3Q2IA

Crystal structure of the wlba dehydrognase from chromobactrium violaceum in complex with nadh and udp-glcnaca at 1.50 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
352
structure length
345
Chain Sequence
MIVIPPITDRKIRFALVGCGRIANNHFGALEKHADRAELIDVCDIDPAALKAAVERTGARGHASLTDMLAQTDADIVILTTPSGLHPTQSIECSEAGFHVMTEKPMATRWEDGLEMVKAADKAKKHLFVVKQNRRNATLQLLKRAMQEKRFGRIYMVNVNVFWTRPQEYYDAAGWRGTWEFDGGAFMNQASHYVDLLDWLIGPVESVQAYTATLARNIEVEDTGTVSVKWRSGALGSMNVTMLTYPKNLEGSITILGEKGSVRVGGVAVNEIQHWEFSEPHAMDEEIKDASGFGHPLYYDNVIKTMRGEATPETDGREGLKSLELLIAMYLSARDGRRVSLPLDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dehydrogenase
publication title Biochemical and Structural Characterization of WlbA from Bordetella pertussis and Chromobacterium violaceum: Enzymes Required for the Biosynthesis of 2,3-Diacetamido-2,3-dideoxy-d-mannuronic Acid.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Oxidoreductase
total genus 132
structure length 345
sequence length 352
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3q2iA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3q2iA01
2D59A 4OGWA 3EZLA 2VRCD 1XR3A 3IMFA 1H93A 1HYGA 2HLPA 4FBGA 1B8PA 1SNYA 3LSYA 5HS6A 2UYYA 3ANLA 3ZU2A 3E6AA 1GCUA 4NK4A 3ETDA 4JCOA 1LDGA 2BELA 4RVDA 3H3FA 1PL6A 4YB8A 2BHLA 5U9CA 3NYWA 3IQDB 5H82A 4R4JA 5A04A 3SLKA 3WMWA 1IOLA 2FHSA 3P2OA 1NWHA 2OBNA 4J9UE 2HSDA 3V5NA 4U8GA 3I4CA 4J0EA 4CQLB 3HADA 2AMFA 2BRUA 3JD1A 2AQIA 1YE3A 2ZCVA 2BGKA 3C7DB 4OO3A 4MVJP 3IS3A 1I33A 4XIJA 1H0KA 1KVUA 1ZO8A 4F46A 2PKRA 4KDEA 4R16A 3JD3A 1T4BA 1NX6A 3D4PA 1NXQA 3FPLA 4I5DA 3VH3A 4WPGA 1E6EA 1WLYA 1YO6A 4R3WA 3HB4X 2IDZA 1LDBA 4GMFA 3UF0A 2ZB3A 4YRAA 1K5HA 2ZIZA 3B6ZA 2O3JA 3VVBA 4II2A 4CMKA 5ITWA 1XU9A 3QRWA 4M87A 1T25A 5ER6A 1T26A 2PH3A 5C5IA 1H6BA 4IY1A 3D3WB 4BNKA 3PIIA 3HN7A 2H63A 4L73A 1T2FA 4MPDA 5IZCA 5EIOA 4RPKA 1D1SA 4XGNA 4JJIA 1GDHA 1ZEMA 2PZKA 4R68A 2X6TA 3WIDA 2J3IA 2YDYA 4R1NA 3G1UA 1NQOA 1Z73A 4BKPA 4BUCA 1C0LA 2RBEA 2X0RA 1S6YA 4R41A 3MTGA 4U6QA 2C59A 4UUNA 4CMHA 4YACA 4RJTA 3Q9UA 5U1PA 3H2SA 3WGYA 3DZFA 2RHCA 3U4IA 4J1SA 1DIHA 3C1AA 3MJCA 5A9RA 5MDHA 4GMGA 3LZ6A 1KVQA 3K8ZA 1PJQA 4BGEA 2Q3EA 4J1QA 3ZNOA 1DXYA 5KVCA 1GYRA 4IS3A 1QRRA 3GGOA 3UCXA 3LU1A 1ZK4A 2IEBA 3TWOA 5FI5A 4MKZA 1HDOA 5JBIA 3LC1O 2O3TA 1PR9A 3Q6IA 2HJSA 3WMXA 4B4UA 1I36A 3L77A 1TA4A 4YDRA 3WQSB 3OIFA 4DLAA 1Q0HA 1U7HA 3AI2A 1C0PA 4IJUA 4JX8A 2I3GA 1XKQA 3GOHA 3EHEA 1NYTA 3KHUA 4CJXA 1LUAA 2E4AA 3HSKA 1LRLA 2D5CA 4CLDA 2CVQA 3CIFA 3H2ZA 1YBAA 2PK3A 3G17A 3JD2A 1IZ9A 3VKUA 3PDJA 5K9ZA 3N74A 4GX2A 1ZVMA 2GPTA 2HJRA 2VHYA 3KZVA 5BT9A 1PS8A 3WIEA 5JY6A 2QZ9A 2VOEA 4OKIA 4N54A 2O7SA 3VDRA 1Q1NA 2GD1O 3NT2A 3A14A 4PLYA 2ZTUA 3U49A 1MFPA 4LW8A 1ORRA 4PLWA 2YV1A 3TZQA 3C8MA 1GUFA 4NFHA 2D8AA 1AHHA 3NX4A 4FSHA 1HSZA 2Q22A 4MP3A 5J9GA 4LSMA 3WOHA 5L4NA 3FBGA 5BSFA 3ZV6A 4CM6A 2YJZA 1DOHA 5TJHA 4E31A 5A05A 2ZYAA 3TSCA 4A0SA 4A27A 1C3VA 4IPTA 3AU9A 1C1DB 1NQTA 2B36A 2CVOA 3E5RA 2OP0A 4MVJM 5JYAA 2B0JA 3B20A 2GN8A 4J2HA 5IDYA 1NAHA 3H5NA 4OIMA 3IL2A 4HNHA 3C3XA 4BKUA 1T2DA 4B3IA 3CUKA 1LDMA 1BXGA 2UDPA 3BHJA 1LDEA 3EMKA 1WPQA 2HCTA 3PZBA 2IYOA 2AXQA 4D79A 2O23A 2DVMA 3TQHA 2GN9A 1CERA 4WLUA 5GMOA 4NU5A 1AUPA 3W4IA 1Z74A 3SX2A 4E2ZA 2Q2QA 1DC6A 1ZFNA 5G0SA 5CHEA 3RC2A 4WOJA 2AEFA 2HMWA 3QWFA 1JKJA 3ZWAA 3L0DA 4LRTB 4IZHA 1WXDA 3JCZA 1YWGO 2R6JA 3PFWO 1MP0A 3PHLA 3DMYA 1JU9A 3VDQA 5TNXA 5MGBA 4DIBA 4AFNA 2J3HA 4L4RA 5L7YA 4HXYA 2GO1A 5AXDA 1K6IA 4Z9FA 5H83A 4ZVVA 4D7AA 2NU8A 4LMPA 5DNAA 3WGGA 4YT4A 1ZKMA 5IDQA 1U2GA 3ZV4A 2IRWA 5JAIA 4P38A 1M6HA 3U3XA 3AOEA 4PLZA 5M6DA 3D4OA 1E3LA 4BV8A 2XPCA 3UOGA 3UFXA 1N9GA 4DMLA 1L1FA 4NJMB 4J4BA 5KVVA 2R00A 1DHRA 2GCGA 4YT2A 3GZ4A 1ISGA 1SB8A 5G0UA 4BO5A 2VTEA 4FW8A 3RBXA 1Q0QA 1PIWA 2UVDA 3K2EA 3VC7A 2AEMA 3HUDA 3NEPX 3W1VA 2DQ4A 4ALMA 4NBVA 4JN6B 2FPIA 2VHWA 4LRSB 3HG7A 4UEKA 1EUCA 1D7OA 5HA5A 1ZNQO 1BDBA 3JQ9C 5JAQA 4QFCA 3GPDG 1YJQA 1A7KA 1EE2A 2FR0A 2GN6A 4FJ1A 1HETA 1C1XA 1DFHA 1UH5A 2DKNA 2AG8A 2P5UA 3S2IA 4EZBA 5CEEA 1UDCA 4OQZA 3NTOA 4MVJE 3BA1A 2QHXA 3OSUA 4EJ6A 4NDNE 1D3AA 3WR5A 4BNMA 1E3EA 1CRWG 2CY0A 2FPPA 3VPGA 3P2YA 9LDBA 2NTNA 1D8AA 1GFSA 3D64A 2X86A 3Q3CA 2H9IA 4TRJA 5TRTA 3GVCA 3FD8A 3KXDA 3ZWMA 4L76A 4II3A 5I7SA 2VHVA 3K96A 2Q50A 1PU2A 3D0OA 4R5HA 3TZCA 3ZW8A 3WB9A 4U7WA 3JQGB 1PJ3A 3LQFA 4MVJD 4Z0PA 3IKTA 4GKBA 3LYLA 3KV3O 4XR9A 4WCFC 2PZJA 4XQGA 1U3TA 4IGFA 2Z1MA 5EINA 3ON5A 4E6PA 4RDHA 2V6MA 3OF2A 1H94A 1A27A 1EUZA 2I65A 4BO6A 1VE9A 1DLJA 4FN4A 3INRA 3VZPA 1NVTA 2VYND 2OGUA 4I5FA 2B5VA 3A4VA 2IXAA 5FYDA 3PJFA 3FNHA 2PZLA 4O63O 4N18A 3FSRA 3IIEA 1LDYA 1GV0A 3VPHA 2DTDA 1BG6A 1BSVA 4CLXA 4FC7A 3S8MA 1T2CA 3NAQA 4IIUA 3GEGA 3GMDA 2O3SA 4TKMA 1IULA 3NT4A 5EQFA 5F5NA 1WDMA 3S1LA 1ENOA 3OECA 1QLHA 4O1MA 2PWZA 1TI7A 3PTZA 5JCXA 3GAZA 4R3NA 1WWKA 5KKAA 5IZCC 5JW6A 2DFDA 3OQ1A 1HT0A 3OBBA 1UXHA 3CXRA 2EKQA 3OJLA 1ADFA 4RQUA 3TF5A 1HSOA 4CLHA 4E30A 3AUAA 1SMKA 3ONDA 1GADO 3FTPA 3QQPA 1O89A 4J6FA 1N2SA 1X1EA 2NWQA 5L4SA 4CQMD 1QV7A 1K6JA 4NPCA 3O38A 4Y8VA 2HRZA 3LK7A 4IJKA 4XKJA 3WYBA 2JFHA 1PWZA 1CF2O 1DPGA 4B3HA 1LXCA 5DOVA 5LDHA 1Y9EA 1KC3A 3PLRA 4J4TA 3DFUA 2FZWA 3WFIA 3K9QO 4HFJA 2NADA 3LT4A 4DIFA 2VUUA 3STHA 1KERA 1X0VA 1YJ8A 3SVTA 3WQRA 1MV8A 1P74A 1R0LA 4N5MA 4R1UA 4QT0A 3JQAA 4CV0A 4YAIA 3V1TC 4AJHA 1VLLA 4B8WA 4DPLA 3H65A 1E3WA 1LJ8A 4NJOA 5DZSA 4BNHA 4P22A 1CYDA 3GFBA 1NPTO 4E33A 3GF4A 3TL3A 2V65A 4P4GA 2C0CA 1DIAA 1DFIA 2C20A 3NRCA 5ITVA 4XZ3A 3WNQA 1VJ1A 5A9SA 1M66A 1TT5A 3ITKA 1GZ3A 4F6LA 1HDGO 3ORFA 2EW2A 5CEFA 4YVFA 4W6ZA 3I9NA 2FY8A 5JFOA 3DBRA 4M55A 1WDKA 4XYMA 3VZSA 3MWDB 1UUFA 3EVNA 5DDIP 4FD3A 3CE6A 5A06A 3H9QA 2GUGA 1HYHA 4BO0A 1W8DA 5JO0A 3CPSA 1ZK3A 4LSWA 4CPDA 4CM5A 1GZ4A 1Q2XA 2I6TA 4IDGA 2X0IA 5IDXA 4YJFB 3PXXA 3K5PA 4AJ1A 1QYVA 4S3MA 4FGSA 5I8ZA 5JO9A 4PZEA 2X0JA 4EI2A 3G79A 2X0NA 1I2CA 2DBQA 4LVCA 4IZIA 4MIYA 3KYDA 2W2KA 4G81A 4C4OA 4I9HA 4W7IA 2YZ7A 3OP4A 4YJGB 5HRUA 3P19A 2Q45A 4H7PA 1J5PA 4Q9NA 2NSDA 1W0CA 4CM4B 3EY4A 1GQYA 4E32A 1DHTA 2DM6A 4Z9YA 3BTUA 1DRVA 3KYCB 5EL0A 4GKVA 5T57A 4DMMA 4TROA 3WSWA 5T67A 4DREA 3BYZA 1JKFA 1AGNA 2CF6A 1JLLA 1HDCA 1Y8RA 1KVSA 1A9ZA 1T1SA 3DDNA 1EVJA 1JAYA 3ROQA 5A1TA 5KJFA 3WS7A 1GPDG 4DPMA 3KTDA 4WLVA 4IXTA 5KJEA 3TRIA 3UVEA 1G0NA 1NPYA 4RCVA 4Z9XA 3H4VA 3PJDA 4XEHA 3KBOA 2BFMA 1B3BA 5BNFA 1UP6A 3WQQA 4Q3DA 2FR1A 3VPXA 3C85A 3FWZA 3RIHA 4IQGA 4CMEA 3I52A 4BQPA 5FEUA 3RC7A 1B8VA 4DLLA 4M1QA 4AG3A 1DRUA 1RYDA 4AJ2A 1AXEA 5DCUA 7MDHA 4UEJA 3EZYA 5DT9A 4L75A 3UICA 4B79A 3PQDA 2JKVA 4GWKA 4UAGA 3H9JA 4XR4A 2E49A 3AUTA 4I5EA 1NPDA 4YCAA 2OOSA 1XWFA 3CSDA 2OUIA 2Z1NA 1PGOA 4E3ZA 3KYBA 3GDFA 3PVZA 4WCDA 4EUEA 2W90A 4CMAA 2OBYA 4ID9A 1BDMA 4OOEA 1UAYA 3M1AA 1A5ZA 4F6CA 4XGKA 3G0OA 1ZW1A 1NHWA 5B4TA 5DF1A 2GZ2A 1Z6ZA 3GEMA 3K31A 4TRRA 4I8XA 2JAPA 4KQWA 1KBZA 5KVQA 3TZKA 5B4UA 4IDBA 1KVRA 2HK9A 4XJTA 1EFKA 1Y8QB 3OIGA 4TSKA 2JFFA 3GNTA 3ETGA 4ZD6A 2I99A 4CMIB 1YH3A 1OMOA 4Y9DA 1V3VA 3DHEA 2EWMA 1UP7A 1OC4A 3ZHBA 1GAEO 3GVPA 3HFGA 3WLFA 2FSSA 3V2GA 3R3JA 2ET6A 3KRTA 1Z82A 2GSDA 4PVDA 2ZTLA 2A94A 2RCYA 3TFOA 4XYLA 4G65A 3QJ5A 1X7GA 4JJFA 5JSFA 5K0ZA 4FJ2A 2A9FA 4ZHSA 3DZIA 4OL9A 4ONEA 2I3AA 2EG9A 2UUOA 2VWHA 4J7UA 1QXSA 5B37A 2WWRA 3H6KA 2HMUA 3PWKA 3AFNA 3TJRA 3VH4A 5KWEA 3HQ4O 1W4ZA 3GH3A 2EV9A 4ALJA 5KTKA 1E7WA 4TMFA 1UP4A 1EDOA 3ZWCA 2X1HA 1ULUA 3PI7A 1RKXA 4A26A 2XAAA 4U0KA 1JA9A 1VPDA 1QYXA 1Q7CA 4CV2A 1PJSA 1WZIA 4DRYA 2ZTVA 3AM5A 2VT2A 3RKUA 4AICA 5CEJA 4WEQA 5JAZA 3EW7A 4J7CA 5AVOA 4LMRA 4BB6A 5EN4A 4EYEA 2ZB4A 4L0QA 3IP3A 4R5MA 2NVBA 2NVUB 1AE1A 1R4MB 2O4UX 3GDGA 4ZN6A 4Z3DA 1LTHR 1N7GA 1VL8A 4B7XA 1B7GO 3KETA 1U4OA 4NBWA 3M2PA 4XGIA 1YOVA 1NFFA 4LVUA 1R6DA 3BTSA 4KOAA 1EE9A 1NR1A 4C7JA 4NNJA 3RUIA 1LC0A 4OAQA 1CJCA 3GNQA 5JMPA 5KOIA 2TMDA 4PRLA 4XQEA 2FRDA 5C7OO 1SOVA 5FFFA 1J6UA 1NVMB 3UUWA 3AFMA 3EDMA 3GEDA 3CH6A 3QP9A 4M54A 4UVDA 1DC4A 4W7HA 1XGKA 1NVGA 2O2YA 2RH8A 2YQ5A 2PD4A 2PNFA 5EQDA 3TOZA 4BNVA 4WNIA 1PS0A 3ZHYA 1A7AA 3PYMA 1YL6A 4J1NA 4J43A 4CL8A 5DP1A 3I3OA 2EKLA 1IPFA 3ZU5A 4R51A 2Y93A 4MVJG 1SEPA 5GZ3A 5IG2A 4NBTA 1ARZA 1PJLA 4G2NA 3HJAA 4RVHA 4WCFA 3F47A 3BMOB 1K2WA 5U4QA 1KVTA 5DBGA 2BMAA 1P1JA 2G82A 4OMUA 4Z0TA 4CQMB 4EEZA 1TXGA 2J5RA 2J8ZA 3HDYA 2EF1A 4H16A 3JQ7B 4FDAA 4ALNA 1DIBA 4HBGA 1GYQA 3T4EA 4NHEA 4QECA 4JXKA 4RLSA 4MVJF 2YV3A 3VOSA 4CM9A 2VZ8A 3LF1A 3ZV5A 5DBFA 3KSUA 4IDFA 1LRKA 1U4SA 1L7DA 4ND1A 4RPHA 1A9YA 4ZQHA 3MJSA 5COAA 4QEDA 3TFQA 3I6QA 3TPCA 1T2AA 4OXKA 1Z7BA 1M76A 1VL6A 4CM8A 3H8VA 5JCJA 4BNJA 4E5KA 3F1KA 5L7TA 4DBZA 4HADA 4DTIA 2VRBA 2QYSA 1ML3A 5ES3A 3DAGA 5TIIA 1KIFA 4CLOA 5JDCA 3FR7A 2YDXA 2FZEA 1EK6A 2XF8A 1R66A 4FCCA 4MOWA 3WXBA 2B5WA 4OHUA 1WZEA 4E13A 4AJOA 4UUOA 4B4OA 2DU8A 4NK5A 3H5RA 2I9PA 3N7UA 1PQPA 3MWEB 1H9AA 3Q9NA 3KO8A 3JQ6A 4YBZA 1PGQA 3U9LA 1KOLA 1M2WA 2WD7B 3FF4A 3OEWA 1EEHA 4B8ZA 1T24A 3F4BA 5I7FA 4ZU3A 1WMAA 4WUVA 4BL5A 3ZV3A 2VWGA 3K30A 3LLSA 4GLLA 3P7MA 4PLFA 3GLQA 2BH9A 3DBHB 1GQ2A 3F46A 1RM3A 2JD0A 4FFNA 2VCYA 2IZ0A 4KUGA 3MJVA 3H9UA 4IIVA 5G4KA 1ISFA 3T7CA 1EVYA 4BKQA 1FDSA 3RFVA 4E5MA 2WM3A 2AW5A 1KEVA 4XYEA 4ALLA 4FPXA 5AXAA 4JP3A 3WWZA 3E18A 3U4DA 1G6KA 3HDHA 4PG4A 4ND4A 3QWHA 3HE3A 2EP5A 1HE4A 3ZH2A 2IXBA 2YV2A 1E1LA 1XG5A 3JYPA 1H6DA 4BO9A 3WDSA 4O5OA 5H81A 3QVSA 2DT5A 2AQKA 1PX0A 2G76A 1DJNA 4E5YA 4FQ8A 1MGOA 4BO2A 2BGMA 1T1RA 5A5EA 1H5QA 4JNKA 3ROKA 1UXJA 1B15A 4AJEA 4CMEC 1ISHA 2AHRA 4XRGA 4BVAA 2Y1EA 1I30A 4Z0HO 1N5DA 1KETA 3RAJA 1AXGA 5BR7A 4JLWA 4IDCA 3BMQA 3GZNA 1E7SA 3F5SA 2GZ3A 4E2YA 2VYVA 4B7CA 3JQ8B 1R4NA 1MXFA 1PJCA 1MB4A 4H3VA 4IINA 3DZHA 1P77A 3DL2A 1ENZA 2DTEA 4BNYA 3JD4A 3VTZA 4WLFA 1CEQA 3ETEA 2GDZA 3RJ5A 3ENKA 3ENNA 3CTMA 3RBZA 1FXSA 4Y98A 4YAGA 3T7EA 3GVHA 4YJHB 1B14A 3I23A 1ZK2A 8LDHA 2P5YA 3MOIA 3WFJA 2D5AA 4EBFA 4Q3EA 3JQBA 4OXYA 1DFGA 4HX5A 3TL2A 1LLCA 1XSEA 3OH8A 4NBRA 3VHRA 1D4FA 3I9MA 4XD2A 4JBGA 1RPNA 1I3NA 1BW9B 1K89A 4L74A 5ICSA 2NU6A 3Q2IA 1RWBA 3GAFA 4PG7A 3O8QB 3AUUA 1V0JA 4E12A 1LSUA 3HHPA 3BMCB 1X7HA 3G3EA 4FFOA 3DB2A 4AJ4A 3DZKA 1U7TA 1FJHA 1ZXBA 5EESA 4E21A 3WGZA 5DOZA 1EUDA 4RVSA 1GL3A 1WP4A 1HDXA 3H9GA 2DBZA 4WGGA 3LT2A 1DB3A 5L4LA 1HE2A 5GZ1A 4BNTA 1MXHA 4K28A 1A72A 5F1PA 4KWIA 1I2ZA 4BNUA 3ZWYA 1E3IA 2X9VA 3SBOA 1MA0A 1YB1A 2IE0A 3CINA 2W2LA 4Q3BA 1JKIA 4XB2A 3GR6A 3IAHA 4IM7A 4ZJUA 1HYEA 2J6IA 3ASUA 3C1OA 2QYTA 3S2EA 2B35A 1E77A 1C0KA 1E7YA 4RQTA 1WNTA 1KEWA 3M6IA 3DTTA 3MJTA 4Y6PA 4K6CA 3DBLB 1WVGA 2PTGA 5A02A 5CPBA 5G0VA 3VPSA 3FPCA 2WE8A 4DQXA 1O95A 2WYUA 2ZJ0A 1V3UA 4ZICA 2Q1WA 4BGVA 4NU6A 4IQ8A 3AY6A 4FS3A 3O9ZA 2FP4A 2NUAA 5JMWA 3BHMA 1RJWA 4FFMA 4N5LA 3W4JA 4NBUA 2QIOA 4AJIA 4J7XA 4DIOA 4DL9A 1U8FO 4ALKA 2A4KA 1HWYA 1IE3A 1YONA 3DR3A 1UR5A 5T6BA 1R0KA 1DBVO 1U1IA 4OJNA 5I9LA 1DC5A 1D1TA 1UXKA 2IZ1A 3GUCA 4WKGA 3ANMA 4J9VA 2O3QA 4GSLA 4LK3A 3TZ6A 5LCXA 4ZGWA 5KNLA 1M75A 5BSEA 1ONOA 1MLDA 1ZBQA 2BD0A 2NQTA 3INTA 1JN0A 1LLDA 4EJ0A 2V7PA 3QLJA 3WYEA 1XHLA 1U3VA 1EMDA 4PG8A 5AQ1A 1CWUA 1HL3A 1MUUA 1TEHA 2EXXA 1N8KA 3KVOA 5TLSA 3V2UA 3SXPA 1GQQA 2Z95A 3O26A 2P4HX 4MINA 1ZMOA 1P1FA 1P45A 4E0BA 2OZPA 2ZB7A 2X58A 4N7RA 1HKUA 1PJ4A 1VRWA 1XU7A 2NV6A 3BAZA 1BRMA 1IHXA 3O03A 1GUZA 5A3VA 3E8XA 1NQ5A 3B1KA 3QY9A 2EHDA 5IF3A 1DRWA 2V6FA 2NVWA 3U09A 1P0CA 4NH4A 2O2SA 3V2HA 1LSOA 4J3FA 4JGBA 3GNSA 2HQ1A 3PYXA 3BMNA 4XJSA 3Q0EA 3SC4A 4CLRA 3BZUA 4TRMA 3WWYA 4MP6A 4A73A 5LC1A 1QKIA 4MKRA 1O8CA 3QW2A 4JBHA 3JD0A 4JBIA 3KOUA 4WLNA 2YHIA 3GRPA 3RQSA 4D43A 4DXHA 2Q1TA 2I66A 1F12A 2VNSA 4ESOA 1E6WA 3QSGA 2QQ5A 4CV3A 1HTBA 5CDYA 4GQAA 1S7CA 3JQAD 2CDCA 1ADCA 5DCYA 1QYWA 2WYVA 1I32A 5JDCC 4PG6A 5ER9A 3RROA 4UEOA 3CMCO 4RPGA 4UUMA 5L7WA 3KB6A 2BFOA 7ADHA 3PQFA 3L6DA 1IPEA 5LDGA 4ZQBA 3PJEA 4EJMA 3GDOA 2PY6A 4DLBA 3W6ZA 2JCXA 2NNLD 2P2SA 1NP3A 2NTVA 3CZMA 3ZN2A 1X0XA 2B37A 1FMCA 2CVZA 4GI2A 1I01A 2Q4BA 3I4FA 4GBJA 4UREA 4HY3A 4CUKA 2DUUA 2Y66A 4E2XA 1RM0A 3KUXA 5IJZA 2P9CA 1HLDA 4FC6A 1MC5A 2Y1CA 1NR7A 4RPJA 2Q49A 3GPIA 2VYNA 4J90A 5L3ZA 5IXSA 2VNAA 1R12A 1HRDA 5COQA 1ZK1A 1E6UA 1I0ZA 1V6AA 3MJEA 2VT3A 1UJMA 3OM9A 1B8UA 1I5RA 1QV6A 4BNIA 4RZHA 3N58A 3IOYA 5KJ6A 2XXJA 1E92A 1N1GA 6ADHA 3SLGA 5A4DA 2HO5A 4YRDA 1FF9A 5BSHA 1QLJA 4AVYA 5BNTA 2VWPA 1ENPA 1HDZA 1NNUA 3WGOA 3WLEA 1ZCJA 4KUEA 4GL4A 1OFGA 1R15A 3FRJA 3WBBA 1LRJA 2JD1A 4OH1A 2VQ3A 4RPLA 1SBYA 2ZB8A 1Y9AA 1P1HA 3ZHXA 1IL0A 1ZK0A 4NFSA 3U0BA 2YY7A 4MP8A 2DBVO 1BXZA 4CQLA 4GGPA 3ICCA 4HFMA 4QUKA 5ENVA 4D0SA 3AY7A 4M86A 4UVEA 1SB9A 1XELA 1IUKA 4RV9A 4OQYA 5C7IO 3NJ4A 1Y1PA 5T5QA 3LF2A 5B4VA 2QRKA 4YRBA 3HFSA 2V6GA 3RVDA 1I3MA 4E5NA 1BXGB 1I2BA 3HB5X 3OETA 3UCFA 3C1TA 2C54A 3PFFA 4J16A 4XDYA 4QQRA 3RUAA 1K0UA 1B26A 1I10A 1YBMA 5I9MA 3TZHA 1V9LA 4QSMA 4YAEA 1ENYA 4WECA 2C29D 4PLCA 3DO5A 2DPHA 3R0IA 1HLPA 3A9WA 4K26A 3D3WA 2OHXA 4PGFA 2POQX 2AA3A 2HRBA 3JQBC 3KSDO 1LSSA 3FWNA 4MVJI 1DDOA 3W8EA 2BI7A 2P68A 4RO0A 1X13A 3JV7A 3AW9A 3S55A 3QE3A 3ZU4A 3GN1A 2H5LA 3GHYA 5HTOA 4ZRMA 2JJYA 4QO7A 2FOIA 3WJAA 5JAMA 1SZJG 4BMNA 1JAXA 4A5OA 4PLTA 1H6CA 1XYGA 3VPFA 2OXIA 4NG5A 3L6OO 2C7VA 3ZWWA 4J2OA 4Y67A 1J4AA 2CFCA 1TT7A 3L6EA 2Y1GA 4P4LA 3DXFA 3F1LA 4OSOA 4PLVA 1XA0A 1N9GB 3B70A 3WNVA 4HV4A 1B16A 4K9DA 3PPIA 3VVCA 5THQA 4AJJA 1MG5A 3D5QA 4C7KA 3WJ7A 8ADHA 1OC2A 3ZWVA 3ZCXA 1YL5A 2UUPA 5C3MA 1PL7A 3EK2A 1YS4A 1EK5A 3PLNA 3I1JA 2JFGA 4DUPA 2PFGA 3DZBA 2CZCA 4FOSA 3VTFA 1E1MA 4MIEA 2FPGA 1PZFA 2Y68A 3HDJA 3I83A 2QRJA 3GK3A 3X2FA 2P9GA 3K6JA 3V1UA 1VC2A 4WOKA 5T8KA 3UW3A 2VOJA 5L9AA 1C1XB 2O50A 3CZRA 2JCVA 3ONEA 2XOXA 5JXWA 4D41A 2EERA 1SO8A 3WTBA 1F14A 1V8BA 1DC3A 1O94A 4HFRA 1KS9A 5ILOA 3DHYA 2ZQYA 2EGHA 4FFLA 2ZYGA 3IDSA 6LDHA 4RF4A 3JTMA 4FFPA 1O6ZA 4OXNA 4QFDA 1MX3A 2GZ1A 3V1YA 4DC1A 2X5OA 2Y05A 1DAOA 5KKCA 1Q7GA 1N1EA 2XXBA 3WYCA 2EJWA 2NQ8A 3SEFA 3IP1A 1C1DA 3W6UA 1F8FA 2WDZA 1G0OA 3P5SA 4YAKA 1GCOA 3COSA 2Q2VA 1EZ4A 1LU9A 3NGLA 3F9IA 1LSJA 2VN8A 3ZU3A 4W9NA 2AE1A 3RJ9A 4F45A 1HEUA 2F1KA 3R1IA 4YPOA 1IYZA 5I7EA 1PSDA 3BTVA 4RF5A 4OKNA 4RVGA 2E37A 4F3YA 1LLUA 2CF5A 1DEHA 4XYBA 2DAPA 4YJDA 5C37A 5HWSA 2NU9A 3QVXA 2RHRA 3KSZO 1B2LA 2GYYA 3D3EA 2G0TA 4M89A 1XDWA 1PGPA 2J3JA 4LCEA 4I9UA 5I9NA 3BIOA 4RF2A 3Q2KA 4URFA 4Y6SA 1JWBB 1PS9A 2EW8A 5DP2A 1JWAB 2QG4A 2WE7A 3C7CB 5GZ6A 1HZZA 1LLQA 5DCWA 1U28A 4BGIA 4MKXA 2AE2A 3RUCA 4CR7A 2W98A 4X54A 4GWGA 2HDHA 4TZKA 3UXYA 2X9NA 5TGDA 1O9BA 1Y5MA 1ID1A 3GG2A 3ZHZA 1QSGA 3V8BA 4D44A 3H5AA 1F0YA 4OM8A 2OMEA 1SCUA 3GGPA 4YA6A 4S1VA 4KWHA 1P9LA 2I5PO 1PJ2A 1M67A 2DBRA 3DC2A 3DWFA 2QX7A 1XCBA 1YGYA 1P31A 1OZAA 1RM4A 4UVIA 3ZI0A 3FNFA 2EGGA 2G5CA 4AL4A 2AG5A 4ALIA 3IKVA 1EQUA 5IFLA 1VSVA 1ZSVA 3L9XA 1VKOA 2BFPA 5FWNA 3GFGA 4GVLA 3UAGA 3ZDFA 1NQAO 2WSBA 1ZH8A 1UZNA 1PEDA 1I3KA 4NJMA 4PIVA 2PR2A 4XYGA 4BHTA 4E4YA 5T64A 1VI2A 2E6UX 4DC0A 3FHLA 3K2BA 5JNLA 1EDZA 4LCJA 1PGNA 2BF7A 3JQAB 3KLPX 1XIVA 1VKNA 1E3WB 1FDVA 1V35A 5JCJD 2CSUA 5L45A 3A06A 5BNIA 2DUWA 1K6XA 4W82A 2OL4A 4KQXA 5JC8A 4J91A 1BVRA 5FI3A 3UKOA 3F6YA 2X9GA 3LT1A 5JPIA 3F4LA 3SC6A 4QTZA 5A9SB 4IBOA 1TT5B 3EYWA 1PL8A 1U2DA 5TS3A 3EUWA 5CDTA 3NDJA 1MC4A 3QV1A 3IUSA 5COBA 3DBRB 4R54A 3LT0A 4M8SA 5F3RA 5L95A 1ZEJA 3W4KA 1DIRA 1Y5RA 4WE3A 5T73A 3UCEA 2CDBA 1RYEA 1JVSA 1UZLA 3U4CA 1SPXA 1X14A 1NFQA 4N5NA 3FTNA 5L51A 4BV9A 1ADGA 1PJBA 2Q1UA 4WJZA 1QG6A 1YVEI 3INGA 4L4XA 5JDIC 1KY5A 1ZSYA 3JQGA 1EQ2A 3GY0A 1X15A 4TZTA 2VRCA 5IAAA 2JL1A 1NWCA 3MZ0A 1YQXA 1FDUA 1ISIA 1SC6A 2WYWA 9LDTA 3KYDB 3PZRA 1U3WA 2W2KB 4KZPA 4YYZA 2J3KA 4I5GA 1U5CA 3RUHA 4E5PA 3NV9A 4Q3AA 3W8DA 4ZRNA 5G0WA 4DQUA 2HAEA 2D0IA 5L53A 3JYQA 3PHJA 1QORA 5J23A 1NFRA 3GVIA 3MEQA 1GPJA 1GD1O 2D2IA 3WTCA 1FK8A 4PFJA 4BNNA 3E82A 3DMTC 1Y8RB 4BGUA 3SJUA 2D1YA 3OQBA 2VHXA 4GLOA 4BS9A 4IGEA 3IC5A 2WEKA 3AM3A 1B0AA 4AJLA 4YT8A 2UAGA 1P0FA 4FFRA 3I9JA 5TT1A 4AJKA 4L9RA 2X23A 2IEDA 4YWJA 4PLHA 1BGVA 1GEEA 4LISA 3SJ7A 4CM3A 4M49A 1Z45A 4R9SA 2VYVD 5ICMA 2JD2A 1E7MA 2VHZA 2ZJ1A 1WAMA 4J0FA 5A5FA 1LQTA 2F00A 2NACA 4CUZA 2J5QA 3PHHA 3G49A 4WASA 5AYVA 3LLVA 4DGSA 4TQGA 3TNLA 2PZMA 3RWBA 4XRRA 4RVFA 4D3FA 2OP1A 4ZA2A 3NTRA 4GSKA 1EBFA 4CUJA 3HZZA 2H6EA 1RM5A 3GMSA 1NHGA 2EEZA 3AUSA 3DAPA 1ADBA 1YB5A 4RORA 5TT0A 4GX5A 5K6AA 3KEOA 3JYLA 2D4AA 4ZQEA 2Q4EA 2DLDA 2B69A 4ILKA 4Q3NA 1XLTA 5GY7A 3PIDA 1LBEA 3AJRA 1EBUA 3I9OA 3DBVO 4PRKA 3RSHA 4D42A 1ZSNA 4P8RA 4NZ9A 5AOVA 2E48A 4CLEA 1W6UA 4IMPA 2FR8A 3PJGA 5A03A 3D1LA 1Z75A 5JYFA 1UXIA 4MVJH 3B1FA 2DC1A 3S2GA 4JJGA 1WW8A 4CODB 2RH4A 4D0RA 1GEGA 2HMVA 3K92A 2RAFA 5F21A 3EC7A 3U62A 4RL6A 1J49A 1GYPA 4WEOA 2JCYA 1GZ6A 1U9JA 2VTDA 3OFSA 4GAEA 3QVOA 5CG2A 1CETA 4TWRA 2C82A 4I9NA 1VJ0A 3RU7A 2Q99A 5EPOA 2G17A 2BGLA 2VZ9A 1B3RA 1F17A 3PDUA 4EEXA 3I6IA 2B4QA 3ROMA 1IZ0A 1LX6A 3WSVA 3PWZA 5T8KC 3PQEA 4BO8A 3I9LA 2YUTA 4A10A 1UDAA 1UDBA 2C2XA 1C14A 2X8LA 2A92A 5ADHA 1PTJA 3ZWNA 3G1TA 4QX6A 3DFZA 3UHAA 4FJ0A 1Y81A 5G2OA 1UAGA 4R1TA 1YRLA 3RD5A 2W2LD 1E3SA 4YJFA 2GN4A 4YEDA 3PHGA 3FN4A 1T4DA 2NM0A 1GR0A 1MFZA 2O3UA 4IS2A 2I67A 5DBIA 2PKQO 3NDRA 3GGGA 3OJ0A 2AQHA 3ST7A 2C7GA 1CQIA 2PGDA 1P44A 3QIVA 4BNWA 3IUPA 2HU2A 2ZTMA 4FB5A 3JQCA 4EW6A 3CKYA 2P4QA 3RUDA 4QXMA 2WJPA 1VSUA 3AM4A 1YXMA 1VM6A 1O0SA 4YJGA 4UVGA 1ZMTA 4JK3A 4PG5A 4CM4A 1T2EA 2FN7A 4BOYA 2O7QA 2PA3A 3GQVA 1JW9B 3QWBA 1F06A 1CDOA 1GTMA 2WD8A 3AI3A 4XCVA 3KYCA 1W73A 3LC7O 4W9NC 3VZRA 4DA9A 1H2BA 4ND3A 1ISMA 4L4SA 2UV8A 5JLAA 4B4WA 2P9EA 3ADPA 1H9BA 3H3JA 3FNGA 1P33A 5F1KA 3ZNNA 4BKOA 4EITA 2V6BA 3S2FA 5EMHA 3MJ4A 2EP7A 3DOOA 1ZUD1 4ND5A 4U0JA 4TKLA 4UUPA 1KC1A 3ULKA 2W4QA 5CDUA 1YOVB 4ZQFA 4RF3A 3VH2A 3DAFA 3I5MA 1FDTA 1PZEA 1E7QA 3MOGA 3NKLA 4P4NA 3E48A 4B4VA 3WGTA 2GERA 1YQDA 4HUJA 4CM1A 2FMUA 4ROSA 4ITUA 3TN7A 4A2CA 3HNPA 3WGHA 1FDWA 4DBVO 1AN9A 4PZDA 3E9QA 4KTTE 3D4NA 3L4SO 2VUTA 1TVEA 3W8FA 3OJOA 4OYRA 3QVTA 4NIMA 5C7LO 5HBRA 3JSAA 5TF4A 2CUKA 3KM0A 2Y99A 1F8GA 1CQJA 3F5QA 2HK7A 3R6DA 2ZATA 5IN5A 5IDWA 1EVZA 4MJLA 4IMRA 1PQUA 3OA0A 2IODA 2PV7A 4HNGA 5JC1A 3PP8A 5CP8A 4RVUA 3ONFA 4YR9A 4IXWA 4WCFB 4TRNA 2GLXA 3WGIA 5ILGA 1Z7EA 4IJWA 3JQFA 1LA2A 4B3JA 2X5KO 5CFZA 1UZMA 4CMJA 3Q1LA 1QYDA 4BNFA 4KMSA 1L7EA 4R9RA 4K6FA 3U5TA 3QWIA 2X5JO 4RGBA 2J5KA 3DZGA 3TOXA 3JYOA 1Y8QA 5TJ9A 3C24A 2G1UA 4RZIA 3ZWOA 5KIAA 4U6SA 4CMIA 2Z5LA 3DHNA 4I08A 4W4TA 2FWMX 1R37A 2P91A 4MIOA 2BKAA 4RDIA 3RUFA 4CM8B 1WMBA 1IB6A 1Q7BA 2CDAA 5KCZA 3JQEA 5HS4A 4CR8A 4JQCA 1PZGA 4PLPA 4U5QA 4XA8A 1PR3A 3PWSA 1HE3A 3GRKA 3L07A 4CLOB 1DIGA 3BTOA 4CMGA 2PH5A 3NTQA 1BTOA 2C5AA 4WLOA 3PK0A 3ADOA 5L40A 1G1AA 4GVXA 4OSPA 3UN1A 3ANNA 1AHIA 1I8TA 4DVJA 2Y67A 4YAJA 2PKQP 3RFTA 4DWVA 5CPFA 2YHUA 4Z6KA 1A71A 2RIRA 1VJTA 3JQDA 1ZXLA 2A35A 1HDYA 2WTBA 2ZK7A 4AJPA 3LC2O 3AY3A 3E9MA 5B1YA 3GG9A 1GU7A 4PN3A 1R0SA 2Y0DA 1X1TA 4DPKA 2HK8A 2YFHA 4PLGA 2I76A 5JE8A 3X2EA 4BO7A 3I9KA 5TX7A 4Z3KA 2JHGA 5CDSA 4MVJA 2X4GA 5G4KB 1PWXA 1EVIA 3HDQA 2NVUA 3ZNQA 3E5MA 1R4MA 3L4BA 2HMSA 2ILTA 3QHAA 3MCVA 3NGXA 3GA0A 4G5HA 1ONPA 1P1IA 2HMTA 4J1TA 4BIIA 1R16A 2B4TO 2BI8A 3BXXA 3F3SA 3PEFA 2GRAA 4LN1A 4XX0A 3OJFA 4OOFA 5A3JA 2GR9A 4IJVA 5CAEA 1HZJA 3AOGA 4D45A 4CM7A 1ISJA 4BO1A 1HDRA 1OAAA 5CDGA 3U4HA 5CG1A 1N92A 3RC1A 1P3DA 4XIYA 4WK6A 5BSGA 5JYDA 3JYNA 3AWDA 1Q0LA 1PZHA 3FCOA 3ICPA 5F5LA 4Y6RA 1ULSA 3WX0A 3PGXA 4YTEA 5HM8A 4LGVA 1OOEA 2C2YA 3PHIA 3L9WA 4YT5A 1U5AA 4NFYA 5FF9A 2PGLA 4W99A 1YL7A 3BMQB 3GZNB 4BMSA 2CNBA 1YB4A 5JDIA 2W8ZA 5K6AC 4HWKA 2Y0EA 2PGJA 1H6AA 1HE5A 3RI3A 2B4RO 3D5TA 1R4NB 4BO4A 4QO8A 5DN9A 1BMDA 1TB4A 2CMDA 1J0XO 2LDBA 4TVOA 5JY1A 1GY8A 3T4XA 3BMOA 1C0IA 1E1NA 4TVBA 4O0LA 5EERA 3A1NA 3DOCA 2DFVA 2Q46A 3AK4A 4CQMA 1X7DA 1E5QA 3DQPA 4GPD1 4I1IA 4BB5A 2PLAA 4ZQGA 3DOJA 3ZWPA 3JQ7A 3UH1A 3ABIA 1KEPA 3CMMA 5DULA 4YQZA 5IZ4A 3DEYX 1IHYA 2VZ0A 2Y0CA 3OIDA 4GGOA 3DMTA 3OEYA 3KEQA 3FI9A 1JDJA 2BFAA 2JHFA 1KY4A 3RKRA 3OHSX 4D3SA 1V3TA 3NJ8A 2NTJA 3UGKA 1XQ6A 2EJVA 5B12A 3CEAA 3BHIA 1DAPA 4IDAA 1QP8A 1NAIA 3RC9A 1ZZEA 2SCUA 3FNEA 4Q39A 2ZKLA 4O6VA 2WMDA 4K1LA 4A03A 1BWSA 1I3LA 3NDIA 4RLHA 5JS6A 1QMGA 2HKIA 2C5EA 2NLOA 1QR6A 4HFNA 4MO2A 3Q11A 3ZWXA 1TLTA 3OICA 1SEVA 5G0TA 3ZZNA 1Y7TA 3IJRA 3RCBA 3KLMX 3ROPA 1N7HA 1E7RA 1LQUA 1P1KA 3ASVA 1LEHA 3H9EO 1DJQA 4WLEA 3R3SA 4XDZA 1O5IA 3WG9A 4CR6A 3DZJA 3NT5A 3AU8A 1XQ1A 3DTYA 1E0DA 4H15A 4NI5A 3PYLA 4XQ9A 5TSDA 2WD7A 3OJEA 4BNGA 2GGSA 5G4LA 2VWQA 2OORA 1KYQA 3OA2A 4AJNA 2O48X 1BXKA 1VL0A 4HKTA 1E1KA 1H2HA 2HUNA 3QWAA 4JROA 4XB1A 1KEUA 2IZZA 4FGWA 4NMHA 3DBHA 4J49A 3GHHA 3GT0A 3E9NA 4R69A 3A28A 4J4HA 4R01A 1NBOA 1SOWA 3VAZA 1ONNA 4NR0A 4ND2A 2D3TA 5TC4A 1YKFA 1ZJZA 2NU7A 1YQGA 1SAYA 4CMCA 1MG0A 1OBFO 2H1SA 2O4CA 4FOOA 1U8XX 3D7LA 5THKA 4GX0A 4CL3A 5AXBA 3LDHA 3NUGA 2ZCUA 1M6WA 2CD9A 3H7AA 3HWRA 3ZGYA 2Y1FA 3LVFO 3E1KA 1P1RA 2Y1DA 4NQZA 3O4RA 4B7UA 3VKVA 4EGFA 5JYEA 4KUHA 2Y1OA 4KP7A 2ZYDA 2QW8A 4GH5A 2QRLA 1ZJYA 3HN2A 4CV1A 1NTOA 4CMBA 3AI1A 3AOEC 4JIGA 3K73O 1HXHA 2BLLA 1OI7A 1JTVA 4IDEA 4O59O 2PD6A 4BNLA 3ITDA 5A9TA 4BKRA 2R00C 1QYCA 4L8VA 1NM5A 3ZNPA 2E82A 1JVBA 3OQ6A 1DO8A 3JQ8A 4YQYA 2YQ4A 5TQVA 3MTJA 2TMGA 1XEAA 4WNCA 4KDFA 5KVSA 1K3TA 3IJPA 1LDNA 3FR8A 5I7VA 2IYPA 2ZQZA 1LNQA 1A4UA 2JAHA 3EGOA 1YDEA 4DQVA 2YW9A 2AEJA 1JQBA 1PQWA 3JQFC 3GN2A 4YJHA 3RUEA 4YXFA 4EUFA 5BQFA 2LDXA 4GX1A 3WBFA 1A4IA 3OMLA 2YYYA 3BMNB 1DSSG 3ZWBA 4CLRB 3GUYA 3GVXA 5KJ1A 3E03A 4A7PA 5F1OA 1PGJA 2QZZA 2GASA 1YBVA 2DTXA 4FR5A 2OO5A 3RFXA 4BNXA 4UULA 4BQRA 1I24A 5ENDA 1IY8A 4R1SA 4DYDA 1UXGA 3PGJA 3RU9A 2Q2WA 4BNZA 3DONA 4JP2A 1BW9A 3M1LA 2YHIB 2X22A 3ZW9A 2OFPA 3O8QA 4PZCA 1GV1A 3VH1A 3BMCA 4PVCA 2GNAA 4E2WA 1LC3A 3EAGA 2C07A 4BO3A 3WICA 3RASA 3M2TA 5IN4A 2GF2A 4Q3CA 2AQ8A 2R2GA 4D3DA 5EJ2A 2O3RA 2FSVA 1HF3A 4FIZA 4IDDA 2B83A 1LI4A 5I8WA 4D46A 4EDFA 1WDLA 4HP8A 3GC6A 1EFLA 3QVWA 1E5LA 2EIHA 2VUSA 4XWYA 5AXCA 4DYVA 3PRJA 1BVUA 2YFQA 1CIVA 4EUHA 4PCVA 4IUYA 2PD3A 4BMVA 3JQ9A 1BHSA 4KTVE 3FBTA 1E3JA 3WGQA 3RBVA 2Q1SA 4MDHA 3VZQA 1PJTA 4CM9D 5IXYA 3B1JA 3TDKA 4INAA 4IQ0A 1U3UA 3C7AA 1YDWA 3DBLA 2DPGA 3EVTA 1NASA 1Y6JA 3QA9A 1GUYA 2X7HA 1DLIA 4UVHA 3L4BC 1ZIDA 4XQCA 5KJCA 2EKPA
chains in the Genus database with same CATH superfamily
2D59A 3DL7A 2CNWD 4OGWA 3EZLA 1XR3A 3IMFA 4KDCA 1H93A 3LO5A 4HT3B 1B8PA 4MR7B 3LSYA 5DLYA 5HS6A 3ZTYA 3OFND 3ANLA 3ZU2A 1SVMA 3ISVA 4BZXA 1SU8A 1GCUA 2ZRAA 3K9CA 4G2TA 2DQKA 5IAJA 5LPNA 3GI1A 3ETDA 4MYUA 1LDGA 3BX1A 4OHBA 2R96A 2GN1A 1VL2A 4YIHA 1PL6A 4YB8A 2E3JA 5U9CA 1PNRA 3IQDB 5H82A 2P77A 4R4JA 1CJBA 2GAAA 3T0FA 4EHFA 1T29A 2R7KA 1C50A 4NMLA 1NWHA 3TUXA 2ONYA 4C3UA 4ANFA 1G8KA 1HEIA 4EATA 1XDUA 4HDCA 2QROA 3TOSA 1IB0A 3K8OE 1GSHA 3KCNA 3R3UA 4J9UE 4JR2A 1N7IA 1CDEA 3T3HA 3I4CA 2WM8A 2VP2A 4QD3A 2H1LA 4FZ5A 5BN3A 2AZXA 4YUXA 3FCYA 2R6HA 5AVWA 1I33A 3PHBE 1H0KA 2VP0A 3HKCB 4KDEA 1N5OX 2IZ5A 1ESCA 1NXQA 4OA5A 4W9MC 4HX2A 4EUKA 1PEYA 1NYLA 1T0HB 1Y1KE 1Z5UA 5AW6A 1M1YE 4OXIA 3MLEA 4P58A 2IEZA 3UF0A 3IWBB 2J5XA 1NVXQ 2ZB3A 2RONA 3C3BA 1HNWB 1RYFA 4NONA 3B6ZA 1FSSA 1J8QA 4CIAA 3EXEB 3A26A 4CMKA 5KPDA 3OOHA 1LF0A 1T25A 2QK4A 2AUNA 3D43A 5C4GB 1E94E 1NDUA 5ER6A 2ILVA 2XKBA 5KDDA 2G6TA 3UK7A 4LXYA 3T5DA 4DV0B 2CB0A 1IBKB 2BKEA 1VGQA 3RTCA 2LCFA 5K7SA 1WUTA 4BEJA 3HN7A 5T41A 2H63A 3KLNA 3ORYA 3HK2A 3EE6A 2WR8A 4MPDA 4EVRA 3O93A 4RPKA 5IJXA 4AO7A 1YKSA 3FOCA 4R68A 1K7YA 3ENZA 3G8DA 4LY9A 1P72A 4PZAA 1ACMA 3CWQA 3I76A 3UUEA 4R1NA 5H68A 4QBTA 3WL8A 2REOA 2HHAA 4HEJA 4TV9A 1C0LA 3TBHA 1KI9A 4TT8A 2K2QB 1IUOA 4R41A 3ENQA 3O2SB 4E1VA 3K0HA 4UUNA 4QHSA 3VZDA 3IMCA 4MW6A 5BT8A 3H2SA 3TR0A 2YJ5A 3DZFA 4NJEB 1D07A 1GT6A 2QE6A 1DX6A 4UM7A 1KAEA 1J09A 2W6ID 2I4RA 2YY6A 3T0GA 4BVHA 4HF7A 5MDHA 4NCJA 3CZQA 1RIIA 3NORA 4QOSA 5AVKA 5B1DA 3GLUA 3JPYA 3ZE0B 3BJZA 1FYEA 3QY0A 3W3AA 3VR4H 2AXPA 4BGEA 4MV1A 4ND7A 4L28A 3TAUA 1DXYA 4X1YA 2J33A 1QAMA 3SNKA 1GYRA 1AHNA 1JT9A 1RMTA 3L6BA 1QU3A 1T5OA 4QZVA 4TMZA 4QYMA 3LU1A 5DRYA 3Q0IA 5AUQA 2VAWA 4XIGS 3AV3A 2JW5A 3CTPA 5AM4A 5HFNA 1DOZA 1HDOA 4ZCQA 4X65B 1N6NA 1M1YA 4OVKA 1C9KA 1I36A 2AC2A 3KQNA 1NGSA 4HLUA 3PTAA 1U7HA 1SH7A 5P21A 4IJUA 1KO8A 1XKQA 2FETA 2AUMA 1Q21A 3GOHA 2W48A 3EHEA 4R1QA 1NYTA 5BP7A 2XCTB 2CXRA 4CJXA 3I53A 2YVAA 4IG4A 3GFQA 1LRLA 1H1TA 2IKQA 2GCPA 4BBPA 4CLDA 1C8LA 2PX4A 2F1HA 2Q6TA 5B58C 1ESEA 2IH5A 3G17A 2QMOA 3UHJA 1AQNA 2P6RA 1IZ9A 3PDJA 5HP4A 3O0DA 3V9PA 3W34A 2HJRA 3A6KA 2V98A 1L5OA 1MEJA 1PS8A 2WMYA 5BT9A 3WIEA 2ZDHA 2QZ9A 4J0CA 1OJ7A 4HDMB 2V7BA 2QTCA 3MS2A 3WGUA 4UUQA 5DNVA 3DM5A 2ZTUA 3P4XA 1MFPA 4M9XA 5AK6A 1F2DA 4BX9A 2W6PA 4MQ6A 2P4UA 1JHRA 2YV1A 3ADCA 5CB4F 4O4HB 3GFFA 4E7PA 3CBGA 4FSHA 3N70A 1EJBA 2WV7A 4YBRA 1N6RA 3RLFA 1I0IA 2CV2A 1IY1A 2G3YA 2Q3HA 4ZCRA 3NWJA 3ECAA 3D54D 3EOBI 4P2BA 5D1HA 4EARA 5HJ7A 4WL0A 4JJEA 5BSFA 3ZV6A 4CM6A 3GU3A 2PFKA 1UOOA 3NCHA 3NWEA 3PFNA 3OPYI 3TSCA 4A27A 1BVHA 1C3VA 1I1QB 1RMQA 1SBZA 1WXHA 5EZYF 3E7WA 3EUEA 4E14A 5K0CA 2P9HA 4MROA 2TECE 2B36A 3KTAA 2Q6LA 4IF4A 2WJZB 3B78A 4AROA 4CKEA 5IDYA 3BH7A 3EIOA 3H5NA 4K8RB 4DCCA 4HNHA 2CD7A 3M6WA 4FZRA 5DBOA 1M8PA 4RLQA 4EVIA 5LKRA 3TTXA 1UAAA 2WP0A 1N2EA 3NBAA 4HB2A 1NI4A 3I9V6 3QELA 3UZUA 3O3MB 3FTDA 5HCNA 2WWVD 1IBLB 4ZZIA 2ZJAA 4LUCA 4NEHB 4S1OA 3EBOA 2DVMA 2WHEA 4DEVA 3SI7A 3G9ZA 2GN9A 1CERA 4WA8A 3TQHA 1F20A 3OWOA 2H2IA 3BCRA 3RIYA 3T1HB 3K2IA 1OUMA 3R3WA 1SHLA 4BGDA 4FGKA 1PV2A 1SVUA 4HS4A 2WB2A 3D59A 4NPHA 3U37A 4R2KA 3LFTA 5ANRB 5G0SA 4CF5A 2QVLA 1V43A 4WOJA 2AEFA 2JS7A 3FBWA 3M6FA 2G9UA 1R4ZA 3QWFA 4QBGB 5DIFA 3H5LA 3X1YA 3L0DA 3BKXA 3EFEA 1XEXB 1Y42X 2I7DA 2QD4A 2RJOA 4PSCA 3FMPB 3PFWO 1HGXA 1MP0A 3TTUA 4BVBA 1T5TA 2H08A 5IJ0B 1E99A 5BV1A 1P8JA 1E3DA 4I6GA 4QQNA 3WHLA 4V0SA 3SC2B 4AXXA 2ZR7A 4ZVQA 5L7YA 1K66A 2NUPA 3HJHA 3WY9A 3EG5A 4PANA 4Z9FA 5H83A 1P39A 3DOIA 1C7JA 3ZWKA 5J4YA 1XTUA 1SCNE 3SFZA 2BDUA 1L4HA 1ZKMA 3K09C 3BPSA 3R3ZA 5IDQA 2PX6A 5JAIA 4P38A 2FUEA 1X1SA 2ZI5A 2QN2A 4RX1A 1M6HA 3GLHB 4H2DA 2N75A 1Z8HA 2D0DA 4MVCA 4PLZA 9GPBA 2PTHA 4H17A 1E3LA 5CR9A 3ZHCA 2XPCA 3T1VA 1C0EA 1TADA 3D31A 4O4LB 5ILQA 1N9GA 2AFIB 3EIQA 1L1FA 1SUWA 2ZXUA 4YMLA 3IAAA 5TVGA 4J4BA 5KVVA 3L1VA 4EY3A 1ISGA 1C9NA 1GQFA 5AJXA 2IYZA 2WJ6A 5G0UA 3OEEA 2VTEA 5K8TA 2WUGA 3L49A 4FW8A 4PO1A 4FUQA 1J8FA 4A8JC 2HF9A 2B4KA 1FLNA 2ZPAA 4HS9A 4QPCA 5IYZF 4X7BA 4DAOA 3L93A 2Z3WA 3RTBA 2DQ4A 2K6GA 1LD3A 4ALMA 2VXBA 1U7PA 3FPFA 1X92A 4D4IA 4M2LA 4EYOA 2RK6A 3HP4A 4F4HA 3ZQ6A 2GO7A 4UEKA 2RE8A 2O54A 1D7OA 2VDKB 1W47A 1EAYA 2H18A 4PHGA 5EHQA 5FV7A 4C22A 1WZUA 2D3WA 3VU0A 3K9WA 4O3FA 4Z9BA 1FSZA 1GJRA 5IANA 1G21E 2DSNA 4KQCA 1M33A 4FJ1A 4UBLA 3ND5A 3DCNA 2A67A 2GBIA 2PMFA 1DFHA 2P5UA 2O2HA 4MUIA 3ELYA 4PC6A 1NXPA 3S2IA 5GM1A 4HB4A 3OQVA 1UADA 2FPXA 2PX8A 3WI7A 2A9QA 1RLIA 3FUXA 4G0NA 2AK3A 2B1JA 4LY3A 3IUQA 3MLBA 4Y6QA 3WR5A 5AVSA 5IUNC 4DC9A 3EP5B 2C2WA 3FMOB 4E3WA 9LDBA 1DG9A 3BXHA 1W1IA 3Q3CA 3PX2A 3FZYA 4OAPA 4C04A 4NP6A 4TRJA 2QRVA 1LJLA 2VJQA 3BF7A 1H05A 3KXDA 3ZWMA 4L76A 2MMGA 1T8SA 5I7SA 5DSZA 2Q50A 2PBZA 4R5HA 5EPUA 2OAQ1 2GHTA 4LDPA 5A2GA 1T8PA 1VQ1A 3JQGB 5KU1A 3TRDA 5LZ5A 4ZKDA 1G98A 2QOEA 4WXMA 3P45A 4GKBA 3GAAA 5CM2Z 3HI4A 1PEAA 3RTDA 3W9SA 4EVSA 4WCFC 4HAOA 4C2AA 1T3LA 1DJPA 5EHXA 2Z1MA 1A8SA 3ON5A 1XLUA 2A7QA 3DW1X 4KODA 4RDHA 2QL9A 3VA7A 3IT3A 2V6MA 1MBZA 1H94A 1NE7A 4JB8A 3VR4A 5INTA 3GPLA 2OM6A 4R9NA 3LP6A 1RYHA 1GSIA 3VZPA 1KI7A 1D2MA 4EFDA 4MV4A 1PDVA 5AW1A 2VKTA 5G1OA 3NETA 4RK6A 4GPAA 4I1PA 2IPXA 2Z3VA 3UIEA 1ZIXA 2XMGA 3MB5A 4O63O 4N18A 4BMOB 3IIEA 4TTRA 3M5DA 1G5IA 3O5AA 2FEMA 3A31A 2HPAA 4RKFA 2NZWA 4FC7A 4JYAB 3S8MA 1T2CA 2NSYA 1VJCA 4INZA 3HRIA 3GEGA 3TEMA 1UC9A 5JALA 1IULA 3ED1A 5EQFA 4DDHA 3QPBA 4RHCA 2QSUA 1E62A 1VIMA 3OECA 1O2DA 2V7TA 2WAYA 1QLHA 1RCTE 2G06A 2R97A 4NCIA 1CEXA 4IXNA 3T6KA 4B34A 1CJKC 4R3NA 2J3QA 3NHPA 4O8JA 1ZH2A 4PFQA 1FLDA 2C98A 1UKYA 3OBBA 3VMMA 1DXOA 4RQUA 1CJTC 3WOVA 3TF5A 3BEOA 3T8YA 1VMDA 1SK9A 1I14A 1GADO 1KRHA 2D7CA 4HDAA 4CKBA 5JR3A 1AZSC 3WBKA 1O89A 2GARA 2IV7A 4HQOA 1X1EA 2NWQA 4IW3B 4B6QA 5L4SA 2BGIA 4PIMA 1QV7A 1Y6QA 3WLJA 5HZHA 1T9DA 4Y8VA 2HRZA 4YCDA 1GXSB 2NSHA 5H5JA 4B3HA 3OD1A 5DOVA 5LDHA 4DMHA 1Y9EA 3NBFA 2G1KA 1U6KA 2CCKA 3WYDA 1NBME 2OZKA 1LK0A 4FNMA 3M4JA 2ZRIA 2XOKD 4X44A 1EI9A 2QN3A 5DRTA 4KFTA 1KYTA 4DNXA 1KE2A 5E3HA 4O8CA 3U31A 2FJ0A 1DNPA 2WVHA 3NTXA 2EZTA 5H3HA 4C9BA 1VSBA 2HMYB 1PFWA 2WIGA 4GXTA 4WW0A 2C9MA 2WU8A 4GHWA 4AKHA 2DQZA 3B1XA 5DZSA 5TE9A 4BNHA 3IBSA 3P9SA 3IERA 1CYDA 3GFBA 4OHWA 2XDYA 2QZSA 5IMBA 2YNMD 3WGJA 2WICA 3L7YA 2B2NA 1RR6A 1TUGA 2HPZA 4WXYB 4JX9A 4Z8XA 5AM1A 3P0IA 4S12A 5JWOA 1DIAA 1DFIA 1CC1S 2A58A 2FSFA 5I4KA 1B1AA 5EWJB 4UQPA 4DKJA 2OXEA 4KR3A 1WR8A 4HWGA 3U16A 3SY8A 1O6FA 1VJ1A 3DPUA 3DM9B 4HLDA 2EFHB 1W581 2Q5IA 1YR2A 3L7MA 1ZH4A 2OGZA 4F6LA 3CF0A 1HDGO 4URVR 2EW2A 5CEFA 3EG9A 4KXUA 4JQOA 4JFRA 5B7NA 1TJYA 1Z7WA 2YL2A 1GGJA 5JFOA 3DBRA 4C20A 3HU2A 4TLDA 2GEDA 4XYMA 5EKXA 3IQWA 1UUFA 4WESA 4QYXA 5DDIP 5C4IA 5A0VA 2GUGA 1HYHA 2FGKA 2WNHA 4W8OA 5JO0A 4XWAA 4K46A 1SURA 1LBIA 1ZK3A 2BFDB 2CFRA 5BW5A 5HQJA 2H4FA 3HXLA 1GZ4A 1LLFA 3ILHA 3GRRA 4P81A 2AEEA 4RHUA 5FL3A 3SIXA 3I2JA 1JFFA 5EIBD 2HM7A 4S3MA 5CX1A 1I13A 3AW8A 1JHAA 4KV7A 4L5AA 1K3UB 4Q4LA 5JO9A 3WZ2A 5KNBH 1DX4A 1YRAA 1RABA 2VNJA 5T4BA 3WMRA 4EI2A 2WWTA 3VSDA 2BFBA 2NO0A 1BQEA 3PC4A 3K53A 2Z8XA 3B8EA 1H0RA 2C3PA 4QXQA 3KYDA 2BCGY 2FXIA 3LLCA 1AF4A 4YV0A 2DCUA 3R7BA 4NNPA 2KHZA 5T3UA 3BJEA 3V42A 3IIKA 1V1MA 2YZ7A 3KJXA 3OP4A 4YJGB 1LX7A 4YRJA 4R3UC 3DB1A 4CM4B 1J5PA 1XK6A 2PG3A 2E87A 3NKFA 1N5MA 3KQUA 1BD4A 4I2VA 3OPVA 1DHTA 3X0DA 4B31A 3H19A 1DRVA 4RZXA 2ALJA 4TSFA 5T57A 3HBJA 3WSWA 4MUHA 4YJ2F 2FEPA 1X7WA 3KQQA 5T67A 1KVSA 3I1JA 5JSZB 4Z49A 2R60A 3ROQA 5B6IA 2I6GA 2FH5B 1QIHA 2WAOA 3VR3D 3WIVA 1RD4A 4P35A 3RS2A 1TAUA 3KTDA 3MJFA 4IXTA 2IDMA 3UVEA 4RCVA 2H9YA 1ZJ6A 1XYVA 5A62A 3VSAA 4C5BA 3OZWA 4QOFA 4R2JA 5LZ9A 2PUVA 4KQKA 1B3BA 4CKYA 4ZT7A 4TL9A 1IBMB 3AZPA 4HJXA 2VAPA 4LJSA 3OM0A 2ZYWX 3K70B 3RIHA 1TQHA 2ORIA 4CMEA 2A5DA 2EDAA 2EWWA 2W2NA 4BQPA 4F71A 1GZSA 4IP0A 4QTTB 5DSXA 1NUHA 1JJAA 1SG6A 3KXIA 2IU0A 3VUEA 4Q7JB 5F9FA 1Z2EA 3GJ8A 4FYMA 4RMIA 4U3JA 1FP7A 2IHBA 1DRUA 1RACA 3KT6A 4YI5A 4ZU1X 5I4IA 1ND6A 3PTLA 2ZS8A 7MDHA 3FB1A 3HUEA 4RVOA 1I0LA 5DT9A 1C9MA 3HY3A 4L75A 2Z43A 1M9NA 2FFBA 3PQDA 4P3OA 1GAQA 4KLCA 3B3JA 3H9JA 4Q7KA 1NUSA 4QVKA 3SGLA 1ATIA 2AJTA 2H1RA 2J32A 3IE0A 3IQHX 3M5PA 3HXPA 5HJ5A 4TMKA 1YCHA 1MQAA 1PGOA 3RVSA 3DLIA 4P7KA 4MMZB 1ODFA 3PGA1 3KYBA 3GDFA 3PVZA 2O2GA 2EZUA 1CRZA 4CMAA 3KL2A 1BDMA 1DAFA 4OOEA 2QUHA 3C4JA 1HEYA 4C87A 3AHIA 4DJAA 4F86A 3G0OA 4YMUA 5B4TA 1N2OA 1R5JA 5LUBA 5DF1A 1FQOA 1BDJA 1VBKA 4JQYA 4TRRA 2GHIA 2A5JA 3QE0A 4K9LA 1QIJA 4DBLE 5KVQA 3VM6A 3VYTB 1ANKA 1KMIY 1D1QA 1KVRA 2GZSA 2VEOA 3T12A 1CY7A 1Y8QB 4FR2A 5G53C 1CPYA 1PBTA 3EW9A 3GNTA 3OT1A 3R3HA 4ZD6A 5ICGA 4ACBA 4PZPA 4Y9DA 4LZAA 1HQDA 3U1VA 2MYPA 3DHEA 3QVGB 2WIFA 1UP7A 3I4LA 2GEBA 1OPRA 1L4NA 1S8AA 2FEKA 1ILEA 3HFGA 2FWAA 4JKYA 3LW7A 3FM9A 3V2GA 2XCLA 1X77A 2GSDA 3D8NA 4PN7A 4PVDA 4DILA 1WTAA 1U8EA 1QKJA 4HX9A 3U40A 5L3SB 3QJ5A 4V0NA 3HEBA 3PE3A 4Q1EA 3ER9A 1V8ZA 4FJ2A 2C31A 4ZHSA 5JH7A 1FRZA 1RAIA 1FA9A 3DZIA 4BDSA 2HY7A 3VHQA 1ZOLA 1Z2NX 3L0OA 2I3AA 1VJRA 1WS6A 1YCGA 3A1FA 4ONEA 3ZPXA 4ZYLA 1C8BA 2AJCA 1QBGA 5JQGA 2BHNA 3AUYA 2Z1DA 3H6KA 2XVMA 1T3HA 4PSDA 3ZG6A 4DIKA 2BBWA 3VH4A 4EG0A 5KWEA 2IBTA 3REQB 3OQJA 4RY9A 3T99A 1EHYA 4TMFA 1UP4A 2I3ZA 3EN0A 1YV9A 4YS6A 1ULUA 5DGIA 1VGRA 4A26A 4JP8A 4BB9A 4DE5A 2XNCA 1Q7CA 4EPXA 4DRYA 1TK3A 2XWQA 3DW3X 3TE7A 1N5RA 2BBOA 3UB3A 3AM5A 4KRGA 1ZC4A 3AHEA 1QQ7A 3HWWA 4AICA 3ZCSA 1XRLA 5JAZA 1RC8A 1RTTA 4BEVA 1W88B 1WY5A 5J2UB 4LMRA 1YACA 5LBIA 1SY7A 1TK9A 4CIWA 5EN4A 4I9FA 3C14C 4XGRA 4EYEA 5CXQA 2EFGA 2Z04A 1R7RA 1USIA 2ZB4A 3M9LA 2ZUUA 4MW4A 3ZIAA 4NRDA 2O8CA 4IMJB 1IM5A 3RYHA 5I7OA 5LOVA 4RK7A 4ZN6A 2YWGA 1BXRB 2RC6A 2VHJA 1OYVA 3FOAA 3H9BA 5A4FS 1KP3A 4B7XA 1U4OA 1P5FA 3AR8A 3CSUA 3LBIA 2CNKA 1BO6A 4TV8F 3KJFA 4OM7A 3W2TA 5CVTA 2BSXA 3AJ8A 5EKSA 1PYDA 1HUQA 1MN6A 2MYTA 1JBKA 4YECA 5CAEB 5FUYA 3M7IA 5FYQA 2NTYC 2P0YA 3GELA 3G2QA 1SULA 5FPYA 5JMPA 5KOIA 2TMDA 2ZREA 2R7AA 4AI6A 2H92A 1FXWA 3SMQA 3UJNA 3QP9A 4F85A 5KX5F 1KO5A 1FYXA 1IXKA 1VBMA 5JARA 3RIMA 4KMOA 4W7HA 4LHVA 4DA6A 2ZW9A 4CTKA 1YC2A 2D1RA 5EQDA 2PNFA 4TS4A 3U9SA 3IX7A 4G41A 1A2BA 4F91B 3TW6A 2RHWA 5AKGA 3JVUA 1YL6A 4KQGA 4CL8A 4FCWA 4S04A 2DR3A 3OCUA 2EKLA 5KNBA 1S8OA 1T3TA 4AG6A 3NI2A 2ES4A 4IVQA 1VZ3A 3W5JA 2VBGA 1UDXA 1M5RA 3Q1KA 3ZCQA 2IX3A 1ARZA 1WXXA 4FDLA 4ES6A 3L8FA 1G55A 721PA 2VXYA 1AMUA 1Z4MA 4MWTA 4OHKA 2WJHA 3O75A 3NU1A 2WT9A 4P31A 3ZDXB 3ZHOA 2C5GA 3UJ7A 4OMUA 3H87A 4Z0TA 2Z83A 3MJHA 3PXEA 2IYXA 3W9BA 4UAUA 2JHCA 1EGQA 3OKPA 2DY1A 2D2EA 2P9QA 4FDAA 4R6WA 4MB2A 4C29A 4EO7A 1XN1A 1E2IA 1TA0A 1TZ2A 1ZD2P 2C00A 1QX4A 1EXWA 2ZRQA 4TMYA 5D3KA 4ZU6X 4NHEA 4OATA 3BD7A 4JXKA 5EJ7A 2GPJA 5TPWB 3VOSA 3SDZA 2VZ8A 4HGOA 3KSUA 3ASZA 5IVIA 3T38A 1F2TA 3ZYZA 3UPTA 2Z8YM 4HVAA 3QYJA 4DJFC 3I6QA 1KAOA 1T2AA 1I72B 2WZDA 1I2AA 1M76A 5JCJA 3PUJA 4HBZA 4BNJA 2PVCA 3AXSA 3FOZA 2IJGX 2YRFA 1Y33E 4DTIA 1F38A 1I6KA 2VRBA 1GARA 5ES3A 3DAGA 1IU9A 5DN6D 5TIIA 5LA6F 1F7VA 1EM6A 4LE2A 1KDPA 4LZJA 3C3AA 2FZEA 2QM3A 4G1BA 5LUAA 3PC8A 4FMCF 4IUDS 3DFMA 4FCCA 2XYVA 3DYBA 1Y9DA 1D4OA 4Q4JB 5D85A 4HNAB 2QR2A 3C70A 2NZ8A 2ZT8A 4YP7A 4B4OA 1RXUA 5F3DA 2DU8A 1G20E 1JYSA 1LFAA 2VH5R 3N7UA 2VJYA 1JR3E 2IV2X 1TQ4A 2QGZA 3VNVA 5J59A 1I7CB 3Q9NA 5HTKA 2QUJA 5HMMA 4LXTA 4YBZA 1KOLA 2OSBA 2P3QA 2IYLD 3SJCA 3OEWA 3BN3A 3WIBA 3LYUA 2MMCA 2UZ1B 4UUBA 4XLZA 1Y1LA 3IT1A 3K30A 3LLSA 1M0TA 1NXVA 1CHNA 5IM4A 2HBRA 4OK5A 4DDVA 1GQ2A 1M5TA 1XYYA 2JD0A 1EFPB 2VF5X 2BMDA 3F46A 3I3SR 1YI0A 4BKQA 1LTKA 3T7CA 1N7JA 3HJRA 1EFHA 4IIVA 4LJ7A 4C1BA 1H4VB 4E5MA 2IF0A 4BJ6A 2AW5A 1KEVA 3MILA 3MSXA 1ZGZA 3PGLA 5AXAA 2ZJOA 1YMVA 3LQRA 4LJ9A 1T9AA 4DEYA 3WWZA 2AD1A 1YZLA 2VJDA 4ODIA 3HDHA 4WY2A 3U4DA 1QIDA 1MT0A 4ITVA 4OQXA 1NVDA 3DG9A 3HE3A 5ETJA 5K2MA 3GV0A 1Y4UA 3DDSA 4P0TA 2QPOA 2C96A 1JALA 3ESAA 2NAPA 3R0VA 1VCHA 3PL1A 2IZ6A 3JYPA 3N05A 4QDUA 2L2QA 5JZMA 4FM9A 2XGGA 1W19A 4O5OA 2CDRA 5H81A 4EQ6B 1EM8B 2G76A 2AX3A 1DJNA 1RHJA 1OFHA 1MGOA 5BNWA 5ITZB 3UA3A 2BGMA 1T1RA 1TYDE 4JUDX 5E1DA 3SS8A 4ER6A 1H0HA 3SM9A 1WBDA 1OW3B 3G9XA 3SSNA 4AQYB 1SZCA 1U0HC 4N4AA 3VYRB 1WZ2A 1ISHA 2AHRA 1H3FA 1MHMB 1J2EA 4CU2A 3TSOA 4BVAA 1FBNA 3A27A 3O4VA 5K0LA 4EI9A 6NULA 3RC8A 4Z0HO 3AVOA 2FW6A 1X1DA 2OLKA 3BMQA 3GZNA 5GTDA 5EMJA 1E7SA 1YMQA 3F5SA 4RVCA 1NF8A 4E2YA 5T7BA 1G59A 4WBNB 3FHTA 2VYVA 1HT1E 4KJXA 4TUYA 3QLVC 2G72A 5KYKA 4EKGA 3GO4A 5KQLA 4B81A 4FYKA 2CJXA 4HOYA 4TXHA 1MXFA 1MB4A 4XASA 4H3VA 3N6RA 1P77A 3Q7TA 3RYIA 1B0ZA 3AKZA 4EDHA 1E1CB 2EZ4A 3ZLJA 4GP7A 2F55A 1XMQB 1RQXA 1RBYA 1V47A 2HD4A 4F38A 1CEQA 5IXJA 4N41A 1C7EA 4QULA 4HN4B 1W9HA 2AFHB 3JTEA 3RBZA 2XUKA 5DNEA 4ME6A 3T7EA 1B14A 1CX9B 3AR2A 3I23A 2XMZA 3GEEA 4H0NA 1OX5A 2P5YA 4CTJA 4LJYA 4ZARA 5IMSA 2QUBA 4Q3EA 3JQBA 4OXYA 4PO9A 3OZFA 4HX5A 1Q3TA 2F3UA 2Q2OA 2X8BA 3TL2A 4O4JA 1KDYA 1ZUIA 2P2CA 3OCCA 3OH8A 1VTKA 2R9VA 3KTOA 2IQIA 2O20A 4GC5A 3DMRA 5CNJA 4ZCSA 3TTSA 4HDKA 1D4FA 2HGZA 3GRUA 4BV2A 5GJVC 2BLNA 3UJBA 5I8PA 4QG7A 3DNFA 1AO0A 1DRJA 1BW9B 4JDPA 1U98A 3WWOA 4RE5A 1YFKA 3D4IA 1RYBA 4I50F 3Q2IA 1N2JA 4YAFA 1RWBA 2JFUA 3FYUA 2MCFA 3HHEA 4ZYTA 5CYPA 2Z5FA 1UDRA 1Q0TA 1XKTA 2P0AA 2XRMA 3OFVA 4ZO4A 1NUQA 3DZKA 4G5FA 1GKYA 1I2MA 1TF2A 2CUZA 2EAUA 3ESYA 1P7CA 1ZI6A 5DOZA 5EP4A 1GLVA 2YWBA 1GL3A 2YJ3A 1WP4A 3CC8A 3I6ZA 1L4YA 5FA8A 5BR4A 1HG0A 3G5AA 4UU0A 2DBZA 4WGGA 1C3JA 4B32A 2OGTA 1XTRA 5DX0A 4BNTA 3OZSA 1VE7A 3THWB 5FOUA 4K28A 3K9LA 3L8ZA 5F1PA 1ACJA 4WVLA 1J00A 1I2ZA 1CRQA 4J0KA 4I19A 2BDTA 3VJMA 4A8JB 5AHKA 4BFVA 4EFNA 2X9VA 1MA0A 3QFSA 4IV0A 4N3NA 2ZBEA 1CNMA 5JZBA 3OSZA 4ZAYA 4DQKA 1L7BA 1MC1A 5KVAA 4O08A 2CWDA 3GR6A 1G5QA 1ZM9A 3IAHA 3ASUA 2J6IA 4ZJUA 5K03A 3GP3A 2HMAA 2BHRA 4LZNA 2FPKA 3B6EA 1C0KA 2L42A 4M99A 4YFVA 1YUBA 2DB3A 5A7GA 3AQIA 3QLEA 1QV9A 4MQMA 3LT5A 4Y6PA 3R24A 2B0CA 4JUBA 3DBLB 3EXHA 3WGKA 5BXQC 4OGGA 5C1PA 3M3PA 2JIZA 3VPSA 3QUCA 2VDNB 5LB2A 5A9TA 3EP8B 1XAHA 2O0JA 3O84A 5TARA 1V3UA 3WYAA 8GPBA 5ERYA 4YCMA 5AHWA 1VG1A 2EZ9A 3EA4A 4NU6A 4IQ8A 3H2IA 4RS4A 3AY6A 2UZ4A 3FXAA 3PDCA 2XJ4A 4FFMA 3HCDA 4Q4HB 4C7MA 1VJDA 2N9UA 4J7XA 4KACA 1XMOB 4BCCA 1O7JA 4A36A 1E79A 2A4KA 2QJWA 1FMTA 2HU7A 3A6LA 4ZZ2A 3V7WA 1IE3A 1SXQA 2LKDA 4DEXA 1U1IA 1MNQA 5EHNA 2AD5A 1AT1A 1UXKA 2DFKB 2IZ1A 1QNFA 2HBZA 3GUCA 3M4NA 3PUXA 2O3QA 4FIDA 2P75A 4DWOA 2B3DA 5LCXA 4ZGWA 1SHKA 4DZTA 1FOEB 2BD0A 5E6UB 5K8LA 3K9FC 2OV4A 2RGWA 1JZSA 1VL1A 4ATNA 4D0GA 1AZLA 1U3VA 1EMDA 3CEPB 4PG8A 3PUYA 3DYIA 4UM9D 3V80A 3ZE6A 2JA1A 5CFLA 3PEWA 2EXXA 4YX9A 3R0QA 3SXPA 1BCSB 1GWNA 3L1IA 5G40A 2DRIA 1JDSA 1BHQ1 2P4HX 1ZMOA 3SJAA 1C9JA 3C87A 1NL3A 3SKXA 3WKBA 3DOHA 2ZB7A 1VRWA 1E2NA 2QL6A 1BRMA 1O03A 3TIFA 1GPBA 1MCZA 4G0YA 4R8VA 2XUJA 3SIPA 1NQ5A 2I7XA 3B1KA 2AMYA 4WK0B 5LB4A 5IF3A 1YE8A 5ALVA 1X7XB 2NVWA 3U09A 1P0CA 3TI9A 2O2SA 3V2HA 1LVUA 3RK1A 3V7UA 4HZIA 3T9BA 5ES4B 1YR3A 3BMNA 1XAGA 5GP1A 4M98A 4FGZA 2NQ2C 4PYOA 4TRMA 3FWYA 1AQ6A 4A73A 1SKQA 2CHVA 3H86A 1OSNA 4F56A 5JQWA 1Q1ZA 2EARA 2ZJ6A 3DS8A 2XTZA 4JBHA 4Q15A 5JLJA 2WINI 3LS2A 3JD0A 3ZVLA 4V02A 3QFCA 2CEKA 1JFTA 3TYXA 3MMXA 2PZEA 3W2HA 2ID8A 2YHIA 3LY8A 4G89A 4LHZA 1FDOA 2ZWAA 2Q1TA 2I66A 4OLJA 1WHTB 4ESOA 1E6WA 2P9YA 3QSGA 3ONNA 1NVBA 3B9QA 5K8VA 4ZYVA 4EQZA 1XD8A 3ZKWA 1GTRA 1EFVA 1HTBA 3BWMA 1AX9A 1VMEA 1Z4KA 4UW9A 3PD7A 4L6IA 1UMCA 2YJTD 1ADCA 1OLUA 3HBMA 4RADA 1I51A 4L57A 2V5AA 4KX5A 2WYVA 5HIMA 2AC7A 2JGRA 2H2WA 5JDCC 4PG6A 1R0XA 3HYCA 2BFEB 1J2JA 4KI0A 4UUMA 1EBBA 1EFCA 1Q6ZA 1QIMA 1OAOC 4L85A 3PQFA 7ADHA 7MHTA 1A77A 3BDIA 3HGMA 1SA0B 1WUJS 1V16B 4ZQBA 2PUDA 1T4CB 1FTGA 2PY6A 4CE6A 1Y8ZA 5ALEA 2CZGA 4FBMA 1HG1A 1W8IA 1X0XA 4D4KA 2CVZA 5AFSA 4GI2A 5LIRA 3F8WA 4IV5A 4UREA 2A1IA 3QEMB 4D5GA 1OPXA 1PR0A 3NDPA 3FX2A 4JGIA 5IJZA 1RM0A 1MO6A 2UZ3A 1L7OA 1HLDA 2W83A 3L4KA 5ALJA 2L19A 2FUG6 2LRHA 4Q37A 4ZOCA 1E2FA 3THYB 2V3WA 1IM8A 4ZHQF 2VYNA 3DD5A 1Z62A 4J90A 5GVRA 1MR3F 3GWZA 5GV7A 1RJGA 4ZVNA 3TEJA 4Q34A 1FFSA 4IDHA 4WXHA 3VTAA 2PMWB 5FPKA 1YRQA 1A8PA 1I0ZA 4BQNA 1BCRA 1PE0A 4DMCA 3CM0A 4P33A 3A0RB 1UJMA 2E4XA 3WLTA 1F8XA 1JUDA 2FPWA 2YY5A 4OPMA 4F7DA 1QV6A 3NYIA 4ZMRA 4ARCA 2YJ4A 3A1DA 3FDZB 4MR7A 1JHVA 3IA2A 4JITA 4MVXA 1RQ7A 4V0LA 6ADHA 3SLGA 1MTZA 4YRDA 1RXSA 1FF9A 4G1UC 2GTPA 1QLJA 3HZRA 1K63A 2BISA 1DQZA 3WGOA 1QGUB 3OC0A 4GSYA 3WIUA 3MELA 3WLMA 4DWWA 1PFKA 2ECOA 4Z8YA 2A8YA 1R15A 3FRJA 4LBYA 3EA5A 2Q21A 1M1ZA 2JD1A 1JBEA 1KK1A 2CJFA 4PX9A 4CF6A 4TWJA 4UFOA 1HYBA 2IOQA 4GBGA 4LJLA 2ZB8A 3ICWA 1XL1A 2WRZA 3X44A 5LQNA 1YK1A 4WUTA 2QUZA 5EZSA 2YY7A 4MP8A 3VGPA 1BXZA 1ZN2A 4QUKA 2ACKA 2PQ2A 1ZM7A 2NZXA 3DR5A 3O2NA 4KXVA 2QJRA 4FR0A 5CM8B 1XELA 1IUKA 2E4YA 2G71A 4FYWA 1UBHS 4C43A 2B1IA 3HKCA 5EY5B 3TJMA 1JDUA 4RV9A 3SKVA 3ZVMA 1DKLA 3BWEA 3NJ4A 1HFJA 3CISA 5T5QA 2HF2A 2QRKA 4LF4B 2V6GA 1MJ5A 1SVWA 4ZVLA 2JLXA 2YCLA 4FLEA 2GN2A 4KL8S 5AVUA 3OU2A 4D9HA 3BIXA 2I55A 2XIJA 4OV6B 4H9GA 4XOIA 3X1DA 1Q14A 3EEOA 3UAYA 4QPPA 2I91A 3EXEA 1RAEA 4BLRA 3LX4A 1QVRA 1XU4A 4NATA 4QSMA 4R8MA 1PVDA 3EP4B 1SIOA 2C29D 3QU9A 5D1NA 3OT5A 1BU5A 1AUXA 2C3MA 1CR1A 1U2RA 1WQ3A 3A9WA 4K26A 2OHXA 5EZ6B 2ZSBA 1Z2DA 2QAJA 3NAZA 4QARA 1IOVA 3QYAA 1JHUA 1J8DA 1VI5A 3FSGA 3CH4B 2ISQA 2RGCA 4C0HA 1JKJB 3IBTA 2RCNA 4ECAA 1XP5A 2YHSA 1Z0KA 4MW2A 2QY6A 3FWNA 1AKTA 2JK1A 5BWNA 2FEXA 5BR7A 4MVJI 3HCNA 3UMYA 1X13A 2XB9A 1GQRA 5DTRA 2EJCA 2PX3A 5DMHA 1Z9BA 1UBKS 1YDGA 2H5LA 3AR6A 4N8EA 2IPOA 1NN5A 2WYIA 1XZDA 2WMOB 5JAMA 1AK9A 3B7GA 4NJEA 4BFYA 3MRTA 2R66A 1JAXA 5JCOC 2H5EA 1KZ9A 4PLTA 1EFDN 4FHDA 2BEJA 4AMBA 1M34B 3VO2A 2OXIA 4BFTA 3ZWWA 1GU1A 3ZEIA 3LY5A 2CFCA 2DFPA 1CUDA 1OVMA 1TT7A 2JVIA 2CLLB 3G0BA 3L6EA 3LYHA 3R5SA 4FMDF 4P4LA 5ECGC 4YXWA 3F1LA 4X8HA 1Z18A 4UMDA 3SSOA 4BC0A 4MB6A 4QJBA 3RYCB 1EESA 2RB4A 1W75A 4JJ6A 4JBWA 4AJJA 3V8NA 4L02A 4MV8A 2P9JA 2WFMA 1SBNE 3UGKA 1M1NB 3CVOA 4F84A 4D8TA 4ZHQA 3KFVA 1TK2A 5B64A 1OC2A 1R6BX 2DJ5A 2XLCA 2VTBB 4ARVA 2VDWB 4C21A 1ECPA 4EP1A 3PLNA 2JGDB 3DZBA 2CZCA 1G5RA 2QIPA 2XITA 4OHYA 1S0UA 2CHEA 3HDJA 2QRJA 3GK3A 4L0DA 2I2WA 4RYLA 5JNSA 3K6JA 3A37A 3H18A 1VC2A 3LHSA 2HFKA 3NH9A 5T8KA 3VVMA 2C78A 2YS6A 5CVJA 1OXMA 2XQJA 5JD6A 4ESEA 1TC1A 1FU4A 1IATA 3UJAA 2D0PB 2WJIA 2JCVA 2XY4A 4KBGA 2ATXA 1VCOA 3DL4A 4D41A 2QJTA 4LQ4A 5BYAA 1SO8A 4HDMA 3TX6A 1A95A 5EP3A 5C4MA 1RQNA 4B1FA 3AVWA 4GECA 4ENSA 1DC3A 1O94A 5LMZA 1KS9A 4V0KA 4R40A 4KRXA 3HKBB 5L3QB 4KXWA 2ZVJA 5JPDA 5IVKA 1Q74A 3IOEA 3OUZA 1N0HA 2IXGA 3JTMA 4O4HA 4RF4A 5GM2A 4FFPA 1NBHA 4MWDA 3C15C 4OXNA 1QGDA 1RIFA 3LBHA 4Y2SA 4EMTA 1MX3A 2J6BA 3MG9A 3PXUA 3H04A 1WB5A 4DLNA 3PSHA 4GE3A 2J07A 2JH3A 3AR7A 4JB0A 4MCHA 4XUDA 2JIDA 1ZICA 2Y05A 2ZBPA 1Q7GA 4XARA 3CA8A 5HIKA 1UBOS 2J7KA 3VC1A 3LBFA 5FUMA 2FWNA 5IW8A 4PPQA 3SF8B 1OTXA 2VCEA 3W6UA 2GHRA 2I4IA 1OBCA 4IH1A 3KV1A 5J2TB 4LRQA 4YAKA 2AFIE 4H0FA 4BTEA 2O2JA 3PU6A 2RSLA 1TM5E 1I79B 2C1EA 1LU9A 3LUHA 3PV0A 4US1R 4Y9SA 5FPTA 4BLTA 2JIQA 4QVGA 1HEUA 2F1KA 2F3TA 2GK3A 2O8VA 2NZJA 2VSYA 3ZCTA 5I7EA 4RF5A 4IIGA 4Y2RA 2BMFA 2DHRA 3KAJA 3QBTA 4RVGA 4CXMA 1P6XA 1DEHA 4XYBA 1R4AA 4I4CA 4YJDA 4ENWA 3AEZA 3UMJA 1UF9A 5AWFC 3QVXA 3BJRA 1OWLA 3D3EA 4GPBA 1ZI9A 3W6NA 4UHEA 1COWA 4V2UA 3N3AC 3BIOA 4JD5A 5TEWA 1U2TA 3MIZA 3RRFA 3IAM6 4Y6SA 5JS7A 1JWBB 1PS9A 2B6NA 1EJ6A 2WKQA 3KSRA 1UBLS 4RL4A 3TOVA 2ETVA 2WE7A 3ZCPA 1TFRA 1P0QA 2GCIA 2QTTA 4UXJA 3ZGZA 5DCWA 3CWZA