3Q2IA

Crystal structure of the wlba dehydrognase from chromobactrium violaceum in complex with nadh and udp-glcnaca at 1.50 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
352
structure length
345
Chain Sequence
MIVIPPITDRKIRFALVGCGRIANNHFGALEKHADRAELIDVCDIDPAALKAAVERTGARGHASLTDMLAQTDADIVILTTPSGLHPTQSIECSEAGFHVMTEKPMATRWEDGLEMVKAADKAKKHLFVVKQNRRNATLQLLKRAMQEKRFGRIYMVNVNVFWTRPQEYYDAAGWRGTWEFDGGAFMNQASHYVDLLDWLIGPVESVQAYTATLARNIEVEDTGTVSVKWRSGALGSMNVTMLTYPKNLEGSITILGEKGSVRVGGVAVNEIQHWEFSEPHAMDEEIKDASGFGHPLYYDNVIKTMRGEATPETDGREGLKSLELLIAMYLSARDGRRVSLPLDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Characterization of WlbA from Bordetella pertussis and Chromobacterium violaceum: Enzymes Required for the Biosynthesis of 2,3-Diacetamido-2,3-dideoxy-d-mannuronic Acid.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Oxidoreductase
molecule keywords dehydrogenase
total genus 132
structure length 345
sequence length 352
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3q2iA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3q2iA01
2X86A 5BQFA 2W98A 4LW8A 1N7HA 1QRRA 2HMWA 5I7VA 1HYEA 4DTIA 4RVDA 1WW8A 3GC6A 3K5PA 4O5OA 1E5LA 2QX7A 3K92A 3N7UA 4HKTA 2PZLA 3HN2A 3ROKA 1Q7GA 3ZWAA 3WR5A 3NRCA 3AI1A 3H9JA 3L4BC 2DVMA 3I9NA 1N9GB 3KSUA 2G17A 3KUXA 2C5EA 3S1LA 3QWHA 5JMPA 2O50A 5DN9A 5IZCA 1ISGA 4KZPA 2JFFA 1R37A 5I8WA 5JAIA 4I5EA 4ALKA 5C7OO 1N1EA 3ZWCA 3H5AA 2D4AA 2D5AA 3WGIA 2BFAA 4NR0A 3MJCA 5DZSA 1ZJZA 3VH4A 1J6UA 2NQTA 2HRBA 2EJVA 4J7XA 3RQSA 3ZHZA 1YL7A 1NQ5A 1FDSA 2EJWA 2OP0A 4E4YA 3FTNA 4JXKA 3SXPA 3U62A 4BO4A 1I3MA 2GSDA 2EGHA 4H15A 4YPOA 3DXFA 2EHDA 2FR8A 1BVUA 1JTVA 4MIEA 3I6QA 3G79A 3CZRA 4IM7A 3WQRA 3W8EA 1CRWG 4B4VA 4RF5A 3D7LA 4RDHA 3PDJA 5A9RA 3TL3A 3WB9A 1QYWA 2DBRA 5JMWA 3JQ7A 2C20A 3VHRA 1E92A 1ZZEA 3HZZA 4XR4A 3IP3A 2DKNA 3PJGA 4J4TA 1GTMA 4D0SA 4J6FA 4RV9A 1MFZA 2PKQP 3JYPA 3RUFA 2OBNA 4J43A 4XD2A 4RPHA 5F5NA 2PD3A 4ALIA 3R1IA 2P2SA 5BNTA 3JQBA 1ADFA 5IN4A 1ONNA 4DLAA 1HE5A 2ZTLA 1DSSG 5K6AA 4G81A 1QLHA 4BKPA 3GEDA 3TPCA 2PZMA 1L7EA 4JBHA 1DXYA 3OP4A 3BMOB 4NMHA 4BNVA 3E9MA 4A73A 2I6TA 2W90A 4R9SA 4YEDA 1N9GA 3E48A 5JAZA 3LK7A 2GDZA 2EW2A 4UVEA 2PD6A 5ENDA 5L4NA 2UUOA 1T2EA 3K2EA 1EUCA 3ORFA 4JQCA 4WEOA 5C37A 2VHXA 4EUFA 2DUUA 2CVQA 2X9GA 3EMKA 4M89A 1GPDG 4NU6A 2POQX 3KM0A 4CMCA 5IZ4A 5JY1A 1H9BA 4CMAA 2BKAA 3EZLA 1CIVA 3OIFA 1F17A 4I5DA 1NAHA 2O2SA 3TJRA 1SCUA 2NU7A 3HB5X 3I9MA 4BIIA 4F6CA 3PGJA 4ZD6A 4J90A 1P0CA 4PIVA 3UCEA 1GQ2A 5FF9A 4QFCA 4BO9A 5FI3A 3VPHA 2O3QA 1YDEA 3IUSA 5DT9A 1B8VA 2BELA 1E7RA 4PCVA 5T8KA 1IHYA 1KVUA 4XQCA 1YDWA 1BXGA 2Y66A 2Z1NA 1NX6A 4GLLA 1WZEA 1B2LA 2WMDA 4BO8A 1O95A 1DAOA 3O03A 4A2CA 5I9NA 1PU2A 3Q1LA 5ER6A 1C0IA 1N8KA 4ZQGA 3FI9A 1V35A 4J7UA 4DPMA 2QHXA 1DC6A 2W2LD 3GDGA 4YAEA 2FPGA 4QX6A 4QSMA 3LF2A 3CE6A 3OF2A 1ZSYA 2V65A 4IDDA 1U3WA 5B4UA 1ADCA 1HWYA 4GLOA 4PG6A 2X0IA 4O0LA 3AUSA 2DM6A 1GYRA 1KBZA 2PR2A 4NH4A 3B1KA 1GUYA 5FI5A 4Q3NA 4WLEA 2CF6A 5DP1A 3F4BA 2WEKA 2ZB7A 1W73A 1ZJYA 1LC0A 2ILTA 3BMOA 5A02A 4WNCA 1EDZA 1PGQA 3AM4A 4FW8A 2BFOA 4GL4A 3Q9NA 1KEPA 3JQBC 2NVUB 3B1FA 1I2CA 4HFMA 1J5PA 3LC2O 2YY7A 3HUDA 3JQAD 3QWBA 1FXSA 4MDHA 3ETEA 1AHIA 2OORA 4EITA 5CG1A 4IMRA 1NVMB 1E0DA 4IZHA 4CV0A 3ASUA 3GH3A 4FJ1A 2AQIA 2J5KA 2HLPA 3A14A 4DMMA 1QLJA 3DZHA 3DZKA 1DHRA 1NNUA 4DYVA 4R54A 2VOEA 1A7AA 3G49A 5BR7A 1R4MA 4IMPA 3G17A 2I5PO 4D43A 1YRLA 1IL0A 3ROMA 3ULKA 2RAFA 4CL3A 3DBVO 4GVLA 1PQWA 3QVXA 2ZJ0A 3KO8A 1LC3A 2VHZA 2QRKA 1T26A 4OXKA 3WS7A 2YQ4A 1I0ZA 1P1RA 4L74A 2RBEA 4N5LA 1DIGA 3PWZA 5DCUA 4IXTA 1T2FA 2HDHA 2IZ0A 1JVSA 1E3EA 1X0XA 3C8MA 3UAGA 4YR9A 3FRJA 3ZNNA 4P38A 1K5HA 3F5SA 1MGOA 3PYMA 3DQPA 4DA9A 4CM8B 5TIIA 3GN1A 4CR6A 4AJ2A 2YV2A 1WDMA 1DEHA 1UJMA 2CDAA 2ZIZA 1C1XB 1HSZA 4EYEA 2R6JA 3JTMA 4CM7A 1DBVO 4ND5A 5A04A 1AXEA 3DAFA 5U4QA 3QSGA 3GDOA 2LDBA 1VI2A 3IMFA 4ITUA 3WGGA 1UXKA 1V0JA 3ADPA 3DONA 3GVXA 3LT4A 3OIGA 3QP9A 4I5FA 5CDSA 5IJZA 3LQFA 4CMEA 1FMCA 3RI3A 4KUHA 5CPBA 4BMNA 4LMPA 1H9AA 3E1KA 3FR7A 2DTEA 1H5QA 4HFNA 1VKNA 1TI7A 1BG6A 1T2CA 3NDIA 4WCFC 3H9EO 1KY5A 2W4QA 3IOYA 4BHTA 4W99A 3HQ4O 1K3TA 1JDJA 3PIIA 3ZWOA 5CFZA 3K73O 2VHWA 1D3AA 3RUHA 1KVSA 1P33A 4CLOA 4K28A 3NGLA 3DMTC 4L8VA 2DTXA 2H9IA 2YZ7A 4IZIA 2O3UA 1YJQA 5CG2A 4XR9A 4YXFA 1LNQA 2DBZA 4YJHB 1NAIA 3UW3A 3H8VA 1TB4A 3BTSA 3ZWPA 1NM5A 4QUKA 1NR7A 1LQTA 3KLPX 2PA3A 2QRJA 4GMFA 5AXCA 1B8UA 1LLDA 1YH3A 5CDYA 3RC7A 4DWVA 1BVRA 5IDYA 1BWSA 3ZWNA 4J9VA 4IDCA 4UREA 3KBOA 1GAEO 1LLUA 5ILGA 4ZQEA 5TLSA 4YYZA 4R3NA 1GEEA 3EDMA 3L77A 2HUNA 4XA8A 4YWJA 1D7OA 3EGOA 4XYMA 1JAYA 2FMUA 5L3ZA 4MPDA 3PK0A 2PZJA 3TZKA 1P1HA 1ISMA 1KERA 3K6JA 3HDYA 1VKOA 5LC1A 1T2AA 3SC4A 1K6XA 3X2FA 4A7PA 1R4NB 4IPTA 1LX6A 1ZXLA 3GVHA 3I9KA 1GYPA 2SCUA 3OSUA 3CUKA 3DBRA 3DTYA 1V3UA 1R4MB 2I99A 4AVYA 5L45A 2ZJ1A 1UAYA 2HQ1A 1MA0A 1UZLA 4CM5A 3MWDB 3PWKA 2XAAA 1E1LA 2DLDA 4PG7A 2ZKLA 3D4OA 1V3TA 1JWAB 4DUPA 3WX0A 4U8GA 2BD0A 3VC7A 1MG0A 3VH3A 4PLTA 4S1VA 5A05A 2XOXA 3FNEA 4CM3A 4WNIA 3O8QB 1I36A 4CODB 3DBLA 1U3TA 2Y99A 3LC7O 1VL8A 2GF2A 1CWUA 4AICA 4KTTE 4O63O 1F8FA 2VNAA 3L6EA 2JJYA 3H3JA 4DGSA 1RM4A 3L6OO 2GGSA 4A10A 4C7JA 2ZTVA 2NU6A 3D4PA 5LCXA 3RWBA 3GLQA 1UP4A 1Z75A 1OFGA 2X5JO 1C0LA 4LCEA 4YCAA 1DDOA 6LDHA 4GPD1 1LBEA 1XGKA 2E6UX 3HDQA 2PKRA 3C3XA 3JQ9A 4Q39A 3ANLA 1ONPA 4UUPA 1GV1A 1VL0A 2FHSA 4RF2A 2E37A 1AXGA 2DT5A 1LXCA 4UVHA 1A9YA 5KIAA 2UDPA 2ZYDA 3CH6A 4CLRA 3QIVA 1YOVA 3DDNA 2GERA 5BSHA 2QRLA 5CDUA 4P22A 4HFRA 2QG4A 5C3MA 1R66A 4RF3A 1MC5A 4FFPA 4WUVA 3ZNOA 3SC6A 4LSMA 2G76A 1BXZA 3IS3A 4PVDA 4FD3A 5TSDA 1ZEMA 5JYFA 4Y8VA 1R0SA 3ZV6A 4BMVA 4ZJUA 4OIMA 3H5RA 4N7RA 5IG2A 5IXYA 4YACA 3K31A 3RSHA 3U4CA 4B7UA 8ADHA 3UH1A 2Y1GA 4YTEA 1NPDA 2RHCA 3QVTA 4J1NA 1Y8RB 1N1GA 3DFZA 1W4ZA 3FNHA 3JYQA 1RM3A 4XCVA 4W4TA 3VZSA 4WASA 3FD8A 4FFRA 4XRRA 5LDGA 3ZHBA 1GADO 3UUWA 3RUCA 1KVRA 5F21A 4AJPA 3OEYA 3GEGA 1K0UA 2PY6A 4PG8A 4LN1A 4GH5A 4F45A 5B4VA 5L7WA 3AI2A 2YQ5A 3FWNA 1HSOA 2LDXA 2V6BA 5IN5A 3WGZA 2AW5A 4CMKA 3H3FA 4MOWA 4KP7A 5HRUA 3KXDA 3JD0A 3U4HA 5B12A 5COQA 5KCZA 4EJMA 4IDBA 1M6HA 1ZXBA 4NFHA 4CJXA 3NT2A 3ANNA 4OQYA 4C7KA 2O3RA 3C7CB 3JYNA 2O3TA 1K6IA 1EE9A 2OFPA 3JQAB 2FN7A 5JAMA 4JIGA 3DB2A 1NWHA 1VJ1A 5KKCA 4ID9A 3WQSB 3KYCB 4IS3A 3KTDA 3WG9A 2GCGA 3E03A 4HBGA 3QY9A 2Q1WA 3DEYX 3KVOA 2Q99A 4WK6A 4R1SA 1HF3A 3NGXA 4LCJA 4BGIA 3DC2A 3V2GA 1MUUA 3C7AA 3OQ1A 2X9NA 3PRJA 3F47A 2WYWA 3BMNA 3B1JA 4NDNE 1NWCA 3RROA 4E3ZA 5AQ1A 3RUEA 5KTKA 1Z82A 5C7LO 2A35A 3N58A 2NLOA 4AJEA 2VUTA 3NDRA 2C54A 4UVGA 5EQDA 2VTDA 2GUGA 2D0IA 1RWBA 4OSOA 4MVJD 4Z0HO 5JE8A 2VTEA 1PR9A 1Y8RA 3U4DA 2HMUA 2IE0A 4GX2A 5KKAA 4MVJM 1LJ8A 1H0KA 1WPQA 1WLYA 3PLRA 5T5QA 3Q9UA 3FBGA 4YT4A 4BO2A 4R3WA 4UVIA 4XDYA 2WJPA 4Y67A 3QHAA 3F5QA 1UZNA 2FZEA 4HWKA 5L7TA 2FPPA 3JQAA 4NBUA 1G0NA 2I76A 2XXJA 3FBTA 4M49A 3AY3A 1Y5MA 3E8XA 1ADGA 3KYCA 2WTBA 4CLDA 4IQ0A 3QVSA 1MFPA 4DYDA 1YQGA 5EIOA 1CEQA 4JBGA 5EJ2A 3ONFA 3UCFA 1RKXA 2OP1A 3PI7A 4U6SA 1NBOA 1A7KA 2X6TA 3GHYA 4XIYA 3WFJA 1IPFA 2RIRA 1JKFA 3VTFA 2VUSA 1WDKA 4AJOA 4CM9A 4J1QA 5CEFA 1X1TA 4NPCA 4ZICA 1EQ2A 4RVSA 1YKFA 3Q2IA 1YS4A 3BAZA 4HFJA 2QYSA 3IP1A 1G6KA 3GZ4A 4BQRA 3UICA 3E6AA 3JQGA 4FSHA 2RCYA 3O9ZA 1HXHA 4OQZA 3IJPA 1H93A 3CINA 3KSDO 2C2YA 2JL1A 3WICA 2B4TO 4ND3A 2VYVD 1SEPA 4BO0A 5DDIP 3RKRA 4R1NA 2NNLD 2WD7B 3WYEA 3FN4A 3GRKA 5TT1A 3G0OA 5A9SA 1M6WA 4XB1A 1M2WA 4RLHA 1PJ2A 1I2BA 5KJ6A 4CQLB 3JQFA 5TJ9A 5JYAA 1LUAA 1YL6A 1DIAA 3OIDA 3W6ZA 2PTGA 3DHEA 3CEAA 4YVFA 5MDHA 1IZ9A 1PL6A 4AJKA 3U5TA 1I10A 1N5DA 3PFWO 2AE1A 2B69A 4OM8A 4R1TA 4XEHA 2X4GA 4XQ9A 3G1UA 2H6EA 4JNKA 2VZ0A 1BXKA 3QJ5A 2Q2QA 1WP4A 5L4LA 2Q2VA 3BMCA 1ISIA 7ADHA 4OO3A 3H9UA 3MTGA 1NVTA 3RC1A 4H7PA 1ONOA 3QWIA 1LU9A 3X2EA 1YL5A 1P0FA 3Q3CA 2Q4BA 3V1TC 4JLWA 2G5CA 4ZN6A 5JW6A 5T64A 4H16A 3UOGA 1I32A 1ADBA 3ZNPA 2B0JA 1W0CA 1XKQA 1NVGA 4RVUA 4TKMA 2I3GA 2HSDA 3AK4A 1U7HA 4PRKA 5LDHA 3RJ9A 2ZK7A 1DC4A 4YQZA 3CIFA 2B4RO 1FDVA 1LSJA 5THKA 1UR5A 5CDTA 1O94A 1JN0A 4DC1A 3RIHA 3DMTA 1YBVA 2G82A 4DL9A 3GMDA 1E7SA 3UN1A 1Y5RA 3S55A 2E48A 2IXAA 4QO7A 3S2GA 2C7VA 2VYNA 1NFFA 3GAZA 5BNFA 3GUCA 1DPGA 2V7PA 4XYGA 1PS8A 5BSGA 2EV9A 4II3A 3C24A 1DFGA 3ZV5A 2AEMA 1PGPA 2IDZA 1UXJA 5ITWA 1PZHA 1WZIA 1QXSA 3ZU5A 5JAQA 1I3NA 3LZ6A 3IKVA 1A4UA 3PQEA 1E7YA 2HMSA 1IULA 4KDEA 3BA1A 3SJ7A 3ZW9A 5BT9A 4AJ4A 1BDBA 5GZ1A 1B3BA 4NJOA 2X0JA 1C1DB 4A27A 2FSSA 4BNKA 3LLVA 4NJMA 4GSLA 2HJSA 4XGNA 4AJHA 1UDBA 3WGYA 3LT2A 4Q9NA 3RCBA 3RFTA 4M55A 3I4FA 4LVCA 5IF3A 4WLVA 4IBOA 1O8CA 4IS2A 4AJIA 1BW9A 2HRZA 4FOSA 3TZCA 2ZQYA 1HTBA 1T25A 2CDCA 3AU8A 3WGOA 1X1EA 3CZMA 3RKUA 3DMYA 3ONDA 4NNJA 3UHAA 3RD5A 4QO8A 1I30A 2O3SA 1YB5A 5KVSA 1SB8A 1QSGA 1KC1A 2HAEA 3FF4A 4EUHA 6ADHA 4DRYA 3K96A 4ALJA 5HWSA 1IOLA 3DWFA 1WDLA 4RQTA 3NT4A 1B0AA 1IB6A 3OETA 4LISA 4NBRA 5KJEA 2WDZA 2FR1A 4K1LA 1PWZA 2FP4A 1EEHA 1GV0A 1LSOA 3ETGA 3L4SO 4MVJI 3GNSA 4PLVA 4NIMA 5G4LA 5M6DA 4PG5A 1D8AA 4D3FA 5L9AA 3KZVA 5COAA 4RPGA 3VH1A 3W6UA 1U1IA 4BKUA 4K6FA 4CQLA 4I08A 5F1OA 1M76A 5EINA 3GGPA 5L95A 1X15A 4A0SA 1V3VA 4MIYA 3ENKA 5KNLA 4B4WA 4ND4A 1KEUA 2BHLA 3RJ5A 2V6GA 5EN4A 4BNIA 1AGNA 4B3JA 1DHTA 4P4NA 2NTVA 4IDEA 1U2GA 4JGBA 1T24A 4CMIB 4BGEA 4MVJE 4WLNA 4DQVA 4IXWA 3BMCB 2NVBA 4BNMA 1R15A 4WE3A 4RJTA 3WLEA 4OHUA 4TSKA 3VZPA 3RC2A 3TDKA 1I24A 4BS9A 1P45A 4D0RA 1Q7CA 3Q6IA 3CKYA 1AE1A 1ULSA 4FIZA 4NFYA 4MKXA 2UV8A 3WJAA 3JYLA 1XU9A 3LC1O 1QP8A 4IGFA 3MJEA 1MC4A 2NVUA 4EEXA 3GDFA 3ENNA 4Z6KA 5TS3A 1IYZA 1A72A 2AG5A 4IIVA 5C7IO 1LA2A 2EP5A 3H4VA 4R01A 3RU7A 5IAAA 5JSFA 1MG5A 3PHIA 1E6WA 2JCXA 4XYLA 2UVDA 1HZZA 4XKJA 1AUPA 2B36A 2EW8A 2YHIA 1B15A 4A03A 2Q46A 5HS4A 3JCZA 4U0JA 3N74A 1O9BA 3WIDA 4R16A 4I1IA 1NHWA 4UUMA 1EQUA 1P1KA 5EESA 2OO5A 3PHLA 2QZZA 2D1YA 4ALLA 3BXXA 4J1SA 3OEWA 1QORA 4IQ8A 5ILOA 4AJNA 1PEDA 1PTJA 4RVHA 1HDGO 4II2A 2YYYA 4I9NA 2O3JA 3RBZA 4LSWA 4WECA 3B70A 4ND1A 4Y98A 1ZH8A 2AEJA 3D3WA 3VVCA 1T4DA 3QLJA 5DULA 1ARZA 1YJ8A 2AQKA 4UEOA 1BGVA 4M54A 2I9PA 1E3LA 1XA0A 4W7HA 4BO3A 2QYTA 3A4VA 4YRAA 3AJRA 3GVCA 1T4BA 4FGSA 2OMEA 2IODA 3DBHB 3LLSA 1EBUA 4QQRA 2PLAA 5DBIA 3WWYA 1MXHA 1EZ4A 1ORRA 1Q0LA 1WAMA 3DHYA 2VWQA 4BUCA 4CMGA 4WOKA 5B1YA 3WIEA 4TROA 2JFGA 4XJTA 4YAJA 2O23A 1I01A 3VKUA 3GK3A 5HBRA 2ZB3A 3UFXA 4Q3EA 3FHLA 3KYBA 1IHXA 2AG8A 3CMMA 5G0WA 4CLEA 2DAPA 1VM6A 1T1RA 2TMGA 4OAQA 4LRTB 3W8DA 2GLXA 4NBWA 2V6MA 3IL2A 1DAPA 4X54A 1QYCA 3AOEC 4R68A 4WCDA 1OZAA 4M1QA 2IXBA 4GBJA 1O5IA 4W82A 1I3LA 4YT8A 2GN8A 4OGWA 4J3FA 2HKIA 5T8KC 1JW9B 3HSKA 5TF4A 4DBVO 2Y0EA 4AL4A 4DIOA 2CUKA 1C0KA 1P1JA 1EVJA 2GYYA 2J6IA 1P3DA 1Y8QB 4PLCA 1YVEI 1VL6A 4OL9A 4CM6A 4HUJA 3OA0A 1LLQA 2BF7A 4NK5A 2EERA 4L0QA 1ZNQO 1GL3A 3VZQA 4PLPA 3OA2A 2VOJA 4MP6A 5DNAA 4CMBA 2YV3A 4GGPA 5J9GA 3GPIA 3NTRA 2C0CA 1D1SA 1DOHA 2Z95A 3IQDB 4E6PA 9LDTA 3DAPA 2JAPA 2C29D 4Z9YA 5AYVA 2OBYA 4MJLA 4FC7A 5HM8A 5JCXA 1ZBQA 2GN9A 4Y6RA 1JLLA 3T4EA 4ROSA 3MOIA 4BNLA 3WTCA 2OZPA 4GWKA 2B83A 4PZDA 4BNTA 3OJ0A 3BTOA 1Q1NA 1Y81A 1PZFA 1PR3A 3SLGA 4AFNA 4EZBA 3QQPA 1H6CA 3S8MA 1PJTA 3L0DA 5L40A 3RBVA 2PK3A 3W4IA 2YJZA 4PLYA 3WBBA 3VDQA 4HX5A 4PLFA 4B8ZA 4PLGA 4Z9FA 2TMDA 3RFXA 5HS6A 4BOYA 3R6DA 1WXDA 4BQPA 5IFLA 3ZWXA 1UXHA 2JHFA 1A9ZA 4D46A 1SOVA 1MXFA 3VPSA 3VVBA 2X0RA 2GNAA 4MVJG 3QE3A 2IZZA 1Z7BA 2BFMA 4F6LA 1T1SA 3A9WA 2H63A 4FFOA 3MJTA 5TNXA 1PJQA 5ICSA 1U5AA 5T67A 5BNIA 5I8ZA 3P2YA 1H6DA 1LDMA 3C1TA 1IZ0A 4Q3AA 5IZCC 2P9GA 4E5NA 2IEDA 1UP7A 4ZVVA 1UDCA 5L7YA 2P68A 1VJTA 3AM3A 4D7AA 1QMGA 3GVIA 3JQ7B 1HE2A 1QYDA 4IIUA 3MCVA 9LDBA 1HZJA 3KETA 3ROPA 2NVWA 4J16A 2ZTUA 2D3TA 2B4QA 1PZEA 1QYVA 4H3VA 1EK5A 1PSDA 3TF5A 2A94A 5B4TA 3TQHA 1LSUA 3KEQA 4DVJA 4RO0A 2F1KA 4BKRA 4DLBA 1ZMOA 5A5FA 2PD4A 1DJQA 3V5NA 1GPJA 3M6IA 2B35A 4JK3A 4E12A 2RH8A 5IXSA 1VRWA 1PJLA 3U9LA 4FR5A 1E7MA 1L1FA 4N54A 4D45A 2VT2A 3PQDA 3LT0A 3K2BA 3AFMA 5G0VA 2WYVA 3JYOA 1DIBA 4CV1A 1XIVA 2RHRA 2Q22A 4R41A 4TZKA 5JDCA 3S2IA 1LTHR 4CQMD 4U7WA 4JBIA 3NKLA 4ZQBA 3H65A 1NHGA 4PLHA 1BRMA 1SNYA 3JQ9C 2I67A 4CV3A 4CUJA 4DXHA 1QV7A 5JO0A 3PJEA 2QIOA 4RF4A 3AUAA 2NSDA 3H2ZA 2RH4A 3RASA 4WKGA 2ZYGA 4BO7A 3D4NA 4EGFA 3ZWVA 3ZHXA 2Q3EA 1TA4A 2NV6A 1A4IA 2EGGA 5A06A 1M75A 2O4UX 1XDWA 2VZ9A 4TWRA 5TJHA 4MKRA 2BGMA 1PGJA 3VAZA 1E7QA 1P1IA 3V2UA 2VUUA 2VQ3A 3EVNA 3PEFA 4PLWA 1RM5A 1WNTA 4AJ1A 1VSUA 4IY1A 2IYOA 3GA0A 5DBFA 3VZRA 2DQ4A 2WWRA 1LRLA 3DOJA 2HK7A 2PKQO 3AM5A 5ICMA 5H82A 1VC2A 3NEPX 3F9IA 3GVPA 3PHJA 3QW2A 4J4HA 5T6BA 3SVTA 2NWQA 2NUAA 2X5KO 1ZVMA 3LSYA 4YAGA 4MIOA 4RL6A 3WMWA 4TKLA 3UCXA 3TL2A 3OHSX 1DFIA 4DQXA 1RM0A 2EXXA 1ID1A 4IDGA 1WMAA 3TWOA 3NT5A 1ZKMA 2R00C 1I8TA 3BMQA 1CF2O 3NUGA 4HADA 2Q49A 3DZGA 4P4GA 2VYND 4FQ8A 1V6AA 4G65A 1ENOA 3HWRA 3INTA 5IDWA 1I2ZA 3L4BA 1KIFA 5A9TA 4ILKA 1YOVB 3O38A 1XG5A 1C14A 4OOEA 2EKLA 1A5ZA 4R5HA 4J49A 1HL3A 1P74A 1UZMA 3P5SA 1I3KA 1K6JA 5U9CA 4BNZA 3D3WB 2DFDA 3L07A 3HB4X 4FCCA 4YJGA 2A4KA 1YXMA 2PFGA 1L7DA 3EYWA 3D5TA 4UAGA 1KOLA 4FFNA 1E1NA 4IQGA 3GEMA 2Z1MA 4LRSB 2PH5A 3ST7A 3KRTA 3RBXA 4YB8A 1PGNA 4WEQA 5G0TA 1OC4A 2Y67A 3AI3A 1IPEA 4EBFA 3ZHYA 4EEZA 1IUKA 3DO5A 1QG6A 1R16A 3AWDA 2VYVA 4XJSA 1RPNA 4CLOB 2PZKA 4W9NA 3LDHA 3SJUA 1BXGB 3AUTA 2JCYA 1LDYA 3AUUA 3ICPA 1PQUA 4YRDA 4AJLA 1HYGA 5AXAA 4J9UE 1PL8A 2J5QA 1DIHA 1GD1O 2WSBA 2P4HX 5AXBA 4FS3A 1EE2A 4I9HA 2X22A 1OI7A 5JDCC 1SZJG 2Y05A 3IIEA 1FDWA 3VDRA 2PNFA 3L9XA 2P5YA 1X14A 4D79A 2ZTMA 2ZQZA 2NQ8A 4R69A 4YJFB 4CMEC 3HFGA 3F6YA 3OQ6A 1WVGA 1HE4A 1NXQA 2NACA 2JD0A 1XR3A 4GVXA 3MJ4A 1HEUA 1ZFNA 3IDSA 4OMUA 2J3KA 4BNYA 3F1LA 5F1KA 1H2BA 1T2DA 1LDEA 5JC1A 2YFHA 4EW6A 3I52A 4CM9D 2PWZA 1C1XA 3LF1A 1ZCJA 4RZIA 5EPOA 3EAGA 2D59A 4ONEA 2NTNA 4ZRMA 2AXQA 5DBGA 4DLLA 5FWNA 1I5RA 2D8AA 2FPIA 4LK3A 4R1UA 4TVBA 4MINA 5G2OA 4R4JA 2P5UA 4DMLA 4CV2A 1TT5A 2P9EA 2CMDA 3SLKA 4Q3CA 3SX2A 1TXGA 4L4SA 1R4NA 4UEKA 3MZ0A 2EWMA 3SEFA 3VPGA 2VNSA 2GR9A 4WJZA 4N5MA 3WGHA 1D4FA 1YE3A 1TT5B 3OECA 1ML3A 3B20A 4YJDA 4O6VA 1U3UA 4DPLA 3GPDG 2G0TA 4XQEA 4Y6SA 4L4RA 4B8WA 1LQUA 4E0BA 3OFSA 3ITKA 4IJUA 2HMTA 3BHMA 2AQHA 1RYDA 2VRCA 1KVQA 4IGEA 4J0FA 4E5MA 4ESOA 4B4OA 1YQDA 2FSVA 1NPYA 4FGWA 4QT0A 1CYDA 3WYBA 3GQVA 1DLJA 4O1MA 1ZO8A 5AOVA 1WWKA 1JAXA 2BFPA 4CM8A 2B5WA 1Q7BA 2HJRA 3D1LA 2Q1TA 3MEQA 5JYDA 1R12A 1Z73A 2EP7A 2Y68A 2VHVA 5KVVA 4GAEA 3INGA 2QW8A 2VT3A 3ZWYA 1SOWA 2H5LA 2NM0A 3MOGA 1NP3A 3K30A 1KY4A 1FK8A 1XSEA 4KTVE 1NQTA 1NQAO 4GX5A 3BMQB 3H5NA 3ZGYA 4GMGA 1XELA 1Y7TA 2AEFA 3BMNB 3K9QO 3CPSA 1SC6A 4EUEA 3KSZO 3OBBA 3MJVA 2OGUA 4KOAA 3JQFC 1HYHA 1G1AA 2C2XA 2FWMX 3DOCA 3H9QA 3DZIA 3K8ZA 4URFA 2X8LA 4BGVA 5CDGA 2DBQA 4JP3A 4S3MA 3T4XA 3HFSA 4D3DA 3EVTA 3E9QA 3H2SA 1NFRA 4E5PA 1HKUA 4OKNA 2A92A 3BTUA 4DBZA 3FPLA 3WMXA 2BI7A 4FN4A 4RPJA 4KWHA 4Z0TA 3GFGA 4YJGB 3QVOA 3EY4A 1JWBB 1O6ZA 3TSCA 3MJSA 2J3JA 3ZWMA 2QZ9A 5I7SA 1P77A 2EKPA 3GZNB 1JQBA 2ZCVA 2C5AA 5EERA 4PFJA 3ROQA 4A5OA 4UEJA 4WLUA 1LRKA 2E82A 2IRWA 4TRJA 4N18A 2D2IA 4BB6A 3W4KA 4WOJA 1PL7A 2CD9A 3I23A 4ZQHA 4JROA 3FNGA 2EF1A 5F5LA 3G3EA 2C59A 4B4UA 2GD1O 1EUZA 4FFMA 4XIJA 4DIBA 3V2HA 1Z6ZA 4PRLA 2HU2A 4UVDA 5GZ6A 4UUNA 3AU9A 1ULUA 5J23A 4ZRNA 4YJFA 1YWGO 1F8GA 1HRDA 4RDIA 4BNWA 1NPTO 2CVOA 3WBFA 1OAAA 1E1MA 4B79A 2EEZA 5TX7A 1HDCA 1SO8A 4F3YA 4GWGA 5L51A 4MP8A 5CPFA 5FEUA 4Y9DA 3I3OA 3PJDA 3UXYA 3VPFA 4A26A 5BSFA 3Q0EA 4ZGWA 2Q2WA 4J7CA 2J3HA 2X23A 1DLIA 2C07A 3TZHA 2DU8A 2DUWA 4NBTA 1WMBA 3ZW8A 5JFOA 1DFHA 4XZ3A 4KUGA 4PZEA 2ZATA 3PVZA 1EUDA 2DTDA 2J5RA 4IDFA 1XYGA 2OL4A 4NU5A 2PV7A 3HJAA 5H83A 3WTBA 3GHHA 1X0VA 3NTOA 1JKJA 4WCFA 2V6FA 3FWZA 2AA3A 3HE3A 1YQXA 4ZQFA 3RC9A 3A06A 3WQQA 1ISJA 2Y0CA 4YDRA 2VWHA 1E3WA 3RAJA 1NR1A 4RCVA 3DHNA 3V1YA 2C7GA 3O26A 1SMKA 1HETA 1EVIA 2Q1SA 4Z0PA 2FOIA 3BYZA 1DB3A 1OC2A 4RLSA 5KJ1A 2P91A 5EL0A 3ITDA 4XDZA 2P9CA 3RU9A 3PHHA 3F3SA 2BI8A 1E77A 3WDSA 2C82A 2PGLA 1DRVA 4MP3A 5A3VA 2Y1OA 1B7GO 4NJMB 4GQAA 1HLDA 4OKIA 3U09A 1SBYA 3GFBA 4Y6PA 4CL8A 3PGXA 5IDQA 1ZSNA 2YV1A 3BTVA 2B5VA 3P7MA 1GR0A 1NASA 5FFFA 1S7CA 3WSVA 5I7EA 5DCWA 4ND2A 3JQGB 3ZV4A 1Q0HA 3DBRB 3GG2A 2WD8A 4XYEA 1GY8A 3ADOA 2E4AA 4EJ0A 3INRA 4NFSA 2DBVO 2Y1CA 1DC5A 2X58A 4BVAA 1AN9A 2CNBA 5JBIA 3DFUA 4R5MA 3TFOA 3NYWA 2VRBA 3JQ6A 4DQUA 4BKQA 5I9LA 3PDUA 1LDBA 1S6YA 5CP8A 2CF5A 4KMSA 4E21A 1J0XO 1U7TA 4P4LA 4RQUA 1KC3A 3I1JA 1MV8A 4EI2A 4CQMB 4CR7A 1P9LA 2X9VA 5EMHA 4PG4A 1EMDA 4B7XA 2CDBA 2YDYA 4TQGA 1P44A 1GQYA 3FR8A 2YW9A 4YBZA 2EKQA 3PQFA 3W1VA 2B37A 4L75A 1ZK0A 4WPGA 1PGOA 4BNJA 2X0NA 4BNXA 1MP0A 2JHGA 2W2KA 5JYEA 3ABIA 4GSKA 1A27A 4J1TA 2XF8A 2O4CA 2VHYA 1E3JA 4B3IA 2WE7A 5THQA 4EJ6A 5TRTA 2FRDA 3A28A 3HADA 1LLCA 3VKVA 1Z74A 4CMHA 1PJSA 4NI5A 4PZCA 4GX0A 5C5IA 2PGDA 1LEHA 2Q45A 4QTZA 1BTOA 3DTTA 1KS9A 2HMVA 3E5RA 3FCOA 2GZ3A 4Z3DA 4EDFA 3FNFA 3WNVA 4CLRB 4NG5A 2BGLA 3U0BA 4MVJP 2WE8A 4U0KA 4ALNA 3NTQA 2I3AA 1Z7EA 3GF4A 4FB5A 3H9GA 3F46A 3MTJA 1GCUA 3TZ6A 5A4DA 1PS0A 1U9JA 1XQ1A 3H7AA 3WWZA 3DZJA 4GGOA 4I5GA 3PYXA 1B8PA 1NYTA 1O0SA 5F3RA 4WLFA 4MKZA 5A9SB 3GGOA 1U4SA 3D0OA 2ZB4A 3SBOA 1JKIA 5GY7A 3DBLB 2CZCA 4E2WA 4P8RA 3JQ8A 3PYLA 3Q2KA 4IINA 1XQ6A 2BGKA 3ZI0A 1E3WB 3TNLA 5GMOA 1YBMA 5AXDA 1UUFA 4LGVA 3VOSA 2Y1DA 4JCOA 2F00A 3PTZA 4Q3DA 5T57A 5L53A 3F4LA 2P4QA 4E33A 4IJWA 1OOEA 3C85A 1U28A 3QVWA 3ZCXA 2NADA 4YA6A 4MVJH 3CTMA 3TOXA 5JC8A 4BO1A 3NJ8A 4ZHSA 1N92A 4CPDA 4CUKA 5JXWA 1BHSA 4CLXA 2W2KB 1J4AA 3L9WA 3TOZA 1UXGA 3H6KA 1ENZA 1W6UA 1ZK1A 4XX0A 2HO5A 4AG3A 2UAGA 3OM9A 5CAEA 4E13A 3C1OA 3UF0A 3L6DA 1Y6JA 5ITVA 2NU9A 1X7HA 3OJLA 3JD4A 2YUTA 4E32A 2BH9A 3AY6A 4J2OA 3KV3O 3AOGA 5I7FA 3WJ7A 4UUOA 1NFQA 5L4SA 4FPXA 2WM3A 4E5KA 1N7GA 3DAGA 3QA9A 3AW9A 5KVQA 4OYRA 1UXIA 1LRJA 3BZUA 3UKOA 2JD1A 3G1TA 1QR6A 3IAHA 4J4BA 4B3HA 1IE3A 3M2TA 3RVDA 1ZUD1 5B37A 4BB5A 1PJ3A 2CVZA 4FJ0A 1FJHA 2OOSA 1U8XX 2EIHA 5A03A 5H81A 3ZU2A 2GO1A 4NZ9A 4BNHA 4YJHA 4CM1A 1EVYA 1QKIA 2AHRA 2X1HA 3IC5A 3HDJA 3ZN2A 4PN3A 1ZW1A 2JAHA 1X13A 3LU1A 3E18A 3ASVA 5DF1A 2J8ZA 1HDZA 4MO2A 5HA5A 4BMSA 2DFVA 1JA9A 4INAA 3WFIA 5G4KB 2R2GA 4RVFA 4QFDA 4B7CA 2VZ8A 1E1KA 3LT1A 2H1SA 3KOUA 3NV9A 1F12A 1LDGA 4CR8A 1F14A 1LDNA 2FZWA 4HXYA 4W9NC 3D64A 5G4KA 4J91A 4YT2A 5A1TA 1R6DA 1PWXA 4RVGA 3KLMX 3PZBA 3PPIA 2XXBA 1Z45A 5A5EA 3NX4A 3QV1A 1HDXA 3ICCA 5JO9A 3GG9A 3JV7A 1YB1A 3I4CA 3C7DB 3UVEA 4FOOA 5I9MA 3NDJA 2YFQA 4PVCA 4NK4A 1PJCA 4YAIA 4FDAA 4HNGA 3E82A 1BMDA 4UULA 1PZGA 4OXNA 1K2WA 4ALMA 5JNLA 4D42A 4HY3A 1PJBA 1VSVA 3CMCO 1DIRA 4BNFA 4BGUA 2R00A 4NHEA 2I66A 1RYEA 3KEOA 4ZA2A 1M66A 2ET6A 1FF9A 2VWPA 3PIDA 2NU8A 3I5MA 4R51A 2HK8A 5BSEA 2ZYAA 4RZHA 2UUPA 3KYDB 4W6ZA 5TT0A 1RJWA 3GAFA 3VH2A 1H2HA 3ZNQA 1AHHA 4YAKA 4OH1A 5JPIA 3I6IA 1YONA 2W8ZA 5ES3A 4BV8A 4E2ZA 3KB6A 1HT0A 4JJIA 2Y1FA 3M1AA 3IKTA 4WCFB 1BSVA 1U8FO 1KYQA 2J3IA 4L76A 1U3VA 3E9NA 4NQZA 3JD3A 3WGTA 2WD7A 1OMOA 1W8DA 5CHEA 4PGFA 3DBHA 4NBVA 3IUPA 4LMRA 3UGKA 4TVOA 4BKOA 3JQEA 2O7SA 4TRNA 4JN6B 1LI4A 2O7QA 1QYXA 3WSWA 5EQFA 3GZNA 3JQDA 1QV6A 1ISHA 3GOHA 2Y0DA 1PJ4A 3GRPA 3V1UA 1V9LA 4CMIA 1GEGA 2IEBA 4M86A 2PGJA 3ZWWA 1TT7A 1P31A 4IUYA 3LYLA 3KHUA 3R3JA 5ER9A 2OXIA 1J49A 1TVEA 1E6UA 5JCJD 3FPCA 4DC0A 1BW9B 3DZBA 4GKVA 4J0EA 3BHJA 4XGIA 3QWAA 2ZB8A 1C1DA 4BNUA 1P1FA 3PP8A 4XB2A 1VLLA 2CY0A 4MVJA 4CUZA 3WGQA 4OOFA 4PLZA 5TC4A 2DPHA 4M87A 4L4XA 4GKBA 2BRUA 4TRRA 1YO6A 5G0UA 3PLNA 3NJ4A 3DL2A 2CFCA 4E5YA 3ON5A 2IYPA 3F1KA 1DC3A 1DRWA 3BIOA 1Y9EA 1BDMA 3O4RA 1Q0QA 3ZU4A 1MLDA 4RPLA 4CLHA 1CERA 4IJVA 4BNGA 1GQQA 1ZK2A 4N5NA 4Q3BA 4QEDA 3STHA 1C0PA 5U1PA 4HV4A 1ZK4A 1GCOA 3A1NA 2AMFA 3MWEB 3S2EA 1MB4A 5AVOA 4BO6A 1Y9AA 1LSSA 1U2DA 1UAGA 3OQBA 4OJNA 4JP2A 3OMLA 4DIFA 1VJ0A 4KDFA 1CDOA 3HG7A 2GASA 1GUFA 2W2LA 3EW7A 4RGBA 3PHGA 2UYYA 3JQ8B 3ZDFA 4KQXA 4IDAA 4CM4B 1GU7A 5KJFA 2QQ5A 5KOIA 3W8FA 5DCYA 3LVFO 1PIWA 1PX0A 1ZMTA 2FY8A 3EZYA 3D3EA 2Q4EA 2VN8A 4OXYA 4CM4A 3EC7A 2DPGA 2GN6A 1XHLA 1XWFA 1F06A 3U49A 1I33A 4TZTA 2A9FA 3IJRA 5JS6A 2Z5LA 2ZCUA 1HDOA 1YGYA 1IY8A 1SEVA 3VPXA 1EFKA 1X7GA 4J2HA 4E2YA 2G1UA 3JD2A 3COSA 3QRWA 8LDHA 4YT5A 2GN4A 5DP2A 3WOHA 4YRBA 1SAYA 2GZ1A 4K26A 4W7IA 1FDUA 3ZWBA 1ISFA 3DR3A 3OJEA 1B26A 1R0LA 1Q2XA 3TZQA 3GT0A 1JVBA 2YHIB 5K9ZA 3WNQA 1TLTA 1A71A 1U5CA 2IZ1A 2OUIA 3GGGA 5JDIC 1CJCA 1EK6A 1C3VA 3EUWA 3E5MA 2BLLA 1EDOA 3GUYA 3R3SA 4XGKA 1G0OA 3PFFA 3I9OA 4FC6A 4AJJA 4JJFA 1E3IA 3BHIA 3OJOA 3FSRA 3HHPA 5K0ZA 1H6AA 1ZK3A 3PZRA 2CSUA 3HN7A 4DPKA 3T7EA 4L73A 2E49A 4ZU3A 1M67A 3RFVA 4O59O 2WYUA 4BNNA 1ENPA 4QXMA 5DOZA 3I9LA 3ZH2A 1H6BA 1CQJA 2O2YA 3HDHA 1V8BA 2VWGA 4RORA 4CQMA 2VCYA 4XQGA 4OSPA 4Z3KA 5CEEA 1KEWA 1ZEJA 5G0SA 2AE2A 4F46A 5JY6A 2XPCA 1SPXA 1ENYA 3ETDA 4DREA 5ENVA 4L9RA 5JLAA 4C4OA 5KJCA 2Q1UA 4G5HA 3I83A 3GY0A 1KVTA 1YB4A 1SB9A 2VRCD 4U5QA 5KWEA 4BL5A 3M1LA 3JSAA 3GR6A 3U4IA 3TFQA 1XLTA 4Z9XA 1B3RA 3OICA 5CEJA 1E5QA 1VPDA 3DOOA 1ZIDA 3AY7A 1CETA 2Q50A 1GFSA 3FTPA 2GPTA 7MDHA 1DO8A 5KVCA 1PS9A 1UH5A 2BMAA 3QWFA 2FR0A 4E30A 1GDHA 3GNTA 1JU9A 1VE9A 5ADHA 4G2NA 2DC1A 5GZ3A 4RPKA 4XWYA 3GNQA 1HLPA 1CQIA 5JCJA 3TN7A 3JQCA 4JJGA 4MVJF 1DRUA 1UP6A 3GN2A 4KUEA 4E2XA 1HE3A 3M2PA 3Q11A 3RUDA 1Y1PA 3OH8A 2I65A 4FFLA 3AOEA 5TQVA 4YQYA 1N2SA 1YBAA 4FBGA 1XCBA 5DOVA 1ZSVA 2Y93A 2O48X 3JD1A 4HP8A 3P2OA 4IJKA 2HCTA 5JDIA 4K9DA 4QECA 3ANMA 3WXBA 3U3XA 3RUAA 2X5OA 3S2FA 5A3JA 3VTZA 4KQWA 5K6AC 1B16A 5T73A 1EFLA 2JCVA 2AQ8A 1PQPA 1GYQA 3C1AA 2Y1EA 5IDXA 4KWIA 2YHUA 3ZV3A 1E7WA 1EBFA 1KEVA 3T7CA 1GZ6A 1K89A 4TRMA 4WGGA 3PJFA 4D44A 1XU7A 4U6QA 3B6ZA 3V8BA 1X7DA 5F1PA 2GZ2A 1O89A 3EK2A 1FDTA 1EVZA 2PH3A 1GZ3A 1F0YA 4K6CA 1U4OA 3CSDA 2D5CA 2GRAA 1TEHA 2JD2A 3OJFA 2YDXA 5HTOA 2JFHA 3PWSA 2OHXA 5FYDA 4CMJA 1R0KA 2NTJA 2EG9A 4XRGA 3RUIA 4D3SA 1H94A 4GX1A 3HNPA 4I8XA 3NAQA 4FJ2A 3P19A 1GUZA 5COBA 1E6EA 3WLFA 4WLOA 1NTOA 3DZFA 3EHEA 4BO5A 1HDYA 3KYDA 1KETA 4JX8A 1Y8QA 4BV9A 3GMSA 1GZ4A 2X7HA 3WYCA 3ZU3A 4E31A 1HDRA 4HNHA 3TRIA 4D41A 4XYBA 1NQOA 4R9RA 4I9UA 1UDAA 4TMFA 1B14A 4GI2A 3W4JA 1D1TA 3PXXA 3D5QA 3ONEA 1OBFO 3CXRA 3ZZNA 1MX3A 3AFNA 3O8QA 2JKVA 4LVUA 1XEAA 1E3SA 4M8SA 3I9JA 5TGDA 1DJNA 2HK9A 3R0IA 5MGBA
chains in the Genus database with same CATH superfamily
3K6RA 2VFAA 3EUAA 2Z6VA 4ENPA 2ZIVB 4DCPA 4EO7A 1HBJA 2B1IA 4QU9A 9MHTA 2I4RA 5B6JA 3HCCA 2EHJA 2P75A 4BV2A 3CRQA 4DTIA 5I7VA 2NGRA 4RVDA 3HXOA 1G5IA 1XZLA 2BZ1A 2ZSBA 3GC6A 3K5PA 4O5OA 2P65A 3BSSA 4ZVTA 2OMKA 3O1IC 1E5LA 3KVNA 2Z8XA 3BIWA 2OV1A 3HN2A 3OC0A 2HGSA 2R4TA 4ZOQI 1SIOA 1TCUA 1DXQA 3R5XA 4LSZA 3WR5A 2B8NA 5C9ZA 5JRZA 1T3HA 3MWYW 1PWEA 4KVGA 4LMAA 4Q9HA 3S1LA 3SJCA 5LFAA 1JIKA 4GM1A 4TYPA 2O50A 5K20A 4A6PA 1KO4A 1IDN1 2O0HA 3DDUA 4D6YA 1RJFA 1RR6A 1CEXA 1VFNA 2YOHA 5JAIA 3QXJA 5BSKA 1I7DA 2PGOA 2N46A 1TA0A 3RPEA 2LNDA 3BB3A 3VYVA 2Q9AA 2Y4OA 1PFUA 3EXHB 4HDRB 3WGIA 1REQB 3MJCA 4B32A 4H1WA 4V1CI 3E61A 5CA0B 1MTZA 3U3DA 1K1EA 4YDHB 2ZWMA 1J6UA 4L0MA 4J7XA 2RHBA 2XB4A 3ZHZA 5J4HA 4NZNA 2EQ5A 4X0EA 1WKCA 2OP0A 3I2GA 4E4YA 2NN3C 3FTNA 4KXUA 3HRHA 4N3AA 3U62A 1I3MA 2EGHA 5I5GA 3ZVRA 5K8VA 1XI2A 2YWDA 3GFQA 1KNQA 4Q0MA 3EY9A 5C4IA 4MIEA 3M6WA 4IM7A 3WQRA 3ET5A 4FYWA 2C77A 4BFCA 1CRWG 1VECA 3UMMA 1YHYA 3PU6A 3ZTYA 5A9RA 2X42A 3IBTA 1JTEA 4M1ZA 4HXGA 4RA6A 4RMGA 3LCRA 1R9NA 3VHRA 4DCMA 1RFGE 1YR2A 1M2FA 4URYR 2PT5A 1NF9A 4CW7A 5LQSA 1OXXK 4I19A 4ECAA 4I9FA 1E92A 2I7VA 5FNVF 4XR4A 3WL4A 1TZJA 5IUJC 4KR7A 3PJGA 4FQ5A 4CIAA 2FUEA 5JZBA 4D0SA 2VJPA 1ZH6A 4PHCA 3G89A 3IIJA 4J43A 4JEUA 2A9RA 2OZLB 3AF5A 4MV8A 2HLHA 2LPMA 4X84A 5CK4A 5FV7A 4DA7A 5LQRA 1PNRA 2ENUA 4RNCA 2XQVA 3GFFA 2P2SA 5BNTA 1SVKA 5C32A 3LTNC 3JQBA 1ADFA 4P33A 5AJHA 1ZX1A 1OFUA 5CR9A 1QZUA 4D9IA 1VE7A 5SZJA 1R2QA 1YOBA 4EG6A 1DSSG 5A3RA 2BWJA 5K6AA 4ARUA 3GEDA 4KMMA 1L7EA 4JBHA 1DXYA 1J5EB 2XGMA 2C9MA 3BMOB 1WB4A 3NHWA 3O8LA 4BASA 4BNVA 4YEDA 5AVWA 3E3MA 4R9SA 1N9GA 3H97A 5E2BA 3LK7A 1Z17A 5A7HA 5H70A 4ZT6A 5JROA 1EJ0A 3O82A 3GWZA 4P34A 2UUOA 5IM5A 4CKXA 4GC5A 1SVOA 4JQCA 3IE1A 2FEWB 2JJ1D 1QPGA 2GD0A 2DUUA 2NT3A 4M89A 4NU6A 1GPDG 1JH8A 4PHTA 5ADWA 3QEKA 1S1MA 5FTNA 3GT4A 2HHJA 3SQWA 1YF3A 2BKAA 3EZLA 1ZU4A 3OIFA 2P8JA 3GD5A 3QFTA 1YI0A 4KLCA 3TQSA 3WKAA 4NCHA 1NAHA 4R2JA 2Y71A 2NU7A 1R6BX 3I9MA 2X0DA 1KWKA 1MO6A 5C4GB 1IJEA 2ZULA 5D85A 3THSA 1RRGA 4I55B 3R5FA 1GQ2A 5FF9A 5AJVB 4PO3X 3T9DA 4BV3A 2Q6TA 4QFCA 5GGYA 2YVAA 5FI3A 1T9KA 1WQ1R 2Q3JA 3I45A 3NBXX 4JLJA 3U80A 2I6XA 5I01A 3MPUA 4EVRA 2HQOA 1GG9A 1X80A 4Y1FA 5DT9A 5T8KA 1B8NA 2BELA 5BWNA 2ZRBA 2JK0A 2W2NA 4H6PA 1VIAA 3NIGB 4IIJF 4UCQA 3QLVA 5FUBA 3E3NA 3FVRA 4EFDA 2B99A 2GPNA 4JLNA 2GXAA 3HKCA 2F43B 4AS3A 2TECE 4X44A 2IUUA 1B2LA 2QTHA 5DV9A 4BO8A 1O95A 1ZH0A 1AUXA 2QA5A 4RHTA 1PU2A 2JJ2A 2ODWA 1P2SA 2G08A 4FZ5A 2R68A 4ZQGA 5AI6A 3FI9A 3NXSA 4FUTA 2QHXA 5CIWA 2W2TA 2WI8A 4LFAB 4XLLA 3C3AA 2FPGA 5MHTA 1B42A 3VBCA 2ZE7A 4V0ME 2JGDA 3VBEA 3ESDA 4YDSA 4TTSA 1P7PA 4BZPA 2DHQA 2C5LA 2Y1LA 5P21A 1FYVA 1U3WA 4DJDC 5AJUA 3FHJA 2C1ZA 3DULA 4GLOA 2F6RA 4KX5A 1VHWA 4MV4A 3BE8A 5ECDA 3SS8A 1IXYA 4A0QA 2HPVA 3D9QX 2EDAA 3OOEA 1ZUHA 1YULA 5DSTA 4QVIA 1OA1A 4URWR 1DCMA 1RRFA 5EZ5A 3W9UA 4ANFA 4MQEA 2H1HA 3F4BA 4FFSA 5DP1A 1W73A 4Z51A 5F2EA 1ZJYA 3BMOA 4W5QA 2QE6A 3FUUA 3VPDA 1VCHA 3EODA 1KI6B 3OE7D 3VHLB 1GN9A 1PSWA 2BFOA 2FLVA 3Q9NA 3JWPA 1E99A 1XVIA 3W5VA 1KEPA 3JQBC 3MGKA 4DG8A 2PXXA 1OGYA 4HFMA 4YRLA 1J5PA 1F5SA 2YY7A 3TNJA 1A4RA 2J0SA 5FWXA 1FXSA 4BMPB 3NBZC 1XU4A 1KBQA 3LDFA 4AMYA 4EITA 1E0DA 1CULC 2CLCX 5JSHA 2B2XA 4I66A 2J5KA 3OAAD 2I3BA 3GCZA 4MUNA 4D4MA 4EYGA 1NNUA 2PUTA 2JFVA 4ZCSA 4DEVA 3E4CA 5ES4B 4BIMA 3OX1A 3LUPA 2JDIA 1A7AA 2RGCA 4F5WA 1XYVA 2HWYA 3PC6A 5E1MA 1BZYA 2I5PO 3RYFB 1IL0A 2H1FA 3C4VA 1Z7WA 5D3QA 3EA5A 3KKEA 4QICA 2OZLA 2XWQA 2D3WA 1CE8A 1TCBA 2WWVD 2FJPA 1J9ZA 3QVXA 1C7IA 3F6RA 3MWFA 5K4HA 3FLEA 1X19A 4NCBA 4B8YA 2H1RA 4IQFA 2YXPX 4C14A 3O74A 4V2IA 5KTNA 3OVMA 1QHIA 4PO8A 4KPYA 4LWOA 3WLSA 2A1TS 1M2EA 2YQ4A 4YAOA 3C41J 2PLFA 4JR1A 5JBNA 1K63A 4N5LA 3PWZA 3WLNA 1VBKA 2EBFX 3BKWA 2C84A 3RYIA 4QG3A 4BX8A 5HCNA 2HDHA 2IZ0A 2B6HA 2B1GA 1E3EA 1I7CB 1KDPA 1X0XA 5HFNA 2OCBA 4US2R 4YR9A 1LI5A 4QOGA 1MR3F 2BE7A 3F5SA 1MGOA 3RIEA 3BIFA 4DA9A 4CM8B 5TIIA 2XKJE 4CR6A 3ZHQA 1VG9B 2YV2A 3QTLA 1DEHA 1RHUA 1NBHA 1I5EA 2VRWA 3TD2A 1DBVO 5KYYA 1G38A 2R7AA 3LQYA 4DSTA 3GRCA 4BLTA 2J85A 2KYRA 1O58A 3GJZA 1QS0A 3QSGA 3U0VA 1ISRA 3HCEA 1FMFA 1PJZA 4OGFA 3KFVA 1BN7A 4UDYX 4AJ9A 2Y1KA 1GUAA 3EXHA 1V0JA 2IHVA 3DONA 3OIGA 3CX3A 3Q0IA 3QP9A 1QOZA 3CO5A 1YV9A 2W42A 1GTSA 1B6TA 3FR7A 4MV6A 4EQZA 1C7FA 1TI7A 1BG6A 3NBMA 4QXAA 1TJ4A 1U8ZA 4WCFC 1J2YA 1ORWA 5GM2A 1KY5A 4B1FA 4NMXB 1HZZC 5FHRA 1JDJA 3E2IA 3UM9A 4M8IA 3PC7A 3RAPR 3UT0A 5CFZA 3ERCA 2IYAA 1CUFA 1YZQA 4N39A 3EBPA 3ZQ4A 1KVSA 1P33A 1STOA 4K28A 4D5EA 3KC2A 2OBLA 3DMTC 4L8VA 1SBZA 2YZ7A 3C6QA 3GIDA 4IZIA 5AKHA 2ZETA 3W7BA 2QUKA 3UOAB 5SYMA 3IH5A 4AAYA 1LNQA 2DBZA 3H7IA 5LNK1 4QREA 3B1WA 3DAYA 1TB4A 2J5XA 3H8VA 1E1CA 3N86A 4YMWA 4QUKA 5AVVA 4KITB 4EMUA 2C31A 1E6CA 3MS2A 2WIDA 2E85A 4LY0A 3B6JA 1A9XA 1QO9A 2ZBRA 5BV1A 1RAEA 2HB6A 1AGYA 4XARA 5F64A 5LUBA 1A88A 3LZDA 2X2OA 3HSYA 4IDCA 5ADVA 2B7BA 1BAPA 4EA7A 2UUAB 1GAEO 4ZQEA 4P31A 2Q41A 4JA0A 3V00A 2KLHA 1BE0A 3CVWA 1NLZA 2I2AA 5BW6B 2OA0A 4ZHQF 4PYLA 1D7OA 2X7JA 2QDXA 1JAYA 4L7VA 2CHUA 4A2QA 3C6ZA 2VC2B 4KK3A 3UAZA 4P81A 1VIDA 2AW3A 4AKEA 3PK0A 1P1HA 1BKDR 1T3SA 2QM7A 4GR5A 4KXFB 3K6JA 2CXNA 3ZJTA 4G01B 4BRWA 3HDYA 1VKOA 1R6VA 4LRWA 2FWBA 4NYIQ 3SC4A 3X2FA 3CH5A 2QRPA 4ZTBA 4E3WA 4LNHA 1R4NB 1SKQA 2ID4A 4HB3A 4IPTA 4JNCA 4F2HA 3BWYA 1ZXLA 3L3BA 1GYPA 2SCUA 3FDZB 3CUKA 1CY6A 1ZMRA 2FWPA 1NUQA 4LYAA 3DTYA 2QTRA 3N87A 2BFFA 4AVYA 1Q7EA 2ZJ1A 5KZMB 1RBZA 5FOWA 4DLVA 1H2RS 3PWKA 5HFAA 3UYLA 2H1VA 3KAQA 4V0MA 1NRIA 1N0WA 2AGVA 2QLMA 1KFBB 1UBHS 1WPXA 4H3SA 4UHFA 4CKWB 1EESA 1SWVA 1FQKA 2J33A 2ZBEA 3D4OA 3PQ5A 2DX7A 3WX0A 1M1UA 3KFLA 3RODA 4ZMRA 1YJAA 5JSUA 3T5DA 1L5HA 4S1WA 4OMCA 1TRKA 2PBFA 1ABFA 3O8QB 4LQDA 3TLXA 5DM60 1HG0A 1G7RA 4BQEA 4KFSA 5F7XA 3EEYA 4TYWA 4GE3A 4KO2S 5JSZA 2AUNA 3QE0A 4LOHA 5DK4A 1XZ8A 4KTTE 1F8FA 2ZWPA 2VNAA 4BX3A 1C7JA 5J4YA 1E9CA 5KYKA 2Z2JA 1SCBA 1NN5A 5K0LA 2FW7A 5JUWA 1GAJA 4DGSA 4ZDWA 1RM4A 3L6OO 1D4AA 3R09A 3ECAA 2PUCA 1WDTA 2NU6A 1FS5A 3R5HA 1RI4A 3GLQA 3VR5A 5HZGA 1Z75A 1C0LA 1W25A 4YCAA 1DDOA 3HDQA 2IFTA 2VTKA 3IQIX 2VSOA 1UDXA 3PUZA 2IPNA 2NYAA 2BF4A 2HO4A 4DR2B 1ZN2A 2O1WA 3ZGNA 4YMTA 1KFJB 1W52X 2IHJA 2LKDA 3OZTA 1T5BA 4U2CA 1UKZA 1IMOA 4WZBA 2VDWB 2XDWA 5BN3B 1CJVC 1A9YA 4U1RA 5WRFA 2Z2YA 2UDPA 3Q7SA 2ZYDA 2QXYA 4TTTS 1PLLA 3AKEA 3RYHA 3ADCA 2O7RA 2GAOA 1XD2A 2GERA 2FEPA 3RTGA 1OSNA 4YRFA 5BSHA 3C5WP 4LV6A 1SQGA 2QK4A 2TRSB 4MR7B 4YAWA 5AM1A 2RJ3A 5FBHA 4P22A 1BDIA 4QGSA 1FRNA 1G42A 1R66A 1XXHA 4X1IB 5BP7A 3ZNOA 3TIFA 3EA4A 3SC6A 4LSMA 2K7ZA 4ZI7A 5HF9A 4L4YA 4DFDA 1T6YA 1KQ3A 4Y8VA 1D04A 1R0SA 1Z47A 3AWIA 4XIGS 1R0YA 1VQ1A 3OZEA 3ZV6A 1TAHA 2VNIA 4BMVA 5DXAA 2XITA 3H5RA 4O4HB 4GP7A 4N7RA 2IIBA 4BX2A 4BC0A 5IXYA 3WZ2A 2P41A 3UH1A 1JXMA 2B1JA 4POAA 4RQAA 4Y2VA 1NPDA 2RHCA 3QVTA 4MSUA 1I2MA 1SUBA 2Q5OA 3JZMA 3ZQKA 1M8KA 1BA2A 2Q0QA 1RM3A 3IDOA 2QG9A 3OIWA 4Q9DA 3SS9X 4YRSA 3GDWA 3ZXXA 4EQ6B 1Y0BA 3IEXA 3RS5A 1H1DA 1VP9A 5G41A 3O8CA 4JHXA 4AJPA 4MVYA 5LQKA 2WB2A 5J40A 1H4SA 4YRJA 2WB4A 4ROTA 2OD2A 4PG8A 2FSIA 3WOVA 1VPWA 1W4LA 3QY0A 2XVAA 2ZYWX 4Z86A 1CRQA 3TTWA 1P75A 3GZJA 2XNKA 4DDUA 3HRKA 4AO6A 1EHCA 5IC6A 4F06A 3KXDA 5TEWA 4U3JB 1K8YB 4ZEVA 1KQGA 2CZGA 4EJMA 4IDBA 3VVMA 1QDLB 4Q00A 4OQYA 1UC4B 4C7KA 2O3TA 1K8RA 1EE9A 3JQAB 5IUNC 4DZRA 2UXBB 2ZYIA 4JIGA 3DB2A 1VJ1A 2P1ZA 2XTNA 1HH4A 1BE8A 1KI8A 1SC1A 1SCQA 3CSSA 1OBHA 3Q72A 5KKCA 2YICA 4O2AB 2NYRA 3FYHA 3EFHA 3KYCB 2GH1A 4IS3A 4M37A 3W2EA 1TYBE 3CB4A 3DO8A 3KTDA 4OXRA 3P0EA 3WDMA 4YALA 4HBGA 4AZ3A 3KPVA 1NQUA 3FCAA 1RLOA 4K9KA 3KVOA 4UE2A 3LZCA 2IKSA 1DGQA 5KHAA 2VA8A 2D2VA 1HF3A 2QTFA 4L16A 4LZZA 4ZAXA 1U11A 5FRDA 4TL8A 1IZ8A 3LVBA 3DC2A 1N2GA 4MGYR 2F64A 1EGQA 1NI5A 2JLCA 1Z5PA 1GU1A 1ZN8A 4KODA 2R62A 2G04A 3PRJA 5TMBA 2M6KA 2E7ZA 2I2XB 3DQZA 3DYVA 5G1PA 1XMVA 5TB5A 3O1LA 3B1JA 2QENA 1WXFA 2LXNA 3O0DA 3SHTA 2PUVA 4JJEA 2OC4A 4ZI7B 4R98A 5AQ1A 3SC3A 1FLAA 4E3ZA 1KO8A 3VPBA 4D8YA 1F4PA 1HO3A 2YWCA 3O95A 1OU4A 4UMDA 1PZNA 2NLOA 2VUTA 3EXHC 3R7WB 2YWXA 3ESRA 4TUYB 5F7ZA 3CG0A 2Z4SA 3KEFA 5FIUA 3T4UA 5ALIA 2C7QA 1QG0A 2ECQA 2VTDA 3COZA 4D4LA 4YUXA 1NLYA 3CY6A 4PQYA 2VTEA 1XDGA 4LWPA 2F90A 3U4DA 2HMUA 4M1SA 4WT7A 2ADFA 2IE0A 4FXOA 1DT5A 1PBNA 4GX2A 2ADMA 4MVJM 2VP0A 2FZ5A 3CV3A 1OIWA 3AO0B 3OLQA 3ZJVA 5ALRA 3SJZA 3Q9UA 1S8NA 3QUBA 1Q3HA 3GGJA 2JJ1A 5H3CA 2FE4A 4DB2A 3NB0A 1XZEA 2ZE5A 1KAGA 3QHAA 4HWKA 4D4JA 5JS7A 2IOQA 2UYCA 3JQAA 4NBUA 2EZUA 2XXJA 3URKA 3J81A 4HJRA 1U0NA 1N6OA 1AD2A 2C1XA 3FBTA 4M49A 4MULA 4EENA 1RCFA 3AY3A 1GXSB 1SY7A 1ADGA 2NZUG 2XUHA 1J06A 2IIVA 2OV6A 1UBGA 2PX0A 4DV5B 1E9DA 5B1HA 4QJ4A 1SFRA 4JBGA 4V0NA 3V4LA 5EJ2A 5JWOA 1DZ3A 1WM1A 4GKAA 2OP1A 1HOTA 1U7PA 4XIYA 3OX4A 1EJ6A 1IPFA 1ZAKA 3OFND 2K6GA 4RY2A 3BWXA 1MABA 2W0SA 3EQZA 1X1TA 4NPCA 5AM4A 1V5GA 1FTWA 1VGVA 3HV0A 3S8EA 2H1CA 1GITA 1H23A 3TQIA 3AZOA 5D51S 2AK3A 3Q2IA 1YS4A 1MQ9A 3R5KA 3L4KA 4JLKA 4HFJA 2QYSA 4JYAB 3WHIA 1G6KA 2OHJA 4BQRA 2AJCA 2E1RA 2G07A 1WS6A 2APJA 4A5SA 3QLVC 1G59A 1J0AA 1RIIA 3O9ZA 2PRIA 1QTRA 3EQ6A 3CINA 5HDBB 4MH0R 3PKZA 3ND7A 3QLEA 5E7IA 2J09A 2QUJA 1J7KA 1Z5VA 4X8LA 5SZKB 4DDVA 1JHDA 4ENVA 3WYEA 5KEIA 5ALXA 5G1NA 4L3VA 3GRKA 1GG5A 2ZRDA 2ID9A 3G0OA 1M6WA 4XB1A 1KEEB 1G20A 1M2WA 2RI6A 3FFWA 4XVHA 1IBLB 5BSVA 1PJ2A 3AESA 4MDYA 3CR7A 1ZLXA 4CQLB 4D9JA 1U2SA 3OEHA 3ZK8A 3MWEA 1EAMA 3PD0A 3IQFA 1O7JA 4HN2A 1SWWA 2PTGA 1F1BA 2VXOA 3DHEA 4YVFA 2OSBA 1IZ9A 2GPAA 5E6SB 4G4SP 5EEGA 1MC8A 3PFWO 3M6XA 4J0HA 4RZ2A 5KYWB 1W76A 1T6ZA 1OASA 3EXG2 1G3IA 5AHRA 4XEHA 4YYEA 1LPNA 1V8DA 3TVDA 2NYVA 2JAWA 1QHEA 3F6SA 3ETCA 4J29A 4JNKA 4NOLA 3UKDA 1JEYB 2J87A 3SGLA 2AI3A 3UJ6A 7ADHA 2PX8A 5BR8B 3VAAA 1N2EA 3Q3HA 2NAPA 1X39A 5HQTA 2QTAA 1MD9A 3QWIA 3L4EA 3SYKA 1GQSA 1DOZA 4I4TF 3X2EA 1P0FA 1Z2CA 2Z09A 2G1PA 2YXBA 2Q4BA 1NDHA 2OV3A 2G5CA 1DADA 1CUEA 4JLWA 1D4ZA 5CYFA 4ZC8A 3AYZB 2Q5QA 5JW6A 4GR9A 5D01A 3TIXB 5IULC 2ZRKA 3UOGA 2BONA 2X9QA 5C1PA 1I32A 3CBQA 1DBRA 1DT3A 1W0CA 1XKQA 2BFNA 1U2RA 4H7IA 2VAVA 5T3YA 3UUGA 1LPMA 4OCZA 3WHLA 3HEBA 1VPVA 2C7BA 3AK4A 2C7PA 3S2SA 1US8A 1LJLA 2EJTA 4HJXA 3OZFA 4PRKA 3ZLJA 3SKXA 2HPZA 4JWKA 3IIMA 2QWXA 3BZWA 3KEMA 4EHAA 1FRZA 2GXQA 1NNI1 2ZK7A 4YQZA 1OVGA 4ENSA 1N3BA 1TEVA 1L5SA 1XKXA 4H77A 1CJUC 2O57A 2FW9A 4OQPA 3FMGA 4YRGA 5HJ7A 4R2HA 3ZCTA 1RXEA 3DMTA 1NUHA 5KNBH 3R9WA 3GMDA 2QPTA 3UN1A 1Y5RA 3WA6A 3S55A 1JIUA 2XRYA 3Q6MA 1JQKA 3S1AB 5AI5A 3I58A 3C15C 4QLBA 2FOXA 1YDHA 4YCJA 2NOAA 3GLIE 1T34A 2R6DA 4O4HF 4YMIA 1PFGA 4N1AA 1NGSA 4M0MA 4Y2PA 4BEBA 2IGTA 4PFSA 1UL1X 3KJXA 3QU9A 1NI3A 3R3UA 1YAJA 1A5BB 4PRZA 4HS9A 1HDIA 1XMJA 5EZYF 2HT6A 5LZ7A 1PZHA 2ACWA 1QXSA 1Q95A 2JAUA 1Y3BE 3UMFA 1I3NA 1C4XA 1WHTB 1T6XA 2ISSD 2P9BA 3IKVA 4ZT3A 1IWOA 1N9KA 5JI3E 3EIHA 5C46F 5BT9A 4JT9A 5HX7A 2BZSA 2BDTA 1B3BA 5DT2A 4NJOA 4ZT7A 4FS8A 2HJ9A 4FE7A 1DPFA 1DUVG 3W90A 2UZ1A 1P60A 2ZRGA 4KLRA 4DEYA 4TVSA 4A36A 2MHCA 3BXPA 2PJRA 1SUDA 2LP4Y 4JUFA 2HJSA 3WRXC 1UDBA 2V7GA 3LT2A 2XYQA 4X92A 1UJBA 2HA7A 2AOTB 3OFVA 1NULA 3ABZA 1QGAA 1I4OA 1SBNE 1W35A 3OZCA 4FOSA 3VC2A 3GV0A 5EE0A 1HTBA 1KQPA 2CDCA 1NV8A 2ZUDA 4HDOB 3EA0A 3SYNA 1YAHA 4J3JA 3DMYA 5AD1A 3UHAA 2Z2ZA 1DX9A 3TIIA 3CVVA 2R6GA 5KSZA 3C3KA 1FX1A 1TM4E 3RD5A 4D98A 1YB5A 1SB8A 3PXAA 4KO4S 1KC1A 3FF4A 2J41A 3GUVA 4KLZA 4DRYA 1C30B 3ZE2B 1XRSB 3FNBA 3DWFA 4L72A 3SWWA 1IB6A 4FHGA 3NAMA 3QG5A 4DAEA 2W37A 5EIBC 4AMVA 3U81A 2FR1A 1MDFA 3HU5A 1LSOA 4WZAE 5LYYA 4MVJI 1Z7YA 4NIMA 1OX4A 5M6DA 1D8AA 1W36C 1CF4A 3D3KA 4QGFA 3KB2A 4I08A 4WOPA 1M76A 1YBHA 3PUWA 4RIEA 5LZ8A 2M6LA 3V32A 1DC8A 2PQMA 1XMXA 2HF2A 1V3VA 1JHOA 4BEWA 5HZMA 4KPGA 4K0KB 3VO1A 3GLUA 4J0QA 1KEUA 1QVAA 2BHLA 5DO9A 3QE2A 3SKYA 5F7OA 1Y37A 5E1DA 1L3CA 4XB6B 3DL4A 1UK9A 2X15A 1U8CB 1DHTA 3A6HA 4JB3A 3DDCA 4IIYA 5I7AA 5CLQA 3MGBA 1KDTA 2PIAA 4IDEA 1U2GA 3QPVA 1T24A 3NDPA 4M9RA 5F78A 1A9RA 3ZXYA 2PO7A 4CMIB 2W6JD 4WLNA 5IK2A 1WB9A 4Q1BA 3NIWA 2NVBA 4BNMA 1XZFA 3IERA 3M6LA 2Z6AA 2VHUA 4TXJA 2QYOA 2IW1A 5AW2A 4DS3A 4YHHB 4GPZA 4O4IA 3H1FA 5TE9A 4BY9E 4J94A 4LQLA 1O03A 4MW1A 1BCSA 1FP4A 3RRXA 1M2GA 3DDWA 3L0SA 4QLOA 1MH9A 5LQCA 4HZGA 1ULSA 4I50A 1P7CA 5EHNA 5K51A 1L8LA 1AKEA 2UV8A 1BMQA 4FILA 4AQ7A 3A1FA 4G24A 1CY0A 1U8TA 2J9GA 3CNQS 4WN9B 3HCRA 3TQQA 2HIAA 3ACDA 4LQCA 3VKVA 1XTIA 4EY8A 4H4DA 4UTXA 3VDNB 5A4IS 3P9RA 4IIVA 5AO9A 5C7IO 2EP5A 2IITA 2ZJOA 1ZA2A 1WXIA 5JVDB 2QAGA 2ZRFA 1MG5A 2VSFA 4CU5A 4U2EA 1GTJ1 1KJNA 3Q7PA 3DEJA 4XKJA 4ZODA 3V8NA 4B6SA 4B48A 2EW8A 1ECJA 4QYMA 3USZA 4C7MA 4RDXA 8ATCA 5K0FA 2QXTA 5DLPA 1IK6A 2QM3A 3JCZA 3PBKA 3N74A 4QYIB 5G02A 5BR4A 2ZIXB 1NHWA 4UUMA 4W8HA 3L8GA 2GQ0A 2OO5A 2D1YA 3CF4G 3BXXA 3IRVA 4YWHA 5CXQA 2ZS7A 3NDBB 1QORA 4RHXA 5B5SA 1TYDE 2QPOA 1USUA 5FBZA 3N28A 1M5RA 4RVHA 4Y2UA 2CLKB 3EXEA 2YYYA 1JJ7A 1DINA 2WICA 3CBGA 4I9NA 4KWEA 4LSWA 4FMBB 3B70A 4N3NA 4WECA 2QL5A 3K32A 1EVLA 1L4LA 2QMEA 2QTBA 1YJ8A 4MYSA 3NCHA 1JS1X 3RAEC 2JBWA 1H2FA 1C8VB 1T10A 4M1OA 4M54A 4X6YA 2C9CA 3KELA 4W9RA 4W7HA 1KQNA 5LQUA 1AMUA 4Z4GA 3T9AA 2G71A 1NE2A 2C2KA 1LD3A 4Z1OA 4FGSA 4LJAA 1SKBA 5LM3A 1II8A 2PLAA 4QQRA 1NMQA 5DBIA 4OK5A 2GZRA 1ORRA 4X97A 1DWOA 4CMGA 5B1YA 4WOKA 3UFXB 4Y2TA 5CIQA 3UW1A 4RDCA 3V4SA 2CL0X 4W5JA 4B6JA 3GK3A 5HBRA 2FMXA 2GBCA 2PYIA 4JXZA 1V5IA 2CLDX 2W6NA 3PEWA 1KQFA 2XDQA 4LTMA 3GJTA 4IIBA 4OAQA 1QAMA 4HX9A 4CTKA 5MGNA 1U28C 4CFSA 1E1QA 1VTKA 2ZSEA 3WNZA 4BVJA 2PWAA 2PFSA 5AKXA 4KBYA 1QYCA 3PQ8A 4Q16A 3PXCX 3RT9A 1GGEA 4YONB 2IXBA 3B7WA 4FDMA 5KX5B 4Q7KA 2CV1A 5THXA 3HXTA 3TBFA 1I3LA 2WQZA 1Q22A 3OF5A 4NAUA 3K0AB 3BGDA 1UC9A 1FFEA 2LTAA 3SPXA 2HKIA 1R6UA 3IBSA 4P9NA 2ADOA 5AP9A 1JW9B 5T8KC 4DBVO 4AL4A 4DIOA 2CUKA 3I39X 4EARA 4RTRA 3P9KA 4EY6A 2WKSA 2QN1A 2OXRA 5SV2A 1J39A 3MN1A 1YVEI 1WD7A 3RYCB 4FB4A 4HUJA 1RVDA 3NV7A 3B85A 1LLQA 2LWIA 2WM9B 4NYMR 5JXGA 5HKOA 1XLVA 1UYJA 1FU7A 1NM5C 2EERA 1Y34E 1ZI6A 1V1RB 3A25A 1ZNQO 5GGXA 4NG4A 4CMBA 2FX3A 2DMRA 5J9GA 3OOJA 3NTRA 3WDLA 2Z95A 2NG1A 3IQDB 4XPZA 9LDTA 3DAPA 1ZWLA 2C29D 2PUHA 5JS8A 4FC7A 3T4EA 2HDOA 3VMMA 2X8BA 3MOIA 2OB2A 4I1OA 4INOA 3DLCA 1ZDMA 1ZU5A 3BXZA 3WBJA 2M1XA 4HGNA 4M60A 3BTOA 3VO2A 4BB9A 2O8CA 1F51E 1Q1NA 3N0VA 3O2SB 4M0EA 1B93A 3L0ZA 1Y81A 3QIAA 1II8B 5IYZF 4LRUA 4IHKA 1AXRA 3RTEA 3QQPA 3L0DA 3GBVA 4K6MA 1DDGA 4PZAA 3VNQA 3RBVA 2PK3A 5L40A 1N2CA 3D7MA 2YJZA 3W4IA 4A2PA 5T7BA 2I78A 5EJGA 1RXWA 4PLYA 3VDQA 2QIPA 3TW3A 1SUCA 4LIPD 1Y1KE 4CIBA 2BFDA 2R65A 1Q74A 2DHCA 5HFJA 5IFLA 2REQB 4V0OA 1UXHA 1NJSA 2XCQA 2IYLD 2CFTA 2JHFA 3ZWXA 4CZ2A 2A9OA 5IVHA 1SELA 1VJDA 4UTRA 2GNAA 4MVJG 3QE3A 2G1JA 3EGXA 2VAPA 3DE3X 4YJ3F 3CRNA 2IYZA 2BGUA 5EXTA 1CUUA 3MSCA 1WUJS 4PHHA 4AN4A 4EF6A 9ABPA 3S81A 4DARA 1CYEA 5H7XA 1ZUWA 2O07A 5D7NA 4Q4AA 1V8PA 4G37A 1XPUA 2H17A 4B74A 1JB9A 5KNCD 2CWDA 1RZ3A 3HFJA 3N05A 3DMDA 5FOXA 4V1CB 1DUSA 2F8MA 1G2OA 4KYUA 3MMPA 4Q3AA 4WWHA 3PXBA 2P9GA 2IEDA 2HOQA 1UDCA 3URMA 1W34A 3U61B 1O6BA 1CS0A 1SKUA 2ZLBA 4CDMA 5I48A 3GVIA 4C04A 1GZ7A 1EXDA 2FEMA 4PR0A 2OHFA 4YJ3A 2RAUA 3D1VA 4LYYA 3MCVA 4EJFA 1HZJA 4Y9SA 3D8SA 3ETHA 3FPEA 2M32A 1X1CA 2ZTUA 4RKYA 2PX4A 4LHZA 3WV4A 1Y3HA 4TMTA 1NVEA 2G9VA 2IYQA 1KRXA 1BU8A 1V26A 1E9EA 4BE7B 4L4UA 3CNHA 2A94A 2ZS8A 1OKKD 3OZSA 3AY0A 2FETA 1YZLA 3G88A 1ZRNA 4DLBA 3T1HB 3P4XA 3QU2A 4PY2A 2QJWA 2OAGA 4XTCS 1JIXA 1Z62A 3V5NA 3FPFA 4EHLA 3L7LA 1OT3A 1M73E 3O7WA 4E12A 3ZVNA 4CHGA 1UK6A 1GPWB 1HGXA 4RZ3A 1R10A 2XQIA 1E7MA 5K8CA 1L1FA 4F2WA 4EVQA 1M34A 3PQDA 4IIJB 5G0VA 4BZWA 6NULA 3JYOA 4WOCA 3A6LA 4E03A 1PW5A 4YP7A 2JIMA 2RHRA 4PNZA 4X95A 1QRDA 1P17A 3G0HA 2N0SA 5FI0B 1OXKB 4TZKA 4KGDA 3S2IA 1IM5A 1L5QA 2QAIA 3K1JA 2CJXA 2MMCA 2YWHA 4AW9A 1U0SY 3K9CA 4U7WA 1G8MA 5DHQA 3R4CA 5D2CA 3P32A 4ZQBA 1E32A 1QCDA 4HQ6A 2GZDA 4U2FA 4GL2A 4PLHA 1N6PA 1SNYA 1E4OA 5D1HA 3HBMA 1Z07A 3K09C 4QEZA 3VGPA 3C97A 1F4VA 1KPHA 5M3BA 4CV3A 4MI3A 3CLVA 5JO0A 3CF0A 2BVNA 2QIOA 3H5WA 3AUAA 2R1TA 2UXDB 2RH4A 5IKPA 3IUEA 1JSLA 2ZYGA 3AXTA 3MC1A 4EGFA 2OCGA 1QYIA 3NPAA 1IVYA 4MPPA 4XVUA 4FKBA 3SN6A 2Q3EA 5SY4A 4FHEA 3HUEA 3KJFA 1TA4A 1I4TD 3UK6A 1AQNA 4DJTA 4HN4B 3FTCA 1Z3IX 1SKYE 1XQ9A 1U98A 2O4UX 3K05A 4LBVA 4TWRA 1P2FA 4KO8A 5TJHA 4DQDA 4DA4A 1VDZA 2WVGA 2PMDA 3VZDA 1ULAA 5B3LA 2DT8A 4AJ1A 3ND8A 3PEFA 4PLWA 3HDTA 2XYHA 1VMKA 4ZVKA 2I91A 1VSUA 4DIKA 3IEVA 3C3WA 1UZUA 3A6EA 2KWIA 3E23A 4MV3A 4OUDA 4GOOD 2YWGA 2OVBA 5JYBA 3H4TA 1RC8A 4Q6BA 1A2OA 5ICMA 1VC2A 1WMEA 3TLGA 4ZZ3A 5A7FA 5DSXA 1E94E 3UQZA 1CUGA 2B78A 3PD7A 1KR2A 1GPNA 2X3UA 1G5FA 2X5KO 1BQEA 1FP2A 1ZVMA 4PCAA 4QXOA 5FLEX 3AR4A 1JG1A 3TQOA 4MIOA 3LDGA 3W6OA 4RL6A 2IS6A 3UCXA 1SVWA 2FSGA 3OQVA 3TL2A 1XAIA 4EECA 5KYUB 3CO0S 4DQXA 1PUJA 4OYLA 1ODLA 4IDGA 4BC1A 2ZREA 5C5DA 2DY0A 2J4CA 3NT5A 4J6EA 1QS0B 3IA2A 3MLEA 1CU1A 3BMQA 2O2XA 4JH0A 5CW1A 3OZUA 1VSTA 3ORQA 4WFJA 5CT8A 2P2DA 5ALWA 1ZN9A 2PBLA 1DEKA 3MGAA 5EA2A 3GIWA 2XF2A 4P4GA 4FQ8A 4TLCA 4PZPA 4G65A 1IAVA 4MQFB 5EHGA 4L9SA 5EXXA 3INTA 2IPXA 1U0TA 1P80A 4XX1A 2F17A 1YJBA 2BKLA 3D8RA 3L4BA 4QUJA 3CUYA 3RJZA 4RMIA 3I1YA 3FCEA 3LW8A 1XG5A 1GDDA 1O3YA 1RXIA 2G40A 1G55A 4OOEA 1O57A 1SKYB 5EJIA 2ZR8A 2GN1A 5AWFC 1UK7A 3CHYA 3PNQA 3HVJA 1K6JA 5U9CA 3I72A 4AN0A 4QNRA 3HB4X 4YJGA 1P5RA 2A4KA 1YXMA 3NTXA 2RHMA 2P9YA 3GPBA 1KOLA 3DKIA 3LE8A 4FFNA 1ZUIA 5F2NA 5AK4A 2QT9A 3GEMA 4LRSB 2PH5A 1CE8B 1FFHA 4QXRA 3KRTA 1U65A 4QJ3A 3Q3JB 4WEQA 5IEJA 1OC4A 4G5SA 1KI7A 3C48A 3D4BA 4LX8A 2VYVA 3Q0TA 2OQVA 2PZKA 5DJ5A 3LDHA 5KC8A 4DKJA 3AUTA 1UJ2A 2JCYA 5TGZA 1LB1B 4BQSA 1U0BB 4AJLA 4YRDA 1HYGA 5AXAA 1HLGA 2QJFA 1PL8A 4J9UE 3VYSB 5AXBA 1Z6XA 1Z6PA 4TWAA 4I9HA 1XZGA 1MRZA 2Y05A 1DQZA 3IIEA 3QX8A 1Z83A 2YHSA 1TMOA 4D96A 2BEWA 4FYMA 4UAUA 3TECE 1X14A 1YB2A 4G8DA 4D79A 4EKIA 2PG3A 2NT4A 4OYYA 3RRYA 1AKQA 4F84A 1S2LA 4KIJA 4MI1A 1HE4A 2IQIA 2OK8A 2QVLA 3LV8A 5K3BA 4OHZA 4LDJA 1Y6FA 3HWX1 3ZGXA 4N3BA 4E07A 3EMDA 5L6LB 2ECFA 5KYXB 3WGVA 1YIOA 1Z26A 3MINB 1LWOA 5AKIA 3F1LA 2GBIA 1H2BA 4Q7MB 4R84A 1LDEA 2HSZA 4UQOA 4BNYA 3FNRA 3GEIA 4EW6A 2DPYA 3V46A 1CR6A 2TMYA 4RZIA 2QVZX 2JLBA 3G2PA 3OPYA 3EAGA 1JR2A 1AA6A 4ONEA 2GTPA 2H07A 3JVDA 2YVUA 4ZRMA 3C43A 2GEBA 4A16A 4B43A 2AXQA 5FWNA 3TRKA 1I5RA 1XNGA 1VG8A 5G2OA 4KZKA 1MQ8B 2IU6A 4KSBA 2P9EA 5FQNA 4Y6OA 3SX2A 1N2XA 3VC3A 4CCSA 4UEKA 1AVTA 4LYJA 2XQKA 4AIIA 3CLSD 3P0RA 3B13B 2WC1A 1A76A 1KP2A 1NA5A 1VOTA 3O84A 4N5MA 1WSDA 4P35A 3WGHA 1RQRA 2D5LA 2RHGB 2VZEA 4DJEC 1CIPA 1ML3A 1THGA 4YJDA 5LD2B 4AURA 1Y3FE 2G0TA 1YZVA 2J3EA 4Y6SA 4L4RA 1WSWA 4E0BA 4ZAZA 1NIPA 4UM5A 3ADBA 5JZSA 1GO2A 1OROA 2Y6VA 1CY4A 1NXSA 3ITKA 4TUYA 1JLKA 2ZCJA 3JALB 2FK8A 3T1QA 2AQHA 3G6KA 3YASA 2ZSUA 4YGXB 2VRCA 4TQ9A 1BE6A 2RHTA 3FDIA 1GG2A 3IKLA 1LJUA 4J0FA 4PTZA 5JV5A 1G8PA 4B4OA 5CK5A 1VGQA 1Z2AA 2A14A 4QEKA 4ABYA 4UOQA 1C7EA 1JKJB 5FBVB 3HBFA 3WYBA 1E2MA 3E1SA 1TIPA 3GLSA 4A6XA 1ZO8A 5ALSA 4DHWA 1WWKA 1JAXA 4G97A 4MUBA 3TTUA 2YCBA 4CM8A 1Q7BA 4NZOA 1VA4A 4JL8A 2BJWA 1JEDA 4P5DA 2RGDA 3GRYA 4OHMA 2PBRA 2EP7A 2Y68A 3MJRA 3VUFA 2VHVA 4RY9A 2YMQA 3UKJA 3DDZX 4GAEA 5KVVA 1I7BB 1N7JA 4QDKA 4G0XA 5BPFA 2OCXA 2NM0A 2G77B 1JQ3A 2XIJA 1KY4A 2Q4DA 5I9SA 3TTVA 4KTVE 1N0VC 4GX5A 4MX8A 1Y7PA 2SKCA 3ZGYA 2JGMA 5D00A 1K9VF 2CMFA 3AEXA 4N0EA 1PJRA 4GBMA 2AEFA 1DEAA 3BE5A 4D9MA 1QGUB 1I9CA 4U39A 4EUEA 5FNVA 3OQIB 3EWIA 2WIBA 2V7UA 4KG7A 1JT9A 2BP7B 2OGUA 2O2JA 2FNAA