3Q2KA

Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
346
structure length
346
Chain Sequence
PITDRKIRFGLVGCGRISKNHIGAIAQHGDRAELVEICDTNPEALQAAEAATGARPFSSLSDMLAQGNADALVLATPSGLHPWQAIEVAQAGRHVVSEKPMATRWEDGKRMVKACDEAGVRLFVVKQNRRNATLQLVKKAIEQGRFGRIYMVTVNVFWTRPQEYYDAARWRGKWEWDGGAFMNQASHYVDLLDWLVGPVESVYAYTATLARRIEAEDTGVAALRWRHGAMGSINVTMLTYPQNLEGSITILGEKGTVRVGGVAVNRIDEWKFAEPHPDDDKIREANYETTSVYGFGHPLYYDNVINCLRGDCEPETDGREGLQSLALLTAIYRSARDGVRIPLPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Characterization of WlbA from Bordetella pertussis and Chromobacterium violaceum: Enzymes Required for the Biosynthesis of 2,3-Diacetamido-2,3-dideoxy-d-mannuronic Acid.
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Oxidoreductase
molecule keywords oxidoreductase
total genus 132
structure length 346
sequence length 346
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3q2kA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3q2kA01
1UZLA 3JYNA 3PTZA 5JXWA 1GCUA 1ADGA 5DDIP 2JJYA 3ONDA 4E5NA 1VRWA 3U49A 4FGWA 3STHA 4B7XA 3KYDA 1MA0A 3ZWMA 1C1XB 2XPCA 3NDRA 3P19A 4OM8A 4EJ6A 5I9LA 1AN9A 5JY6A 2Y0EA 3WSVA 3DBLB 3E1KA 4M49A 2NVUA 1GZ6A 2NTNA 2BFMA 3LLVA 4YPOA 4ND2A 1ENPA 4HNHA 2G17A 1B14A 5A5FA 3UCFA 2GZ2A 3G79A 2D3TA 3PPIA 4B3HA 3ENNA 4D45A 6ADHA 5A1TA 1WZIA 3SLGA 1MFPA 3KB6A 3ULKA 4RDHA 5G2OA 1KVTA 4HWKA 4GVXA 1PR3A 4KTVE 3I9LA 2CDCA 4RL6A 3V1YA 1C1DB 1HYHA 1NVGA 1H93A 5A03A 1M6HA 2VRCD 3VPGA 3WMXA 2X86A 1I3MA 2DBVO 2NQ8A 2D8AA 1O0SA 3E5MA 3IJPA 1N92A 1LEHA 1E7QA 1DJNA 3DR3A 2NWQA 4CLOB 1H6CA 1BXKA 1N1EA 2OOSA 4CLOA 1WDMA 2EF1A 2J3KA 4MPDA 4XRRA 4CV2A 3DOJA 5A06A 3L6DA 2D1YA 4R5MA 4TRMA 5BT9A 4KMSA 1R0KA 1NX6A 1YXMA 4OXKA 3ZWBA 4BO4A 3WBFA 3WGYA 5G0UA 3DQPA 5BSFA 5EQDA 1WDKA 1HDZA 2ZB4A 5JCXA 3W4JA 4MINA 4IMRA 2E82A 1W4ZA 5ICMA 5I7FA 4XIYA 2VTDA 3PZRA 2PZKA 4L74A 3T7EA 3D5TA 4ZA2A 3Q9NA 2YFHA 5BNTA 4IQGA 4ZQGA 4BKPA 1VL6A 4DIBA 3LC1O 1ISMA 2EGGA 3HN2A 3H9UA 1ZJYA 2JCVA 2ZTUA 3IUPA 4MVJF 1E5LA 2WE7A 4U6QA 3GLQA 4B3JA 4CMCA 4WLEA 2O50A 4HNGA 3AY6A 2NACA 3NT2A 4OKNA 3GDFA 1JWBB 3JD2A 4XYBA 5CHEA 4OHUA 3PWSA 7MDHA 1P33A 1Z6ZA 3DL2A 4RV9A 4WNIA 1DAPA 1P1JA 5AOVA 4KDFA 2YQ4A 4BL5A 4DREA 4KDEA 3DTTA 5EIOA 4TKMA 3W1VA 1M67A 3WOHA 4HX5A 2H1SA 4DLAA 3K5PA 2BI7A 3HFSA 5A9RA 4YJGB 4B4VA 4JK3A 2NVBA 1U4OA 1GTMA 2Q99A 3ANMA 3AOEC 4GMFA 1OAAA 1Z74A 2B4RO 5THKA 1UZNA 2FN7A 3RVDA 3WGTA 2VT2A 5A9SA 3FF4A 3ICCA 4IPTA 2X0JA 1DPGA 4ROSA 5B4VA 2NADA 4YJDA 4P4LA 3WWZA 5CG1A 2ZB7A 4YAGA 1K6IA 2ZB8A 2HMVA 3PHIA 3T4EA 2XF8A 3DWFA 4Q3BA 2B5VA 2ZTLA 1CWUA 2VHWA 1U2GA 3QP9A 4NK5A 5B12A 2Q1UA 3GN2A 1GFSA 3GR6A 3UUWA 2QZZA 3IP1A 4XYLA 3C85A 1DIHA 3ETDA 1N9GB 3GK3A 3AFMA 1IL0A 4KWIA 4UEKA 1H6AA 4AJ2A 3RFXA 2DBRA 5HA5A 1PGJA 1A7AA 1UDBA 3RASA 1ID1A 4OQZA 2OO5A 4MKXA 4MOWA 1YL6A 1BG6A 4B8WA 2DAPA 3RD5A 5HWSA 3FR8A 1ONOA 4Y8VA 2BI8A 4L73A 3ZNPA 4YJGA 5CG2A 3LYLA 3OA2A 2OBNA 3O9ZA 4OOFA 1P1IA 1B3RA 1PZEA 2O3RA 1M76A 4W4TA 3TWOA 3VVBA 1EVIA 4ID9A 4R41A 2VRBA 1ZXLA 2X5JO 1IY8A 1QYWA 1ZK1A 2PGJA 3JQEA 3Q9UA 1ZKMA 4FSHA 4Y9DA 2A4KA 4ZQEA 1MFZA 4FC6A 4PIVA 1U28A 3A1NA 3W8DA 4ZD6A 2X8LA 4X54A 4E32A 4BNKA 3H3FA 1I2CA 1LSSA 4PLCA 1E3IA 4CUJA 2X1HA 1CYDA 4O5OA 1V8BA 3GRKA 3O26A 2ZYDA 4J9VA 3WYBA 1K2WA 3NYWA 4IQ8A 3QA9A 1E1NA 2HJRA 1ML3A 5DZSA 3DTYA 3D7LA 4WEOA 4M87A 4BNXA 3IQDB 1WPQA 4E6PA 5U4QA 2XXJA 1PL7A 2VWGA 5JLAA 2PLAA 3NDJA 4HKTA 5B4TA 3TRIA 2X6TA 1S6YA 3VC7A 3RKRA 1VSVA 1VLLA 2FZWA 2I5PO 5CFZA 3NAQA 5DBFA 4QEDA 3RUFA 4Z6KA 4J1SA 4WOJA 4XR9A 4E5KA 4YBZA 5HS6A 1ZJZA 4QSMA 5F3RA 2JD2A 4ALKA 1LDMA 4AJIA 3NT5A 4BUCA 3S2GA 3EW7A 2ZIZA 4EUHA 2BGMA 4JP3A 4HADA 4NHEA 1DIRA 3FPCA 3PGXA 3IL2A 1LSOA 2P4QA 2ET6A 3S2EA 2VT3A 1F8FA 3OQ1A 4H16A 3SBOA 4NBUA 1GZ4A 3K9QO 4JCOA 3FPLA 3KTDA 4YA6A 3GVPA 4J4BA 1B2LA 1ZK4A 4HV4A 1NQAO 1OC2A 3JYOA 3GOHA 1GY8A 2O4UX 3IS3A 1KEVA 2A92A 3Q2IA 3GAZA 4XDZA 4WLNA 3DHEA 3LF2A 4LW8A 1LLCA 4KP7A 5LDHA 4WNCA 3K96A 3KVOA 3GZ4A 4HP8A 4EW6A 3RROA 3UHAA 1DHTA 4ALIA 3PQEA 1EVJA 1X0XA 1PZHA 3I83A 4RVDA 2WD7A 4XEHA 3NRCA 1XU7A 2XAAA 1D1TA 1GDHA 2Q2VA 3ZDFA 1I2BA 4DXHA 1VJ0A 5KJCA 1GYQA 2D5CA 3OJ0A 5BNFA 4GMGA 2ZCUA 1H5QA 1TVEA 3HB5X 3L77A 2O3TA 2IDZA 4AJKA 5K6AA 1UH5A 2UAGA 4AJ1A 1I3LA 3BMOA 1K6JA 1KY4A 4XGKA 4FR5A 1UP6A 3VH3A 2NV6A 1DLJA 4M89A 4CMKA 4GH5A 4Z0HO 3DBRB 4MJLA 1XG5A 1PJCA 4R5HA 1E3EA 5C7LO 3IKTA 2WJPA 4CR8A 5TS3A 1CIVA 2Z95A 2OXIA 1YONA 4PG5A 3ASUA 1LQUA 2JCXA 2QYTA 3ITKA 4FFMA 2ZB3A 1ZSNA 2CUKA 4OYRA 1BSVA 3KSDO 3B1FA 4UVHA 1ORRA 3PLNA 1OFGA 2EKQA 3I6IA 4NDNE 3U62A 1E1MA 2X9NA 1FJHA 4GSLA 1JLLA 4JROA 1A9ZA 4PG7A 3JQCA 4UVDA 3VKUA 2FR1A 5MGBA 4FJ1A 1G6KA 1YVEI 1XSEA 3OJOA 4M1QA 5CDSA 5C37A 1P0CA 1T26A 4PG8A 1A71A 4TZKA 1DRVA 3UN1A 3QVWA 2ZQYA 3UAGA 1N7GA 3IMFA 1QP8A 3BMQB 2HRZA 2VYVA 1Y5MA 3L4BA 4RZIA 3ROMA 4CR7A 4BOYA 1UUFA 2Y1DA 4B4OA 3WGZA 4INAA 5TGDA 3BMCB 3JD4A 4R1UA 1Z7EA 3PVZA 1VSUA 3ZW9A 1ISGA 4UVIA 3ICPA 2IODA 1YE3A 1W6UA 3KSZO 2GF2A 5F21A 2NLOA 1TXGA 2PKQP 3A28A 4H7PA 2H5LA 1CETA 1LJ8A 4D44A 3FRJA 3GAFA 5ADHA 2QQ5A 2ZKLA 4ZU3A 1DB3A 2B36A 2FHSA 3ZNNA 1ENZA 3RC9A 1SMKA 4JBHA 3GQVA 4BNLA 3U0BA 1VKNA 3DONA 5FF9A 2YDYA 5F5LA 3IOYA 4XYGA 5AXCA 2YJZA 4E2ZA 2YFQA 3S55A 3U5TA 1NQ5A 4DGSA 3WICA 1Y9EA 5IN5A 2OHXA 4PZDA 3LC7O 4UUOA 4G2NA 3KUXA 2VZ9A 4CM9A 2PWZA 1HKUA 4E2XA 2G5CA 3PQDA 5JSFA 3DAPA 4DVJA 1DC3A 1EUDA 3JYQA 3R3JA 1EBFA 3RAJA 1WW8A 1KC1A 1D1SA 1C3VA 2QRLA 2JL1A 1PEDA 3ORFA 2DTEA 2WMDA 1Y8RB 3A4VA 1RM0A 3BMCA 3E48A 3LLSA 4I5FA 3RUHA 3UKOA 2GN9A 3OQBA 2E4AA 2E37A 3WLEA 2W2KB 5JDCA 3WTBA 2JD1A 4H15A 4GLOA 4E0BA 3PFWO 1D8AA 3P2YA 4Z9YA 1Q7CA 4YTEA 4B3IA 3GVCA 5JDIA 3NKLA 4HFJA 4M8SA 1SNYA 1F8GA 3Q1LA 4LSMA 1DBVO 1N8KA 4EGFA 4GKVA 2X0IA 3HNPA 1HL3A 5LDGA 2GN4A 1C0IA 2UYYA 3M2PA 1M66A 2X5KO 2PZJA 2Q2QA 3KOUA 4EEZA 3I6QA 3RBZA 4DPKA 3T4XA 4YAKA 3WGQA 4MIEA 1N5DA 2Y1CA 5DCUA 3ZH2A 1XCBA 1HDCA 3BAZA 4J9UE 4E33A 1FXSA 4CMEA 5T57A 3SX2A 3QWAA 3ZW8A 1OZAA 3M1AA 4BGIA 4YAIA 4MIYA 1E1LA 3G1UA 2H63A 4Z0TA 2EWMA 4J2OA 1JVSA 1LDGA 4WCFB 4WLUA 4BV9A 4Q3AA 1AUPA 2EIHA 1J0XO 1ZXBA 4BO5A 2CMDA 2C20A 2GN8A 4D7AA 1W0CA 5IDYA 1RM5A 2ZQZA 4WECA 4JXKA 2IZZA 1BTOA 2IYPA 5JPIA 5KKAA 5K6AC 1Q0LA 1UXHA 1VJTA 3CEAA 4CM8B 3I52A 1HYGA 2BGLA 1PJ3A 1U3WA 3DO5A 1HETA 2ZATA 3ONFA 4QO7A 2XXBA 1O6ZA 3F46A 1ISHA 5IDQA 4R69A 1LC3A 1U9JA 3GGOA 4U5QA 4IDFA 2VHXA 2GR9A 1C14A 4O6VA 3QVTA 4LSWA 1YBAA 4YJHA 4WKGA 4IM7A 1QSGA 4GSKA 4JLWA 4MIOA 3F5QA 2P9CA 2V6BA 3CMCO 1Z7BA 1E77A 2Z1NA 3FN4A 2EKPA 4DMLA 3ETEA 4CMIA 4GI2A 3LZ6A 3SC4A 4Q3CA 2WDZA 1GUFA 2PK3A 4WCFA 3BZUA 3WGGA 3D0OA 3AFNA 4BNIA 1XELA 1Z45A 2D2IA 1J6UA 3AOEA 4LCJA 3RC7A 1SPXA 5IF3A 4PZCA 1WWKA 3G3EA 1PSDA 3UGKA 1OMOA 5M6DA 3JD0A 3V2HA 5FI3A 4Z3KA 2QRJA 3FNGA 3VZQA 4XYEA 2WYUA 3E03A 3HQ4O 2OZPA 3JQ9A 2GO1A 3BHMA 2OUIA 3K30A 2VOEA 4L4XA 4PG4A 1GZ3A 3D3WA 4IDCA 2VNAA 2X9GA 3GRPA 3SXPA 3JQFC 1CF2O 1T25A 3BHIA 5THQA 5JCJA 5DOZA 3K2EA 1P1HA 4E21A 2FY8A 4FS3A 3GG2A 4ND3A 2B69A 1ZFNA 5TJ9A 3ST7A 3RKUA 4CMHA 3OIFA 4LMPA 3E18A 4P4GA 1DO8A 3BYZA 3OJLA 1JN0A 5BQFA 2HLPA 4ZHSA 4DYDA 2W2LD 3AW9A 3BTOA 5ER6A 2AG5A 4J7UA 3O4RA 2I66A 2NSDA 3LK7A 5COBA 4Y6PA 1XQ6A 2B83A 2IXBA 2HAEA 5G4KA 4F45A 5C5IA 4XYMA 3VPXA 3RUIA 3EAGA 3JQ6A 4N5LA 4RGBA 3N74A 1U5CA 2IEDA 3AWDA 5GMOA 5T67A 1IOLA 1GADO 2Q3EA 3F6YA 3VZPA 1KBZA 3SJUA 1TT5B 1EEHA 5H81A 1H2BA 3HG7A 2BD0A 5G0SA 3CUKA 4C4OA 5KNLA 4HY3A 2RCYA 3JQAB 3ANLA 4XQCA 3QE3A 4ITUA 4XR4A 2YV2A 5L7YA 1ZCJA 4AL4A 4BB6A 4BO1A 4CLXA 4E5PA 5KJ6A 3U4DA 3RIHA 4BKUA 1QLHA 4R1NA 1MX3A 1PJTA 5GY7A 4D3DA 2NTVA 2FOIA 1JTVA 4DC0A 3CH6A 3SEFA 3AY7A 4NJMB 2G0TA 4ALLA 3DHYA 3GY0A 3U4HA 5I9MA 1YH3A 4R9SA 5JDIC 4FN4A 1PX0A 3GEDA 4CPDA 8ADHA 4NNJA 5KJFA 2JHFA 5COAA 1ADFA 4DA9A 3TZKA 1GQYA 2VNSA 4TRRA 5EJ2A 2WWRA 3HDJA 2VCYA 1O94A 1QG6A 4D3SA 2GNAA 4JJIA 3RCBA 3NX4A 4GQAA 1E6UA 4F46A 4FD3A 1RPNA 5TRTA 2FR0A 2I6TA 4NBRA 3GUYA 3VH2A 1TT5A 5KVVA 1E7MA 4BMNA 3PEFA 2F1KA 4L4RA 3E9MA 3PJGA 5EMHA 2NU7A 2O4CA 5T5QA 1P44A 1A4UA 4RCVA 5F5NA 4NI5A 3AJRA 3W8EA 2JAHA 4F6CA 4XD2A 1RM4A 1VM6A 1KEPA 1NNUA 2YV1A 1PQWA 4R54A 2DQ4A 4RVUA 4R51A 1Q0HA 1EE9A 1NAIA 3K8ZA 4NFYA 5KTKA 4CMBA 5EERA 4YQZA 3OICA 2Y0CA 1UP4A 2VYNA 3FTNA 3RU7A 2Y66A 2OP0A 3DZGA 2HK8A 4CM4B 1O9BA 4MO2A 4Q3NA 1V3TA 1RKXA 3RC1A 4DLBA 4RF3A 3CINA 4NJOA 6LDHA 1HZZA 3U4CA 4TMFA 2C54A 1NR7A 2X58A 4GGPA 1SAYA 1FMCA 2VZ8A 3VZSA 2AQKA 4FOOA 4I08A 3PYLA 4HFNA 5L95A 3PK0A 4BNJA 4I5EA 1EQ2A 3OEYA 5JS6A 3GC6A 3MCVA 4ND5A 5ITVA 1U1IA 2D59A 1U8FO 2R00A 3WMWA 3OA0A 2Y93A 3ZI0A 5ICSA 4E12A 4MVJG 1VC2A 1UDCA 4FFPA 4II2A 3CSDA 4OQYA 5HBRA 1DC5A 1PZGA 4BO7A 1T2FA 2PD4A 4U7WA 5JY1A 4IJWA 1MG0A 1P3DA 4NG5A 4OH1A 4IZHA 3EZYA 1U7HA 3OM9A 1XU9A 3UOGA 5DBGA 4TROA 3QRWA 7ADHA 4I9NA 2GZ3A 2X7HA 4ZQHA 3GF4A 3FTPA 2OGUA 4RPLA 4A27A 2EG9A 5F1KA 3K92A 1M2WA 1GPJA 3ZV5A 2QZ9A 2E6UX 3M1LA 3W6ZA 4A2CA 4Y98A 1BW9B 1R4MA 3V2GA 1A9YA 1X13A 1VJ1A 2H9IA 1D7OA 2VHVA 4EBFA 5I7SA 3L0DA 3V5NA 3NTRA 1SOVA 1ZEJA 2DKNA 4W7IA 2O23A 3L4BC 1I5RA 4UUNA 2YHUA 3BTUA 4I5DA 2VOJA 1HSOA 1E92A 4IMPA 2P91A 4WJZA 4R4JA 2J3HA 3JQDA 2HMUA 3CTMA 4FFNA 5ENVA 4DQVA 1NM5A 4NZ9A 1L1FA 2EW8A 3OP4A 1KEWA 2F00A 3DAFA 4R1SA 4PVCA 1UAYA 3AK4A 3JQGB 4J16A 1PZFA 4YRDA 3HUDA 3QV1A 4PGFA 4O1MA 3ETGA 3RFVA 4BNUA 2CF5A 1PGPA 3OF2A 1GUZA 3PP8A 2C0CA 5JO0A 4YACA 1IE3A 2YDXA 3I4CA 5TSDA 3LU1A 2B4QA 2NU8A 5CEJA 4W7HA 1XHLA 4WEQA 1TI7A 1BW9A 2C07A 4MP6A 3TZHA 2DBZA 2TMDA 1QYVA 5IN4A 4KWHA 1P1RA 1NR1A 3H5RA 2GN6A 4JBGA 2P9GA 4R01A 3B20A 2ILTA 1NWHA 3NTQA 3CPSA 4QUKA 4BO0A 1BGVA 3PGJA 4CV3A 2DFVA 1EDOA 3QJ5A 2Z5LA 3AI2A 5ER9A 3H9EO 4ALJA 1NPYA 2YHIB 3ZWPA 2VUSA 1GD1O 2UDPA 4AJJA 4BGEA 4PCVA 1NBOA 1SZJG 1A7KA 3WB9A 1E7WA 3OIDA 4C7KA 4YJHB 4CMJA 4LVCA 4E5YA 3OFSA 3LT0A 1I01A 8LDHA 4BS9A 4AJOA 5G0TA 1ZMTA 1Y1PA 4CLEA 4D0RA 2BFPA 4I9HA 3P7MA 4U6SA 2R2GA 1F12A 1HTBA 4UUPA 2FSVA 2GRAA 3OMLA 2QYSA 2PTGA 1SEPA 4CLRB 3OSUA 2EKLA 3WYEA 5CPBA 4D0SA 2W98A 1ZUD1 2JFFA 1LRLA 3LSYA 2HO5A 2HDHA 5EINA 5KIAA 1JQBA 1O5IA 5U1PA 3ROKA 3L6EA 1GPDG 4R16A 2E48A 3LF1A 3P5SA 2CVZA 4FQ8A 4YAJA 4A73A 2CFCA 3DZFA 4RLSA 1IUKA 1FDSA 1I0ZA 4CMGA 4YXFA 5DBIA 2BELA 2A35A 1EE2A 3EUWA 1WAMA 4BO3A 2O3SA 4XA8A 1BVRA 1PGNA 4ZICA 3ITDA 2VWPA 1P77A 2DPHA 1WVGA 4DC1A 3JYLA 3VHRA 2AMFA 2V6FA 4B79A 1BRMA 1FDUA 3V1TC 2GGSA 3H9QA 4TVOA 3KBOA 1ENOA 5JYAA 2W90A 3MWEB 4YT2A 5I7VA 3D4PA 4FBGA 1E6EA 3I4FA 3KEQA 1PR9A 2Y1FA 1Z75A 1XEAA 2YHIA 4LRSB 4OXNA 4IQ0A 3EK2A 1MP0A 3GHHA 1T2EA 4IGFA 1JAXA 5L4SA 5JYDA 1P31A 2PY6A 4W9NA 4KQWA 3MJTA 4UEJA 1ULSA 3C1TA 3F4LA 1R0SA 4IDAA 4OSOA 4PLGA 3C1AA 2VWHA 4GL4A 1MXHA 1YB4A 2LDXA 1UXIA 2BHLA 3FNFA 3TNLA 3D5QA 4DRYA 2NUAA 1E7RA 3ZU5A 3F3SA 1CEQA 2DVMA 4IIVA 3PI7A 3GZNA 5KWEA 3U09A 2EEZA 5TC4A 5U9CA 2AQHA 4XJTA 3AUTA 4BMSA 5IAAA 1Y8QB 4GGOA 4K26A 4PVDA 5KJEA 2Y1EA 1XIVA 4N18A 4IIUA 3PIIA 3Q2KA 4NQZA 1E5QA 1HDYA 1E6WA 4EJ0A 1NPDA 3WTCA 1YWGO 1XLTA 1D4FA 1GAEO 3FNEA 3JYPA 4JJFA 4ND4A 4RQUA 4E30A 1ENYA 2Q1WA 3KXDA 2Y68A 4JJGA 1Y7TA 3D3WB 1CJCA 2Q4BA 2JAPA 5TNXA 1MC4A 1B26A 1ADBA 3D3EA 1DC6A 1J5PA 1VL8A 3K6JA 1ZSVA 3ZWNA 3ADOA 3S1LA 3WSWA 1R4NA 1N1GA 1GUYA 2FSSA 3FCOA 1NFFA 3PZBA 3GHYA 3NEPX 4PLTA 2C29D 3H2SA 5KKCA 5L9AA 1YOVA 1WLYA 3AM5A 1G0NA 2VUUA 3H7AA 5A9SB 3RSHA 4IS2A 5JMWA 3KHUA 2HMSA 4E5MA 2G1UA 5L7WA 4K6CA 4IS3A 3DC2A 4OGWA 4D43A 1AXEA 2OMEA 3SJ7A 2WSBA 4CUKA 5IJZA 2B0JA 1ADCA 1HSZA 1ZMOA 3DEYX 4P38A 4DBVO 1R12A 4F3YA 3F4BA 4CODB 1GQQA 1JAYA 5EESA 4DPMA 1K0UA 1N9GA 1YJ8A 3N7UA 3DBHA 2DTDA 1SBYA 3AOGA 3JTMA 5JNLA 3SC6A 4YQYA 3UF0A 2FPGA 3ZV6A 4J1QA 4DLLA 2CSUA 4JNKA 3WQSB 4Y6SA 1IHXA 4YRAA 3DDNA 4FCCA 4G81A 5DP2A 1HE2A 1GL3A 2NU6A 1E3JA 5BSEA 1I3KA 2W2LA 4R68A 3G0OA 4RF2A 4DYVA 1U2DA 2CZCA 1JW9B 3PYXA 1BVUA 1I24A 3ZV3A 4CV1A 1UR5A 3E9QA 3CKYA 2AE1A 3WIEA 4CL3A 4BQPA 1E3SA 2Q1SA 2Q46A 3AY3A 4KUEA 3QWHA 1ZO8A 4JIGA 2AEJA 5H83A 4GKBA 4ILKA 4I8XA 4BVAA 3RUAA 1PJQA 1X14A 4J0FA 1JKFA 1Q7GA 2HRBA 5A05A 4N5NA 4EUFA 3PDJA 3PFFA 1PJSA 1V35A 5ES3A 3W4KA 2E49A 3OJFA 4J2HA 2GDZA 1JA9A 2EP5A 4E2YA 5BNIA 1U3VA 1A27A 3H5AA 4PZEA 4K1LA 4YR9A 1EBUA 2X22A 1JVBA 4CM8A 4XX0A 3LVFO 3AUAA 4ZVVA 3WFIA 1N7HA 4WCDA 4OO3A 3KSUA 3MWDB 4QTZA 1YGYA 5KCZA 2RH8A 1QLJA 2DLDA 3WNVA 1LBEA 2YV3A 1UXGA 3I9NA 4UEOA 4BB5A 2BGKA 1K89A 1B15A 2P68A 4M86A 2PGDA 2GPTA 1DHRA 4HUJA 4MVJI 1UAGA 1R16A 4IUYA 2IYOA 3LT2A 3H6KA 4MP3A 3OJEA 3ZNOA 3MJVA 4PLWA 2IZ0A 4BKQA 5IDXA 4BO9A 3ZWXA 3WXBA 3DZKA 3KYBA 2V6GA 4Q3DA 3QSGA 3U9LA 1PU2A 4D3FA 1BDBA 5FI5A 2CDBA 4B8ZA 1ZW1A 1KYQA 3WYCA 1R0LA 4W9NC 1HDGO 1PQPA 4YJFB 4MVJE 2VHZA 4KTTE 5HM8A 5HS4A 1UZMA 4WOKA 2VUTA 4CM6A 1EMDA 1PWXA 4CMIB 3WGOA 2ZJ0A 3E6AA 4EITA 3GFBA 4FOSA 4Y67A 1M75A 1ZBQA 4Z3DA 3WIDA 3BMQA 4FFLA 1A4IA 3WLFA 5FWNA 4DBZA 2Q50A 4II3A 5KJ1A 4H3VA 4Y6RA 3TOXA 1Y8RA 2P4HX 5COQA 3TL3A 3TSCA 4QXMA 1AXGA 3GG9A 1H6BA 4BNNA 4ALMA 5BR7A 3UW3A 2OFPA 1OBFO 3WJAA 2P5YA 1G0OA 3ZU2A 4IJVA 3IJRA 3I23A 1PJBA 3NGXA 3ZHZA 4E4YA 4IJUA 2BKAA 4WCFC 1DDOA 3WS7A 1DC4A 4L0QA 4XB1A 4EZBA 1V9LA 2ZJ1A 4FPXA 4YT5A 1V3VA 3AUUA 1TLTA 2W4QA 5EL0A 3L07A 4BQRA 5JAQA 5IZ4A 1ZK2A 2TMGA 2RAFA 1DXYA 4P22A 1RJWA 2DFDA 3H3JA 4OJNA 2C7GA 2OL4A 5TF4A 4YT8A 1I36A 1RYDA 4JBIA 1BXGA 4GWKA 5CP8A 1YQDA 4DQUA 1P9LA 4G5HA 1KY5A 1PS8A 1RWBA 3S2IA 5FFFA 1R4NB 1FDVA 2C5AA 4RVSA 3GDGA 4CL8A 2C5EA 4UUMA 5G4LA 3W4IA 1NQOA 1E3WB 3VDQA 4AJHA 5JW6A 1MC5A 1E7SA 1DLIA 4DUPA 3UXYA 5H82A 1XQ1A 1PJ2A 1K5HA 3EYWA 1R66A 1OI7A 3B70A 2EV9A 3VVCA 1HT0A 4O59O 3HHPA 4AVYA 4KUHA 3GNQA 4QT0A 4DPLA 4CQMB 3KZVA 1LNQA 2W8ZA 3PLRA 3BXXA 1W8DA 4L9RA 4Z9FA 1HDOA 3RUCA 4DL9A 4EYEA 3GVXA 3QLJA 4LCEA 2QRKA 1CQIA 3JQBC 3CZMA 3ANNA 4ZQBA 4YYZA 4QFDA 1I32A 1GEGA 3O8QB 2Q4EA 3HE3A 2P9EA 4A5OA 4BNMA 1XR3A 4L4SA 3ZWWA 4NJMA 1E1KA 4FB5A 1NFQA 3TOZA 3H4VA 4IXWA 3IDSA 4QO8A 3JQAA 3H65A 1YBMA 3OQ6A 4NIMA 1I2ZA 2ZTVA 3BMNA 3TFQA 4ZN6A 3D64A 1D3AA 4AG3A 4IJKA 1T4BA 2FPIA 3TN7A 1DRUA 1DOHA 4RLHA 5G0VA 5ILOA 3AU8A 5EN4A 4W99A 1LDBA 4XDYA 1UJMA 4PRKA 2HJSA 3VKVA 3K31A 1LLDA 1LRJA 1HLDA 1TB4A 3C3XA 4KUGA 1VE9A 5JC1A 4PLHA 4PLVA 4BMVA 1Z82A 4MVJM 5JMPA 1HE5A 2X0RA 4JN6B 1IB6A 1NHGA 5CEEA 3FWZA 5G4KB 2I9PA 3MJCA 1C0PA 4R3WA 4J4TA 4J90A 5AQ1A 1KOLA 1M6WA 3RWBA 5KVSA 4IDBA 3FD8A 4R9RA 2AEMA 2Q49A 3ON5A 3RJ9A 3C24A 2FPPA 5BSGA 2WYVA 4OL9A 3WFJA 3C7DB 2C7VA 1YBVA 5AXBA 4BNZA 3UVEA 5J9GA 1I3NA 2Q22A 2X0NA 3KYCA 4YJFA 5CEFA 1HDRA 3MTJA 4CQMA 3I3OA 1GEEA 4D42A 3KYCB 1NVMB 5B4UA 3TDKA 5A02A 4XQEA 3AM3A 1BHSA 1SOWA 4XKJA 4WGGA 3RUDA 3KLMX 4B4UA 3VAZA 1NHWA 4J7XA 1R15A 2VQ3A 5I8ZA 4HXYA 2O2SA 3ZWOA 3BIOA 2EHDA 1LDEA 4DMMA 5IG2A 1Q0QA 5IFLA 2ZCVA 1TEHA 5I7EA 2AEFA 4OXYA 3H8VA 3R1IA 4HBGA 5A3VA 4RDIA 4AJEA 3MJEA 1CDOA 2B5WA 1LLQA 2C2YA 3FHLA 4RVGA 5F1PA 4ZJUA 3V1UA 4RF5A 2XOXA 4ESOA 3INGA 1EUZA 3DOCA 1IPEA 3JQ7B 3COSA 5TQVA 1J4AA 3INTA 2GZ1A 1YL7A 2PD6A 4BNGA 3QW2A 2YY7A 2O48X 2BMAA 2LDBA 1YDWA 3JQAD 1LRKA 1LUAA 3DHNA 4BNFA 3DZHA 1NASA 5J23A 4MVJP 3L4SO 5JYEA 4BO2A 4YB8A 1K3TA 3LT4A 3F1LA 4IY1A 3E9NA 3KETA 2BFAA 1JDJA 1LI4A 5DCYA 1RM3A 3W8FA 2X4GA 1QYDA 1YQXA 2YW9A 4N5MA 1G1AA 1YL5A 1JU9A 4NBTA 3SLKA 2UVDA 1NFRA 1DIBA 3JSAA 1NVTA 2X9VA 3QWIA 4OMUA 5ENDA 2Z1MA 4CM1A 4BNHA 4Q9NA 2HKIA 4YWJA 4R3NA 4LN1A 2HQ1A 1ZK0A 2WM3A 5TX7A 5F1OA 4U0JA 2DM6A 1GQ2A 4FJ0A 1LU9A 5T73A 2CF6A 1BXGB 3B1KA 2IE0A 1YS4A 1GYRA 1Y6JA 4BGUA 1VKOA 1B8UA 1FK8A 2O7SA 4GVLA 4J0EA 5JDCC 3Q3CA 2X5OA 1VI2A 1NWCA 4LGVA 4QX6A 3TZCA 1T2DA 5IDWA 1YO6A 1I33A 2J6IA 2JHGA 4J1NA 3FWNA 4PLZA 1EVZA 4ONEA 4PLPA 3AM4A 3HDHA 2HK9A 3HFGA 4K28A 3BA1A 3FBGA 1HWYA 4DTIA 4P4NA 1YQGA 1ONPA 1Y9AA 3H5NA 4M55A 1F14A 4XQGA 4GBJA 3JQ7A 4OIMA 2BRUA 3TL2A 2FR8A 2PFGA 4XQ9A 1DJQA 4MKZA 2CVOA 2FP4A 1XGKA 1PGQA 4ZQFA 1ZH8A 3PIDA 3KM0A 2AXQA 1TT7A 2I65A 3DXFA 3ZWYA 1GR0A 1E7YA 3C7CB 4WK6A 1RYEA 1EFLA 2Y1GA 1H6DA 2IXAA 2G76A 3DZBA 3ROQA 2V6MA 3RFTA 3AU9A 1T4DA 2PKRA 3FI9A 1HRDA 3KRTA 1QXSA 3DBRA 4TWRA 2DT5A 2UUOA 5FEUA 1GU7A 4ZRNA 4BNTA 3X2FA 4RVHA 4XGIA 4CQLB 1R37A 2IRWA 1NXQA 4BNYA 1CRWG 1C0LA 1CERA 2AHRA 3NV9A 1LDNA 3TZQA 4XRGA 3WQQA 3QHAA 1MB4A 4BNWA 2JFHA 1LA2A 1WMBA 4W6ZA 3OBBA 3LT1A 3WWYA 1LXCA 4GLLA 1O8CA 2ZYAA 2ZYGA 3W6UA 4CM9D 3G17A 4CQLA 5JAIA 4DWVA 3OETA 4TSKA 4IBOA 3OEWA 1ZSYA 1PQUA 5JC8A 4WASA 2IEBA 4RVFA 5I8WA 1Z73A 2EJVA 2HCTA 2RIRA 4XWYA 1DFHA 4RF4A 1DIAA 3UICA 1V6AA 4UVGA 3R3SA 3VH4A 3X2EA 1X7HA 3GMDA 5AXDA 5T64A 1KVSA 3JCZA 2GLXA 3F47A 4A26A 1P45A 3H9JA 4UREA 4YRBA 4EDFA 2CY0A 2Y05A 2NNLD 2AQ8A 3I9MA 2BLLA 3BTVA 3TF5A 3VDRA 1XDWA 1LQTA 1FF9A 1E0DA 3QWFA 2NVWA 1FDTA 5DCWA 3PQFA 1VPDA 1X1TA 4CLDA 3DZIA 1QKIA 3KV3O 4FDAA 1B7GO 4BIIA 1T1SA 5T6BA 4A03A 2VYND 4MP8A 3KYDB 4PFJA 1QORA 1L7EA 1I10A 4FIZA 3FNHA 1QMGA 3BHJA 1HLPA 2WEKA 4TZTA 1UXKA 4CLHA 3C8MA 2C2XA 5TT0A 4O63O 4NFHA 4MKRA 1YRLA 3D4NA 2GASA 2HMWA 1BMDA 2AA3A 2JD0A 3HADA 1WZEA 1HF3A 3GNSA 1U5AA 3H9GA 2Y1OA 4MVJD 3KLPX 4GAEA 1L7DA 1OC4A 2VTEA 4WUVA 1SC6A 3HB4X 4MDHA 3ZHBA 4XB2A 2CNBA 3I5MA 3UFXA 1SCUA 3N58A 1ZEMA 3WDSA 5LCXA 4WPGA 4K9DA 1B0AA 5A3JA 1LSJA 5JE8A 3L6OO 3QVXA 3ZHXA 5L51A 1GYPA 2J3JA 4LK3A 4XIJA 1YOVB 2G82A 2Q2WA 2DTXA 4IZIA 1OOEA 4XJSA 1GCOA 1Y81A 3TPCA 3L9XA 4JP2A 3F1KA 1KVQA 4I1IA 3GVIA 4NPCA 3A9WA 2DUWA 2DBQA 4W82A 3GPIA 3A06A 4TRNA 3P2OA 5CDGA 2JFGA 3CIFA 1MV8A 1SO8A 3F9IA 3DBHB 2IZ1A 3OH8A 3HZZA 2EJWA 1WNTA 1NAHA 3EZLA 2EW2A 1HE4A 5ITWA 3GGPA 3ZU4A 4AFNA 4BGVA 3DAGA 4B4WA 2WD7B 1W73A 4NU6A 4IDEA 3PHJA 3JD3A 4BHTA 3MJSA 3WR5A 3FSRA 3FBTA 3MEQA 2DUUA 3HN7A 1T2CA 2PR2A 1R4MB 1DRWA 4RQTA 1N2SA 3RBXA 4AJNA 3SVTA 1EK5A 3UCEA 4S1VA 1BWSA 4J4HA 2J3IA 4E13A 2VHYA 4BNVA 4AICA 2AG8A 1IHYA 2JKVA 4JGBA 5TIIA 3GA0A 4QFCA 3OHSX 5JBIA 2POQX 5CDYA 1XKQA 2PZLA 5G0WA 2NTJA 1MXFA 5C7OO 2C59A 1QR6A 1NPTO 3CXRA 3I9JA 4D46A 4AJLA 3GEGA 3G49A 4WE3A 1LX6A 4XCVA 3HDQA 4GX0A 3GPDG 3VPSA 3A14A 4NMHA 3E8XA 2BF7A 1YB5A 4LMRA 2W2KA 4ZGWA 4U0KA 1NYTA 4L76A 1ARZA 1PJLA 3MOIA 3NTOA 1QYXA 3L9WA 3O8QA 3JQ8B 1P0FA 5B37A 5I9NA 3K73O 1ZIDA 4MVJA 1PJ4A 3GN1A 4DIOA 5L4LA 2R00C 3QVSA 4KOAA 3JV7A 4S3MA 4MVJH 3VPHA 4LVUA 3WGIA 5JYFA 1JWAB 4CLRA 5MDHA 4NK4A 2FWMX 1PL8A 2A94A 4TKLA 9LDBA 1SB9A 3PJEA 3PJFA 4M54A 2A9FA 2PZMA 1CQJA 1GV1A 4FGSA 5KOIA 1QV6A 3TQHA 1V3UA 4FJ2A 3JQ9C 1FDWA 3GNTA 4Q39A 3ADPA 3B1JA 1ISFA 1U8XX 4PRLA 2WE8A 3EC7A 3FR7A 4D79A 2HMTA 3CZRA 5A5EA 2WD8A 3ZGYA 4PLYA 1UDAA 1KVRA 3TZ6A 1H0KA 4E31A 1WXDA 1IULA 2X23A 5GZ1A 2C82A 3GT0A 5DULA 2R6JA 1ULUA 3PJDA 1KS9A 3EY4A 2EERA 3NUGA 1A72A 1NTOA 3WBBA 4J43A 4J3FA 5CDUA 3I9KA 4NU5A 5T8KA 3DB2A 3PWKA 4N54A 3DMYA 4BKRA 3S2FA 1IPFA 4NBWA 3U4IA 3JQBA 5KVQA 4YVFA 3PHGA 4GWGA 3ZN2A 5L40A 1YDEA 4YCAA 2PD3A 1MGOA 3WGHA 2PGLA 3OIGA 1J49A 2QG4A 3HSKA 1DEHA 2Y67A 3CE6A 2JCYA 1DFGA 1F17A 2NU9A 3HWRA 3RJ5A 4CUZA 2VRCA 3RI3A 1I30A 3PHHA 1U3TA 2GYYA 1AHHA 1EK6A 3GH3A 3ZCXA 3CMMA 4PLFA 1H94A 4P8RA 3D4OA 4JX8A 4IDDA 4WLVA 1GV0A 2P2SA 4FFOA 3ZHYA 3GZNB 5C3MA 2PKQO 1BDMA 2I76A 3WQRA 3I1JA 5JO9A 5GZ3A 4LISA 3MTGA 3EVTA 4PG6A 3T7CA 2UUPA 4UAGA 5FYDA 2RBEA 3TJRA 5CAEA 3MJ4A 1WMAA 1U7TA 4Z0PA 2V7PA 4YEDA 1HDXA 2Y99A 9LDTA 3O03A 2ZTMA 3B6ZA 2AW5A 5TT1A 3INRA 4U8GA 3DZJA 5IXSA 2DC1A 1I8TA 4I5GA 4FC7A 4FW8A 3V8BA 5L3ZA 3BMNB 2BFOA 2OBYA 2NQTA 3Q0EA 1LTHR 3DBVO 3BMOB 2PA3A 3QVOA 1P1KA 1EUCA 4RPGA 1XYGA 4CM5A 2GUGA 4A0SA 2D0IA 1DFIA 4RPHA 5A4DA 2GD1O 4ND1A 3HDYA 2OP1A 1DIGA 4TVBA 1UP7A 4TRJA 4ZRMA 1U4SA 3R6DA 4CM4A 2EP7A 2QX7A 5AXAA 3HJAA 3ZZNA 5T8KC 2HSDA 5L45A 4I9UA 1U3UA 3IIEA 1ZNQO 3JD1A 3QIVA 4XZ3A 4CR6A 4CM7A 5B1YA 4E3ZA 1Y8QA 2OORA 3S8MA 4GPD1 3C1OA 4J91A 1HE3A 1KEUA 4RJTA 2NVUB 2FMUA 2CVQA 4DQXA 4HFRA 4WLOA 3GFGA 4YT4A 5L53A 4F6LA 1KETA 2PNFA 5DN9A 2RHRA 1IZ9A 4NBVA 3IUSA 1PS0A 2CDAA 3ENKA 3Q6IA 1T24A 1YB1A 1AE1A 5DOVA 3Q11A 2D5AA 4BKOA 2HU2A 2FZEA 2P5UA 4A7PA 3PHLA 3IP3A 3DMTC 3PYMA 3ZNQA 5IZCC 1X0VA 3I9OA 1X1EA 1KERA 1HXHA 1PTJA 3ONEA 4G65A 5DT9A 1R6DA 3R0IA 3QQPA 4J6FA 1QV7A 4URFA 2B35A 3O38A 1K6XA 1SB8A 2QIOA 3M2TA 1C0KA 4YDRA 4RO0A 5GZ6A 4RORA 4NR0A 1E3WA 2J5RA 2PV7A 1ZZEA 1LLUA 4N7RA 5TLSA 3GUCA 5JAZA 1HZJA 4DIFA 1NP3A 2GCGA 4FFRA 2B4TO 3ZWVA 2YUTA 4CQMD 1HEUA 2B37A 4ALNA 2Y0DA 3PDUA 1H9BA 3TFOA 2NM0A 4WLFA 4BO6A 1PWZA 1NQTA 3BTSA 3GDOA 2PH3A 3KO8A 5IXYA 2EGHA 2QHXA 3K2BA 1B8PA 5K9ZA 1T2AA 3IKVA 5HTOA 3F5SA 5AYVA 1IYZA 2I3GA 4K6FA 3VTFA 1YKFA 3DFZA 1AHIA 1MUUA 2EXXA 4IXTA 5TJHA 5HRUA 5KVCA 2O2YA 2RH4A 1O89A 5A9TA 1O95A 1WP4A 4PN3A 1Q1NA 1P1FA 1S7CA 2YQ5A 1QRRA 4Q3EA 3ZU3A 3VH1A 4NFSA 1PL6A 3WJ7A 3VOSA 4CMEC 3WG9A 5C7IO 2D4AA 1B3BA 2J8ZA 5BSHA 3WX0A 3DBLA 3UCXA 2V65A 3EGOA 3JQ8A 1EDZA 3AI1A 3LC2O 4IGEA 1JKIA 3WNQA 4AJPA 2AE2A 3AUSA 4LRTB 3GMSA 1X7GA 5DP1A 4CMAA 3KEOA 2H6EA 3PRJA 1KC3A 2Q45A 3VZRA 5IZCA 5K0ZA 4EUEA 1H9AA 1BXZA 3ABIA 3RU9A 2RHCA 3GVHA 1UXJA 3EDMA 1B16A 3ROPA 4E2WA 3JQGA 4RZHA 1XWFA 4CM3A 2Q1TA 4NH4A 2UV8A 3U3XA 3ASVA 3ZWAA 2QW8A 2VN8A 1C1DA 1KVUA 4BO8A 4BV8A 2GERA 4IDGA 1ZVMA 1ISIA 1PIWA 3EVNA 3LQFA 4TQGA 5EPOA 5AVOA 2VZ0A 3M6IA 3MOGA 2YZ7A 2J5KA 1F06A 2O3JA 3H2ZA 2O7QA 4J7CA 1QYCA 4JQCA 1ONNA 4R1TA 5CPFA 3EHEA 3UH1A 3NJ8A 4CJXA 2VYVD 5L4NA 4EJMA 5JFOA 3LDHA 1AGNA 2CD9A 3PXXA 2DU8A 1T1RA 4GX2A 3VTZA 3NGLA 3EMKA 2SCUA 1V0JA 4C7JA 2ZK7A 1B8VA 1EQUA 4KZPA 5DNAA 4QQRA 5ILGA 3NDIA 1EVYA 1F0YA 2AQIA 5DF1A 1DSSG 3E5RA 2I3AA 2I99A 4OKIA 4HFMA 2DPGA 1PGOA 3IC5A 3OECA 4RPKA 1H2HA 2HUNA 4CV0A 1Q7BA 2YYYA 2WYWA 3DFUA 1PS9A 3V2UA 1VL0A 3D1LA 2WTBA 4OSPA 3NT4A 4D41A 4J49A 4AJ4A 4EEXA 3MZ0A 4B7UA 5JCJD 3JQFA 3QWBA 3GGGA 1LSUA 3E82A 4B7CA 5L7TA 1JKJA 2FRDA 1LDYA 4Z9XA 1YJQA 1HYEA 1P74A 4EI2A 1Q2XA 1ISJA 1X7DA 4L8VA 1SEVA 3G1TA 2J5QA 2I67A 4J1TA 2O3QA 2O3UA 2BH9A 3QY9A 1X15A 4KQXA 4XGNA 3RC2A 1KIFA 1MLDA 4QECA 4YAEA 3VPFA 4A10A 4GX1A 1WDLA 3DMTA 5A04A 4GX5A 5LC1A 3NJ4A 3AI3A 1IZ0A 1ZK3A 4OAQA 2PH5A 3DOOA 4O0LA 3ZWCA 1A5ZA 3PWZA 5CDTA 2VWQA 3RQSA 2HK7A 5JAMA 1DAOA 1MG5A 1EFKA 1Y5RA 1TA4A 5EQFA 3GEMA 4UULA 1E3LA 1C1XA 3C7AA 3RBVA 3IAHA 4RPJA 3ZV4A 3RUEA 1EZ4A 4OOEA 4L75A 4IINA 4UVEA 2GSDA 1XA0A 1LC0A
chains in the Genus database with same CATH superfamily
1UZLA 2XT9A 2P9BA 3KGDA 3K0CA 3BB1A 5DDIP 2JASA 1JLSA 3L1JA 4G9BA 4MPPA 2QTLA 3ONDA 3WLAA 4GBGA 4KR6A 3F5MA 1JFSA 3BE8A 1JLMA 3L8CA 3KSRA 5BOVA 3JRWA 3KYDA 5JXIA 2CXTA 2H59A 2I4RA 2GHIA 2H1OA 2Q62A 1E79D 4ZWNA 4YYEA 4ZXPA 1R0WA 2JBAA 1RLOA 3P19A 5KUTA 1XHEA 4EJ6A 3A36A 3C4VA 5JY6A 2AGVA 3LPAA 3PUVA 4NV0A 3H1FA 1P4RA 1SCAA 4QGFA 1L5LA 2CLCX 4Z4CA 2QLTA 2QN2A 5IC5A 4Q7QA 1QIDA 4HNHA 2DWUA 2RMKA 4NZOA 5A5FA 1VCHA 3V4OA 4DWOA 4DY4A 4IGAA 1RVDA 2QAGA 2RHOA 3A3KA 3ESRA 3P45A 2Q3HA 3ADKA 3R6GA 5AW9A 1RZUA 5K0NA 6ADHA 4DEYA 2VJYA 1O87A 1OFVA 3BXGA 4PF1A 2VJDA 5CH5A 1KEEB 2FEXA 1TECE 3UM9A 1U7ZA 3TVTA 1PR3A 3KKMA 3N3AC 1UZAA 1USUA 2ODTX 3I9LA 1MIOA 5JTTA 4MITA 4B17A 1PQ4A 3V1YA 2R1VB 3ZY6A 8AT1A 5JALA 2WJ4A 3BEOA 2ZRIA 4KHZA 1YUNA 1T1GA 1XMPA 4OQFA 1FFEA 3NWJA 4K87A 2WHXA 1WXXA 2ZKIA 1CC1S 5CDHA 1O0SA 2VH5R 4OHRA 1L5FA 5HK9A 1URPA 2EJCA 4YJ2A 1FMFA 4P3OA 1JJIA 1IXSB 3X1ZA 1DJNA 3FVTA 5JRJA 4V0LA 3OTOB 2JGDB 3UTCA 1W36C 1BXKA 3FMGA 2DE0X 5DIZA 3WE7A 4GDFA 5K0LA 4XUGB 4NONA 2J3KA 4CV2A 4E46A 1QWSA 2D1YA 3GYGA 3BD7A 4Q9JA 1PV4A 1NV9A 3THWA 3FXAA 1QWOA 4KMSA 4PZ0A 4PWZA 5BVHB 2XZDA 4OIFA 1NX6A 1BNCA 1HFKA 2AZMA 1YXMA 1Z6QA 2D7JA 4I1OA 4OXKA 3ZJTA 1UDRA 4JXZA 1EXWA 2A2ZA 2B8NA 3WGYA 2AOTB 5G0UA 2WM9B 3NIDB 3P9NA 4NH0A 3M4YA 5CBKA 3RFFA 4R8SA 2V3CC 3LMKA 5IM5A 4PZZA 3GEBA 1PJ8A 4IMRA 1AZLA 3CONA 2E82A 1N1MA 3EQ7A 1Z4OA 2IOQA 3G6KA 2VTDA 4TTVA 4U2BA 3VR1A 1K8XB 1M10A 1GZSA 2PT7A 1XKXA 3Q9NA 4HGRA 1LPMA 2QNRA 421PA 3IVCA 1IB0A 4NOKA 4WI1A 5JVDF 4U2CA 1O9GA 3LC1O 2EGGA 4DEXA 4DIKA 4F2HA 1O6GA 1V43A 2QR3A 4NATA 2H0QA 4UARA 4TLBA 1L8XA 2C4TA 3E4DA 4UFOA 2O8CA 5K3OA 1YRBA 3KQTA 3L49A 3H8WA 4CMCA 4OUKX 1QIHA 1KL7A 1WL8A 1YZHA 2CLIB 2FPUA 2O50A 2ZAOA 4HNGA 4MVCA 5CCDA 4RY2A 2O14A 1EUYA 1JWBB 1T2NA 2R65A 4PE5B 5CHEA 4HJXA 3PWSA 1FTSA 1T9DA 1OWPA 1XMXA 1YR1A 1Z6ZA 3FG9A 3G8AA 2UUCB 2VNJA 4GPIB 1CSEE 1DAPA 1I1QB 4KDFA 2FN9A 1C29B 4KDEA 5LIPA 3CNQS 3W2EA 1O54A 4CU5A 1X2BA 3HVRA 3K7EA 2H1SA 1PKXA 1D2NA 2J67A 4LIPD 1L3CA 3MHPA 1GQOA 2H07A 2FUKA 3BULA 4JQYA 3LWNA 1JDUA 4O1IA 1N34B 3IVGA 2IHBA 4YJGB 2GBLC 2VBCA 4R2IA 5HKOA 4DLUA 4NCIA 2LD4A 5BT8A 2PLFA 2GEUA 3MCTA 3MLBA 4ZZ2A 5CITA 1COWD 1GTMA 3ANMA 1PX2A 2PL5A 4GMFA 1OAAA 3RBAA 2YW2A 5AK5A 4ZGBA 5IH7A 2FN7A 2JFUA 4KLAA 4A92A 3FF4A 3OUZA 3KR2A 4ZVUA 3ICCA 4IPTA 2X0JA 3DE6X 3OCUA 4QAQA 4ROSA 4TWZA 5B4VA 2GAAA 4IDQA 1NZJA 3DUFA 2Z56A 3O84A 3FIJA 3O91A 2V9ZA 1E59A 1ZL2A 2ZB8A 3OZRA 4XXHA 2EU8A 2BBSA 3PE3A 4DDKA 3DWFA 1YJAA 4I6JA 4IV8A 3VNQA 4CCAA 3L0OA 1TVCA 2H16A 2OQIA 5B12A 4DDVA 1UWCA 1Z33A 4IMJB 2GZAA 2QZZA 5FBRB 1FS4A 4H0NA 3IP1A 3AJ8A 2YJNA 1I4WA 1AY0A 4XYLA 3C85A 1DIHA 5EXTA 1N9GB 2FGKA 3GK3A 4LF8B 2GEVA 2C2GA 1TKCA 1JDBC 2G1KA 4L2IB 3B89A 3E15A 3PNMA 3RIEA 2DBRA 3NBAA 3UV3A 4P82A 2VSOA 5CGZA 1ID1A 5A7GA 4MKXA 4L3WA 4MOWA 5JWRA 4M60A 1Q91A 1QCCA 1YL6A 2G09A 4IR7A 4KO2S 2DAPA 3TV1A 5HWSA 1F6WA 2YJGA 3K0CC 4C22A 1ONOA 4HJRA 5TPZA 5CG2A 3BGDA 5EC8A 5FI0B 1CIPA 3W3ZB 2O3RA 3IILA 4W5JA 1V3QE 4W4TA 3U48A 4HEHA 2QV7A 1VLQA 1Y6ZA 2VRBA 4ID9A 4PNHA 1D2AA 3BE6A 3SZUA 4NCXA 2R47A 4IUCS 5HRAA 3R7WA 5H9WA 3DE0X 3JQEA 5AXAA 2C5FA 2YC4C 1O0CA 2NYVA 1M2KA 3LY5A 1IJEA 2Q2OA 4B7ZA 4TLEA 4WK4B 3SIWA 5BR1A 3M4ZA 4BNKA 2H7XA 4CF3A 4CUJA 3K70C 1L4KA 4O25A 3GLUA 1IXRC 4O5OA 3PA8A 4YJKA 4C2BA 3ZDAA 3GW8A 3DTVA 4UUBA 2IYAA 4X8LA 1AKWA 1Z4QA 2ZUCA 3GZJA 4UUAA 4J9VA 5EXPA 3U7JA 4D9JA 3TLKA 3HEAA 2JLUA 3K3PA 5ALFA 1E2HA 4Q82A 2AYYA 2HCBA 5DZSA 1ZVJA 1PT9A 4P3YA 5TARA 3CPHA 2ZBVA 1X7ZA 4M87A 3RS7A 3RYIB 5BYKA 3IQDB 1WPQA 5B30A 4E6PA 5U4QA 1WUJS 3KWJA 5JLAA 4BZPA 4CHTA 2V0GA 4JC8A 1NN1A 3TRIA 2P79A 3FGNA 1Z06A 1WCXA 3FPKA 5DBHX 1HMPA 2HJHA 3LZDA 3RNOA 5D3MB 2YN2A 2C4UA 3EAQA 4FNGA 5DBFA 4Q18A 3L8GA 4Z6KA 2Z2XA 3QM1A 4WOJA 5CA0B 4YBZA 1OCEA 1CTQA 3FLEA 3BKXA 5HS6A 1DQZA 1O8BA 4EUHA 3EW7A 1J70A 2ZIZA 1FSSA 4UEQA 1S2LA 4NHEA 1DIRA 3K1TA 3PGXA 3MG9A 3QFCA 2B61A 5H3HA 2PR7A 4KPFC 1TJPB 3DV9A 2AJ8A 1F8FA 3DF7A 3SBOA 4NBUA 3M5CA 4LXYA 1J9ZA 4QOFA 1REQA 1Q57A 3K9QO 3N39C 2O8FB 3SZMA 3HKEA 3KTDA 3OCXA 2E5FA 2QL5A 1OC2A 2W2TA 3G7SA 1ZHFA 2O4UX 3IS3A 5BSTA 1W8IA 2CEAA 2HHLA 3D8UA 3GUZA 3MRXA 3C70A 4V0NA 3TIIA 3QU4A 3TJMA 3JAWB 4XCXA 3X2SA 4DQLA 4WDRA 4BFLA 3GAZA 1RC1A 3DLIA 3SKYA 4TTIA 3E9RA 4WADA 1BU5A 3B8HA 4LW8A 1XZIA 5TPZD 4DSTA 3N76A 1LNZA 4P3KA 1OAKA 2AOVA 4WNCA 1ZD8A 1HL7A 2XB8A 3C45A 3KVOA 4HP8A 4XDGA 2GQ0A 1V41E 3LHIA 2JFVA 1EVJA 1A9OA 4M0FA 2XUFA 3AJEA 1A9SA 1YULA 3IELA 4RVDA 3VPAA 1JHQA 1G8SA 5KWVA 1GZ7A 4EPYA 3VKGA 3JZMA 1COWA 1D1TA 2BMWA 3CZ9A 4N3GA 4LZWA 1QGAA 4KYTA 4RA6B 5BSUA 3W2HA 4XUCA 3UJNA 2D5CA 5AIBA 3OJ0A 4QU9A 4A0QA 3L7IA 4G41A 1I4LD 1TVEA 5I6DA 2XCIA 3UZUA 3DOEA 3HB5X 3PUHA 4R1PA 2B6HA 1JLRA 1O9HA 4WGFA 1KPIA 2FHPA 2A5LA 1XLUA 2IDMA 4I0WB 4FR5A 1SG9A 4M83A 2QJWA 1DXQA 1IEQA 4L8WB 4CMKA 2WWVD 1CVIA 5JV5A 1QTQA 1E18A 1XTVA 3DBRB 4JI3B 3W1WA 5CBPB 1P7WA 5K8VA 2AG6A 2VS1A 1MB0A 4DLKA 3EF1A 5C4GB 2YVAA 4QIHA 3WK9A 4RSMA 1PJCA 3PSAA 3VSBA 1HTTA 1E3EA 1N75A 1I0IA 2PFSA 8OHMA 5MF6A 2RONA 2WJPA 5TS3A 1CIVA 1CY2A 3IKTA 2IT1A 4R1MA 3L8ZA 3P8ZA 3PFCA 1AO3A 3QFFA 3ASUA 3DGEC 1GQFA 1LQUA 3N2KA 3K15A 3TIXB 5KX5B 4FFMA 4KE9A 1G3QA 2CUKA 4BTEA 3KX2A 4UVHA 3U62A 1RR6A 1FVHA 4NDNE 5CCBA 4NCJA 4Q4LA 1YS7A 2ZRBA 4GSLA 1JLLA 4FHCA 1A9ZA 3ZCPA 3DQQA 4MI3A 1Z4MA 3AFHA 4PG7A 1U0OC 2HXGA 3UMJA 1TQ4A 5J40A 4E3WA 4QXAA 1SXJE 4FJ1A 4EB0A 4L8YA 1XSEA 5A62A 4M1QA 3B6MA 4BX2A 4EZEA 4D4IA 4G36A 5AVYA 5DNEA 1PW5A 3W6OA 1P0CA 4CRWB 3ITNA 4N3BA 5CYOA 4HWPA 4C5BA 5ALGA 1DRVA 1J9EA 3TQOA 2O2CA 3OOJA 4B34A 2ZRJA 4FOPA 4MSUA 1ZLXA 3QUCA 4LNHA 1Y5MA 4CR7A 1KBQA 3G82C 4BOYA 4GU5A 4EGAA 2PSEA 2Y1DA 3GGCA 3KTAB 4INAA 4B4OA 3CRMA 5KNDA 2X4IA 3WKCA 1OZ0A 4R1UA 4PYJA 4CEIA 1FFHA 4M53A 1NQWA 3SYTA 3WGVA 1UC5B 2ZT7A 1U0RA 3M82A 4HNSA 3EWAA 3ICPA 2IODA 2L0XA 3ZU6A 5ALJA 2DHDA 1FYDA 3KE8A 3EF0A 5F21A 2AZTA 5AK4A 4MEJA 4EQ6B 3A28A 1AH2A 3DLAA 2VSQA 3FRJA 2IZ7A 1L1RA 4CG3A 1ODSA 5ADHA 2AXEA 2QQ5A 4HDCA 1E3DA 2IH5A 3I9V6 5IVIA 3MLEA 2CLSA 4HRVA 1ENZA 4LKRA 2B1GA 3JZFA 4OGFA 4P4TA 4PIMA 2XQJA 4DA7A 4YV1A 2C1ZA 3CKMA 4DC9A 3G89A 3LPDA 3WO1A 2YDYA 3HACA 4OI0A 3T7IA 3L46A 5AM3A 2YJZA 2FV8A 5C5EA 2AOTA 4TYQA 1B0PA 1Y9EA 2JI6A 1KR5A 3NBUA 5J2TB 3BG5A 1U99A 1TAQA 2C04A 2CVHA 2VIIA 3QW4B 5EVJA 5DNWA 1RWVA 1OFHA 2JJ1D 3G9UA 2VZ9A 5EP4A 3M6LA 4CM9A 1NUUA 3H5IA 1HKUA 3IUEA 2VA8A 4G85A 2PJZA 4G24A 2Q9UA 4I4LA 4RV4A 2R4TA 4M9XA 4YHBA 4ZT2A 3OHPA 5IC4A 4OHKA 1EBFA 4K7JA 3H17A 1DJLA 1QC5A 5DK6A 1DX6A 3PKJA 1FLNA 1D1SA 4XM2A 3LQ4A 3IEMA 2WMDA 2P0AA 1OGYA 4LSZA 4BQQA 3H1EA 4A36A 1Y8RB 3TIFA 2A1UA 3N5KA 1CZUA 3CGWA 1B41A 2QRVB 3LLSA 2LIVA 3E1GA 4I5FA 3WDKA 3IHLA 2DCUA 5DX1A 2ISQA 3EIQA 3F9CA 2OBBA 3G9XA 3H6HA 3O2QB 3UKOA 3RARA 1EAMA 4ND7A 4JR2A 3U39A 3A9UA 3ODGA 5F51A 1T29A 1WRBA 4QYMA 5JDCA 2XYVA 2FUG1 1MEEA 4H15A 4E0BA 3PFWO 2F3SA 2XE7A 3DVQX 1D2EA 2HADA 1Q7CA 4PPFA 4Z9YA 4HUQB 4EPRA 1IPHA 3ZD7A 5JDIA 2IHJA 4BN5A 3CEJA 4M8SA 3EP5B 2W0MA 2WJHA 3P9CA 3VVMA 1RVV1 2ZSKA 2AX4A 4LSMA 1GZVA 1N8KA 3U3DA 2F8LA 2P9QA 4CKEB 1Y4SA 4GKVA 4PYRA 3RVLA 2QJRA 5LDGA 4P3NA 4EGFA 2RD2A 1PV1A 1W29A 2GUWA 3KFLA 2X5KO 1K8QA 2PZJA 3CVJA 3ELBA 4FZVA 4EEZA 2ZJBA 2IYEA 4F93B 2QV0A 4YAKA 3Q8MA 3WGQA 4MIEA 2H5JA 4ZRDA 5DCUA 1OUMA 1CJVC 1HDCA 1X7YA 1CUDA 1FXSA 3FSGD 3NXKA 4J9UE 1RQNA 4GS5A 1NW9B 2ETXA 2PKCA 4ZOLA 4Z4EA 2PIDA 4CZ2A 5HSGA 1UJ2A 2OO7A 3G1UA 2H63A 3N0VA 4CF7A 3AEXA 3ILVA 4Z0TA 3WL3A 1VP3A 4J2OA 2G28A 3K5WA 2BTQA 3GLTA 2ZITA 1OV6A 1OILA 5CFPA 2EIHA 4PAMA 4EVQA 3QUSA 4II7A 4CFSA 4G89A 1ZS9A 3DJFA 4AUEA 5CW2A 1QRUA 2W70A 4ID3A 3ROGA 4BVBA 5IDYA 3IKLA 3K1AB 1IN4A 1HEYA 1A3CA 2AFRA 4XOIA 3K1AA 4JXKA 5EIFA 1OKKA 5K6AC 5FIUA 3OE4A 3ZY2A 1NDHA 2Q4TA 1EB9A 4G25A 3WA6A 4ABTA 3CEAA 4PCAA 4AB1A 4EFDA 3V34A 2QVLA 2BM8A 4AMGA 1H8EA 3IH5A 4UHCA 1PJ3A 3DO5A 1D03A 1TYEB 2QX4A 2XMSA 1TM3E 2PGAA 1JIVA 4QO7A 2XXBA 1O6ZA 5C9ZA 4R69A 1U9JA 5DWDA 2VHXA 4C4XA 2GR9A 3FY4A 1N2ZA 3WL7A 4JYPA 2LR0A 2IFTA 1TNDA 3IIJA 4NLLA 4KIGA 4IHKA 4WKGA 2KX7A 3ENWA 3KKKA 4JLWA 3F5QA 3FI0A 3RVPA 4N4AA 3G8BA 2XCLA 2XX3A 3BL8A 1VPLA 4YS6A 1DS6A 4KYVA 1IBMB 1YE5A 4KXLA 3ETEA 1GXSB 2F1OA 4CMIA 4EYKA 1MQAA 3GJ0A 3ISJA 3LZ6A 3QXGA 3SC4A 4ZCPA 3VU9A 3COWA 5M3BA 2HWXA 1GUFA 2ORYA 2QN7A 5JT1A 3M3PA 3OFKA 3I8SA 3WGGA 1EA5A 2WUEA 1K4KA 1E1YA 1GL6A 1WABA 1RQXA 1X7XB 2XITA 4LVOA 2D2IA 4KI7A 4MW5A 4UMFA 5IF3A 4QM6A 1UKZA 4PEVA 4W8OA 5TF0A 3W3AD 5KX5F 5G1PA 1OMOA 1ZC4A 5M6DA 1RHJA 1VOTA 2VDWA 4MCAA 4B35A 2QRJA 1IJBA 4BJHB 2YV5A 2YWJA 3J81k 2OCGA 3LOUA 3OVMA 4OEHA 3HQ4O 4H7EA 4HWRA 1GL9B 3WWCA 5KTOA 2TMKA 3JQ9A 2C99A 3K16A 3K30A 4KIWA 3A6EA 4L4XA 4L7QA 3WYNA 1JJBA 2W6PA 1E5XA 2DECA 4INZA 3H18A 3C6BA 3D3WA 2GB4A 2VATA 4H4DA 3PRKE 4IDCA 4H35A 3JQFC 4ITRC 4IIGA 3T9FA 1RXWA 3RYCB 1CF2O 3BHIA 2WTXA 2HCJB 5JCJA 1BZYA 3K2EA 4E21A 1BU8A 1U2TA 4JC5A 2PMEA 5MGBA 3GG2A 4ND3A 1R9JA 1EGMB 5TJ9A 3MWJA 3VR4D 1DJPA 4CMHA 2ODBA 1D4OA 3TBHA 5C53B 1PFUA 4NNPA 1NY6A 1VBKA 1JN0A 1T0IA 3H13A 3OKPA 3OX4A 3PRYA 4R1LA 1D2GA 2W58A 3PGMA 3UWSA 1KY3A 1K3FA 5K45A 1QVWA 1B43A 1GPUA 5B1EA 4EPXA 4YMHA 2MSEB 3MXOA 2XODA 5LWHA 1SZPA 2B5OA 3AR9A 5AI0A 2IXBA 1PNQA 2HAEA 2CNDA 4Q3OA 4F45A 1OVGA 4PYNA 3RUIA 4B0OA 3JQ6A 2DFTA 1N2EA 5CVCA 1VL1A 3CVXA 3AWDA 4N8EA 1XNJA 2IYZA 5TB5A 4BFSA 3F6YA 2SCUB 3N07A 3ESAA 3LQQA 4H1UA 3V8QA 4EBFA 1B76A 1BX0A 5SYMA 3SJUA 1Q0UA 4M38A 3U80A 1U8ZA 1AOXA 2O0KA 2J9YB 1JJAA 1ZMRA 1IBSA 5G0SA 2HUPA 3KQOA 1CIJA 2XYGA 4HY3A 1AN0A 4QREA 3NFYA 3I62A 5BUCA 1FOEB 2PS1A 3DS8A 1Z12A 2BDTA 2P35A 3QE3A 2YV2A 2PS0A 4HLCA 4E5PA 2QTZA 4NYJQ 5BW6B 4YIHA 3AVPA 3U4DA 4I6GA 4UJ5A 3PFBA 4Y2QA 3WNCA 2FLVA 5HUQA 1MX3A 5LQJA 4RY9A 3BSFA 4JC4A 5GY7A 3A7DA 4UAVA 2VI5A 3KPJA 2CT8A 2RH5A 3CH6A 1GNSA 3SEFA 1U2DC 4QTXA 5A71A 3FYDA 1YFJA 4ALLA 2GHTA 2CUTA 5D6NA 3GY0A 5I9MA 1YH3A 3NEJA 2I4TA 4GD3Q 4R9SA 1XTRA 2A5JA 4MEBA 2I6SA 1NNLA 2BEUB 2FCRA 2C83A 4MGZR 4LHVA 3KS9A 3CS3A 5COAA 3IPAA 4DA9A 4MV8A 3E7PA 1JQ3A 1LS1A 1UBNA 1ABBA 2P8JA 2N3ZA 1ZU4A 2YIMA 3HCNA 1OI2A 1XVAA 2B9EA 1Q1ZA 1L7BA 1JMVA 2GNAA 4KRGA 2GTHA 1PNRA 3RCBA 2DLNA 3LVRE 2DFNA 4GQAA 1DQYA 4M1MA 5D3MA 3SZ3A 2WUWE 4CKZA 4FD3A 4YX9A 4EY5A 2XAUA 3FZYA 3DV2A 4MO9A 1TT5A 3AKEA 1E7MA 4HB0A 4L0MA 1FFYA 1DEOA 4L4RA 4NAVA 3W1EA 1E1QD 2O7NA 1EESA 5EOVA 2NU7A 2O4CA 1P44A 1V9SA 2C2HA 4RCVA 1WO8A 4JU9A 4O4IB 3CEMA 4J94A 4XD2A 2YY6A 1VM6A 3CNNA 1SIUA 2RARA 1YS2X 4O4IA 3E7XA 2QN8A 5FOSA 1G8KA 2NPOA 1ZRMA 2ZEJA 3GFPA 3IO5A 1Z2AA 1TFRA 2EL7A 3M6MD 4IJ5A 4IJ6A 4TTQA 4Q7JB 2YWEA 5LWQA 4FDVA 1JEYA 2Y77A 3ENZA 5KTKA 2FSVC 2NZYA 1RU3A 3IGFA 3VKHA 3HKBA 4FEYA 2AL7A 1UP4A 2VYNA 5FPQA 3FTNA 2G9VA 2Y66A 3DZGA 5TV2A 3FJ1A 2IELA 1IBLB 2YJTD 4DLBA 1GAXA 4AI6A 1RCTE 2OTCA 4OH7A 2J9FA 3C6KA 4CN9A 3NRJA 6LDHA 1HRKA 2LKDA 1FC0A 1US8A 1L4YA 4W63A 3C6MA 4EYSA 1V7QA 1TU4A 3GCDA 1NR7A 3OQOA 3VKFA 2CXSA 3VZSA 3IUMA 2RE8A 5BQPA 1Q6YA 4FOOA 4I08A 5FUYA 3UWMA 1GNVA 7REQB 3E9CA 4INPA 4X1KB 2MU1A 4BNJA 3A6PC 3JAWA 2REQB 3NC1C 4L9WA 4QSHA 4C05A 5JS6A 4DG8A 3DQZA 3MCVA 4MTLA 2OZLA 1GSHA 5GINE 2I2CA 2D59A 3DDZX 2R00A 3OA0A 3A1WA 4MAFA 3S4YA 4TLDA 2OA0A 3ZI0A 4EUSA 1BH6A 2X1MA 3MCWA 4P6VF 5FPSA 4P53A 1J06A 1UDCA 4KLZA 2WM2A 1VA4A 3CSDA 3QEMA 1DC5A 1PZGA 1U0BB 3DL7A 5JY1A 4NG5A 1U9IC 4JZYA 4AUMA 2BC9A 1OFTA 1UKVY 5SZIA 2W71A 2J3EA 2Q3FA 4BQNA 4LXGA 4YLEA 1WULS 1GG5A 3SFTA 4F5EA 2PCLA 3MS4A 5CH8A 3LRXA 4DCTA 4I9NA 4U9HS 3WDLA 2GZ3A 2H4WA 3Q3EA 3QKWA 5JSYA 3HWWA 4LF5B 3GF4A 4H08A 1VXRA 2O8NA 3BA6A 4F96A 8MHTA 2OGUA 4A27A 4CKCA 5AUNB 4FDLA 3PCTA 3K92A 3TLJA 3OUTA 4NV1A 4FGJA 1LFDB 1M2WA 1GPJA 2Q1YA 3ZV5A 5BYAA 1OLXB 4OHBA 2QZ9A 3W6ZA 4EHIA 2O8BA 5J2UA 5HOQA 1R4MA 3KHKA 3BGVA 3A25A 2PUDA 4QXRA 3ML1A 2EZ9A 2BAGA 2VHVA 3C39A 2HGSA 2OQ2A 2ZRHA 3PGKA 2PWYA 4HQRA 4YCJA 1BCRB 3RV3A 3STVA 3HLTA 3REOA 1GPMA 3W2FA 3V5NA 2VSFA 1YI8A 2TMYA 1SOVA 2Z9CA 3ESQA 2B8TA 2E4XA 1YU6A 5EJGA 1UMCB 4CEJA 4W7IA 2FXIA 5EG5A 1TKRA 4RABA 3BTUA 1IWOA 4X8MA 4TKUA 4MR8A 3AVWA 4H1HA 5IABA 1H69A 4WJZA 1IZZA 5GAJA 3UXMA 4R4JA 3JQDA 2HMUA 3CTMA 2DR2A 4EDHA 4FCWA 2WYHA 4GQBA 1S3IA 3GBPA 1MB2A 2YOFA 4H0FA 4KQKA 3P4XA 3UAZA 2J4DA 1HDIA 1QHHA 2F00A 2OFXA 4D0NA 2C84A 5A0FA 1OH6A 1UAYA 3EE6A 4AD8A 3AK4A 3JQGB 3I0ZA 4J16A 4BLUA 3GAMA 4OATA 4UNQA 2P78A 2ODAA 2RK4A 3OLWA 4PHGA 1ST2A 1T8WA 2IPOA 3DZCA 3LG2A 4G56A 4OFWA 4EKGA 4C4ZA 1TUEA 2AN5A 3N0WA 1PGPA 1NOIA 4YRJA 3ZBPA 1T9CA 5CA0F 2HCFA 1WB9A 1NQXA 3CPJB 3LPLA 3NAZA 3PP8A 3TAUA 2VRNA 4ASUA 1TM4E 3PT9A 2B4QA 5CEJA 3ZGVA 2EX4A 3IXMA 1BW9A 1JTEA 1YUMA 1ZRHA 3F98A 3GOQA 3JVEA 1MOPA 4G0OA 1P1RA 1NR1A 3HMKA 3RNLA 1MAWA 2GN6A 3MFYA 2YRXA 4BX3A 3IQWA 1WTCA 3KQVA 1Y6RA 3B20A 4OGGA 2YZ2A 5IPFA 5B5SA 4DCPA 3FZGA 5IVKA 3EPAB 3PGJA 2DFVA 4NC9A 1ESEA 4F5WA 4GDMA 1O94C 3JATA 1TLFA 3BHNA 4K9MA 4L8GA 1Y1SA 4BLSA 4C4PA 2V9CA 4BECA 1A04A 4ECAA 5D3ZA 5AKXA 4PTZA 1SU7A 3L7JA 3MTDA 3AL0C 5A3SA 1NPYA 2BFEB 4JEMA 4FZ5A 2P4UA 1UODA 1XJ5A 1GD1O 2VUSA 5HOEA 2VEOA 3G9QA 1Z25A 4H31A 5LBUA 4BGEA 4KIJA 1IUPA 1E7WA 1PJRA 3G7NA 1W5EA 5GONA 2CYCA 3JZDA 3FF1A 4EKEA 1ZJ5A 3D6TB 2RDMA 2XMDA 2FE4A 2IF2A 1I01A 1MPXA 2O0LA 3FE2A 3GRFA 3OFSA 2VRWA 4H6WA 5DISB 5G0TA 4AJOA 5AW8A 2E5LB 1YK0A 1I2AA 2BFPA 3FKSA 3FYCA 4BEWA 4MAAA 4Q66C 3P32A 1CS0A 1F12A 4LQDA 3K94A 2FPGB 2V7QA 2FSVA 2GRAA 3BGSA 2ZDQA 4CLQA 1SUIA 2NUTB 4D99A 3NBFA 1SEPA 2N1MA 4YP1A 4V1CB 2V0NA 2QWXA 3OSUA 5EZQA 1CR6A 2BMEA 3WYEA 2DMRA 5IC6A 4UOEA 2QG9A 3E53A 3T5PA 4W5QA 1C1YA 1ODJA 3QFSA 4AZTA 1GQRA 1D2RA 4WOBA 5LZ4A 4KNYA 1O5IA 2XUKA 1Q21A 3EULA 5U1PA 2VPIA 4R71A 3UIEA 2OK7A 3EUAA 4M1SA 2H2WA 3GQBB 1SQGA 2W37A 4A73A 3I2YX 1NXPA 3F7NA 2JFOA 2PA0A 1VZ3A 1WXHA 3PNPA 3W2GA 4QUEA 4RLSA 4D4KA 2VPXA 4E6EA 1IUKA 2BELA 4HVTA 2TRSB 2A35A 2FOXA 2R1ZA 3QF7A 4BO3A 4O02B 4XA8A 3RAGA 3CG4A 3J7TA 3R5FA 4ZICA 5EUQB 2WFLA 3NHSA 2GESA 4IFIA 5GQSA 2VNHA 5IT4A 1F20A 3KVVA 4X3CA 4UJ3A 1RMQA 5JSUA 4B79A 1IIBA 3RR2A 5KNCD 3NHRA 2GGSA 4D3XA 3H9QA 1M2HA 3D4BA 3MWEA 4ZCTA 2ISCA 2PBFA 4E07A 4MWBA 5KINB 4FBGA 4IIBA 1XQXA 4MUNA 5CIYA 1II0A 2NMVA 2C0QA 2WIBA 1JHVA 2X4LA 2HSZA 3EXIA 4FVTA 4HXGA 2UYCA 5IK2A 1ZI6A 3OCCA 1XEAA 4OXNA 2PUTA 3IV6A 4U00A 2CMGA 2CK3D 2OAP1 4MQEA 2AG0A 2YHAA 4ZVRA 5LQAA 2VDVE 4U2DA 1D6MA 2PY6A 4RHEA 3Q87B 4GO1A 1QMIA 4PLGA 1L8AA 4KMMA 3C1AA 1BYIA 1SXPA 3AHGA 1JEJA 2LDXA 5J2UB 3NAGA 4P0TA 4QATA 3D5QA 2YWCA 3PJRA 5DM0A 1CEQA 2DVMA 3TEFA 4IIVA 4TT8A 1KJZA 3EFEA 5KWEA 3U4QA 4M7PA 3AZPA 4XJTA 1TQ6A 4DNPA 5IAAA 1Y42X 2Z5GA 4ZK2A 2CZQA 2D2FA 2ZI5A 5PNTA 4OM7A 1JV2B 2IV3A 4PVDA 5ALIA 2Y1EA 5KJEA 1JSLA 4DLPA 4LPKA 4IIUA 4V24A 3NJRA 2BGIA 4KV9A 1WSAA 2G72A 4KR9A 3CRVA 1K9VF 1R8QA 2GAFA 4NE7A 4P58A 4R7TA 2OYSA 3BWBA 4EB8A 3ESYA 3CLTD 1GAEO 1MC1A 3FNEA 3JYPA 3RJMA 3VKWA 3L43A 3EP4B 2PMDA 1U98A 4AUKA 1I6WA 1JU3A 3NALA 3RADC 3I2HA 4JJGA 5HX7A 3IEUA 1GZHB 2Q4BA 1YCGA 1QFMA 2JAPA 1B26A 2XTAA 3COYA 4MRAA 1ZUWA 3MN1A 4KSCA 3QU5A 4TT3D 4ZVNA 1YRQA 3JS5A 4BMXA 1T0JB 3K6JA 3KVNA 1FS6A 1ZSVA 3QI2A 4J0HA 3QLTA 2QMYA 2VP2A 3IDQA 5LDDC 4OHCA 3KZXA 4O5AA 5TVGA 3BE5A 4QGAA 4A6PA 1J0BA 5KYNA 4XDHA 2FSSA 1NFFA 5DN6A 5L9AA 1YOVA 5JH7B 2CLMB 1JXAA 4MKFA 1HG1A 1GIAA 2WJIA 4RHTA 3H7AA 1NQUA 2O2ZA 3BGIA 4EVIA 2B3TA 4Y2JA 3S6JA 5L7WA 4P83A 1BGWA 1TUGA 1CRZA 3QVJA 2E4YA 5CAEB 3NHBA 3RWOA 1I4TD 1AXEA 2QNBA 2HN9A 2IP4A 5DYWA 1PEKE 3FUCA 2NIPA 3LDAA 3C16C 2B0JA 5AUQA 2B94A 1HSZA 1ZD1A 4DBVO 1R12A 3SR0A 2B7LA 2OV6A 1N2IA 2JGLA 1GQQA 2A33A 1YJ8A 1K0UA 1ZD3A 1U3GA 4DLNA 5JHHB 4V0MA 3HKBB 3EGEA 3T38A 4C7XA 4ARBA 2OECA 3MGCA 2A5DA 2J3MA 1K6MA 3UJDA 2A1UB 1M72A 3AVQA 1ZITA 4GP6A 4YQYA 3SC6A 4Q4CA 1Z8NA 4Y6SA 4HD8A 2XDQA 4QU5A 4HSGA 4XW2A 1CRQA 3AF6A 1Y0BA 4UXIA 4Z7JA 1EDDA 1U81A 3LC0A 4FFSA 3H9BA 1Y7PA 2YXNA 4R68A 4R7GA 1CK4A 3BSWA 3Q12A 1IEXA 1R7RA 1I24A 1F4LA 3DW1X 2KYRA 3T4UA 1UR5A 3N8KA 1E2MA 4CL3A 5LZ8A 4BQPA 3AY3A 1Z47A 1Q3KA 1XVUA 3ESXA 3QWHA 5I3CA 3ZDBA 3R6LA 5J4HA 5H83A 2ZBGA 1LX7A 2HFJA 4KACA 1C50A 5C18A 2R3SA 1N78A 1G5PA 2RC5A 1FTYA 3PR3A 2XZLA 1P2DA 1TFUA 3LPMA 5F2OA 4J0FA 4N3CA 1JKFA 4HRAA 4RZQA 3NWOA 3IMKA 3PDJA 1ORVA 2RFLA 1JPVA 2LWIA 4GOLD 4YO7A 3R7NA 3W5UA 1PJSA 2FMFA 4BFTA 5EJ6A 2ZRQA 4ZI7B 2CHUA 2GDZA 4GUAA 4W5TA 2WQ6A 3NVAA 1U3VA 3GJQA 3FKSD 3H5AA 3LNTA 3HXQA 2C4NA 4YR9A 1NBMA 4BLPA 1M1NA 3BH7A 2X22A 3L0CA 4RHCA 1JVBA 4YCLA 3R8XA 1E6KA 3NBMA 3OI7A 4B82A 3HXOA 1G5IA 3IQEA 5C32A 4WCDA 1MZVA 1E2PA 4TL8A 4XWAA 3U7FB 1LCIA 3QVKA 3OG9A 1Q1AA 2Q8NA 1RWQA 2JS7A 2QUKA 1IH8A 1XZCA 3HA7A 3IXQA 3MWDB 1PF7E 4QELA 1KO4A 4TKVA 5BWOA 3QEAZ 1KK3A 3A0UA 5TMEA 1Z3CA 3QA3E 1K98A 1VBFA 2C4MA 1UXGA 5IULC 5L4LA 2H5EA 1QFZA 2BGKA 4FKZA 4GHWA 1R9GA 4NENA 1K89A 1QV9A 3BZBA 2P68A 4M86A 4MWDA 5H8WA 1M1ZA 2FX5A 3E7DA 4EY4A 2X7XA 1UAGA 1R16A 3R74A 3WK4A 3UQYS 1J7KA 4IV0A 4Q16A 3BCUA 3I01M 3MJVA 2Z9BA 2IZ0A 4MQMA 4MRPA 1CD5A 4PX9A 5CJJA 1T4GA 1CG6A 3A6KA 5TGTA 2V7GA 3RTEA 1CJMA 2C42A 4HWGA 4Q4DA 5TPWA 4BO9A 5CB4A 1FLVA 4KIFA 5JNVA 3U44B 4D9CA 3T3EA 3PXGA 1ZOOA 3QOWA 2XUDA 4NZZA 4X41A 3U9LA 2EATA 4B2PA 4WQMA 5CA1A 1D9ZA 4H2DA 1EX9A 4AULA 2D54A 1HDGO 1PQPA 1M2OA 1RJ9B 4O8JA 3O0TA 4YJFB 3WWOA 4INJA 1CUAA 1K8YB 4IIHA 5HM8A 2B7CA 3OJWA 1C0EA 5JQGF 3CLUD 4Q4JB 1U31A 4CM6A 1PWXA 1XRLA 3WGOA 4KN5A 2NO7A 2PUCA 5DNYB 3IWCB 3WLJA 4WD3A 1SXIA 3IVMA 4Y67A 1JQLB 4XWWA 4PGAA 1WB4A 1ZBQA 1BN7A 1OY1A 4QDKA 3LA8A 4Q6WA 2BGGA 1TU3A 3BMQA 4FFLA 4TKZA 2QTGA 4LYDA 5BSKA 5CX1A 2Q50A 2QVZX 1G4UR 4GYYA 4ZI7A 5CDFE 2P4HX 3TSCA 4ZCRA 3GJ6A 2Z6UA 5BV0A 1H6BA 2YOGA 2FMHA 4ALMA 3LBHA 1J23A 3UW3A 1TO1E 2OFPA 2WTAA 4I1PA 4GRDA 1TQHA 3L8EA 1U8UA 4F06A 2NU9B 3TNDA 3NGXA 1OKKD 3ZHZA 4E4YA 2WB4A 1DMSA 1OT5A 1VE6A 2OCBA 3IXLA 4G07A 2BKAA 4WCFC 2TECE 5DU2A 2GK4A 3WIVA 5LVAA 4YRRA 3IKJA 2WU8A 4OI2A 3D81A 4EZBA 1V9LA 5LQUA 1R0XA 3HVHA 1V3VA 4YT5A 4QLAA 3L07A 3L8HA 3FMPB 4P22A 3TTYA 3MGBA 3X1WA 2X4DA 4LTNA 4D9IA 1AT1A 2OL4A 1T5HX 5TF4A 4TZ6A 1I36A 5DGHA 4WT7A 1YQDA 5HMMA 4DQUA 5AOAA 1WPRA 4DV1B 1FS5A 1RWBA 3TUXA 1OWLA 3S2IA 3TI9A 1KK0A 3O1JC 1R4NB 2C5AA 4JITA 3GDGA 3NB0A 4LZPA 4UUQA 3TG8A 3D6UA 3HYCA 3LD9A 2BR5A 2GEJA 4MCHA 3P9XA 4QLBA 1ZUHA 3VHXA 4K9RA 4RUKA 2OBFA 2NVOA 5EIWA 1MDFA 1NRWA 4MRRA 5BWMA 1PJ2A 3GRAA 3EYWA 1P0IA 3P9YA 1PNTA 3B70A 4HQNA 3ZGNA 1N4AA 1RI5A 4YAFA 4QT0A 4MB0A 2H57A 4HZUA 4BP3A 1YNOA 3AGQA 3L6UA 3D3JA 1KJ8A 4D2IA 4FX2A 2YYZA 3JQRA 4ZT7A 1Q14A 2JHAA 2QA5A 2KI5A 4FNOA 3WISA 3ZPXA 4Z4GA 2FPWA 3W90A 3LUAA 1YZNA 4ZVOA 2PGXA 5FI1B 4QFDA 4EW2A 3DLHA 3O8QB 3T3NA 3HE3A 3ZJUA 1DC8A 1UQRA 1C80A 2FPOA 2X1VA 4OXIA 3ZWWA 4Y9RA 3QITA 4HVAA 1M83A 4RFVA 4C2UA 3TOZA 4IXWA 3IDSA 2JJMA 4QOJA 5F3DA 1EXNA 3JQAA 1NI5A 3D0QA 2Q5CA 3H65A 3VYSB 2I3DA 2OESA 4I4TB 2JAOA 4CKWB 1W0JD 2IITA 3NDPA 5F4BA 3TFQA 4ZN6A 4KVAA 1QJCA 1D3AA 2VYQA 4R8RA 1T4BA 4AG3A 4OV6B 4L4YA 1VPTA 4C6TA 2DEUA 3QG1A 2FZVA 4H18A 2BR3A 1CJKC 4RLHA 4E70A 4HEJA 4X6LA 3OC0A 4MLDA 1EJBA 4NCBA 3TLBA 4ZOQI 5EN4A 1O94D 1LDBA 2AC4A 4XDYA 1KE1A 2B9VA 1K06A 3HY6A 4JSRA 4O2AF 3H42B 5LYJA 4NCKA 4OD0A 2QAIA 2RKBA 3Q3GE 3CX3A 2ZI3A 3A1VA 4HEQA 1SBZA 5JAOA 5KC9A 5IEJA 2X0RA 4TN1A 3I09A 3KJNA 1IB6A 3N8GA 5IEBA 1BWPA 4C4YA 5AHKA 3IHTA 3OLQA 1U94A 2M1ZA 2VLIA 3O5AA 1U1EA 4F4HA 2PMFA 1ZNZA 2PRJA 3BWXA 2H51A 2QQEA 1CX9B 3RWBA 1YASA 4Q3KA 5C8VA 1EKXA 3ZD8A 4IDBA 4X94A 3FD8A 6REQA 2Q49A 1NOJA 2W0SA