WW8A 4RVDA 4NFYA 3WICA 3C24A 1WNTA 4S3MA 4M86A 4E12A 1P1HA 2FHSA 1YWGO 2P5YA 2VZ0A 4NU6A 2AXQA 3EW7A 1AGNA 2OP1A 1NM5A 3DZKA 2NVUA 1LSOA 4D3DA 4MO2A 4WCFA 1LLDA 4J4BA 4XRRA 1UZLA 3OICA 1N92A 4PG4A 1GTMA 1R0SA 2Y68A 1YB4A 3GAFA 4PN3A 1QYDA 3I9LA 1PGNA 5EJ2A 1ZEJA 3GDFA 4CMHA 1C3VA 1IYZA 2CUKA 5EMHA 4B79A 1D8AA 1YB1A 2YV2A 3JQFC 4MP3A 4CMEC 5IJZA 1VL6A 2PZKA 4IJWA 4ZU3A 3BMCB 2EGGA 4CM8B 2UYYA 5IFLA 2BRUA 5J23A 1YJQA 3SX2A 4D79A 2BH9A 4IM7A 2C2YA 3BMNB 4PVCA 3MZ0A 5ILOA 5TRTA 3WOHA 4EBFA 1HE3A 3NDJA 5HBRA 3RQSA 4PRLA 2JKVA 5A9SB 1DC6A 3E8XA 3KOUA 1XKQA 3TWOA 4HUJA 3C8MA 3FF4A 1J0XO 4XB2A 2AE1A 4ROSA 3CE6A 3TF5A 1LRLA 3UW3A 4Y6SA 3AI2A 3BMCA 5TNXA 4BNXA 1EVJA 2O7SA 4FC6A 3OSUA 4DREA 1BVUA 3HJAA 2FR0A 3BMNA 2ZJ0A 3L4BA 1G1AA 3NUGA 4LMPA 2VUUA 4DUPA 1Y8QB 1GYPA 1UDAA 4E5MA 5FEUA 1K0UA 4Z3DA 4D3FA 3ABIA 2ZQZA 1EVIA 4KTVE 3WQQA 3HB5X 5FYDA 3GVIA 2IZ1A 2VTDA 4XA8A 4ESOA 1YOVB 4KMSA 4RORA 3ZV4A 4YAIA 1GQYA 4IXWA 2ZYGA 1Z74A 3KM0A 1JKIA 2PD3A 1C1DA 3U3XA 1LU9A 1GQ2A 4RZHA 4DXHA 1S7CA 1DIAA 4IMPA 3N7UA 4L4SA 3DZHA 2H63A 2ZATA 2X7HA 3B1JA 4HADA 3LZ6A 4I8XA 2V6MA 3PWSA 3ZN2A 3U09A 2BI7A 2GN9A 4DPLA 2ILTA 1PEDA 4A27A 3TQHA 3LU1A 2NTNA 4ND3A 1UXIA 2WD7A 4BKQA 3BMOA 2VZ8A 4DMLA 4IJKA 2NVWA 2PY6A 1JWAB 3L6EA 2P4QA 4QECA 1I3LA 3I3OA 5A06A 4LVUA 3HQ4O 3RC7A 4O59O 4ID9A 4EI2A 4KOAA 1NASA 2EW8A 3I83A 4BNIA 5L51A 4TRJA 1H6AA 3AW9A 4HP8A 4QTZA 3LT0A 3WYCA 2FPPA 5DULA 1DFGA 3K5PA 4RF4A 2OOSA 4OM8A 3TSCA 4LGVA 4FB5A 1E6UA 1HEUA 2CDCA 1BGVA 1X0VA 3NTOA 2ZKLA 3BMOB 3DXFA 1B0AA 4K1LA 3IAHA 3T7CA 2VCYA 3COSA 3E5RA 3FD8A 3EHEA 4L73A 2EKLA 5F1OA 3AFMA 3CTMA 1TT5B 4IMRA 3WGQA 1VM6A 1C0KA 2HLPA 4NG5A 4YT2A 4YQYA 5IDWA 4LW8A 4DYVA 4YPOA 1YDWA 4R3WA 2HDHA 4B7UA 3I52A 4JJGA 5EQFA 2GDZA 5CHEA 1ISMA 1P0CA 1XA0A 3WIDA 4D0RA 1ADFA 4K6CA 4NU5A 1LDNA 3AY7A 3AM4A 1UDBA 2D5CA 4FFRA 2NM0A 3PZBA 2O3JA 4OXKA 4HV4A 4FBGA 2PKQO 4NR0A 4BGUA 6LDHA 4BS9A 1EZ4A 2FSSA 1GAEO 3V8BA 5DBGA 1XLTA 2HJSA 4GMGA 3INRA 3D4PA 3SLKA 5CDGA 3F9IA 2VUTA 3RUCA 1Q7BA 1LDYA 4J91A 2ZCVA 2E82A 2I76A 4S1VA 1JW9B 3B1KA 4L74A 3GEDA 2O2YA 3PHHA 2NUAA 4ZQHA 2HMTA 3QY9A 2I5PO 4IQ0A 1NFQA 1VE9A 1DRUA 4Q3NA 2HKIA 4ZRNA 1LX6A 3D7LA 3ULKA 3JQAB 3TRIA 3OJLA 5TT1A 1D3AA 3GRPA 4ND4A 4XYEA 2HU2A 5CEEA 3G1UA 1B7GO 1O6ZA 1GU7A 2JHFA 4Q3BA 3GG2A 3U49A 2J8ZA 4BNYA 4ND1A 3AI1A 2QZZA 3E03A 3QP9A 2A35A 3SXPA 4WK6A 3K73O 1R4MA 4IGFA 4J2HA 3OBBA 2C7VA 3U9LA 5I9LA 5T67A 1YO6A 3JYPA 4R1UA 4BUCA 4XDZA 3JQFA 4CMEA 1HF3A 1P1JA 2DTEA 2AG8A 4WLFA 4YEDA 2O4CA 1JWBB 5JY6A 3DEYX 5DCWA 3TN7A 1XR3A 3M2TA 1PL8A 2QZ9A 4ZA2A 3FPCA 1QLHA 2Z1NA 2W2LA 3OF2A 2Y67A 3Q2IA 1Y8QA 3FPLA 1M2WA 1EQ2A 3WXBA 3OHSX 1PL7A 2YW9A 1RWBA 1DIBA 1E5QA 9LDBA 4DBVO 4Z9XA 4R51A 2WMDA 4F45A 2WE8A 1PL6A 2NNLD 3EZLA 4I5FA 1UXJA 4WLVA 1JKFA 1NFFA 1YB5A 5KVSA 1ARZA 2X6TA 3QA9A 1YQGA 1I2ZA 5JC1A 1ZSYA 3SC6A 4CMJA 5C7LO 4H3VA 3LQFA 3L4BC 4OKIA 3FHLA 3BMQB 1ENPA 2G5CA 3A4VA 2LDXA 5EQDA 1ONOA 1R0KA 3GLQA 3Q3CA 4XGNA 4H16A 4EZBA 3NTQA 1ZBQA 2Q45A 5BNFA 2FPIA 4KQWA 3NYWA 1I01A 3UH1A 1GV1A 3VKUA 1GV0A 2X22A 5ILGA 2WJPA 4O5OA 1NAIA 2H9IA 3GFBA 3L6OO 3RFTA 3C1OA 3S2EA 3UF0A 5DDIP 2FP4A 1B2LA 3SC4A 2CZCA 3LF1A 5CDTA 3BMQA 4KUEA 4OAQA 4WLNA 3IKTA 4MPDA 4QUKA 4M89A 5KVVA 3Q1LA 1DIRA 3FNEA 4UEOA 3K30A 1M66A 2Q1WA 1T24A 3MEQA 2PGDA 3FCOA 4IDAA 4ZJUA 4GQAA 1EVYA 1DFHA 2D59A 4D43A 1EBFA 2GN6A 3WGIA 5G4LA 4MVJG 4BNLA 1F8FA 4XYLA 2I3GA 2GZ3A 2B5VA 3Q0EA 2EERA 2B36A 5DN9A 5T64A 5KOIA 1PQWA 4L8VA 3H5AA 1B3RA 4IBOA 3R0IA 5JNLA 4G2NA 3P19A 4AJ1A 4EUEA 1I0ZA 5GZ1A 3QWBA 2YHUA 2Q50A 1LLQA 2V6FA 1XU7A 2GYYA 4YJGA 4BNUA 3HDJA 4J1TA 2FMUA 1I2CA 2GN8A 3UICA 3BTOA 2OORA 4NH4A 3HN2A 4HFJA 3BTUA 4XQGA 3HDHA 3JV7A 2Z5LA 4QXMA 2C7GA 3MJCA 2Q4BA 2RCYA 3OJEA 1GZ3A 4IS2A 3NV9A 5JAIA 4CMCA 4CUJA 3AI3A 3KYCA 4WE3A 1K5HA 1MXFA 1ZXBA 4FJ1A 2B4TO 1U3WA 3AU9A 4XIJA 4YAEA 1ZK0A 4J0EA 1HSOA 3KLPX 1I36A 3I4FA 1P77A 4Z6KA 4MVJD 2P4HX 3K8ZA 1SO8A 5AXDA 4TRNA 3SBOA 2ZYDA 2WD8A 4BKPA 5A05A 2P91A 4IINA 4IS3A 4LRSB 4BO8A 3BTVA 1UDCA 4U8GA 3RD5A 1C0PA 4B4OA 4BKUA 1I32A 1OI7A 3GGPA 4JP3A 3DO5A 4MKZA 3RAJA 4Z0TA 4NK4A 1DC3A 1DHRA 1L7EA 1O9BA 3KSUA 3T4XA 5IXSA 1LA2A 1KBZA 4CLXA 2J3IA 4FOOA 4CL8A 1R4NA 7ADHA 4QFDA 3QW2A 3PZRA 4QT0A 3FWNA 3H7AA 2DAPA 4J1QA 3QVWA 4E0BA 1GD1O 2D8AA 1PJCA 4IZHA 4RCVA 5JAQA 1P1IA 3AUUA 2YV1A 2BMAA 3JQGA 3UFXA 3H4VA 4XJTA 1PX0A 3GOHA 5MGBA 4CLDA 1NHGA 5CDUA 1GPDG 1ISJA 1Q7CA 5JE8A 3NEPX 1OC2A 3L9WA 3CKYA 3C1TA 2C54A 3GDOA 2JCVA 3RUHA 1Y9EA 2Z95A 3CMMA 3ROKA 1BHSA 2HSDA 2J5RA 4EITA 3UGKA 4CQMA 1DSSG 2W4QA 3FSRA 4XEHA 4YJFB 4BNMA 4BO4A 4B8ZA 4DC1A 1KEVA 2DFVA 4FFMA 1CEQA 1HDZA 1DJQA 1PS0A 2VRCA 4BNJA 4B3JA 3K2BA 4NIMA 4WEQA 4UVGA 5JFOA 3OQ1A 3W4KA 1CDOA 2JD0A 2G76A 3IUPA 4YAJA 1HDRA 4J9VA 4RQUA 3DTYA 3FI9A 4Q9NA 4Y9DA 4E13A 2OGUA 1U8FO 3KBOA 1MA0A 3RSHA 1DIHA 3BXXA 1IPFA 4R16A 1E5LA 4INAA 4AJKA 5H81A 2NVUB 3Q9UA 4AJLA 5CDYA 3CEAA 3KTDA 1XELA 4J43A 2Q22A 3ROPA 3IJRA 3RWBA 1QYXA 1SCUA 3M1AA 1ISFA 4KWIA 3IMFA 3DHEA 2Q2VA 1OOEA 2P9GA 2BGLA 3LVFO 4F46A 5F3RA 4BIIA 2BFAA 3L4SO 2J3KA 2VHXA 3GPDG 2O3QA 3JYLA 3PDJA 4DMMA 4P4GA 4IZIA 2YDYA 2H1SA 1UXGA 3LLVA 3ONDA 4RO0A 2Q4EA 1TXGA 3OIGA 1HTBA 3RUEA 4DYDA 1PIWA 3M6IA 4EEZA 1SBYA 2WWRA 5L53A 4C4OA 3ZWMA 2GF2A 4Z0HO 5JLAA 2LDBA 4G5HA 3I9JA 1DRVA 4BB5A 5I9MA 4BGVA 1UP4A 4XRGA 2PZMA 1A7AA 1UAGA 4BKRA 1Z82A 2DT5A 1TEHA 3P2OA 3OH8A 3WIEA 4EDFA 1Z75A 3GT0A 3RIHA 1UAYA 4TWRA 1WDKA 1DEHA 3ZWCA 5B12A 4P4LA 4E3ZA 4WNIA 3VPHA 4BNNA 1IE3A 2X5JO 2FR1A 2C5EA 4F6LA 4DLBA 3PQEA 4CLHA 2X0RA 3CZRA 3WWYA 4E5NA 5G2OA 5A9SA 1FMCA 3MJTA 4JROA 4KUHA 3FTPA 4Q3EA 4D45A 4XQ9A 2I9PA 1ZO8A 4I9UA 1U28A 4IPTA 3O8QB 5KJEA 4GVLA 4GLOA 1IPEA 1HWYA 4J7UA 5G0SA 4PLVA 3H9EO 3ETEA 2W2KB 1KC1A 1T1RA 4J7CA 4PG6A 4PLFA 3WJAA 2C59A 1IZ9A 1R0LA 1MFPA 2P68A 2UV8A 1EEHA 2V6GA 2IYOA 4J6FA 1M75A 3G0OA 3JQCA 4ZGWA 1T4DA 3PIIA 3D1LA 4XR4A 4CQLA 2HO5A 2DQ4A 2VQ3A 5ER6A 4U6SA 1J4AA 3DBVO 1XYGA 2PH3A 4CMBA 1R16A 5K9ZA 4RPGA 3NGLA 4R1NA 5L40A 3QWHA 2CDBA 4YB8A 3SVTA 3ANLA 3GDGA 1RM3A 2UUOA 2X1HA 1EUZA 3A14A 3AM5A 3D5TA 4L0QA 1BDMA 2BGKA 3IIEA 1KVSA 3OFSA 3R1IA 1RM4A 1Y7TA 4HWKA 5HTOA 1I3MA 1N9GB 4L4XA 4KUGA 2JCXA 3E9QA 2E48A 5KVCA 4MIOA 3ZNNA 1NP3A 5I9NA 1LRJA 1ONPA 4CMGA 3L77A 2AA3A 3TZQA 4BNZA 2RHCA 2WD7B 3HUDA 5JYAA 4R9RA 1FXSA 3EVNA 1ULUA 4I5DA 5JSFA 3DAGA 4JP2A 5TJ9A 1E6EA 2Q49A 5IDYA 2V65A 1P9LA 4IDBA 4O63O 1G0NA 2AQIA 4RJTA 1VSUA 4E30A 4RPHA 1JA9A 5ADHA 2GR9A 5L9AA 2C5AA 2FSVA 1HLPA 3AY3A 3WSVA 2XAAA 1GUYA 3AUTA 3V1YA 2ZB3A 3IL2A 1O0SA 4I5GA 2ZCUA 4A10A 3D64A 4E2WA 2GERA 3RBXA 3GHYA 3F5QA 1RM5A 5L4NA 3RASA 4YRBA 3IKVA 4KZPA 2CF5A 1U3VA 2DBZA 1KEWA 1UJMA 2YQ5A 3ZNPA 4BHTA 1QRRA 4YCAA 4LMRA 4TVBA 1E6WA 3VH1A 4R5MA 4NJMA 2GZ2A 3DMTA 1ADBA 1I10A 4DWVA 3OETA 1P0FA 2PFGA 3MCVA 2OL4A 4WLEA 1PZFA 3C85A 4WPGA 3EK2A 5DZSA 4UAGA 9LDTA 1QYWA 3PGXA 3I4CA 3UUWA 1VJTA 4K28A 4TRMA 4CLEA 2OZPA 2OUIA 3QV1A 1Y81A 3I23A 4QX6A 2B35A 1I30A 3R6DA 3K2EA 4RF2A 4RVSA 5AOVA 5FI5A 3KZVA 3PWZA 4JIGA 4WASA 3LLSA 4BNFA 3FR7A 5JC8A 4TZTA 3FBGA 3DBRB 4NJMB 3VPSA 2RIRA 1KC3A 4MDHA 4J90A 5CP8A 3I9OA 2G1UA 2NVBA 2X58A 3JYQA 1UUFA 1VL8A 1OBFO 2C20A 4DIFA 4ZQFA 1N7GA 1QLJA 2QIOA 4F6CA 5I7SA 5JS6A 1D1TA 3LT1A 1D4FA 1V6AA 1WMAA 4YJGB 4XGKA 3H3JA 1GQQA 4DA9A 3PYMA 1O94A 1TLTA 4A5OA 3RU7A 3W4IA 4OH1A 3W8FA 1PSDA 1OFGA 3GNSA 3H5RA 1PZEA 3PFFA 3OP4A 4RVUA 4H7PA 2OHXA 3DZGA 1ZMTA 1GYRA 3E5MA 4NI5A 4BMNA 4E33A 4Z9FA 5L7WA 1EQUA 5CDSA 5FF9A 3P7MA 2Y05A 2C29D 2QG4A 3M1LA 2IXAA 2POQX 2X9VA 1SC6A 3KEQA 3W1VA 2Y1GA 4MIEA 5A4DA 8ADHA 3GA0A 1XCBA 7MDHA 1CF2O 1Y5RA 1AN9A 2D4AA 1NXQA 3OEYA 3O9ZA 1YH3A 1E1NA 2CDAA 3E18A 1K6XA 2X9GA 1M6HA 5THQA 2ZIZA 1LDBA 1AUPA 3PHIA 5EIOA 1NWHA 2I6TA 4JJIA 3U4HA 1NQTA 3ZCXA 3TNLA 5LDHA 2QYTA 4GWGA 5TX7A 4Z3KA 3IUSA 3DFZA 4FJ2A 4JX8A 3WWZA 3NJ4A 4EUFA 5ICSA 2Y1OA 3JD0A 3R3SA 3VTFA 5I8WA 1X1TA 3EZYA 2VHVA 4TROA 2IODA 4GWKA 3A06A 2VYND 3EY4A 1A27A 3ZV3A 1IULA 2B83A 1VSVA 2WSBA 3JQAD 1MV8A 3H2SA 4FDAA 5U9CA 4J1NA 1A4UA 1LC3A 2F00A 3HFSA 4DC0A 4OO3A 3E9MA 3NRCA 4RF3A 1W0CA 4D44A 1X7HA 3Q2KA 3DBHB 4A0SA 3H9GA 2W90A 2BFPA 3GNTA 3JD4A 1LDEA 5L95A 4WOJA 4IIVA 4NPCA 1LTHR 1NQAO 5DP1A 2WYWA 1U9JA 1YQXA 2IDZA 3RUIA 3ASVA 3G49A 4CR7A 1FDWA 3WGYA 3C7DB 1BXZA 1F0YA 1KY4A 1VKNA 4UEJA 1OAAA 2HCTA 3ZWVA 4GAEA 4B8WA 1GEEA 3GNQA 3VPFA 4I5EA 3GVCA 3GUCA 4FFNA
chains in the Genus database with same CATH superfamily
2PH5A 3R9WA 2D0IA 3GPIA 1T26A 4AUMA 1XDUA 2I03A 4IZ6A 3BFVA 4Q7LA 1PGOA 3PUYA 4U5XA 4BP1A 3DZ7B 3CF6R 1G3IA 2ZS8A 1GUZA 1VHJA 5B30A 4GSYA 3CZAA 1W35A 5KMGB 4G81A 1JLHA 3DMDA 1WXWA 1TX4B 2AEEA 1EGQA 2JVJA 1XCPA 3LC2O 5DP2A 1KI6B 4OUKX 3DMNA 5G40A 3ZLVA 1HDYA 1PG0A 1PVVA 3EQ9A 4PHHA 4J1SA 3VYRB 1MW9X 3BUSA 4U7PB 5HUJA 5M5BA 2ZWMA 4ZD6A 1M7GA 2Q9AA 4I3HA 3T99A 5IWAB 4JL8A 4YAFA 4KAFA 1JDVA 1VCIA 1SUCA 3EP8B 3NWJA 2R6HA 1AQYA 2NZUG 3REQA 4Z99A 1COWD 4I55A 2AYXA 3WDSA 3KKQA 2HA0A 1NVVQ 3GD7A 3LWBA 4DQXA 3SM9A 2ZSDA 2Q6VA 4XJSA 1J6UA 4UTPA 4MQBA 4L5CA 5HJ7A 2PGAA 1D09A 4D3ZA 3HJBA 4RPIA 1C9NA 2BKAA 2PGLA 3O1IC 3S2IA 1LPPA 1R4AA 3C6XA 2HMUA 2BGMA 2R8BA 4H1TA 1U63A 4MRSA 1O6GA 2W2PA 1X7GA 2AMJA 1TAHA 2OCIA 1U7PA 2WIBA 1AF7A 2X0IA 1AUXA 2GEVA 2MOKA 3BE4A 3C3YA 1FFXA 1EP9A 1XB2A 2GZHA 1JYEA 3PDIB 4OG2A 3LHDA 1T9DA 1ES9A 3OJ0A 3JTMA 5HQ3B 1MEJA 1YAHA 2OGSA 2YS6A 3H1BA 3N6XA 4QDOA 4WGFA 1XMQB 3FTNA 2O6HA 1JEYA 5E8JA 2XGSA 3FFXA 5AJYA 1M2VA 4WDRA 2Y92A 4YP0A 4HTFB 3GLIE 4LIPD 9ATCA 1NXXA 4PG8A 4J0HA 4CIBA 1WBDA 3IP5A 2A78A 3H83A 2XRZA 1B16A 2F8LA 1NTRA 2CJXA 5A5EA 3RYCB 5GY7A 1KAGA 1GSOA 1RAAA 3IV6A 3JQGB 1PNOA 2QN8A 1R27A 4I1UA 3ROGA 3RIMA 1NE7A 1JQLB 2CHUA 1YTLA 2G0NA 1L7NA 1C30B 3GVHA 2Q5IA 5BWNA 5F7OA 5K7SA 3JR7A 2AJLI 2DPLA 4J3FA 2XMCA 1MENA 3S6JA 5DM0A 5F51A 1I3KA 4D42A 5J40A 1LLCA 4FUQA 5BWCA 2PX6A 4CR6A 1QIMA 3M9WA 4II3A 3COPA 3KUXA 3KV3O 3OQJA 1UODA 4FTWA 3U5ZB 1CEEA 4CLQA 2N42A 2VYFA 2QM3A 2IY7A 1L5WA 1V47A 2WUEA 3TMKA 2QDKA 2IRWA 3CIFA 3UCXA 3ZVRA 3NHAA 4LV8B 1ADGA 1JG3A 1Q0PA 4U00A 3NBKA 5CTJA 3NHYA 5AVJA 1P2SA 3C70A 1NW9B 3LF2A 4JKIA 4RIHA 3WFIA 1QCYA 1U94A 1RYZA 4MLZA 4UUMA 2BW0A 4WFQA 1EJ2A 2PMKA 4PTYA 4TKMA 3PQ4A 3H65A 4NJOA 3R7WA 1VJ5A 4H6WA 2NMVA 2WF6A 3G0CA 1YZ3A 1W46A 2LKDA 2OM6A 3O38A 4R1SA 4UULA 2MSCB 4Z0PA 4PQGA 1WA5A 4L6CA 4LYJA 5FA6A 5C9ZA 4E03A 1O97C 2AQHA 4TOIA 4KDEA 5I5EA 3TQQA 3UN1A 4URWR 4AFNA 3WIEA 3W2TA 3I76A 3OPYI 5KINB 2NACA 2LPMA 1DKUA 3RH0A 1WETA 2OESA 1I2DA 4RL4A 3G9QA 3TLZA 1A8QA 4M76B 1QH8B 3K0HA 4BZZA 5DBEX 5B3AA 3DMPA 1PJSA 1IUKA 1NJ1A 3D3NA 3TRHA 5C3MA 3CF2A 2OV2A 2HJRA 1YB6A 3FTDA 3BWDD 3SQNA 3OPYB 2JFOA 4IIXA 2DQSA 5FLEX 4D02A 1JQ3A 1XVAA 4U7FA 5TB5A 4KIGA 3ZWBA 4BC1A 1XV5A 2P2NA 1Z29A 3D6AA 3DV2A 3OLQA 2O2JA 3Q6MA 3UAOA 2JFPA 4EEXA 4COOA 3OOSA 2XWBF 2ZIFA 5HOQA 5GJBA 1XAJA 1WPXA 1BE6A 3GFRA 3EWAA 4UNQA 2MCFA 5K5EA 5E6SA 4KIJA 1ND6A 2ZDGA 2BR3A 2ZTMA 2DR0A 2AHRA 2RGCA 1XFDA 4RHCA 2FUG6 3H0VB 2H3EA 1N4AA 4BB0A 5KTYA 2AJBA 5DW0A 5EWLA 4P7JA 1HNXB 1SZPA 4K9QA 4RA9B 4L16A 4ML3A 4KX3A 2OZVA 3SVLA 1OGYA 2WABA 5LMNB 1JRLA 3FRJA 1SOAA 1F06A 2QVYX 1SRQA 2JL1A 2Q1XA 5HDBB 1UBKS 4FOSA 1HETA 1I9GA 3N3BC 3MHPA 3D2LA 1IBRA 3A05A 3EGOA 2HD4A 4KW7A 1OXMA 2FLKA 2P4UA 3I01M 1IU9A 2OSBA 3BE6A 2RGGA 3CRMA 5LP6F 2Z2YA 4RV4A 3VMFA 2VP5A 3C15C 1A9SA 2J9GA 3AQ4A 3H1GA 5KQMA 3FOAA 3OY7A 2FE4A 5IKOA 1KETA 1PD1A 2O2EA 3HNRA 3BE5A 3DOHA 4KN8A 1DBSA 2A4MA 3D02A 1CFZA 3IS3A 4MPJA 4H1UA 3P9RA 5FOTA 1JHRA 2JGNA 1XGKA 3KO8A 3PEVA 3PPWA 2BGIA 1K6IA 3ZYZA 1YCDA 2H1RA 1A9YA 2WSMA 3HXTA 2FYTA 3LVQE 4EYKA 3RRXA 3TOSA 3UMYA 5AM3A 2ZAIA 4CQLB 4ONEA 4LC0A 3WNCA 1TIPA 4O3FA 4D8UA 5CVCA 3VX4A 3QK7A 1UBMS 1XXLA 2E4AA 2NO5A 4IDGA 1PG5A 3ED1A 1IHUA 1XQXA 5BOVA 4A8JC 2FRDC 4LHVA 1D1QA 2N75A 4ME6A 2B30A 2OWDA 3G7NA 3N58A 1H4QA 4F1JA 2JI9A 2OY0A 1MJGA 1WSDA 2M98A 1YL6A 2EKDA 1DKQA 3TZHA 3K5WA 1TM3E 3A9VA 4E46A 4FXPA 3UPTA 1IZ8A 2JFYA 3CG0A 1MMFB 3I45A 4XWYA 4D6PA 1GCUA 2BFCB 4YUZA 2LV8A 2WV9A 1VLJA 4CUKA 5JZOA 3QVTA 3O6VA 1A4RA 4KHZA 1XD8A 1ACMA 3TZKA 1H2RS 1L4KA 3BHMA 4ZMBA 3EVGA 1JJ7A 3PUHA 2DQZA 4CMIA 3A25A 3IQDB 1OZGA 2OVFA 1OUMA 3E9CA 4KE8A 3X1XA 4WZAE 1QOPB 2LTAA 1E0JA 4HBGA 4XYMA 3BWEA 1VZ2A 5CBPA 1VSBA 3KGDA 2G7ZA 2ZIXA 3AR3A 4PSCA 2IDJA 1AQIA 4M98A 2JGMA 1N1EA 1CE8A 2JIPA 3FFBA 3Q9SA 1NU8A 2FVYA 2P40A 2MDTA 4KVGA 1F0KA 1YOVA 1QCCA 4FFLA 4R41A 4MA5A 8LDHA 1RLOA 1AQUA 1RQGA 3Q7RA 2H11A 5K45A 1CYDA 3IT3A 4G0MA 3KUDA 4PG7A 5DNWA 4U2FA 3DCYA 5DMXA 3ZCPA 4J0KA 1GPMA 1RW4A 2FEKA 3LT4A 3OF3A 3K1AA 4UUOA 2FP4B 3ZHBA 5IJ9A 3AF2A 3O1HB 1Y1TA 1CRQA 1SUPA 1E1MA 3QUBA 1KDTA 5CPBA 3WLQA 5E3HA 4CMIB 3OZIA 4CIWA 4E5DA 2Y4OA 1T2EA 4P93A 3AJAA 5J5CA 3ND5A 1Q1EA 1CDEA 1ICEA 4PHTA 4AICA 4TTAA 4BTEA 4FYJA 3G0DA 1G64A 4MGHA 1M6VB 4R2JA 4W7IA 5ER9A 1N6KA 2Z4SA 3G0IA 3KLMX 2XYGA 1P80A 1QJCA 5LZ4A 5AVVA 1V1RB 3VVBA 1LS6A 1RI3A 1GLGA 5COQA 2ZJ1A 1FDSA 2AJCA 1QO7A 1R6XA 2J5KA 1XA4A 5CFQA 2ES4A 1C1XA 2H4ZA 3PUJA 4H0NA 4OREX 2G7MC 4RS3A 5AH0A 2XZDA 4GXQA 5J5AA 5LMCA 3AFGA 4WCFB 5LMZA 4B33A 4AIIA 4BE4A 3RI3A 1JA0A 3E1GA 2H2HA 1JH9A 4BRWA 1NVMB 3NHSA 3JQEA 4HFRA 1B6TA 3EGIA 1P4JA 2JJYA 5DWQA 5HGXA 3Q40A 4ND2A 1EUCA 1R9NA 2B78A 1EAMA 2OCLA 3PXAA 1GU1A 2YWGA 3Q5DA 5JMPA 2OHOA 5F5NA 1DWPA 1DMRA 3VNUA 1B8PA 1HT3A 2KX7A 3QYJA 3U7GA 1UIRA 3KTOA 1ZL0A 2DFKB 2ZWAA 2IC5A 4W9RA 2GT1A 1FYXA 3IRVA 4BO0A 2DLDA 3SN6A 3WAJA 3FBWA 2O8BA 1IZYA 3RYFB 1YFLA 3HUUA 3T3EA 2IYSA 2LUOA 4PO9A 3NHBA 2B4YA 2JZOA 1PU2A 2PT5A 1XXHB 2W6MA 1O89A 1H8ED 4GE0A 1HDCA 1VJ0A 3AKEA 5F21A 5C8XA 5BYBA 3AVYA 2J9ZB 4OQEA 5COAA 1A9OA 1E7SA 4G5FA 3E0XA 4MVJP 5BW6B 4EG7A 3OQ6A 2ZRFA 3W5AA 2PJZA 4XIGS 5CX1B 1V7CA 1FTGA 1FP6A 4MP8A 3NKLA 2HF7A 2QLFA 4IP0A 4M49A 1MO3A 3U31A 5A4IS 3IA2A 3JAWA 1TVCA 1SAYA 4IG9A 2IYPA 4QWWA 3D0OA 2ATIA 5B1IA 5JANA 2ECQA 4FLFA 1BROA 1LPNA 1XE3A 3CPEA 5EWJB 4Q7JB 4MIYA 2VRCD 3CRNA 2YHAA 4CF5A 4Y2YA 1IXZA 4FHFA 3SJZA 4EEKA 2VHJA 1G8SA 4M2LA 3O3NB 3AEYA 3B53X 3O2SB 5L8VA 1KERA 3MSXA 4ZQCB 1GFSA 3Q9NA 2UVPA 3MTAA 4YCBA 2HEIA 3KETA 1FFGA 4YDHB 2ZE5A 2WAAA 3AKCA 1ZPDA 5JS7A 3UT5A 3HZOA 2AN5A 4IICA 4GZ6A 1TKBA 3UAWA 2DB3A 2BCGY 4IY1A 1X9HA 3INTA 1II9A 4M22A 2J4FA 4PNZA 4IXMA 1C1DB 3G9TA 5C37A 5KDDA 5I9IA 3CSSA 1W5EA 2R5WA 3O93A 3ST7A 5IABA 3CVUA 3UWMA 1DOZA 1DLIA 2NYUA 2Q3EA 4QGFA 5EIAA 1E5XA 1SVLA 3KPUA 3BH7A 1R6VA 2VPYA 4RH1A 5HK8A 3IOBA 2D2EA 2E5WA 2FWMX 2ZSEA 2E2WA 2WNSA 1W2HA 1C14A 2VXCA 5BQXA 4A2PA 2JBWA 3V8QA 4PGGA 1FFXB 5T4BA 5JPIA 1O87A 5KNBH 4OYRA 2RBEA 3A2LA 2JGJA 3R7DA 3TSOA 3RR2A 1X8JA 2R48A 4FZRA 4C7BA 2WV7A 2O8DA 1TECE 4RF5A 3OTHA 3WG9A 5IN5A 1QQAA 3HI4A 1GU0A 1M1UA 3E2IA 2AFVA 1OGJA 1OYOA 2UYHA 3PE3A 1COWA 4AM8A 4JK3A 5HUHA 2EGHA 2ZPUA 3NMUF 5AHKA 2DBRA 2B94A 3BD6A 3QPBA 4NVRA 1BCSB 2G77B 3FPHA 4TMTA 1NM5C 2QE6A 5DM1A 1AKQA 2YS7A 5KOJA 4R3NA 4RZ2A 2G72A 4RSHA 4NBUA 2R5FA 4D7AA 2GBLA 4E4RA 1RKVA 2D5BA 3QYPA 2GAAA 1Z5PA 2EV9A 3H1TA 3EGEA 1QYCA 2XECA 5E1OA 5EINA 3TG2A 4GGOA 1ST3A 2IXDA 1RWXA 3COZA 5E9WA 1QQ7A 5IJAA 1XG5A 4XD7A 4EG5A 2DWQA 2ZB8A 3EOAI 3L7OA 2IPOA 4WBNB 1RC8A 2FOLA 1TE2A 2BMVA 2XNSA 3K0CA 2VXYA 1RADA 1RBZA 3VR3A 4MYSA 3UG7A 3HYSA 3PG5A 5LA6B 4FD3A 3G2KA 1G0OA 2XUOA 1MQSA 4BZXA 1FYEA 1TL7C 3CH7A 4JDPA 2G4LA 1DRJA 3ICWA 5BPHA 1G1MA 4ITVA 4XFKA 3AU8A 3BWCA 2ET6A 3NB0A 3Q3VA 1SXJB 2EKPA 1DRWA 1QV7A 4JLUA 3TUJC 1VBMA 2H3HA 1CQWA 4MQ4A 3KSRA 4FZ5A 1HOTA 2PG3A 1DJOA 1EWRA 3ZH2A 1W5FA 2XCSB 1Q0SA 3OD5A 3JPWA 1MC8A 4TKLA 4MVWA 1E96A 4OJNA 5F2NA 1Z0FA 1TO6A 2OBNA 3QWAA 1R10A 2OPHA 1XTZA 2EAUA 1J1ZA 2G8LA 3MRSA 3ONEA 1TK9A 1PCXA 2GTHA 3C7TA 3CMCO 2ACKA 4ND8A 1U9ZA 1DXYA 2W83A 4QBKA 3CWQA 1JPJA 4WZBA 5EGNA 1J9ZA 2D0OB 3GOQA 3QTTA 4KJXA 1DZIA 3AHCA 2ZRAA 4QVGA 5EE0A 1CBUA 1YL7A 3NETA 5GAJA 4EHHA 1BMQA 1EK5A 1TRKA 4RY8A 4U7GA 1XJWA 3CIOA 4FQ8A 3O3CA 4LNAA 4B3RB 1RBYA 2OE2A 2R8YA 4GL4A 3EPLA 1WU8A 2O2XA 2XOKA 4MJ7A 1KH3A 4NECA 3JQAA 1L2TA 4DV3B 1ENYA 1SD1A 4G24A 4FEGA 4LK3A 3E48A 4NYIR 2XMGA 1CUFA 1BXKA 1ZQ1A 3GI1A 3EVTA 1U0TA 3QZUA 2JPDA 4YI5A 1Y6JA 4TT3A 1RZRA 4UE3S 5FTNA 4EQ6A 2PKRA 3GQBA 5C51B 3G8CA 3QEAZ 4AWXA 4P0TA 3RFVA 4GZLA 4JJAA 3RVNA 1KMHB 1XWFA 1GL7A 3C6KA 1FVHA 2N46A 2QTGA 2X13A 3FVRA 3PF9A 4JC5A 3TOVA 5CT9A 5K8VA 5D7BA 2Z0MA 2FN7A 4HQNA 2NN3C 1EP2B 1LCIA 3H19A 4NAVA 3ZU3A 3O83A 1E7WA 3LXMA 4D92A 2Q3HA 4ENRA 1W96A 3UM9A 2HZ7A 3TL2A 1XYYA 3GAAA 1CZKA 2A0XA 2X2OA 5HF5A 2C3OA 3AF5A 3HH8A 5JMWA 5EA2A 1C5KA 3DDWA 2I3ZA 3V8NA 3OUTA 2GBFA 4K03A 4ISBA 2RI1A 1GDTA 3DGEC 1ESDA 2EATA 3GJ3A 4COKA 2CNOA 1FDTA 3DZFA 4N18A 5DGDA 4BQOA 3VKHA 2GZDA 1Z73A 4MR7B 5EPOA 4C7OB 2RGNC 4QYWA 3EXG1 3JQDA 4I1SA 4AO7A 3UJBA 4OI0A 1DEOA 4F91B 1UJ6A 2YIJA 1VI2A 1ORIA 3AUAA 1DOAA 1Z22A 4NMLA 4PZZA 4ALNA 4AJIA 1IDOA 3QUSA 4JB8A 3A58B 1EK2A 4DMUB 4P8RA 2MYPA 4MV9A 4EATA 2O8EA 2Z9BA 1NRXA 1OASA 1N2SA 3DM5A 2I99A 1H1LA 3NBQA 3T15A 5EHNA 4RTPA 3ZDBA 4TWAA 4E7PA 1O6FA 2CY0A 3AEZA 1UC4B 3FRIA 1G4AE 4HR7A 1VLZA 3F7TA 1Y1KE 3V42A 4J3NA 4FWBA 3K70B 2CJYA 4L78A 2ZT6A 1UOEA 3CH6A 2ABWA 3ZHQA 3EGDB 1WW3A 3C41J 1FMFA 2I4TA 1GCGA 1J9EA 5EMKA 1C3OB 2O50A 4Q00A 3PE6A 4GKBA 3LBAA 3WNDA 2XAUA 1PFQA 2ODEA 2YY5A 4NPHA 3RARA 5KJ6A 2XDYA 4FFSA 1AV7A 3CGWA 3GYGA 3O95A 4LTDA 3AR5A 4Y9TA 1ZVVA 4ZKDA 5B1YA 3HR7A 4NCIA 1NULA 1WXDA 4PE5B 4BFUA 2JJ8A 5D1HA 1BRTA 2NT3A 4ZIRB 3SFTA 5TMBA 4N3CA 2XT6A 1EFAA 5DRYA 1SRRA 3R3JA 3ZNQA 4BO7A 5KYWB 1XVVA 3TFQA 3GH1A 2XNDD 1KFJB 3TZLA 4XDHA 2PV0A 1VGVA 3KSZO 3WXMA 4D4LA 2H16A 3INNA 3RKRA 1NVTA 1Y6QA 4R2XA 4R9NA 3WVNA 1EBUA 4QYIB 4M9ZA 4RH0A 4N39A 5MN5A 1E3EA 3Q8LA 3WYBA 1GTSA 1J39A 3OT1B 3VR5H 5BVGA 1SB9A 3DQQA 2X0EA 3UJAA 4AY6A 2A3RA 4KTTE 4BO2A 4E6EA 1T0BA 5FH9A 1YS7A 1NNSA 1V16A 4RM2A 3HN7A 4NZZA 4X45A 3M0EA 4AYTA 4RFSB 3ELDA 1RRFA 1KTVA 1X1CA 1G60A 3FYUB 3PUXA 2EZUA 5E4JA 3UKOA 5BOSA 1CYEA 5FTKA 3MW8A 3UYLA 1IN5A 1NSTA 1ECGA 4PYLA 3MERA 1E9VA 5K6AC 3LRXA 1UMCA 4RE5A 5KQLA 1ZLXA 1RQ7A 1QV9A 1GOTA 1YQUA 3L7MA 4MO9A 2X86A 2CYBA 1EVQA 3N8HA 4PBSA 2NLOA 2X2FA 4OL0A 4YRZA 1TMYA 2REQB 5J4YA 1DE0A 4N1AA 3T4EA 4CFYA 5JH7B 1MXHA 1LI4A 1ZOPA 1A82A 1EXNA 4Q1FA 5FFMA 3T3MB 3V7YA 1M2FA 1KAEA 4A6XA 1U4OA 3BRWA 4C3ZA 3RBAA 2F43A 4DGSA 5HJ5A 1EDOA 1MG0A 1HZJA 4PXAA 1EFTA 3DAHA 1XMVA 4TWIA 1QHHB 5JISA 4LECA 1Z9BA 3OEWA 2EFYA 4O1MA 2CLIB 3ZZTA 2FHPA 2IBMA 3UB2A 2ZM5A 3BT7A 2PZLA 1REQB 2G6BA 1JP7A 2RGEA 4ND8B 4RLQA 4ANFA 1E9CA 3KVYA 1AKNA 3RCBA 3M5WA 3MLEA 3TM4A 2R4QA 1KARA 1QH1B 4V0LA 3ZWYA 4YRAA 1DPGA 1XQ1A 3O2NA 3H9UA 3Q0TA 4YALA 1NTOA 2HMWA 5T8KA 4ZTBA 4M8IA 5I47A 2DFDA 4G1MB 3WAKA 2OQIA 1Q20A 2L82A 1U1EA 1DJNA 2NYAA 1LPSA 1H66A 1M33A 1RQ2A 3UK6A 4BBPA 2P9HA 3WNQA 3VHLB 1GARA 2Y6UA 1KJWA 1LVHA 3SEQA 3D2CA 2ZPAA 1M10A 3L7JA 2YUIA 1M74A 4ZOBA 1IEVA 2BFDB 2HGSA 2ZJ4A 1BEUB 1MVOA 1NFRA 3GRCA 4B09A 1WZ2A 1KI7A 1TB4A 3JYNA 4P86A 3WZ2A 2FMHA 4AS1A 1Z2OX 5TVOB 3D7MA 3R4CA 1CR6A 2FOXA 3GRKA 2AVDA 1TCUA 3QBDA 4R0NA 1X1QA 5F4ZA 4XYBA 1ZR4A 3HDGA 4PM4A 2XNJA 1XU4A 4WOKA 4NRDA 4OQNA 5U4QA 1PRYA 3PRJA 3DAYA 3PXDA 4I46A 4HZGA 4QYSA 4YMVA 1UBUS 1E18A 1AXGA 2QLTA 4TKZA 1X1AA 2Q6OA 2XD9A 2JANA 3CKMA 1Q15A 2V7VA 3BFXA 5IK2A 3RRFA 2HQSA 4KJZA 1ZY2A 4MW1A 4XVRA 4V1CI 4Y2QA 1NR7A 2EIHA 1MC4A 3A36A 1BMDA 1IRXA 1YKFA 1IHYA 1OBOA 2I55A 4A6DA 2HCRA 4J4TA 1KY2A 1RU3A 1VA5A 1AZTA 2I6XA 3JQBA 3T61A 5L4SA 2G04A 1M2OA 4TMFA 3PUVA 3PXEA 4EMTA 5FTMA 1YRQA 4Q7KA 3W79A 3M34A 1QR2A 1I7DA 2VBCA 1CZLA 5B5SA 4V1CB 1V1MA 4P35A 2FZWA 4AB1A 2RK3A 3I04A 4NICA 4QBTA 4R2HA 5CYGA 2J9YB 4OXRA 3WKBA 4B48A 4NBRA 3PC4A 4ZC1A 5DTJA 4MKGA 3C4QA 3NAQA 3AEXA 3HB1A 2R8EA 2XJ9A 2FXIA 4ZI2A 3S8EA 1L5MA 2FP3A 1KJIA 5AJUA 1I33A 5EHXA 4HWSA 2BFFB 3IAUA 3QE3A 5LR6A 4QG3A 2HTEA 1YMQA 2CUZA 4P32A 2HF9A 2LVBA 3G7UA 4BU1A 4B4UA 3P26A 2AMYA 3RNOA 3VSCA 4XQ0A 3SE0A 3PA6A 3UK1A 2A92A 3SKVA 1N78A 1SH7A 3NJ8A 4C6SA 1IL0A 4J49A 3U13A 3K5HA 1S6YA 5GMOA 4BIMA 2ZI4A 4EWLA 3BJMA 1XTKA 1KEEA 3AVQA 4O5AA 3CR8A 4PF1A 3HGQA 3NOOA 1LW7A 4R6WA 4WTOA 3TOCA 2IXFA 2OXEA 2ZBGA 3O47A 2TMKA 5C7YA 4K0KB 1O95C 2C04A 1KMCA 1ZCBA 4KX5A 4ZAXA 2RGAA 1USKA 1E2KA 2YHIA 3TBHA 4BVJA 1K4MA 4FJ0A 4RVOA 1XDGA 4UFNA 1KRHA 2VATA 3K0AB 1JBEA 2FPNA 1JMYA 2P27A 4XZ3A 2OENG 1E2GA 2ZM6B 2QRZA 3UWPA 4GZ5A 4MGZR 3WB1A 5JZ9A 2NW6A 1WZCA 3ZHYA 1DTWB 5BNWA 2O54A 1TUEA 3EZ2A 2CVZA 4MVYA 2JIMA 4EDHA 3LX5A 2UZIR 3IAEA 2ZDQA 4PZ9A 1NOKA 1H8HD 4Q7EA 2CMFA 3RYHA 1DADA 4DQUA 4FFWA 5DNCA 3BDVA 3K4QA 2WP0A 1CEYA 3HUFA 4YJHA 1XSEA 3LYLA 3FTFA 2J0UA 1V5EA 3DOEA 4CV0A 5JDCC 2R8RA 2JIRA 2FN9A 4QDXA 3OQBA 3ROQA 3U3RA 1RNLA 4W9NA 1G8JA 3OOHA 1U0EA 4P83A 2W4IA 1FDRA 2ID7A 3EIUA 4B3IA 5JZBA 1MRNA 3HO1A 3ZEAA 2X76A 1G4HA 4FDMA 2ZUTA 1XROA 1W1IA 5NLLA 4PY2A 5BSEA 3O5AA 2WU1A 4JH0A 1PHPA 1J21A 2P0AA 3GUZA 4AZSA 1ZK1A 2YRXA 5JTUA 1AZLA 4NZ9A 1ODTC 3BWBA 3ON5A 1NN0A 3PC2A 5EZSA 3VSAA 4C22A 4XPIA 4CM6A 5HEKA 4KE9A 2GK6A 2V9PA 3PHCA 4BGEA 5F1PA 4QQKA 3WJ2A 3MT0A 2OMKA 4Q02A 1Z38A 3E23A 4IFTA 5SZIA 1YMVA 4Y8VA 2LD4A 4DNPA 4KITB 1NMZA 4F5DA 1L0BA 2CW5A 4E7OA 4DLLA 4IIGA 4QE3A 3JQ7A 4A2CA 1KOLA 4AL4A 1K3UB 2DVMA 2P78A 3WHPA 4CM4A 1E6CA 5HUQA 4G89A 1XZMA 3H2JA 1PDOA 4EPRA 1Z6XA 2P2YA 3Q7SA 1F9AA 5E8RA 3FMIA 1VECA 2JB9A 4H0CA 4TTPA 4YY3B 1W5AA 4JGBA 3UANA 1YE8A 4G85A 1DLJA 2PUVA 2APJA 5BSWA 4A16A 2RC6A 3QMVA 4YBRA 1RE0A 2DJIA 1T9KA 3L01A 4RESA 3IQGX 4B4VA 4TLMB 2W42A 1TO1E 5CB8A 2GASA 1HNNA 2O7RA 1M2KA 2ZE7A 4IDNA 5AVKA 1V6SA 1A2KC 5LDGA 4OHYA 1WCXA 4X00A 1YBMA 3F4LA 2QTCA 3CR7A 1C7RA 1IRIA 1DKMA 4MCJA 3WIVA 2IOQA 4QULA 4QGHA 3Q7TA 5SZJA 4B3GA 3AFIA 2I87A 3RVPA 2GPJA 3SJ7A 3AXTA 4N6GA 4JT4A 2WAYA 4I6EA 2F3PA 2IXGA 4FMBB 4G3XA 5JNTA 4O4HF 2NUTB 4TL9A 2IEBA 2QMZA 1T1EA 3ISJA 3F3SA 5BQ5A 2IQ5A 3U0BA 4A82A 1QE3A 1YJAA 1KOFA 3QFSA 4NBVA 4ENPA 5JIBA 2RE8A 1H6CA 2J46A 1ADJA 3MS7A 1VJCA 1IOVA 3C0KA 2VO1A 3RSZA 4HLDA 4OB8A 5THXA 3M3PA 3NRBA 3U4QB 5FFNA 3GBPA 5CXXA 3ROFA 1Z8DA 1LBEA 5CXUA 1X38A 1L4GA 1BKYA 2AE2A 1UT5A 4PBRA 3CU5A 3TW0A 1YI1A 4AVYA 2BI4A 1A9ZA 3HZZA 3GLGE 3COVA 4PVDA 4WZAA 4HDRB 4TLDA 3T9EA 3ETHA 4L22A 3FLMA 3IHWA 5FULA 3QWIA 3KEOA 3RSOA 4F6RA 1UEIA 5CB4A 1LPMA 2QLMA 3LA8A 2QXYA 5A9TA 1RLTA 4DBZA 1LQ2A 4RGVA 4F8YA 4MK4A 1Z4NA 3KQPA 3BIOA 1QG4A 2EG9A 3CEPB 2D7JA 3W5SA 3IEMA 3NPAA 2IHVA 5AVQA 4WSOA 4OLHA 3KOYA 2PAFA 5CFNA 4F4DA 2VYVD 2SKEA 1LBHA 1S2MA 2IYQA 3HBMA 3PHGA 3RHSA 3RUFA 2AOXA 2WJVA 3HU3A 2DFNA 5LQAA 3G0HA 1LJ8A 2P2LA 1W9MA 4OMFG 2I4MA 2XWQA 2CLOB 3EZFA 1SD2A 5BSHA 5I48A 1ISIA 2KLHA 3RS9A 3KYDA 3RU9A 3WR5A 1YS9A 4BMYA 1SBIA 2VK8A 1NPYA 3TLGA 3U7QA 3WJ1A 4GP9A 4RPJA 4V3CA 4O25A 2ZJOA 5G41A 1P5FA 2OXFA 2WAOA 4OGLA 3G2MA 3ZG6A 5BYKA 3F6SA 3G8AA 3TECE 3ER8A 4BFYA 1ZGAA 1NUHA 2AHOA 1RRPA 2YZMA 2JLWA 1T1SA 1U5AA 1LV7A 2GJ9A 4NMHA 4UDXX 4OA8A 3L43A 4EG0A 5FI3A 4EMBA 3ZK7A 2JI7A 2B99A 1KGDA 3W90A 5KYNA 4PX3A 4AYWA 5IYZB 4Y1FA 3K0FB 1XTIA 3IP1A 1MTOA 4EJSC 5CA0A 4XVHA 5KWSA 1WP4A 1JILA 3M70A 4AP5A 3EULA 1MB9A 4H3HB 3ENNA 2C4WA 3PFHA 5DGIA 1FU7A 4P4TA 4YMIA 1VCNA 4Y6RA 3WQQA 1PTJA 2OV3A 2PKWA 3FSGD 2OV8A 2ACVA 4LCEA 1GNRA 1H4VB 1D03A 1PZHA 4DA8A 3E2MA 1BDJA 1M83A 3OM1A 4HQ6A 1E6LA 4Y2SA 2AW5A 1FTQA 1OC4A 1J8FA 4X62B 2HBRA 4AG3A 2OYRA 1NF2A 4QXRA 3T7SA 3Q2OA 4D56A 1KA9H 4LN1A 1R8JA 4JVMA 4CMAA 2BGNA 4JNCA 1PJLA 2ZJ6A 4BO6A 5KOYA 1A8IA 5KVAA 3RS0A 2BBSA 4RX1A 2CV2A 2JDIA 1WXXA 3D4LA 1UJNA 2V8BA 1SMKA 2HHJA 3AETB 5ALXA 2Q3MA 5EWMA 1XALA 2GUWA 4XX0A 5FPHA 1KVUA 5AVXA 2EJCA 1E92A 3PDCA 4EGJA 1N2CA 1XRJA 1RZRD 3A6GA 1PNVA 2IEAA 5AW1A 4MGIR 1GGHA 1YZGA 2HV8A 1PR9A 2CLSA 1EVEA 1PD0A 1W1WA 3AP1A 3C8ZA 3ID6C 1W2WB 1VLLA 4QGGA 4D80A 4EHFA 4RULA 4Z7NB 4C76A 1A8HA 2VT3A 3ZZ0A 1FIUA 4QGAA 2VK2A 3RT9A 3UHAA 1Q1QA 1FBNA 2CMGA 2P67A 3R9KA 3WFJA 4MNTA 4JLSA 1VA4A 2OK7A 2V6JA 3W6PA 4LXQA 4ZI5A 3G2QA 3O8OA 3FNFA 2A1UB 2VG8A 5K0ZA 4PXSA 2WB2A 3ESDA 4I55B 4J4HA 5SY4A 2B4RO 2AXEA 3BF7A 3AZQA 2BBOA 1JNXX 4G8JA 3LRTA 1ZR2A 5KNDD 4IWYA 4NCBA 1JIUA 3DE2X 1K0FA 4G1CA 1IHXA 4PYQA 4RPLA 1PLKA 1KR2A 4HAWA 3A9TA 1T5BA 1AA6A 2Y0CA 3M82A 5EE1A 3CVYA 1AUQA 3R24A 1IIBA 1J99A 1NRIA 2QQEA 3C97A 1FFCA 2AJTA 3MF4A 4M8SA 1RKXA 4OMUA 5EIWA 3UOGA 4BMVA 1RPNA 1XCLA 4DCMA 2AEFA 2ZUFA 1OH6A 2P2ZA 5CFMA 1AUVA 3EY9A 4A6PA 3B2QA 2AFIA 2P2DA 4ALMA 2BFOA 4U02A 1TUGA 3OEHA 1W87A 4IOKA 3PVZA 4QM6A 4B4WA 4YACA 3LJKA 1PE0A 2SICE 3ED5A 2Z6QA 3OFVA 1T3TA 1H23A 2C94A 4GMKA 4P4SA 1WIWA 4JBIA 2FPPB 3EGVA 3OU6A 2Q1UA 1SM4A 1P1KA 1DV1A 3U3ZA 2JCYA 1H2AS 4INPA 3ZJUA 1WKBA 1Q1ZA 1SKBA 2MMGA 5TMEA 3GFFA 1YZTA 5DBIA 4R2IA 4EENA 2BTQB 2F7SA 3PXGA 2C00A 2M2IA 4OHRA 3JRNA 2I2FA 3OIYA 4TZKA 2VF4X 4OOFA 3VZCA 3BTSA 4DG8A 4GC9A 1QYIA 3E35A 4CIVA 3TG8A 4GPD1 3R20A 3V1NA 2WB4A 2ZSUA 3USCS 1A77A 4Q9DA 5JS8A 2O3RA 3MTJA 4AJ2A 4A2WA 2Q4RA 3HNPA 5LQJA 3D1JA 3F2VA 4PTLA 4MUNA 1UMCB 1YBVA 3IHLA 5EN4A 4MRRA 3C74A 5EKTA 5C8ZA 4UBJA 5KSYA 2QPOA 1T3GA 3JQ6A 3L0IB 1DBWA 3AY6A 4U7TB 3COYA 1KFBB 5B1EA 4AJ4A 2QMEA 2YWXA 2P1ZA 1EX9A 2EQBA 3D2AA 1MG5A 4GYKA 3DWEX 3KOZA 3KQMA 3LBHA 2AK2A 5GM2A 2KS6A 1R37A 1CU1A 2DETA 2UAGA 2PMCA 3G13A 2ZAMA 3DP9A 2X5KO 3PHLA 4Y67A 5KYKA 1T9ZA 5LZ9A 2Q9BA 1WD5A 1DKLA 4F9TA 1TLFA 3G3EA 1HG0A 5HCUA 4BE9A 1ZCJA 4PLHA 3UJHA 4B5LA 1NN3A 5I7WA 4ZQGA 2AEMA 4JL6A 2PD6A 4R01A 1YR7A 2GN1A 5FL3A 1HE1C 1J8QA 2W2NA 3QYFA 4MV0A 3ZZUA 4EKIA 3U4MA 1EHYA 1I6WA 3BCUA 3IR6A 1DTSA 3G9XA 2CFIA 4I50A 2ZRPA 1E7RA 3BEOA 1NXWA 4XI9A 1O94C 1T4GA 5KAPA 3R6GA 2VNJA 5LNK1 3AEUA 3FGPA 5A1JA 3C3JA 1AKMA 3IUNA 5F7JA 1O9GA 3DXZA 4ZJPA 1JN0A 3QSYA 1Y8AA 1FDIA 1Q7GA 5I9TA 5BORA 2VF2A 4PWZA 1Y37A 1HR0B 2G9RA 1VYVA 2O57A 1JLLA 3QIVA 5KCMA 4E5KA 3R77A 5AKXA 4DA4A 4L07A 2XKKA 5CRIA 1WE2A 3ANMA 3DDCA 5KTMA 1OH7A 3PGJA 4E31A 4F3YA 5K3OA 3IP3A 3FCXA 4BV9A 2PZGA 5EJ5A 2OXCA 1XFAA 4I2NA 1WB4A 2PBZA 5GJVC 4GI1A 3VOTA 2GCOB 5LLDA 1OPRA 1E3SA 4LA4A 4QUGA 4R8MA 1BDHA 1F60A 1YS4A 3NYRA 1NL3A 2NZ2A 1EUDA 4C29A 5CB4F 2DLNA 1GZUA 1VFNA 1P9OA 1XMSA 5LCXA 1VP3A 5IMBA 3K1YA 1OXVA 4DSOA 2VJBA 5EQTA 3G5UA 2XOXA 4PSAA 3UUGA 3GEGA 1TF5A 1WXHA 4CEJB 1HYQA 3O2QB 4O8CA 2VWHA 3LW8A 3QVKA 4NAUA 4KR3A 1Q14A 1KI9A 3OEED 3OZXA 3ZV5A 4M87A 1KQGA 5G0UA 2I33A 2NYVA 4WXHA 4D0NA 4QDZA 3NT2A 2BBWA 1CUWA 3MWEA 4GFDA 5JQGA 2H1LA 3WHIA 1P2UA 2XYHA 3TTWA 4BEVA 4GX5A 4QYMA 3ZI4A 2Q5EA 2NXWA 1HL3A 1ECFA 2CL6X 1T1JA 3AGQA 3I58A 3PCRB 2B82A 4UMEA 2KJQA 5H5JA 2B0CA 2VJPA 3OFKA 5A4JA 3P9PA 3A9RA 1QK5A 1T5LA 3R74A 3DZ4B 1LLUA 2XXJA 4B7XA 5DNEA 5EJ7A 3N3AC 3QBTA 3K92A 1PV2A 2AC7A 4WNYA 1S1CA 1QIKA 4LRYA 4TL8A 4BEJA 2NU6A 3S99A 3QVXA 1MB0A 5AHRA 2BEWB 3LECA 2FFQA 1ULHA 3CLUC 3NNNA 4HH1A 2WSSA 2G1JA 4GEKA 3TB4A 5CAEA 2WA2A 2YHSA 4HVCA 1E77A 3PFWO 3OM0A 5JAPA 5A4AA 1US8A 2V7WA 1I1HA 1VIVA 1GLNA 1MX5A 2H1HA 1KU6A 2WSLA 3IOCA 3R5HA 3AP3A 3B6KA 1YA8A 1TVKA 3HY6A 4KQKA 3ZVNA 4IDEA 2Y71A 4Q3OA 1LC0A 3MIIA 5LC1A 4MKRA 4QUBA 4EG8A 4QG7A 1FUYB 1A0OA 2WUFA 2DPGA 1UT6A 3DOOA 3IGFA 3JPYA 3KHUA 4C4SA 4WACA 1N5DA 3CY6A 3V1TC 2HFKA 4KC0A 1TGVA 3GUHA 4GOND 2O5RA 3UC9A 3W3ZB 4YP9A 2Q2WA 3ZQ4A 4ACBA 2JARA 521PA 1FUKA 1XZHA 5BP7A 4NCAA 4PYKA 4WNCA 4X44A 3RYHB 4A2QA 1OT3A 2JA2A 4JC8A 1J70A 2QX6A 4PLPA 3NKFA 5FQNA 4D98A 2AB0A 4B35A 2B1IA 2E4VA 3QFFA 4OHUA 3EJ6A 4R9VA 2ZIUB 3WV5A 3AUYA 4AZ0A 5A04A 1YZUA 4MITA 3J7TA 2D3TA 1K4YA 1SC4A 3ADPA 3HJNA 4ZI7A 1JTVA 5AVTA 4LSGA 3U4DA 3ZTYA 4NV1A 4OK6A 5AXBA 3OQHA 1BKSB 4QICA 4BL5A 4B3TB 1CT9A 2ODWA 2OO5A 4NONA 4OQZA 4ASUD 3IIMA 5C32A 1KQFA 1EX7A 1R4ZA 1SCBA 2ZI6A 4Y2UA 1QANA 2V55B 1NLZA 1PJRA 1JHUA 2D00A 3C24A 1X39A 1TCBA 2J4DA 4M86A 5E38A 1AT1A 3DE7X 1G17A 4CG2A 2CEAA 2P5YA 4NU6A 4QZVA 3MXTA 4RKYA 1BFUA 3EW7A 1BMTA 2PUEA 4MEAA 2BEKA 2Q9CA 3DZKA 4I2VA 5GGXA 2PO7A 3OBIA 2R2AA 3C6YA 4JP8A 5AKYA 1EFDN 3IAM6 3RODA 3P8ZA 4D3DA 3CHYA 3ESXA 4MO2A 4PX5A 4OXQA 4WCFA 4YMWA 1T10A 3RU3A 1N92A 1GGNA 3LIPA 3GXOA 2C9BA 4XCXA 1QYDA 4W1SA 4LJ9A 1R00A 1ZEJA 2L18A 2ZKIA