3Q2PA

Reduced sweetness of a monellin (mnei) mutant results from increased protein flexibility and disruption of a distant poly-(l-proline) ii helix
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
GEWEIIDIGPFTQNLAKFAVDEENKIGQYGRLTFNKAIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monellin chain B/Monellin chain A chimeric protein
publication title Reduced Sweetness of a Monellin (MNEI) Mutant Results from Increased Protein Flexibility and Disruption of a Distant Poly-(L-Proline) II Helix.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
total genus 20
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3q2pA00
1IV7A 4LZIA 1RN7A 1STFI 1DVDA 3K9MC 1KWIA 2W9PA 3NX0A 4N6MA 5ELUA 4N6V0 4N6TA 1CYUA 1N9JA 1WNHA 4CCVA 5LC6A 3IMAB 4N6OB 3LH4A 3GAXA 3UL6A 3UL5A 3PYJA 5ELJA 4ZM8A 1GD3A 2OCTA 1N5HA 1MNLA 1LXEA 3PXMA 1TIJA 1CYVA 1CEWI 4TX4A 1ROAA 5EQLA 1GD4A 1DVCA 1G96A 2KXGA 1YVBI 1IV9A 3MWZA 5A0OB 4N6LA 3S67A 3KFQC 4N6NB 4EYCA 1N5PA 3Q2PA 3SVAA 3QRDA 1NB5I 1MOLA 2O9UX 1R4CA 1EQKA 1M9GA 3L0RA 5LC7A 3PS8A 1A67A 1FA3A 1FUWA 1PFPA 2W9QA 4N6UA 2CH9A 2BO9B 1A90A 3KSED 4IT7A 1NB3I
chains in the Genus database with same CATH superfamily
2XGLA 2H0HA 4K90B 4MMZB 1WMNA 4EV2A 4LZIA 8CHOA 1STFI 7RNTA 4XBTA 1O7GB 3EE1A 1W6YA 2IUJA 1G0TA 1SJWA 4U13A 1BSDA 2C10A 4BL3A 1GY5A 1TFOA 2UGIA 2Z6BA 3CME3 4LYLB 1KWIA 1ZGXA 4NPBA 2GBWB 4N6MA 2XRXB 2IA7A 2CFLA 1LOWA 4KFDA 1PU4A 3WOEB 4HYZA 1TRPA 4RNTA 3O8YA 3KCHA 4STDA 5D82A 3F8XA 1N9JA 4CDLA 1BRGA 1BRJA 3CCV3 3SLUA 1K28A 2WOFA 1KC84 1UW1A 3KZTA 3SOAA 3PZWA 4MMXB 3I0YA 3FGYA 3GAXA 2AADA 3UNLA 3MYTA 3F40A 3PCSA 3UL6A 3PYJA 3CC43 3ALAA 2WGOA 5ELJA 5BIRA 1RN1A 5JPPA 5CK6A 2QEX3 1I70A 4O3VA 3PXMA 5M18A 2BMOB 1IVWA 2IYJA 2P38A 3HOHA 2F4YA 3AGNA 1CEWI 2HMJB 3HI7A 3JUOA 6RNTA 1QVG2 1SARA 1BNSA 1DMQA 1BVIA 2JQ5A 4O02B 5EQLA 4EC6A 3JUQA 1RMSA 3GZRA 2MF7A 2ZL8A 4R9KA 1JZOA 1N8QA 2P09A 2D42A 1G96A 1VZZA 1Q7HA 2K3DA 3FG4A 5GSPA 3I563 1U8CB 3NXJA 1TU5A 3FLJA 1B27A 1X1WA 1YVBI 1M1XB 3B4PA 2F98A 2F86B 1UGIA 5A0OB 3EBYA 2CX0A 2F5MA 1W5ZA 4CPKA 1X1XA 3ER7A 1RRHA 2Z77A 4XM4A 5DRVA 3S5CA 1YIJ3 1BRKA 1CQSA 3AGOA 2M7OA 4X2HA 2PNCA 1JNQA 2D1WA 1LVNA 4HZ9B 4WFOA 4JF8A 2OTJ3 1I0XA 3FG1A 1B2SA 3QRDA 2STDA 4MJDA 5AEWB 1NB5I 1M904 1QALA 1Q824 1T5YA 3HX8A 1OACA 5IEOA 1RGLA 3I553 1R4CA 1EQKA 3BB9A 1IQ8A 4HM7B 2ZDJA 3SOYA 3U1WA 3B4OA 1FUTA 3L0RA 1RGAA 5IG0A 3EX9A 1VQ73 4KVHA 1LQGC 1AVKA 1ULJB 1QAKA 3F14A 2C11A 1F8NA 1K9M4 4WWUC 1RGCA 5AI1A 1VQP3 1IDPA 1JBSA 3EF8A 1A67A 1UGHI 3WHOA 1E97A 4HM2B 1YJN3 2XEPA 4H61A 5CXOA 3G713 1FUSA 1TJDA 1YGEA 2B1XB 3BU4A 3LTBA 4BIRA 4HM6B 3ZFZA 3MG2A 1K734 5TGNA 1WMOA 2H0GA 4GHOA 1J2BA 1GOVA 3NV0B 3NV0A 4R4KA 2XH9A 1GMRA 4N6UA 1T2IA 2P0MA 1OPYA 1V74A 1AY7A 3WODG 4HM4B 5I97A 3JVCA 2CG0A 1B3SA 1VQ93 3G16A 3GZYB 2BIRA 1RGEA 3NBRA 3EC9A 2CC3A 1OGZA 1RCKA 9RNTA 3QK9A 4HM8B 2XGNA 1ZS7A 1DMNA 5M1AA 2L4VA 4JRFA 1UI8A 2CFWA 1DVDA 1Q9EA 2RCDA 4GB5A 1IVUA 3F7XA 3DH2A 3BNDA 3K9MC 3LTDA 6STDA 4BL2A 1BSCA 5AIHA 1RNTA 1ZO2A 3WDGB 1K41A 2W9PA 1FZUA 1R4YA 2CWTA 4HBRA 1EKMA 3MHEA 1RJOA 3NX0A 1BRHA 5BXQA 3VGNA 3VF1A 2LYXA 3N8BA 4HM3B 2BNGA 1BRIA 3B8LA 3DGMA 5AYRB 4N6V0 5IG5A 3MPHA 5CF1A 4O2HA 4EV5A 3LTAA 5M19A 4BTXA 3CCM3 2OTL3 1NU3A 1CYUA 3G0KA 1WNHA 3EJVA 1BNJA 2OOVC 2HMOB 4KFEA 2HOHA 2P0XA 1O7HB 3EBTA 4HVNA 2XSHB 3IMAB 3MKIA 1I2FA 4L8PA 4N6OB 1I3FA 3UJMA 2FNQA 1AVLA 3FH1A 3WMDA 2RFRA 4L7KA 4XBXA 1GMPA 1L5GB 7STDA 3CC73 5EVHA 5D81A 3UL5A 4OK0A 5G2GA 3OX9A 5IG4A 1MGRA 1LOYA 1YJW3 1BGSA 1N5HA 3HIGA 1LXEA 1B21A 1HYFA 1LOVA 4FMDA 4K1UA 1CYVA 1JJ22 3N54B 1W00A 3JUPA 3D9RA 1T3BA 4R9LA 1RSNA 3KN4A 1NJI4 5AEUB 5IW9A 1BNGA 1O7WB 1D6UA 1RRLA 4NREA 3A76A 1N8R4 1OF5A 1OF5B 1SPUA 2KXGA 4EBGA 1KSIA 3MWZA 3CPW2 2GSPA 2GXFA 3GWRA 1JV2B 1MWRA 4N6LA 1CH0A 2R4IA 3NBJA 4IPBA 1ROVA 1YJ93 2SBLA 3KFQC 1TP6A 1BOXA 1BRSA 2XSOB 4EYCA 3CCR3 1VQ83 1AQZA 1FGTA 3CPOA 5KP1A 4OVMA 1MWUA 2CFDA 3RDEA 1FGRA 1OH0A 2W0QA 1OGXA 4J9AA 2KF4A 2OWPA 2YX9A 4FMBA 2Q07A 3CCQ3 5BU4A 3EN1B 1Z1SA 3FKAA 2K54A 3D4AA 1VQK3 1WTHA 1KQS2 1V57A 7GSPA 2FGTA 3M8CA 3DGYA 1E3VA 4I5QA 3D5IA 2INXA 2P05A 1PY3A 4GSPA 4BTWA 3PS8A 4L8OA 2E2UA 1NWWA 2FXTA 3DXOA 1FA3A 1FUWA 3E99A 1T2HA 1PFPA 4FMCA 1ZX2A 2QGUA 3PCRA 1RGHA 1BUQA 1AR0A 3LXUX 3SYUA 1I8VA 4RNZA 1NNVA 1GOYA 4LEHA 2W03A 1JZDA 4HKVB 1S723 5CLKA 1W2ZA 3X3YA 3CCE3 4ORLA 1EEJA 4WYKB 4WYKA 1Y4KA 1FW7A 3OV4A 1BSEA 1S5AA 3S27A 5AIFA 3MG1A 3SEDA 1RCLA 1O7NB 1PYLA 4R80A 3HIIA 1UUVB 1IQXA 2ZHXB 1FGOA 3F7SA 1I2GA 4HOHA 1IU7A 2OQEC 2HMKB 4IIAA 1B2XA 4EXRA 2PZVA 1GSPA 2CWVA 1W4NA 2WOHA 3H51A 1BNIA 2WO0A 5ELUA 2F99A 1WQLB 2F5WA 1O7PB 1IQYA 1GY6A 1W6CA 2Z7AA 3DUKA 3NHXA 3Q1CA 5IF6A 1YIT3 3RNTA 3CMA3 1GMQA 1HU9A 1TTOA 4N6TA 1X1UA 1BAOA 1RDSA 1Q42A 2IUKA 2W2CA 2YFLB 1C54A 1JN5B 1JN5A 4HM5B 2YFJB 4GL6A 2KF5A 1UCJA 1JB2A 4FCZA 4CCVA 1BNEA 4K61A 8RNTA 1YI23 3S29A 4BTYA 3LH4A 3Q90A 3SX1A 2QA43 2UX0A 3X3XA 3DGNA 3DM8A 3CC23 2CG1A 3CCL3 1GD3A 1W02A 1GYBA 1JB5A 2AAEA 2RGQA 1TIJA 1IT7A 4MMYB 3WA3A 1UDII 1IK3A 2BU4A 1A2KA 4TX4A 3MSOA 4J5GA 4MEIA 3LT8A 1GD4A 1US1A 3K5TA 1DVCA 2JDIH 4X2OA 1C7HA 2KCDA 1N9EA 3WR2A 1QMAA 1UCKA 4CJNA 1X1YA 3G8ZA 1VQN3 1MWSA 1Q7Y4 4LSOA 1JBTA 1BSAA 1YNVX 1VQ63 3AHSA 1ASKA 3FZWA 1Q40A 1Q40B 2H0IA 2GEXA 5EEOA 3T8NA 1DMMA 2WGQA 4RZMA 2ML5A 3OXAA 1UI7A 1VQQA 5IG3A 2SARA 3SXXA 1A2PA 3K63A 3S28A 5JPUA 3BLZA 1N5PA 3FCSB 3HK4A 3CCJ3 1JRQA 4J8TA 3NM7A 3X42A 4Q53A 2E2VA 3SVAA 1U5OA 1W01A 3GZBA 1GOUA 5KP3A 2O3OA 2J8XB 2IMJA 3F9SA 3FF2A 3T0UA 3DGLA 4XB5A 2F56A 2XFTA 1ULIB 3CNMA 3DMCA 2GU1A 3AMOA 3AMOB 2CIUA 3DGOA 3GRDA 3NUVA 4AKZA 4DKIA 1M1K4 1YGWA 2CWUA 1LQMB 3OW22 3NBBA 3TDGA 3CXC2 2CW9A 2Z76A 3NM2A 1VQL3 3BIRA 3U97A 1LRAA 4AEQA 1TFKA 1EUIC 3KIIA 3STDA 1B20A 3GZXB 2B24B 3BNCA 4H3UA 4WHAA 3VSYA 1BU4A 3DZLA 4BU4A 5BVBA 1D6ZA 2BO9B 6GSPA 2RNTA 4ILFA 1EA2A 3G4S3 1OCVA 1BSBA 1GS3A 4HAAA 3B7CA 1KD14 3WA2X 2BMRB 4KFFA 1A90A 1RGFA 1NB3I 3EB8A 3DY5A 5G1LA 1Q814 3X41A 3V92A 5HOHA 1IV7A 4WP5A 1RN7A 1TRQA 1O7MB 1B2ZA 3OWYA 3FSDA 1A2VA 2XFSA 1I2EA 2A15A 4XBYA 1OUNA 5AYSC 3T8UA 3ZG5A 2YFIB 3JUNA 1B2UA 3LZAA 1RGGA 1UCLA 3EN8A 1NO3A 3GSPA 1W2B2 3BNEA 2ML6A 1FGMA 2RSXA 3LMLA 1HZ1A 3A5EA 5G1KA 1Q864 1TUHA 3FF0A 2W6JH 5RNTA 1YVSA 1QJGA 2RBIA 4FCMA 2ZA4A 1JKGB 1JKGA 3KSPA 2GBXB 4HJLB 3JUMA 1VQ53 5LC6A 1RHLA 2UUGC 4KT3B 1UCIA 5FGOA 1YHQ3 1RNBA 1FYSA 3LYGA 1SIHA 2C4BA 1BANA 2Y74A 4LMIA 2CK3H 1B2MA 1BRNL 4ZM8A 5STDA 3K7CA 2OCTA 3J7Yd 1VQO3 1SQWA 1MNLA 1OHOA 3EHCA 3RGRA 2KRTA 3FG3A 4FMAA 3PGBA 1GY7A 2QIYA 1IVVA 1QAFA 1ROAA 2XF3A 3D3LA 3NQYA 1DETA 4R1KA 1D6YA 1QVF2 3URPA 1HKXA 3RGAA 1MGWA 3N9HA 5CF2A 2CFGA 4HM1B 2CX1A 2BT3A 4QWTA 1JBRA 4FCJA 3IPTA 1BIRA 1K8A4 1W7CA 1IVXA 2GU3A 5JBSA 1G02A 2IY2A 3CU3A 3CCS3 1BUJA 1IV9A 1I0VA 2GEYA 1IT8A 2K0MA 1SIIA 4N3VA 5IERA 1IYYA 1LOXA 3S67A 1RGKA 3X40A 2OQEA 1UUGB 5AIIA 4NHFA 2W56B 2W56A 2HMMB 1V58A 4N6NB 3CD63 1RLSA 3EQQB 3HZPA 3OWUA 2CFKA 1VQM3 1FGQA 3F8HA 4EW5A 1I3IA 4RBNA 1RKYA 2W04A 4FR9A 3Q2PA 5DREA 1OHSA 3V99A 4XDWA 1ISKA 4RNYA 2BMQB 2Y73A 3K0ZA 4LGQA 4XDVA 4AKYA 2I9WA 2R41A 1MOLA 2CHCA 3OWSA 2O9UX 3KKGA 5IEPA 3IJEB 4KZ1A 3ECFA 1DE3A 4HZBB 1WMPA 1M9GA 4PEJA 3D79A 1RN4A 3X3ZA 3WOFB 5FW5A 1RTUA 3LOYA 3ZG0A 3MG3A 2KF3A 1STDA 4I4KA 4J5KA 5LC7A 5D83A 5IENA 1AV4A 4G1MB 3D5GA 2KAAA 1NDOB 3ROBA 3G6E3 1E3RA 2KF6A 2XR8B 3H3HA 5AIGA 3UB1A 1BNRA 4HM0B 1LNHA 3CCU3 2MC8A 1LNIA 1W6GA 2W9QA 3LT9A 2HMLB 3LTCA 5KP4A 1EG9B 4OUQA 4O8SA 2E2TA 4K1VA 5HGRA 1DYUA 3Q3FA 2CKFB 1JB4A 2HMNB 3AHWA 3V98A 2CH9A 2LQVA 1VQ43 1BNFA 3BNBA 1OHPA 1UUWB 2L1SA 2BHMA 3NQZA 2OOVA 1MWTA 3KSED 4IT7A 3CNXA 3KE7A 2V1LA
chains in the Genus database with same CATH topology
2XGLA 4K90B 4MMZB 1WMNA 4EV2A 4LZIA 8CHOA 1STFI 4XBTA 1O7GB 3EE1A 1W6YA 2IUJA 1SJWA 4U13A 2C10A 1GY5A 1TFOA 2Z6BA 3CME3 1KWIA 2GBWB 4N6MA 2XRXB 2IA7A 2CFLA 4KFDA 1PU4A 3WOEB 4HYZA 3O8YA 4STDA 5D82A 3F8XA 1N9JA 4CDLA 3CCV3 3SLUA 1K28A 2WOFA 1KC84 1UW1A 3KZTA 3SOAA 3PZWA 4MMXB 3I0YA 3FGYA 3GAXA 3UNLA 3MYTA 3F40A 3PCSA 3UL6A 3PYJA 3CC43 3ALAA 2WGOA 5ELJA 5JPPA 5CK6A 2QEX3 4O3VA 3PXMA 2BMOB 1IVWA 2P38A 3U1WA 1CEWI 2HMJB 3HI7A 3JUOA 1QVG2 1DMQA 2JQ5A 5EQLA 4O02B 4EC6A 3JUQA 3GZRA 2MF7A 2ZL8A 4R9KA 1N8QA 2P09A 2D42A 1G96A 1VZZA 3FG4A 3I563 1U8CB 3NXJA 1TU5A 3FLJA 1YVBI 1M1XB 3B4PA 2F98A 2F86B 5A0OB 3EBYA 1W5ZA 3ER7A 1RRHA 2Z77A 4XM4A 5DRVA 3S5CA 1YIJ3 1CQSA 2M7OA 4X2HA 2PNCA 1JNQA 2D1WA 1LVNA 4HZ9B 4WFOA 4JF8A 2OTJ3 3FG1A 3QRDA 2STDA 4MJDA 5AEWB 1NB5I 1M904 1QALA 1Q824 1T5YA 3HX8A 1OACA 5IEOA 3I553 1R4CA 1EQKA 3BB9A 1IQ8A 4HM7B 2ZDJA 3SOYA 3B4OA 3L0RA 5IG0A 3EX9A 1VQ73 4KVHA 1ULJB 1AVKA 1QAKA 3F14A 2C11A 1F8NA 1K9M4 4WWUC 1VQP3 5AI1A 1IDPA 3EF8A 1A67A 1E97A 4HM2B 1YJN3 2XEPA 4H61A 5CXOA 3G713 1YGEA 2B1XB 3LTBA 4HM6B 3MG2A 1K734 5TGNA 1WMOA 1J2BA 3NV0B 3NV0A 4R4KA 2XH9A 4N6UA 2P0MA 1OPYA 1V74A 3WODG 4HM4B 5I97A 3JVCA 2CG0A 1VQ93 3G16A 3GZYB 3NBRA 3EC9A 2CC3A 1OGZA 3QK9A 4HM8B 2XGNA 1DMNA 2L4VA 4JRFA 1UI8A 2CFWA 1DVDA 2RCDA 4GB5A 1IVUA 3F7XA 3BNDA 3K9MC 3LTDA 6STDA 5AIHA 1ZO2A 3WDGB 1K41A 2W9PA 2CWTA 4HBRA 1EKMA 3MHEA 1RJOA 3NX0A 5BXQA 3VGNA 3VF1A 2LYXA 3N8BA 4HM3B 2BNGA 3B8LA 3DGMA 5AYRB 4N6V0 5IG5A 3MPHA 5CF1A 4O2HA 4EV5A 3LTAA 3CCM3 4BTXA 2OTL3 1NU3A 1CYUA 3G0KA 1WNHA 3EJVA 2OOVC 2HMOB 4KFEA 2P0XA 1O7HB 3EBTA 4HVNA 2XSHB 3IMAB 3MKIA 4L8PA 4N6OB 3UJMA 3WMDA 2FNQA 1AVLA 3FH1A 2RFRA 4L7KA 4XBXA 1L5GB 7STDA 3CC73 5EVHA 5D81A 3UL5A 4OK0A 5G2GA 3OX9A 5IG4A 1YJW3 1N5HA 3HIGA 1LXEA 4FMDA 4K1UA 1CYVA 1JJ22 3N54B 1W00A 3JUPA 3D9RA 4R9LA 3KN4A 1NJI4 5AEUB 5IW9A 1O7WB 1D6UA 1RRLA 4NREA 3A76A 1N8R4 1OF5A 1OF5B 1SPUA 2KXGA 4EBGA 1KSIA 3MWZA 3CPW2 2GXFA 3GWRA 1JV2B 4N6LA 3NBJA 2R4IA 4IPBA 1ROVA 1YJ93 2SBLA 3KFQC 1TP6A 3CCR3 2XSOB 4EYCA 1VQ83 1FGTA 3CPOA 5KP1A 4OVMA 2CFDA 3RDEA 1FGRA 1OH0A 2W0QA 1OGXA 4J9AA 2YX9A 2OWPA 4FMBA 3CCQ3 2Q07A 3EN1B 1Z1SA 3FKAA 2K54A 1VQK3 1WTHA 1KQS2 2FGTA 3M8CA 1E3VA 2INXA 2P05A 4BTWA 3PS8A 4L8OA 2E2UA 1NWWA 2FXTA 3DXOA 1FA3A 1FUWA 3E99A 1PFPA 4FMCA 1ZX2A 2QGUA 3PCRA 1BUQA 1AR0A 3LXUX 4RNZA 4LEHA 2W03A 4HKVB 1S723 5CLKA 1W2ZA 3X3YA 3CCE3 4ORLA 4WYKB 4WYKA 1Y4KA 3OV4A 1S5AA 3S27A 5AIFA 3MG1A 3SEDA 4R80A 1O7NB 3HIIA 1UUVB 1IQXA 1FGOA 3F7SA 1IU7A 2OQEC 2HMKB 4IIAA 4EXRA 2PZVA 2CWVA 1W4NA 2WOHA 3H51A 2WO0A 5ELUA 2F99A 1WQLB 1O7PB 1IQYA 1GY6A 1W6CA 2Z7AA 3DUKA 3NHXA 3Q1CA 5IF6A 1YIT3 3CMA3 1HU9A 4N6TA 2W2CA 2YFLB 2IUKA 1Q42A 1JN5B 1JN5A 4HM5B 2YFJB 4GL6A 1JB2A 4FCZA 4CCVA 4K61A 1YI23 3S29A 4BTYA 3LH4A 3Q90A 3SX1A 2QA43 2UX0A 3X3XA 3DGNA 3DM8A 3CC23 2CG1A 3CCL3 1GD3A 1W02A 1GYBA 1JB5A 2RGQA 1TIJA 1IT7A 4MMYB 3WA3A 1IK3A 1A2KA 4TX4A 3MSOA 4MEIA 3LT8A 1GD4A 1US1A 3K5TA 1DVCA 2JDIH 4X2OA 1C7HA 2KCDA 1N9EA 1QMAA 3G8ZA 1VQN3 1Q7Y4 4LSOA 1VQ63 3FZWA 1ASKA 5EEOA 1Q40A 1Q40B 2GEXA 3T8NA 1DMMA 2WGQA 4RZMA 2ML5A 3OXAA 1UI7A 5IG3A 3SXXA 3K63A 3S28A 5JPUA 3BLZA 1N5PA 3FCSB 3HK4A 3CCJ3 1JRQA 4J8TA 3NM7A 3X42A 4Q53A 2E2VA 3SVAA 1U5OA 1W01A 3GZBA 5KP3A 2O3OA 2IMJA 3F9SA 3FF2A 3T0UA 3DGLA 4XB5A 2XFTA 1ULIB 3CNMA 3DMCA 2GU1A 3AMOA 3AMOB 2CIUA 3DGOA 3GRDA 3NUVA 4AKZA 1M1K4 2CWUA 3OW22 3NBBA 3TDGA 3CXC2 2CW9A 2Z76A 3NM2A 1VQL3 3U97A 4AEQA 1TFKA 3KIIA 3STDA 3GZXB 2B24B 3BNCA 4H3UA 4WHAA 3VSYA 3DZLA 5BVBA 1D6ZA 2BO9B 1EA2A 3G4S3 1OCVA 1GS3A 3B7CA 1KD14 3WA2X 2BMRB 4KFFA 1A90A 1NB3I 3EB8A 3DY5A 1Q814 3X41A 3V92A 1IV7A 4WP5A 1RN7A 1O7MB 3OWYA 3FSDA 1A2VA 2XFSA 4XBYA 2A15A 5AYSC 1OUNA 3T8UA 2YFIB 3JUNA 3LZAA 3EN8A 1NO3A 1W2B2 3BNEA 2ML6A 1FGMA 2RSXA 3LMLA 1Q864 1TUHA 3FF0A 2W6JH 1QJGA 4FCMA 1JKGB 1JKGA 3KSPA 2GBXB 4HJLB 3JUMA 1VQ53 5LC6A 5FGOA 1YHQ3 3LYGA 1SIHA 4LMIA 2Y74A 2CK3H 4ZM8A 5STDA 3K7CA 2OCTA 3J7Yd 1VQO3 1SQWA 1MNLA 1OHOA 3EHCA 3RGRA 2KRTA 3FG3A 4FMAA 3PGBA 1GY7A 2QIYA 1IVVA 1QAFA 1ROAA 2XF3A 3D3LA 3NQYA 4R1KA 1QVF2 1D6YA 1HKXA 3RGAA 3N9HA 5CF2A 2CFGA 4HM1B 2BT3A 4QWTA 4FCJA 3IPTA 1K8A4 1W7CA 1IVXA 2GU3A 5JBSA 3CCS3 3CU3A 1IV9A 2GEYA 1IT8A 2K0MA 1SIIA 4N3VA 5IERA 1LOXA 3S67A 3X40A 2OQEA 5AIIA 4NHFA 2W56B 2W56A 2HMMB 4N6NB 3CD63 3EQQB 3HZPA 3OWUA 2CFKA 1VQM3 1FGQA 3F8HA 1RKYA 4RBNA 2W04A 4FR9A 3Q2PA 5DREA 1OHSA 3V99A 4XDWA 1ISKA 4RNYA 2BMQB 2Y73A 3K0ZA 4LGQA 4XDVA 4AKYA 2I9WA 5IEPA 1MOLA 2CHCA 3OWSA 2O9UX 3KKGA 3IJEB 4KZ1A 3ECFA 4HZBB 1WMPA 1M9GA 4PEJA 3X3ZA 3WOFB 5FW5A 3LOYA 3MG3A 1STDA 4I4KA 5LC7A 5D83A 5IENA 1AV4A 4G1MB 1NDOB 3ROBA 3G6E3 1E3RA 3H3HA 2XR8B 5AIGA 3UB1A 4HM0B 1LNHA 3CCU3 2MC8A 1W6GA 2W9QA 3LTCA 3LT9A 2HMLB 5KP4A 1EG9B 4OUQA 4O8SA 2E2TA 4K1VA 5HGRA 1DYUA 2CKFB 1JB4A 2HMNB 3V98A 2CH9A 2LQVA 1VQ43 3BNBA 1OHPA 1UUWB 2BHMA 3NQZA 2OOVA 3KSED 4IT7A 3CNXA 3KE7A 2V1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV7 A;  4LZI A;  1RN7 A;  1STF I;  1DVD A;  3K9M C;  1KWI A;  2W9P A;  3NX0 A;  4N6M A;  5ELU A;  4N6V 0;  4N6T A;  1CYU A;  1N9J A;  1WNH A;  4CCV A;  5LC6 A;  3IMA B;  4N6O B;  3LH4 A;  3GAX A;  3UL6 A;  3UL5 A;  3PYJ A;  5ELJ A;  4ZM8 A;  1GD3 A;  2OCT A;  1N5H A;  1MNL A;  1LXE A;  3PXM A;  1TIJ A;  1CYV A;  1CEW I;  4TX4 A;  1ROA A;  5EQL A;  1GD4 A;  1DVC A;  1G96 A;  2KXG A;  1YVB I;  1IV9 A;  3MWZ A;  5A0O B;  4N6L A;  3S67 A;  3KFQ C;  4N6N B;  4EYC A;  1N5P A;  3Q2P A;  3SVA A;  3QRD A;  1NB5 I;  1MOL A;  2O9U X;  1R4C A;  1EQK A;  1M9G A;  3L0R A;  5LC7 A;  3PS8 A;  1A67 A;  1FA3 A;  1FUW A;  1PFP A;  2W9Q A;  4N6U A;  2CH9 A;  2BO9 B;  1A90 A;  3KSE D;  4IT7 A;  1NB3 I; 
#chains in the Genus database with same CATH topology
 2XGL A;  2H0H A;  4K90 B;  4MMZ B;  1WMN A;  4EV2 A;  4LZI A;  8CHO A;  1STF I;  7RNT A;  4XBT A;  1O7G B;  3EE1 A;  1W6Y A;  2IUJ A;  1G0T A;  1SJW A;  4U13 A;  1BSD A;  2C10 A;  4BL3 A;  1GY5 A;  1TFO A;  2UGI A;  2Z6B A;  3CME 3;  4LYL B;  1KWI A;  1ZGX A;  4NPB A;  2GBW B;  4N6M A;  2XRX B;  2IA7 A;  2CFL A;  1LOW A;  4KFD A;  1PU4 A;  3WOE B;  4HYZ A;  1TRP A;  4RNT A;  3O8Y A;  3KCH A;  4STD A;  5D82 A;  3F8X A;  1N9J A;  4CDL A;  1BRG A;  1BRJ A;  3CCV 3;  3SLU A;  1K28 A;  2WOF A;  1KC8 4;  1UW1 A;  3KZT A;  3SOA A;  3PZW A;  4MMX B;  3I0Y A;  3FGY A;  3GAX A;  2AAD A;  3UNL A;  3MYT A;  3F40 A;  3PCS A;  3UL6 A;  3PYJ A;  3CC4 3;  3ALA A;  2WGO A;  5ELJ A;  5BIR A;  1RN1 A;  5JPP A;  5CK6 A;  2QEX 3;  1I70 A;  4O3V A;  3PXM A;  5M18 A;  2BMO B;  1IVW A;  2IYJ A;  2P38 A;  3HOH A;  2F4Y A;  3AGN A;  1CEW I;  2HMJ B;  3HI7 A;  3JUO A;  6RNT A;  1QVG 2;  1SAR A;  1BNS A;  1DMQ A;  1BVI A;  2JQ5 A;  4O02 B;  5EQL A;  4EC6 A;  3JUQ A;  1RMS A;  3GZR A;  2MF7 A;  2ZL8 A;  4R9K A;  1JZO A;  1N8Q A;  2P09 A;  2D42 A;  1G96 A;  1VZZ A;  1Q7H A;  2K3D A;  3FG4 A;  5GSP A;  3I56 3;  1U8C B;  3NXJ A;  1TU5 A;  3FLJ A;  1B27 A;  1X1W A;  1YVB I;  1M1X B;  3B4P A;  2F98 A;  2F86 B;  1UGI A;  5A0O B;  3EBY A;  2CX0 A;  2F5M A;  1W5Z A;  4CPK A;  1X1X A;  3ER7 A;  1RRH A;  2Z77 A;  4XM4 A;  5DRV A;  3S5C A;  1YIJ 3;  1BRK A;  1CQS A;  3AGO A;  2M7O A;  4X2H A;  2PNC A;  1JNQ A;  2D1W A;  1LVN A;  4HZ9 B;  4WFO A;  4JF8 A;  2OTJ 3;  1I0X A;  3FG1 A;  1B2S A;  3QRD A;  2STD A;  4MJD A;  5AEW B;  1NB5 I;  1M90 4;  1QAL A;  1Q82 4;  1T5Y A;  3HX8 A;  1OAC A;  5IEO A;  1RGL A;  3I55 3;  1R4C A;  1EQK A;  3BB9 A;  1IQ8 A;  4HM7 B;  2ZDJ A;  3SOY A;  3U1W A;  3B4O A;  1FUT A;  3L0R A;  1RGA A;  5IG0 A;  3EX9 A;  1VQ7 3;  4KVH A;  1LQG C;  1AVK A;  1ULJ B;  1QAK A;  3F14 A;  2C11 A;  1F8N A;  1K9M 4;  4WWU C;  1RGC A;  5AI1 A;  1VQP 3;  1IDP A;  1JBS A;  3EF8 A;  1A67 A;  1UGH I;  3WHO A;  1E97 A;  4HM2 B;  1YJN 3;  2XEP A;  4H61 A;  5CXO A;  3G71 3;  1FUS A;  1TJD A;  1YGE A;  2B1X B;  3BU4 A;  3LTB A;  4BIR A;  4HM6 B;  3ZFZ A;  3MG2 A;  1K73 4;  5TGN A;  1WMO A;  2H0G A;  4GHO A;  1J2B A;  1GOV A;  3NV0 B;  3NV0 A;  4R4K A;  2XH9 A;  1GMR A;  4N6U A;  1T2I A;  2P0M A;  1OPY A;  1V74 A;  1AY7 A;  3WOD G;  4HM4 B;  5I97 A;  3JVC A;  2CG0 A;  1B3S A;  1VQ9 3;  3G16 A;  3GZY B;  2BIR A;  1RGE A;  3NBR A;  3EC9 A;  2CC3 A;  1OGZ A;  1RCK A;  9RNT A;  3QK9 A;  4HM8 B;  2XGN A;  1ZS7 A;  1DMN A;  5M1A A;  2L4V A;  4JRF A;  1UI8 A;  2CFW A;  1DVD A;  1Q9E A;  2RCD A;  4GB5 A;  1IVU A;  3F7X A;  3DH2 A;  3BND A;  3K9M C;  3LTD A;  6STD A;  4BL2 A;  1BSC A;  5AIH A;  1RNT A;  1ZO2 A;  3WDG B;  1K41 A;  2W9P A;  1FZU A;  1R4Y A;  2CWT A;  4HBR A;  1EKM A;  3MHE A;  1RJO A;  3NX0 A;  1BRH A;  5BXQ A;  3VGN A;  3VF1 A;  2LYX A;  3N8B A;  4HM3 B;  2BNG A;  1BRI A;  3B8L A;  3DGM A;  5AYR B;  4N6V 0;  5IG5 A;  3MPH A;  5CF1 A;  4O2H A;  4EV5 A;  3LTA A;  5M19 A;  4BTX A;  3CCM 3;  2OTL 3;  1NU3 A;  1CYU A;  3G0K A;  1WNH A;  3EJV A;  1BNJ A;  2OOV C;  2HMO B;  4KFE A;  2HOH A;  2P0X A;  1O7H B;  3EBT A;  4HVN A;  2XSH B;  3IMA B;  3MKI A;  1I2F A;  4L8P A;  4N6O B;  1I3F A;  3UJM A;  2FNQ A;  1AVL A;  3FH1 A;  3WMD A;  2RFR A;  4L7K A;  4XBX A;  1GMP A;  1L5G B;  7STD A;  3CC7 3;  5EVH A;  5D81 A;  3UL5 A;  4OK0 A;  5G2G A;  3OX9 A;  5IG4 A;  1MGR A;  1LOY A;  1YJW 3;  1BGS A;  1N5H A;  3HIG A;  1LXE A;  1B21 A;  1HYF A;  1LOV A;  4FMD A;  4K1U A;  1CYV A;  1JJ2 2;  3N54 B;  1W00 A;  3JUP A;  3D9R A;  1T3B A;  4R9L A;  1RSN A;  3KN4 A;  1NJI 4;  5AEU B;  5IW9 A;  1BNG A;  1O7W B;  1D6U A;  1RRL A;  4NRE A;  3A76 A;  1N8R 4;  1OF5 A;  1OF5 B;  1SPU A;  2KXG A;  4EBG A;  1KSI A;  3MWZ A;  3CPW 2;  2GSP A;  2GXF A;  3GWR A;  1JV2 B;  1MWR A;  4N6L A;  1CH0 A;  2R4I A;  3NBJ A;  4IPB A;  1ROV A;  1YJ9 3;  2SBL A;  3KFQ C;  1TP6 A;  1BOX A;  1BRS A;  2XSO B;  4EYC A;  3CCR 3;  1VQ8 3;  1AQZ A;  1FGT A;  3CPO A;  5KP1 A;  4OVM A;  1MWU A;  2CFD A;  3RDE A;  1FGR A;  1OH0 A;  2W0Q A;  1OGX A;  4J9A A;  2KF4 A;  2OWP A;  2YX9 A;  4FMB A;  2Q07 A;  3CCQ 3;  5BU4 A;  3EN1 B;  1Z1S A;  3FKA A;  2K54 A;  3D4A A;  1VQK 3;  1WTH A;  1KQS 2;  1V57 A;  7GSP A;  2FGT A;  3M8C A;  3DGY A;  1E3V A;  4I5Q A;  3D5I A;  2INX A;  2P05 A;  1PY3 A;  4GSP A;  4BTW A;  3PS8 A;  4L8O A;  2E2U A;  1NWW A;  2FXT A;  3DXO A;  1FA3 A;  1FUW A;  3E99 A;  1T2H A;  1PFP A;  4FMC A;  1ZX2 A;  2QGU A;  3PCR A;  1RGH A;  1BUQ A;  1AR0 A;  3LXU X;  3SYU A;  1I8V A;  4RNZ A;  1NNV A;  1GOY A;  4LEH A;  2W03 A;  1JZD A;  4HKV B;  1S72 3;  5CLK A;  1W2Z A;  3X3Y A;  3CCE 3;  4ORL A;  1EEJ A;  4WYK B;  4WYK A;  1Y4K A;  1FW7 A;  3OV4 A;  1BSE A;  1S5A A;  3S27 A;  5AIF A;  3MG1 A;  3SED A;  1RCL A;  1O7N B;  1PYL A;  4R80 A;  3HII A;  1UUV B;  1IQX A;  2ZHX B;  1FGO A;  3F7S A;  1I2G A;  4HOH A;  1IU7 A;  2OQE C;  2HMK B;  4IIA A;  1B2X A;  4EXR A;  2PZV A;  1GSP A;  2CWV A;  1W4N A;  2WOH A;  3H51 A;  1BNI A;  2WO0 A;  5ELU A;  2F99 A;  1WQL B;  2F5W A;  1O7P B;  1IQY A;  1GY6 A;  1W6C A;  2Z7A A;  3DUK A;  3NHX A;  3Q1C A;  5IF6 A;  1YIT 3;  3RNT A;  3CMA 3;  1GMQ A;  1HU9 A;  1TTO A;  4N6T A;  1X1U A;  1BAO A;  1RDS A;  1Q42 A;  2IUK A;  2W2C A;  2YFL B;  1C54 A;  1JN5 B;  1JN5 A;  4HM5 B;  2YFJ B;  4GL6 A;  2KF5 A;  1UCJ A;  1JB2 A;  4FCZ A;  4CCV A;  1BNE A;  4K61 A;  8RNT A;  1YI2 3;  3S29 A;  4BTY A;  3LH4 A;  3Q90 A;  3SX1 A;  2QA4 3;  2UX0 A;  3X3X A;  3DGN A;  3DM8 A;  3CC2 3;  2CG1 A;  3CCL 3;  1GD3 A;  1W02 A;  1GYB A;  1JB5 A;  2AAE A;  2RGQ A;  1TIJ A;  1IT7 A;  4MMY B;  3WA3 A;  1UDI I;  1IK3 A;  2BU4 A;  1A2K A;  4TX4 A;  3MSO A;  4J5G A;  4MEI A;  3LT8 A;  1GD4 A;  1US1 A;  3K5T A;  1DVC A;  2JDI H;  4X2O A;  1C7H A;  2KCD A;  1N9E A;  3WR2 A;  1QMA A;  1UCK A;  4CJN A;  1X1Y A;  3G8Z A;  1VQN 3;  1MWS A;  1Q7Y 4;  4LSO A;  1JBT A;  1BSA A;  1YNV X;  1VQ6 3;  3AHS A;  1ASK A;  3FZW A;  1Q40 A;  1Q40 B;  2H0I A;  2GEX A;  5EEO A;  3T8N A;  1DMM A;  2WGQ A;  4RZM A;  2ML5 A;  3OXA A;  1UI7 A;  1VQQ A;  5IG3 A;  2SAR A;  3SXX A;  1A2P A;  3K63 A;  3S28 A;  5JPU A;  3BLZ A;  1N5P A;  3FCS B;  3HK4 A;  3CCJ 3;  1JRQ A;  4J8T A;  3NM7 A;  3X42 A;  4Q53 A;  2E2V A;  3SVA A;  1U5O A;  1W01 A;  3GZB A;  1GOU A;  5KP3 A;  2O3O A;  2J8X B;  2IMJ A;  3F9S A;  3FF2 A;  3T0U A;  3DGL A;  4XB5 A;  2F56 A;  2XFT A;  1ULI B;  3CNM A;  3DMC A;  2GU1 A;  3AMO A;  3AMO B;  2CIU A;  3DGO A;  3GRD A;  3NUV A;  4AKZ A;  4DKI A;  1M1K 4;  1YGW A;  2CWU A;  1LQM B;  3OW2 2;  3NBB A;  3TDG A;  3CXC 2;  2CW9 A;  2Z76 A;  3NM2 A;  1VQL 3;  3BIR A;  3U97 A;  1LRA A;  4AEQ A;  1TFK A;  1EUI C;  3KII A;  3STD A;  1B20 A;  3GZX B;  2B24 B;  3BNC A;  4H3U A;  4WHA A;  3VSY A;  1BU4 A;  3DZL A;  4BU4 A;  5BVB A;  1D6Z A;  2BO9 B;  6GSP A;  2RNT A;  4ILF A;  1EA2 A;  3G4S 3;  1OCV A;  1BSB A;  1GS3 A;  4HAA A;  3B7C A;  1KD1 4;  3WA2 X;  2BMR B;  4KFF A;  1A90 A;  1RGF A;  1NB3 I;  3EB8 A;  3DY5 A;  5G1L A;  1Q81 4;  3X41 A;  3V92 A;  5HOH A;  1IV7 A;  4WP5 A;  1RN7 A;  1TRQ A;  1O7M B;  1B2Z A;  3OWY A;  3FSD A;  1A2V A;  2XFS A;  1I2E A;  2A15 A;  4XBY A;  1OUN A;  5AYS C;  3T8U A;  3ZG5 A;  2YFI B;  3JUN A;  1B2U A;  3LZA A;  1RGG A;  1UCL A;  3EN8 A;  1NO3 A;  3GSP A;  1W2B 2;  3BNE A;  2ML6 A;  1FGM A;  2RSX A;  3LML A;  1HZ1 A;  3A5E A;  5G1K A;  1Q86 4;  1TUH A;  3FF0 A;  2W6J H;  5RNT A;  1YVS A;  1QJG A;  2RBI A;  4FCM A;  2ZA4 A;  1JKG B;  1JKG A;  3KSP A;  2GBX B;  4HJL B;  3JUM A;  1VQ5 3;  5LC6 A;  1RHL A;  2UUG C;  4KT3 B;  1UCI A;  5FGO A;  1YHQ 3;  1RNB A;  1FYS A;  3LYG A;  1SIH A;  2C4B A;  1BAN A;  2Y74 A;  4LMI A;  2CK3 H;  1B2M A;  1BRN L;  4ZM8 A;  5STD A;  3K7C A;  2OCT A;  3J7Y d;  1VQO 3;  1SQW A;  1MNL A;  1OHO A;  3EHC A;  3RGR A;  2KRT A;  3FG3 A;  4FMA A;  3PGB A;  1GY7 A;  2QIY A;  1IVV A;  1QAF A;  1ROA A;  2XF3 A;  3D3L A;  3NQY A;  1DET A;  4R1K A;  1D6Y A;  1QVF 2;  3URP A;  1HKX A;  3RGA A;  1MGW A;  3N9H A;  5CF2 A;  2CFG A;  4HM1 B;  2CX1 A;  2BT3 A;  4QWT A;  1JBR A;  4FCJ A;  3IPT A;  1BIR A;  1K8A 4;  1W7C A;  1IVX A;  2GU3 A;  5JBS A;  1G02 A;  2IY2 A;  3CU3 A;  3CCS 3;  1BUJ A;  1IV9 A;  1I0V A;  2GEY A;  1IT8 A;  2K0M A;  1SII A;  4N3V A;  5IER A;  1IYY A;  1LOX A;  3S67 A;  1RGK A;  3X40 A;  2OQE A;  1UUG B;  5AII A;  4NHF A;  2W56 B;  2W56 A;  2HMM B;  1V58 A;  4N6N B;  3CD6 3;  1RLS A;  3EQQ B;  3HZP A;  3OWU A;  2CFK A;  1VQM 3;  1FGQ A;  3F8H A;  4EW5 A;  1I3I A;  4RBN A;  1RKY A;  2W04 A;  4FR9 A;  3Q2P A;  5DRE A;  1OHS A;  3V99 A;  4XDW A;  1ISK A;  4RNY A;  2BMQ B;  2Y73 A;  3K0Z A;  4LGQ A;  4XDV A;  4AKY A;  2I9W A;  2R41 A;  1MOL A;  2CHC A;  3OWS A;  2O9U X;  3KKG A;  5IEP A;  3IJE B;  4KZ1 A;  3ECF A;  1DE3 A;  4HZB B;  1WMP A;  1M9G A;  4PEJ A;  3D79 A;  1RN4 A;  3X3Z A;  3WOF B;  5FW5 A;  1RTU A;  3LOY A;  3ZG0 A;  3MG3 A;  2KF3 A;  1STD A;  4I4K A;  4J5K A;  5LC7 A;  5D83 A;  5IEN A;  1AV4 A;  4G1M B;  3D5G A;  2KAA A;  1NDO B;  3ROB A;  3G6E 3;  1E3R A;  2KF6 A;  2XR8 B;  3H3H A;  5AIG A;  3UB1 A;  1BNR A;  4HM0 B;  1LNH A;  3CCU 3;  2MC8 A;  1LNI A;  1W6G A;  2W9Q A;  3LT9 A;  2HML B;  3LTC A;  5KP4 A;  1EG9 B;  4OUQ A;  4O8S A;  2E2T A;  4K1V A;  5HGR A;  1DYU A;  3Q3F A;  2CKF B;  1JB4 A;  2HMN B;  3AHW A;  3V98 A;  2CH9 A;  2LQV A;  1VQ4 3;  1BNF A;  3BNB A;  1OHP A;  1UUW B;  2L1S A;  2BHM A;  3NQZ A;  2OOV A;  1MWT A;  3KSE D;  4IT7 A;  3CNX A;  3KE7 A;  2V1L A; 
#chains in the Genus database with same CATH homology
 2XGL A;  4K90 B;  4MMZ B;  1WMN A;  4EV2 A;  4LZI A;  8CHO A;  1STF I;  4XBT A;  1O7G B;  3EE1 A;  1W6Y A;  2IUJ A;  1SJW A;  4U13 A;  2C10 A;  1GY5 A;  1TFO A;  2Z6B A;  3CME 3;  1KWI A;  2GBW B;  4N6M A;  2XRX B;  2IA7 A;  2CFL A;  4KFD A;  1PU4 A;  3WOE B;  4HYZ A;  3O8Y A;  4STD A;  5D82 A;  3F8X A;  1N9J A;  4CDL A;  3CCV 3;  3SLU A;  1K28 A;  2WOF A;  1KC8 4;  1UW1 A;  3KZT A;  3SOA A;  3PZW A;  4MMX B;  3I0Y A;  3FGY A;  3GAX A;  3UNL A;  3MYT A;  3F40 A;  3PCS A;  3UL6 A;  3PYJ A;  3CC4 3;  3ALA A;  2WGO A;  5ELJ A;  5JPP A;  5CK6 A;  2QEX 3;  4O3V A;  3PXM A;  2BMO B;  1IVW A;  2P38 A;  3U1W A;  1CEW I;  2HMJ B;  3HI7 A;  3JUO A;  1QVG 2;  1DMQ A;  2JQ5 A;  5EQL A;  4O02 B;  4EC6 A;  3JUQ A;  3GZR A;  2MF7 A;  2ZL8 A;  4R9K A;  1N8Q A;  2P09 A;  2D42 A;  1G96 A;  1VZZ A;  3FG4 A;  3I56 3;  1U8C B;  3NXJ A;  1TU5 A;  3FLJ A;  1YVB I;  1M1X B;  3B4P A;  2F98 A;  2F86 B;  5A0O B;  3EBY A;  1W5Z A;  3ER7 A;  1RRH A;  2Z77 A;  4XM4 A;  5DRV A;  3S5C A;  1YIJ 3;  1CQS A;  2M7O A;  4X2H A;  2PNC A;  1JNQ A;  2D1W A;  1LVN A;  4HZ9 B;  4WFO A;  4JF8 A;  2OTJ 3;  3FG1 A;  3QRD A;  2STD A;  4MJD A;  5AEW B;  1NB5 I;  1M90 4;  1QAL A;  1Q82 4;  1T5Y A;  3HX8 A;  1OAC A;  5IEO A;  3I55 3;  1R4C A;  1EQK A;  3BB9 A;  1IQ8 A;  4HM7 B;  2ZDJ A;  3SOY A;  3B4O A;  3L0R A;  5IG0 A;  3EX9 A;  1VQ7 3;  4KVH A;  1ULJ B;  1AVK A;  1QAK A;  3F14 A;  2C11 A;  1F8N A;  1K9M 4;  4WWU C;  1VQP 3;  5AI1 A;  1IDP A;  3EF8 A;  1A67 A;  1E97 A;  4HM2 B;  1YJN 3;  2XEP A;  4H61 A;  5CXO A;  3G71 3;  1YGE A;  2B1X B;  3LTB A;  4HM6 B;  3MG2 A;  1K73 4;  5TGN A;  1WMO A;  1J2B A;  3NV0 B;  3NV0 A;  4R4K A;  2XH9 A;  4N6U A;  2P0M A;  1OPY A;  1V74 A;  3WOD G;  4HM4 B;  5I97 A;  3JVC A;  2CG0 A;  1VQ9 3;  3G16 A;  3GZY B;  3NBR A;  3EC9 A;  2CC3 A;  1OGZ A;  3QK9 A;  4HM8 B;  2XGN A;  1DMN A;  2L4V A;  4JRF A;  1UI8 A;  2CFW A;  1DVD A;  2RCD A;  4GB5 A;  1IVU A;  3F7X A;  3BND A;  3K9M C;  3LTD A;  6STD A;  5AIH A;  1ZO2 A;  3WDG B;  1K41 A;  2W9P A;  2CWT A;  4HBR A;  1EKM A;  3MHE A;  1RJO A;  3NX0 A;  5BXQ A;  3VGN A;  3VF1 A;  2LYX A;  3N8B A;  4HM3 B;  2BNG A;  3B8L A;  3DGM A;  5AYR B;  4N6V 0;  5IG5 A;  3MPH A;  5CF1 A;  4O2H A;  4EV5 A;  3LTA A;  3CCM 3;  4BTX A;  2OTL 3;  1NU3 A;  1CYU A;  3G0K A;  1WNH A;  3EJV A;  2OOV C;  2HMO B;  4KFE A;  2P0X A;  1O7H B;  3EBT A;  4HVN A;  2XSH B;  3IMA B;  3MKI A;  4L8P A;  4N6O B;  3UJM A;  3WMD A;  2FNQ A;  1AVL A;  3FH1 A;  2RFR A;  4L7K A;  4XBX A;  1L5G B;  7STD A;  3CC7 3;  5EVH A;  5D81 A;  3UL5 A;  4OK0 A;  5G2G A;  3OX9 A;  5IG4 A;  1YJW 3;  1N5H A;  3HIG A;  1LXE A;  4FMD A;  4K1U A;  1CYV A;  1JJ2 2;  3N54 B;  1W00 A;  3JUP A;  3D9R A;  4R9L A;  3KN4 A;  1NJI 4;  5AEU B;  5IW9 A;  1O7W B;  1D6U A;  1RRL A;  4NRE A;  3A76 A;  1N8R 4;  1OF5 A;  1OF5 B;  1SPU A;  2KXG A;  4EBG A;  1KSI A;  3MWZ A;  3CPW 2;  2GXF A;  3GWR A;  1JV2 B;  4N6L A;  3NBJ A;  2R4I A;  4IPB A;  1ROV A;  1YJ9 3;  2SBL A;  3KFQ C;  1TP6 A;  3CCR 3;  2XSO B;  4EYC A;  1VQ8 3;  1FGT A;  3CPO A;  5KP1 A;  4OVM A;  2CFD A;  3RDE A;  1FGR A;  1OH0 A;  2W0Q A;  1OGX A;  4J9A A;  2YX9 A;  2OWP A;  4FMB A;  3CCQ 3;  2Q07 A;  3EN1 B;  1Z1S A;  3FKA A;  2K54 A;  1VQK 3;  1WTH A;  1KQS 2;  2FGT A;  3M8C A;  1E3V A;  2INX A;  2P05 A;  4BTW A;  3PS8 A;  4L8O A;  2E2U A;  1NWW A;  2FXT A;  3DXO A;  1FA3 A;  1FUW A;  3E99 A;  1PFP A;  4FMC A;  1ZX2 A;  2QGU A;  3PCR A;  1BUQ A;  1AR0 A;  3LXU X;  4RNZ A;  4LEH A;  2W03 A;  4HKV B;  1S72 3;  5CLK A;  1W2Z A;  3X3Y A;  3CCE 3;  4ORL A;  4WYK B;  4WYK A;  1Y4K A;  3OV4 A;  1S5A A;  3S27 A;  5AIF A;  3MG1 A;  3SED A;  4R80 A;  1O7N B;  3HII A;  1UUV B;  1IQX A;  1FGO A;  3F7S A;  1IU7 A;  2OQE C;  2HMK B;  4IIA A;  4EXR A;  2PZV A;  2CWV A;  1W4N A;  2WOH A;  3H51 A;  2WO0 A;  5ELU A;  2F99 A;  1WQL B;  1O7P B;  1IQY A;  1GY6 A;  1W6C A;  2Z7A A;  3DUK A;  3NHX A;  3Q1C A;  5IF6 A;  1YIT 3;  3CMA 3;  1HU9 A;  4N6T A;  2W2C A;  2YFL B;  2IUK A;  1Q42 A;  1JN5 B;  1JN5 A;  4HM5 B;  2YFJ B;  4GL6 A;  1JB2 A;  4FCZ A;  4CCV A;  4K61 A;  1YI2 3;  3S29 A;  4BTY A;  3LH4 A;  3Q90 A;  3SX1 A;  2QA4 3;  2UX0 A;  3X3X A;  3DGN A;  3DM8 A;  3CC2 3;  2CG1 A;  3CCL 3;  1GD3 A;  1W02 A;  1GYB A;  1JB5 A;  2RGQ A;  1TIJ A;  1IT7 A;  4MMY B;  3WA3 A;  1IK3 A;  1A2K A;  4TX4 A;  3MSO A;  4MEI A;  3LT8 A;  1GD4 A;  1US1 A;  3K5T A;  1DVC A;  2JDI H;  4X2O A;  1C7H A;  2KCD A;  1N9E A;  1QMA A;  3G8Z A;  1VQN 3;  1Q7Y 4;  4LSO A;  1VQ6 3;  3FZW A;  1ASK A;  5EEO A;  1Q40 A;  1Q40 B;  2GEX A;  3T8N A;  1DMM A;  2WGQ A;  4RZM A;  2ML5 A;  3OXA A;  1UI7 A;  5IG3 A;  3SXX A;  3K63 A;  3S28 A;  5JPU A;  3BLZ A;  1N5P A;  3FCS B;  3HK4 A;  3CCJ 3;  1JRQ A;  4J8T A;  3NM7 A;  3X42 A;  4Q53 A;  2E2V A;  3SVA A;  1U5O A;  1W01 A;  3GZB A;  5KP3 A;  2O3O A;  2IMJ A;  3F9S A;  3FF2 A;  3T0U A;  3DGL A;  4XB5 A;  2XFT A;  1ULI B;  3CNM A;  3DMC A;  2GU1 A;  3AMO A;  3AMO B;  2CIU A;  3DGO A;  3GRD A;  3NUV A;  4AKZ A;  1M1K 4;  2CWU A;  3OW2 2;  3NBB A;  3TDG A;  3CXC 2;  2CW9 A;  2Z76 A;  3NM2 A;  1VQL 3;  3U97 A;  4AEQ A;  1TFK A;  3KII A;  3STD A;  3GZX B;  2B24 B;  3BNC A;  4H3U A;  4WHA A;  3VSY A;  3DZL A;  5BVB A;  1D6Z A;  2BO9 B;  1EA2 A;  3G4S 3;  1OCV A;  1GS3 A;  3B7C A;  1KD1 4;  3WA2 X;  2BMR B;  4KFF A;  1A90 A;  1NB3 I;  3EB8 A;  3DY5 A;  1Q81 4;  3X41 A;  3V92 A;  1IV7 A;  4WP5 A;  1RN7 A;  1O7M B;  3OWY A;  3FSD A;  1A2V A;  2XFS A;  4XBY A;  2A15 A;  5AYS C;  1OUN A;  3T8U A;  2YFI B;  3JUN A;  3LZA A;  3EN8 A;  1NO3 A;  1W2B 2;  3BNE A;  2ML6 A;  1FGM A;  2RSX A;  3LML A;  1Q86 4;  1TUH A;  3FF0 A;  2W6J H;  1QJG A;  4FCM A;  1JKG B;  1JKG A;  3KSP A;  2GBX B;  4HJL B;  3JUM A;  1VQ5 3;  5LC6 A;  5FGO A;  1YHQ 3;  3LYG A;  1SIH A;  4LMI A;  2Y74 A;  2CK3 H;  4ZM8 A;  5STD A;  3K7C A;  2OCT A;  3J7Y d;  1VQO 3;  1SQW A;  1MNL A;  1OHO A;  3EHC A;  3RGR A;  2KRT A;  3FG3 A;  4FMA A;  3PGB A;  1GY7 A;  2QIY A;  1IVV A;  1QAF A;  1ROA A;  2XF3 A;  3D3L A;  3NQY A;  4R1K A;  1QVF 2;  1D6Y A;  1HKX A;  3RGA A;  3N9H A;  5CF2 A;  2CFG A;  4HM1 B;  2BT3 A;  4QWT A;  4FCJ A;  3IPT A;  1K8A 4;  1W7C A;  1IVX A;  2GU3 A;  5JBS A;  3CCS 3;  3CU3 A;  1IV9 A;  2GEY A;  1IT8 A;  2K0M A;  1SII A;  4N3V A;  5IER A;  1LOX A;  3S67 A;  3X40 A;  2OQE A;  5AII A;  4NHF A;  2W56 B;  2W56 A;  2HMM B;  4N6N B;  3CD6 3;  3EQQ B;  3HZP A;  3OWU A;  2CFK A;  1VQM 3;  1FGQ A;  3F8H A;  1RKY A;  4RBN A;  2W04 A;  4FR9 A;  3Q2P A;  5DRE A;  1OHS A;  3V99 A;  4XDW A;  1ISK A;  4RNY A;  2BMQ B;  2Y73 A;  3K0Z A;  4LGQ A;  4XDV A;  4AKY A;  2I9W A;  5IEP A;  1MOL A;  2CHC A;  3OWS A;  2O9U X;  3KKG A;  3IJE B;  4KZ1 A;  3ECF A;  4HZB B;  1WMP A;  1M9G A;  4PEJ A;  3X3Z A;  3WOF B;  5FW5 A;  3LOY A;  3MG3 A;  1STD A;  4I4K A;  5LC7 A;  5D83 A;  5IEN A;  1AV4 A;  4G1M B;  1NDO B;  3ROB A;  3G6E 3;  1E3R A;  3H3H A;  2XR8 B;  5AIG A;  3UB1 A;  4HM0 B;  1LNH A;  3CCU 3;  2MC8 A;  1W6G A;  2W9Q A;  3LTC A;  3LT9 A;  2HML B;  5KP4 A;  1EG9 B;  4OUQ A;  4O8S A;  2E2T A;  4K1V A;  5HGR A;  1DYU A;  2CKF B;  1JB4 A;  2HMN B;  3V98 A;  2CH9 A;  2LQV A;  1VQ4 3;  3BNB A;  1OHP A;  1UUW B;  2BHM A;  3NQZ A;  2OOV A;  3KSE D;  4IT7 A;  3CNX A;  3KE7 A;  2V1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...