3Q2PA

Reduced sweetness of a monellin (mnei) mutant results from increased protein flexibility and disruption of a distant poly-(l-proline) ii helix
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
GEWEIIDIGPFTQNLAKFAVDEENKIGQYGRLTFNKAIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monellin chain B/Monellin chain A chimeric protein
publication title Reduced Sweetness of a Monellin (MNEI) Mutant Results from Increased Protein Flexibility and Disruption of a Distant Poly-(L-Proline) II Helix.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
total genus 20
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3q2pA00
1CYVA 1MOLA 4N6TA 1N5PA 4IT7A 2OCTA 1M9GA 1CEWI 1FA3A 1DVDA 4N6NB 1GD3A 2KXGA 2O9UX 3PXMA 1GD4A 1MNLA 3QRDA 4N6LA 1LXEA 3L0RA 1KWIA 4CCVA 2W9QA 1IV9A 3SVAA 1RN7A 3NX0A 1N5HA 1G96A 2W9PA 1EQKA 5ELUA 1N9JA 4N6UA 1STFI 3UL6A 3KFQC 1IV7A 3S67A 1DVCA 4N6V0 3GAXA 1A67A 5A0OB 4N6OB 1WNHA 1TIJA 4ZM8A 3PYJA 2BO9B 1R4CA 1ROAA 4N6MA 3IMAB 3Q2PA 1YVBI 1CYUA 4EYCA 3PS8A 4LZIA 1NB5I 5EQLA 3LH4A 4TX4A 3K9MC 1NB3I 1A90A 1PFPA 2CH9A 5ELJA 3KSED 5LC6A 3UL5A 5LC7A 1FUWA 3MWZA
chains in the Genus database with same CATH superfamily
1BVIA 1MGRA 3I553 2P09A 3CMA3 3OX9A 1KD14 3URPA 1I70A 4N3VA 1FGRA 1YJN3 2OCTA 3EB8A 4OUQA 2HMOB 2BU4A 1F8NA 1TTOA 2CX0A 3LTAA 1S723 4N6NB 1GS3A 3HZPA 3HIIA 5IG4A 3BU4A 1DYUA 1GD3A 2I9WA 5AI1A 4J9AA 2Z77A 2KXGA 2OTL3 3ZFZA 3NM2A 3CCS3 4OK0A 1W02A 1UCIA 3BIRA 1RCKA 2R4IA 1OHPA 1QVF2 2ZDJA 3KCHA 3MKIA 2B24B 2KF4A 4N6LA 5STDA 1RSNA 4RZMA 2BIRA 2QIYA 2HMJB 3WOEB 5AIFA 2C4BA 1AY7A 3EBTA 1IV9A 1IVVA 2O3OA 5G1KA 4RNZA 3CC73 1RN7A 3PGBA 3EF8A 3NUVA 3F9SA 1K8A4 1E3VA 2R41A 2IMJA 3IPTA 1EG9B 3OWSA 1BUJA 1B3SA 4HZBB 2OQEA 4HM7B 3FH1A 1JRQA 3PCSA 3F7XA 4OVMA 1AV4A 2XGLA 3KKGA 1VQ63 1UDII 1RN1A 2Y73A 1J2BA 1LNHA 5RNTA 3PCRA 2IUJA 3G713 4FMDA 2RNTA 1D6YA 1HU9A 1ZGXA 2D42A 1Z1SA 1C7HA 3BNCA 3KFQC 1GYBA 1KC84 5KP4A 5HOHA 1VQL3 4EW5A 2CFWA 2XSOB 3DGMA 5G2GA 3JUOA 4XBTA 6GSPA 4HM0B 3CCE3 1TFKA 5D82A 3A76A 5FW5A 1VQN3 1I0VA 3G0KA 1B2ZA 4O8SA 3G4S3 1D6UA 3EHCA 3S5CA 1IYYA 1B20A 1UCJA 1OF5A 1W7CA 4GB5A 1VQP3 4BL3A 1I8VA 1NDOB 1OF5B 1JB2A 2CWVA 4XDWA 5EVHA 1RRLA 1YGEA 3K63A 3B7CA 3AHSA 3BNEA 1SJWA 2C10A 2UUGC 3WODG 2KCDA 1BU4A 4K61A 5AEWB 3S28A 2J8XB 4EV2A 5IERA 3LZAA 2BHMA 1VQ73 1E97A 1ULIB 3Q2PA 2WOHA 4FMCA 4NPBA 1EA2A 1K734 4HJLB 4J8TA 4RBNA 3A5EA 3V99A 4QWTA 3PS8A 1RGGA 1I2GA 4R80A 5IG3A 1RNTA 1TU5A 3HOHA 4MMYB 3MHEA 4J5KA 3DM8A 1QAFA 1MWSA 4KFEA 1RGEA 4LZIA 1ULJB 3SYUA 1BOXA 3ZG0A 3U97A 1W00A 1X1UA 1VQO3 1JN5B 2JDIH 3GSPA 4GSPA 3DY5A 4BTWA 3CCQ3 2CHCA 3B4PA 1CH0A 3EJVA 1UCLA 1W5ZA 1Q864 4LSOA 4TX4A 5IF6A 3GRDA 1NU3A 3K9MC 1DMNA 1DE3A 3AHWA 1GMPA 1GY6A 1RDSA 3CCM3 1IQXA 2INXA 4L8OA 4HKVB 2STDA 2ZA4A 1DETA 3UL5A 8CHOA 2GEYA 1FUWA 3FF2A 1JBTA 2C11A 3O8YA 3F8HA 2E2TA 4HBRA 2AAEA 4HOHA 4LEHA 4NHFA 4HM6B 4N6TA 3EC9A 5EEOA 1G0TA 7STDA 5IEPA 2HMLB 1CEWI 1ZS7A 1QAKA 3G8ZA 2BMQB 1RCLA 1RKYA 1AVKA 1I3FA 1FGQA 2WGOA 1O7GB 4RNTA 1A2PA 1GOUA 4X2OA 3NXJA 1LOXA 2OWPA 1ZX2A 4AEQA 1GOYA 1TP6A 1RGLA 2YFLB 3M8CA 3PXMA 4I5QA 4RNYA 4WFOA 3VSYA 1BRNL 1SQWA 2MF7A 2FNQA 3WA2X 2XEPA 2XSHB 3JUQA 3OWUA 3SOAA 1JBSA 1LRAA 2B1XB 3WDGB 1FUSA 2FXTA 1AR0A 3FKAA 4LMIA 1RGKA 4R1KA 3L0RA 3ALAA 1Q42A 2W04A 5BXQA 1W2B2 1JBRA 1TRQA 3D5IA 1BSEA 4FR9A 2KF5A 1STDA 3CU3A 5I97A 1G96A 3CME3 1RGAA 1RGHA 3BNBA 1YJW3 1RNBA 2XRXB 1RTUA 1T2IA 3UJMA 3WR2A 4KFDA 4XB5A 2XR8B 1EQKA 3F40A 3MYTA 5DRVA 2IY2A 4HM2B 4K1UA 3FSDA 1BSDA 1STFI 2F86B 3X3ZA 2WOFA 4O3VA 1BNRA 1RGCA 3DZLA 1RHLA 2CWTA 1IV7A 1IU7A 2H0GA 3NQYA 4R4KA 1N8R4 2HMNB 5M1AA 4XBXA 5A0OB 1WTHA 3I563 4FCMA 1KQS2 1GY5A 4R9KA 2BNGA 1UI8A 1Q40A 1M1XB 5JBSA 1B27A 1Q40B 3VF1A 1I3IA 3DGLA 1GY7A 1VZZA 3J7Yd 2KRTA 1IDPA 1YI23 3JUMA 1YIT3 1NJI4 2Z76A 3VGNA 3JVCA 5CF2A 2BO9B 3GZBA 2BT3A 1E3RA 2FGTA 3HIGA 3FZWA 4L7KA 1LOYA 3IMAB 5IG0A 1BRSA 1JV2B 3DGOA 1O7NB 1FYSA 2CX1A 1O7PB 1QALA 4L8PA 3IJEB 1N9EA 3BNDA 1BIRA 3LXUX 3AGNA 5FGOA 3TDGA 3T8NA 1OGZA 1FGTA 4HZ9B 1VQ93 2P0XA 3MG2A 3FG4A 3DUKA 3N54B 1OUNA 4K90B 4EV5A 1NB5I 4X2HA 3STDA 1BANA 4BU4A 2E2VA 1B21A 6RNTA 1UGIA 3EBYA 3V92A 3SEDA 1JNQA 2OQEC 4FCJA 2IYJA 3X42A 4FMAA 1OH0A 1NB3I 1A90A 1HZ1A 1ZO2A 1Q824 1SPUA 2XGNA 1AVLA 1JB4A 3D5GA 4FCZA 2XFTA 3GZXB 2L4VA 1BRHA 1OGXA 1ASKA 5LC6A 3ER7A 1GOVA 5IEOA 2CK3H 5HGRA 1MWTA 2YX9A 3D9RA 2P0MA 4KT3B 1VQ83 4IPBA 1UUVB 3DXOA 3RNTA 3LYGA 3EN8A 1Q814 4JRFA 1W4NA 3OWYA 1WQLB 1RJOA 2GU3A 3ECFA 3NV0B 2IA7A 1JN5A 2M7OA 1IVWA 1V57A 2K3DA 3F7SA 3WOFB 1FA3A 1N8QA 4I4KA 1FZUA 1HKXA 2Y74A 1B2UA 1I2FA 3T0UA 4EXRA 1NNVA 1BGSA 4KFFA 5M18A 1D6ZA 4HAAA 3Q90A 4BTYA 1IQ8A 4KVHA 1TFOA 3DH2A 3NHXA 2OOVA 1YIJ3 1BNFA 2XF3A 2HOHA 1MNLA 5IW9A 3V98A 1YVSA 2GBXB 3N9HA 1U8CB 3KZTA 3QRDA 1PU4A 4PEJA 1TRPA 1VQQA 3CCU3 4ILFA 4HM4B 2QA43 5TGNA 2P38A 1W6CA 2CG1A 1I2EA 3NM7A 1LNIA 4WHAA 3KE7A 4H61A 1BNEA 3LMLA 3B4OA 1LOWA 4WWUC 4LGQA 5AIGA 3X3YA 1N5HA 1OCVA 2D1WA 2F5MA 2RGQA 3D4AA 2QGUA 3E99A 4K1VA 1RLSA 1ROVA 4DKIA 4KZ1A 4XM4A 1FGOA 1EUIC 5CK6A 3U1WA 1UUGB 3D3LA 4XDVA 1BSCA 2W2CA 3I0YA 1CQSA 1N9JA 1UI7A 1YNVX 2Z7AA 1BNGA 2F4YA 3KIIA 2OOVC 3MSOA 3X40A 4EC6A 3NBBA 5BU4A 1V74A 5BIRA 3MG1A 3CD63 1UCKA 3S67A 1DVCA 4CDLA 1B2MA 4N6V0 1BUQA 1TUHA 2GU1A 1IT7A 1Q7HA 1X1XA 1A67A 2W6JH 3LT8A 3LOYA 3D79A 1OACA 1BNIA 3LTDA 1S5AA 1VQM3 3MG3A 3OXAA 3F8XA 4AKYA 1GSPA 1X1YA 2V1LA 2K0MA 4IIAA 1WMNA 4HM3B 5CLKA 1GMRA 1T3BA 3KN4A 1WMPA 3LTBA 1R4YA 1TIJA 2PZVA 4MEIA 2ML5A 4R9LA 3K7CA 5CXOA 2CIUA 2W0QA 1YGWA 4ZM8A 1NO3A 5KP3A 5BVBA 1JB5A 4MJDA 3RGAA 4GHOA 4N6MA 5AIHA 2F56A 1G02A 3F14A 1US1A 3CPW2 1YVBI 3SX1A 2QEX3 1OHOA 4CJNA 1O7HB 1FUTA 1TJDA 2RCDA 1M904 3FCSB 2CKFB 1BRJA 3GZRA 3CXC2 1DMMA 1X1WA 4JF8A 3BB9A 1OPYA 8RNTA 1Q9EA 1LQGC 1B2XA 2CFGA 4FMBA 2CFKA 3LTCA 1DMQA 1PY3A 2SARA 1MGWA 3SOYA 1NWWA 3K0ZA 3BLZA 2CC3A 5M19A 2UGIA 4MMXB 3EN1B 2HMMB 3X41A 2JQ5A 3PZWA 2W56A 1QMAA 1KSIA 2KAAA 3UB1A 2ZHXB 2W56B 1PFPA 4WYKA 5AYSC 1T2HA 4WYKB 1A2KA 1BSAA 1O7MB 2HMKB 4HM1B 4LYLB 5ELJA 3G16A 3ROBA 5LC7A 2WGQA 3MWZA 1CYVA 2LQVA 3Q1CA 2XFSA 3Q3FA 1MOLA 2MC8A 2F5WA 3K5TA 4G1MB 3CCR3 3G6E3 1SARA 1YHQ3 3CCL3 1N5PA 2OTJ3 1B2SA 1IVUA 4IT7A 1M9GA 5IG5A 1FGMA 1SIIA 2K54A 4CPKA 3EX9A 1DVDA 2YFIB 2CFDA 5JPPA 3FGYA 1IQYA 1Y4KA 3WHOA 3H3HA 1W6YA 2UX0A 1BNJA 2O9UX 1VQ43 1UW1A 3RGRA 1GD4A 2XH9A 4Q53A 3DGNA 1JKGA 3EQQB 2CW9A 5DREA 1K9M4 3N8BA 1L5GB 4HM5B 1JKGB 5IENA 1LXEA 3X3XA 2Z6BA 3CC23 2BMOB 4ORLA 3CCJ3 1BRKA 3CC43 1W6GA 1KWIA 2WO0A 2SBLA 1Q7Y4 4CCVA 2W9QA 4H3UA 3GZYB 3SVAA 5GSPA 3T8UA 4O2HA 3NBRA 3NX0A 2CWUA 4EBGA 1HYFA 3JUNA 3OV4A 3H51A 5AEUB 3NV0A 2CFLA 1UUWB 1RGFA 4MMZB 3ZG5A 2W9PA 3DGYA 3MPHA 1ISKA 1JJ22 4NREA 1C54A 1LVNA 3FG3A 5ELUA 3RDEA 3OW22 5D81A 1BSBA 3HK4A 4N6UA 1OHSA 1EKMA 3UL6A 1W01A 7GSPA 5AIIA 1IT8A 1MWRA 2GXFA 4XBYA 2L1SA 1LQMB 1RMSA 2LYXA 1YJ93 1BRIA 1T5YA 4STDA 3GAXA 4BL2A 1QVG2 3DMCA 4BIRA 2PNCA 4N6OB 3CNMA 1EEJA 1O7WB 3GWRA 2ZL8A 4GL6A 1IVXA 1U5OA 1UGHI 2RFRA 1SIHA 2AADA 3UNLA 5G1LA 1LOVA 1WNHA 2Q07A 2KF6A 2YFJB 3HX8A 3LT9A 3HI7A 3WMDA 4WP5A 1GMQA 3S29A 1VQ53 1W2ZA 1BAOA 4HM8B 3PYJA 4AKZA 2H0HA 5AYRB 3AMOA 3FLJA 3FG1A 6STDA 1IK3A 1R4CA 1ROAA 1A2VA 3AMOB 3SLUA 2F98A 4BTXA 1CYUA 2IUKA 5D83A 4EYCA 1JZDA 2H0IA 3KSPA 4U13A 2RBIA 5JPUA 1PYLA 3SXXA 1FW7A 1K41A 3B8LA 4O02B 3CNXA 3NBJA 1MWUA 3AGOA 3EE1A 3WA3A 1AQZA 1WMOA 2CG0A 2GBWB 7RNTA 2BMRB 3CPOA 5KP1A 2W03A 2A15A 3S27A 4J5GA 1BRGA 5EQLA 2GSPA 4HYZA 9RNTA 1VQK3 3CCV3 1QJGA 2E2UA 2F99A 3QK9A 3LH4A 1I0XA 1M1K4 1V58A 2P05A 2RSXA 3NQZA 2GEXA 1BNSA 4HVNA 2CH9A 2ML6A 3FF0A 1JZOA 1RN4A 3KSED 1RRHA 5CF1A 3JUPA 1K28A 2KF3A
chains in the Genus database with same CATH topology
3I553 2P09A 3CMA3 3OX9A 1KD14 4N3VA 1YJN3 1FGRA 2OCTA 3EB8A 4OUQA 2HMOB 1F8NA 1S723 3LTAA 4N6NB 1GS3A 3HZPA 3HIIA 5IG4A 1DYUA 1GD3A 2I9WA 5AI1A 4J9AA 2Z77A 2KXGA 2OTL3 3NM2A 3CCS3 4OK0A 1W02A 2R4IA 1OHPA 1QVF2 2ZDJA 3MKIA 2B24B 4N6LA 5STDA 4RZMA 2QIYA 2HMJB 3WOEB 5AIFA 3EBTA 1IV9A 1IVVA 2O3OA 3CC73 4RNZA 1RN7A 3PGBA 3EF8A 3NUVA 3F9SA 1K8A4 1E3VA 2IMJA 3IPTA 1EG9B 3OWSA 4HZBB 2OQEA 4HM7B 3FH1A 1JRQA 3PCSA 4OVMA 1AV4A 2XGLA 3KKGA 1VQ63 1J2BA 2Y73A 1LNHA 3G713 3PCRA 2IUJA 4FMDA 1D6YA 1HU9A 2D42A 1Z1SA 1C7HA 3BNCA 3KFQC 1GYBA 1KC84 5KP4A 1VQL3 2CFWA 2XSOB 3DGMA 5G2GA 3JUOA 4XBTA 4HM0B 3CCE3 1TFKA 5D82A 3A76A 5FW5A 1VQN3 3G0KA 4O8SA 3G4S3 1D6UA 3EHCA 3S5CA 1W7CA 1OF5A 4GB5A 1VQP3 4XDWA 1NDOB 1OF5B 1JB2A 2CWVA 5EVHA 1RRLA 1YGEA 3K63A 3B7CA 3BNEA 1SJWA 2C10A 3WODG 5IERA 2KCDA 4K61A 5AEWB 3S28A 4EV2A 3LZAA 2BHMA 1VQ73 1E97A 1ULIB 3Q2PA 2WOHA 4FMCA 1EA2A 1K734 4HJLB 4J8TA 4RBNA 3V99A 4QWTA 3PS8A 4R80A 5IG3A 1TU5A 4MMYB 3MHEA 3DM8A 1QAFA 4KFEA 4LZIA 1ULJB 3U97A 1W00A 1VQO3 1JN5B 2JDIH 4BTWA 3DY5A 3CCQ3 2CHCA 3B4PA 3EJVA 1W5ZA 1Q864 4LSOA 4TX4A 5IF6A 3GRDA 1NU3A 3K9MC 1DMNA 1GY6A 3CCM3 1IQXA 2INXA 4L8OA 4HKVB 2STDA 3UL5A 8CHOA 2GEYA 1FUWA 3FF2A 2C11A 3O8YA 3F8HA 2E2TA 4HBRA 4LEHA 4NHFA 4HM6B 4N6TA 3EC9A 5EEOA 7STDA 5IEPA 2HMLB 1CEWI 1QAKA 3G8ZA 2BMQB 1RKYA 1AVKA 1FGQA 2WGOA 1O7GB 4X2OA 3NXJA 1LOXA 2OWPA 1ZX2A 4AEQA 1TP6A 2YFLB 3M8CA 4WFOA 3PXMA 4RNYA 3VSYA 1SQWA 2MF7A 2FNQA 3WA2X 2XEPA 2XSHB 3JUQA 3OWUA 3SOAA 2B1XB 3WDGB 2FXTA 1AR0A 3FKAA 4LMIA 4R1KA 3L0RA 3ALAA 1Q42A 2W04A 5BXQA 1W2B2 4FR9A 1STDA 3CU3A 3CME3 1G96A 1YJW3 3BNBA 2XRXB 3UJMA 4KFDA 4XB5A 2XR8B 1EQKA 3F40A 3MYTA 5DRVA 4HM2B 4K1UA 3FSDA 1STFI 2F86B 3X3ZA 2WOFA 4O3VA 3DZLA 2CWTA 1IV7A 1IU7A 3NQYA 4R4KA 1N8R4 2HMNB 3I563 4XBXA 5A0OB 1WTHA 1KQS2 4FCMA 1GY5A 4R9KA 2BNGA 1UI8A 1Q40A 1M1XB 5JBSA 1Q40B 3VF1A 3DGLA 1GY7A 1VZZA 3J7Yd 2KRTA 1IDPA 1YI23 3JUMA 1YIT3 1NJI4 2Z76A 3VGNA 3JVCA 5CF2A 2BO9B 3GZBA 2BT3A 1E3RA 2FGTA 3HIGA 3FZWA 4L7KA 3IMAB 5IG0A 1JV2B 3DGOA 1O7NB 1O7PB 1QALA 4L8PA 3IJEB 1N9EA 3BNDA 3LXUX 5FGOA 3TDGA 3T8NA 1OGZA 1FGTA 4HZ9B 1VQ93 2P0XA 3MG2A 3FG4A 3DUKA 3N54B 1OUNA 4K90B 4EV5A 1NB5I 4X2HA 3STDA 2E2VA 3EBYA 3V92A 3SEDA 1JNQA 2OQEC 4FCJA 3X42A 4FMAA 1OH0A 1NB3I 1A90A 1ZO2A 1Q824 1SPUA 2XGNA 1AVLA 1JB4A 4FCZA 2XFTA 3GZXB 2L4VA 1OGXA 1ASKA 5LC6A 3ER7A 5IEOA 2CK3H 5HGRA 3D9RA 2YX9A 1VQ83 2P0MA 4IPBA 1UUVB 3DXOA 3LYGA 3EN8A 1Q814 4JRFA 1W4NA 3OWYA 1WQLB 1RJOA 2GU3A 3ECFA 3NV0B 2IA7A 1JN5A 2M7OA 1IVWA 3WOFB 3F7SA 1FA3A 1N8QA 4I4KA 1HKXA 2Y74A 4EXRA 3T0UA 4KFFA 1D6ZA 3Q90A 4BTYA 1IQ8A 4KVHA 1TFOA 3NHXA 2OOVA 1YIJ3 2XF3A 1MNLA 5IW9A 3V98A 2GBXB 3N9HA 1U8CB 3KZTA 3QRDA 1PU4A 4PEJA 3CCU3 4HM4B 2QA43 5TGNA 2P38A 1W6CA 2CG1A 3NM7A 4WHAA 3KE7A 4H61A 3LMLA 3B4OA 5AIGA 4WWUC 4LGQA 3X3YA 5I97A 1N5HA 1OCVA 2D1WA 2RGQA 3E99A 4K1VA 2QGUA 1ROVA 4KZ1A 4XM4A 1FGOA 5CK6A 3U1WA 3D3LA 4XDVA 2W2CA 3I0YA 1CQSA 1N9JA 1UI7A 2Z7AA 3KIIA 4EC6A 3X40A 2OOVC 3MSOA 3NBBA 1V74A 3MG1A 3CD63 3S67A 1DVCA 4CDLA 1BUQA 4N6V0 1TUHA 2GU1A 1IT7A 1A67A 2W6JH 3LT8A 3LOYA 1OACA 3LTDA 1S5AA 1VQM3 3MG3A 3OXAA 3F8XA 4AKYA 2V1LA 2K0MA 4IIAA 1WMNA 4HM3B 5CLKA 3KN4A 1WMPA 3LTBA 1TIJA 2PZVA 4MEIA 5CXOA 2ML5A 4R9LA 3K7CA 4ZM8A 2CIUA 2W0QA 1NO3A 5KP3A 5BVBA 1JB5A 4MJDA 3RGAA 4N6MA 5AIHA 3F14A 3CPW2 1US1A 1YVBI 3SX1A 2QEX3 1OHOA 1O7HB 1M904 2RCDA 3FCSB 2CKFB 3GZRA 3CXC2 1DMMA 4JF8A 3BB9A 1OPYA 2CFGA 4FMBA 2CFKA 3LTCA 1DMQA 3SOYA 1NWWA 3K0ZA 3BLZA 2CC3A 4MMXB 3EN1B 2HMMB 3X41A 2JQ5A 3PZWA 2W56A 1QMAA 1KSIA 3UB1A 4WYKA 2W56B 1PFPA 5AYSC 4WYKB 1A2KA 1O7MB 2HMKB 4HM1B 5ELJA 3G16A 3ROBA 5LC7A 2WGQA 3MWZA 1CYVA 2LQVA 3Q1CA 2XFSA 1MOLA 2MC8A 3K5TA 4G1MB 3CCR3 3G6E3 1YHQ3 3CCL3 1N5PA 2OTJ3 1IVUA 4IT7A 1M9GA 5IG5A 1FGMA 1SIIA 2K54A 3EX9A 1DVDA 2YFIB 2CFDA 5JPPA 3FGYA 1IQYA 1Y4KA 3H3HA 1W6YA 2UX0A 2O9UX 1VQ43 1UW1A 3RGRA 1GD4A 2XH9A 4Q53A 3DGNA 1JKGA 3EQQB 2CW9A 5DREA 1K9M4 3N8BA 1L5GB 4HM5B 1JKGB 5IENA 1LXEA 3X3XA 2Z6BA 3CC23 2BMOB 4ORLA 3CCJ3 3CC43 1W6GA 1KWIA 2WO0A 2SBLA 1Q7Y4 4CCVA 2W9QA 4H3UA 3GZYB 3SVAA 3T8UA 4O2HA 3NBRA 3NX0A 2CWUA 4EBGA 3JUNA 3OV4A 3H51A 5AEUB 3NV0A 2CFLA 1UUWB 4MMZB 2W9PA 3MPHA 1ISKA 1JJ22 4NREA 1LVNA 3FG3A 5ELUA 3RDEA 3OW22 5D81A 4N6UA 3HK4A 1OHSA 1EKMA 3UL6A 1W01A 5AIIA 1IT8A 2GXFA 4XBYA 2LYXA 1YJ93 4STDA 1T5YA 3GAXA 1QVG2 3DMCA 2PNCA 4N6OB 3CNMA 1O7WB 3GWRA 2ZL8A 4GL6A 1IVXA 1U5OA 2RFRA 1SIHA 3UNLA 1WNHA 2YFJB 2Q07A 3HX8A 3LT9A 3HI7A 3WMDA 4WP5A 3S29A 1VQ53 1W2ZA 4HM8B 3PYJA 4AKZA 5AYRB 3AMOA 3FLJA 3FG1A 6STDA 1IK3A 1R4CA 1ROAA 1A2VA 3AMOB 3SLUA 2F98A 4BTXA 1CYUA 2IUKA 5D83A 4EYCA 3KSPA 4U13A 5JPUA 3SXXA 1K41A 3B8LA 4O02B 3CNXA 3NBJA 3WA3A 3EE1A 1WMOA 2CG0A 2GBWB 2BMRB 3CPOA 5KP1A 2W03A 2A15A 3S27A 5EQLA 4HYZA 1VQK3 3CCV3 1QJGA 2E2UA 2F99A 3QK9A 3LH4A 1M1K4 2RSXA 2P05A 3NQZA 2GEXA 4HVNA 2CH9A 2ML6A 3FF0A 3KSED 5CF1A 1RRHA 3JUPA 1K28A 3F7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CYV A;  1MOL A;  4N6T A;  1N5P A;  4IT7 A;  2OCT A;  1M9G A;  1CEW I;  1FA3 A;  1DVD A;  4N6N B;  1GD3 A;  2KXG A;  2O9U X;  3PXM A;  1GD4 A;  1MNL A;  3QRD A;  4N6L A;  1LXE A;  3L0R A;  1KWI A;  4CCV A;  2W9Q A;  1IV9 A;  3SVA A;  1RN7 A;  3NX0 A;  1N5H A;  1G96 A;  2W9P A;  1EQK A;  5ELU A;  1N9J A;  4N6U A;  1STF I;  3UL6 A;  3KFQ C;  1IV7 A;  3S67 A;  1DVC A;  4N6V 0;  3GAX A;  1A67 A;  5A0O B;  4N6O B;  1WNH A;  1TIJ A;  4ZM8 A;  3PYJ A;  2BO9 B;  1R4C A;  1ROA A;  4N6M A;  3IMA B;  3Q2P A;  1YVB I;  1CYU A;  4EYC A;  3PS8 A;  4LZI A;  1NB5 I;  5EQL A;  3LH4 A;  4TX4 A;  3K9M C;  1NB3 I;  1A90 A;  1PFP A;  2CH9 A;  5ELJ A;  3KSE D;  5LC6 A;  3UL5 A;  5LC7 A;  1FUW A;  3MWZ A; 
#chains in the Genus database with same CATH topology
 1BVI A;  1MGR A;  3I55 3;  2P09 A;  3CMA 3;  3OX9 A;  1KD1 4;  3URP A;  1I70 A;  4N3V A;  1FGR A;  1YJN 3;  2OCT A;  3EB8 A;  4OUQ A;  2HMO B;  2BU4 A;  1F8N A;  1TTO A;  2CX0 A;  3LTA A;  1S72 3;  4N6N B;  1GS3 A;  3HZP A;  3HII A;  5IG4 A;  3BU4 A;  1DYU A;  1GD3 A;  2I9W A;  5AI1 A;  4J9A A;  2Z77 A;  2KXG A;  2OTL 3;  3ZFZ A;  3NM2 A;  3CCS 3;  4OK0 A;  1W02 A;  1UCI A;  3BIR A;  1RCK A;  2R4I A;  1OHP A;  1QVF 2;  2ZDJ A;  3KCH A;  3MKI A;  2B24 B;  2KF4 A;  4N6L A;  5STD A;  1RSN A;  4RZM A;  2BIR A;  2QIY A;  2HMJ B;  3WOE B;  5AIF A;  2C4B A;  1AY7 A;  3EBT A;  1IV9 A;  1IVV A;  2O3O A;  5G1K A;  4RNZ A;  3CC7 3;  1RN7 A;  3PGB A;  3EF8 A;  3NUV A;  3F9S A;  1K8A 4;  1E3V A;  2R41 A;  2IMJ A;  3IPT A;  1EG9 B;  3OWS A;  1BUJ A;  1B3S A;  4HZB B;  2OQE A;  4HM7 B;  3FH1 A;  1JRQ A;  3PCS A;  3F7X A;  4OVM A;  1AV4 A;  2XGL A;  3KKG A;  1VQ6 3;  1UDI I;  1RN1 A;  2Y73 A;  1J2B A;  1LNH A;  5RNT A;  3PCR A;  2IUJ A;  3G71 3;  4FMD A;  2RNT A;  1D6Y A;  1HU9 A;  1ZGX A;  2D42 A;  1Z1S A;  1C7H A;  3BNC A;  3KFQ C;  1GYB A;  1KC8 4;  5KP4 A;  5HOH A;  1VQL 3;  4EW5 A;  2CFW A;  2XSO B;  3DGM A;  5G2G A;  3JUO A;  4XBT A;  6GSP A;  4HM0 B;  3CCE 3;  1TFK A;  5D82 A;  3A76 A;  5FW5 A;  1VQN 3;  1I0V A;  3G0K A;  1B2Z A;  4O8S A;  3G4S 3;  1D6U A;  3EHC A;  3S5C A;  1IYY A;  1B20 A;  1UCJ A;  1OF5 A;  1W7C A;  4GB5 A;  1VQP 3;  4BL3 A;  1I8V A;  1NDO B;  1OF5 B;  1JB2 A;  2CWV A;  4XDW A;  5EVH A;  1RRL A;  1YGE A;  3K63 A;  3B7C A;  3AHS A;  3BNE A;  1SJW A;  2C10 A;  2UUG C;  3WOD G;  2KCD A;  1BU4 A;  4K61 A;  5AEW B;  3S28 A;  2J8X B;  4EV2 A;  5IER A;  3LZA A;  2BHM A;  1VQ7 3;  1E97 A;  1ULI B;  3Q2P A;  2WOH A;  4FMC A;  4NPB A;  1EA2 A;  1K73 4;  4HJL B;  4J8T A;  4RBN A;  3A5E A;  3V99 A;  4QWT A;  3PS8 A;  1RGG A;  1I2G A;  4R80 A;  5IG3 A;  1RNT A;  1TU5 A;  3HOH A;  4MMY B;  3MHE A;  4J5K A;  3DM8 A;  1QAF A;  1MWS A;  4KFE A;  1RGE A;  4LZI A;  1ULJ B;  3SYU A;  1BOX A;  3ZG0 A;  3U97 A;  1W00 A;  1X1U A;  1VQO 3;  1JN5 B;  2JDI H;  3GSP A;  4GSP A;  3DY5 A;  4BTW A;  3CCQ 3;  2CHC A;  3B4P A;  1CH0 A;  3EJV A;  1UCL A;  1W5Z A;  1Q86 4;  4LSO A;  4TX4 A;  5IF6 A;  3GRD A;  1NU3 A;  3K9M C;  1DMN A;  1DE3 A;  3AHW A;  1GMP A;  1GY6 A;  1RDS A;  3CCM 3;  1IQX A;  2INX A;  4L8O A;  4HKV B;  2STD A;  2ZA4 A;  1DET A;  3UL5 A;  8CHO A;  2GEY A;  1FUW A;  3FF2 A;  1JBT A;  2C11 A;  3O8Y A;  3F8H A;  2E2T A;  4HBR A;  2AAE A;  4HOH A;  4LEH A;  4NHF A;  4HM6 B;  4N6T A;  3EC9 A;  5EEO A;  1G0T A;  7STD A;  5IEP A;  2HML B;  1CEW I;  1ZS7 A;  1QAK A;  3G8Z A;  2BMQ B;  1RCL A;  1RKY A;  1AVK A;  1I3F A;  1FGQ A;  2WGO A;  1O7G B;  4RNT A;  1A2P A;  1GOU A;  4X2O A;  3NXJ A;  1LOX A;  2OWP A;  1ZX2 A;  4AEQ A;  1GOY A;  1TP6 A;  1RGL A;  2YFL B;  3M8C A;  3PXM A;  4I5Q A;  4RNY A;  4WFO A;  3VSY A;  1BRN L;  1SQW A;  2MF7 A;  2FNQ A;  3WA2 X;  2XEP A;  2XSH B;  3JUQ A;  3OWU A;  3SOA A;  1JBS A;  1LRA A;  2B1X B;  3WDG B;  1FUS A;  2FXT A;  1AR0 A;  3FKA A;  4LMI A;  1RGK A;  4R1K A;  3L0R A;  3ALA A;  1Q42 A;  2W04 A;  5BXQ A;  1W2B 2;  1JBR A;  1TRQ A;  3D5I A;  1BSE A;  4FR9 A;  2KF5 A;  1STD A;  3CU3 A;  5I97 A;  1G96 A;  3CME 3;  1RGA A;  1RGH A;  3BNB A;  1YJW 3;  1RNB A;  2XRX B;  1RTU A;  1T2I A;  3UJM A;  3WR2 A;  4KFD A;  4XB5 A;  2XR8 B;  1EQK A;  3F40 A;  3MYT A;  5DRV A;  2IY2 A;  4HM2 B;  4K1U A;  3FSD A;  1BSD A;  1STF I;  2F86 B;  3X3Z A;  2WOF A;  4O3V A;  1BNR A;  1RGC A;  3DZL A;  1RHL A;  2CWT A;  1IV7 A;  1IU7 A;  2H0G A;  3NQY A;  4R4K A;  1N8R 4;  2HMN B;  5M1A A;  4XBX A;  5A0O B;  1WTH A;  3I56 3;  4FCM A;  1KQS 2;  1GY5 A;  4R9K A;  2BNG A;  1UI8 A;  1Q40 A;  1M1X B;  5JBS A;  1B27 A;  1Q40 B;  3VF1 A;  1I3I A;  3DGL A;  1GY7 A;  1VZZ A;  3J7Y d;  2KRT A;  1IDP A;  1YI2 3;  3JUM A;  1YIT 3;  1NJI 4;  2Z76 A;  3VGN A;  3JVC A;  5CF2 A;  2BO9 B;  3GZB A;  2BT3 A;  1E3R A;  2FGT A;  3HIG A;  3FZW A;  4L7K A;  1LOY A;  3IMA B;  5IG0 A;  1BRS A;  1JV2 B;  3DGO A;  1O7N B;  1FYS A;  2CX1 A;  1O7P B;  1QAL A;  4L8P A;  3IJE B;  1N9E A;  3BND A;  1BIR A;  3LXU X;  3AGN A;  5FGO A;  3TDG A;  3T8N A;  1OGZ A;  1FGT A;  4HZ9 B;  1VQ9 3;  2P0X A;  3MG2 A;  3FG4 A;  3DUK A;  3N54 B;  1OUN A;  4K90 B;  4EV5 A;  1NB5 I;  4X2H A;  3STD A;  1BAN A;  4BU4 A;  2E2V A;  1B21 A;  6RNT A;  1UGI A;  3EBY A;  3V92 A;  3SED A;  1JNQ A;  2OQE C;  4FCJ A;  2IYJ A;  3X42 A;  4FMA A;  1OH0 A;  1NB3 I;  1A90 A;  1HZ1 A;  1ZO2 A;  1Q82 4;  1SPU A;  2XGN A;  1AVL A;  1JB4 A;  3D5G A;  4FCZ A;  2XFT A;  3GZX B;  2L4V A;  1BRH A;  1OGX A;  1ASK A;  5LC6 A;  3ER7 A;  1GOV A;  5IEO A;  2CK3 H;  5HGR A;  1MWT A;  2YX9 A;  3D9R A;  2P0M A;  4KT3 B;  1VQ8 3;  4IPB A;  1UUV B;  3DXO A;  3RNT A;  3LYG A;  3EN8 A;  1Q81 4;  4JRF A;  1W4N A;  3OWY A;  1WQL B;  1RJO A;  2GU3 A;  3ECF A;  3NV0 B;  2IA7 A;  1JN5 A;  2M7O A;  1IVW A;  1V57 A;  2K3D A;  3F7S A;  3WOF B;  1FA3 A;  1N8Q A;  4I4K A;  1FZU A;  1HKX A;  2Y74 A;  1B2U A;  1I2F A;  3T0U A;  4EXR A;  1NNV A;  1BGS A;  4KFF A;  5M18 A;  1D6Z A;  4HAA A;  3Q90 A;  4BTY A;  1IQ8 A;  4KVH A;  1TFO A;  3DH2 A;  3NHX A;  2OOV A;  1YIJ 3;  1BNF A;  2XF3 A;  2HOH A;  1MNL A;  5IW9 A;  3V98 A;  1YVS A;  2GBX B;  3N9H A;  1U8C B;  3KZT A;  3QRD A;  1PU4 A;  4PEJ A;  1TRP A;  1VQQ A;  3CCU 3;  4ILF A;  4HM4 B;  2QA4 3;  5TGN A;  2P38 A;  1W6C A;  2CG1 A;  1I2E A;  3NM7 A;  1LNI A;  4WHA A;  3KE7 A;  4H61 A;  1BNE A;  3LML A;  3B4O A;  1LOW A;  4WWU C;  4LGQ A;  5AIG A;  3X3Y A;  1N5H A;  1OCV A;  2D1W A;  2F5M A;  2RGQ A;  3D4A A;  2QGU A;  3E99 A;  4K1V A;  1RLS A;  1ROV A;  4DKI A;  4KZ1 A;  4XM4 A;  1FGO A;  1EUI C;  5CK6 A;  3U1W A;  1UUG B;  3D3L A;  4XDV A;  1BSC A;  2W2C A;  3I0Y A;  1CQS A;  1N9J A;  1UI7 A;  1YNV X;  2Z7A A;  1BNG A;  2F4Y A;  3KII A;  2OOV C;  3MSO A;  3X40 A;  4EC6 A;  3NBB A;  5BU4 A;  1V74 A;  5BIR A;  3MG1 A;  3CD6 3;  1UCK A;  3S67 A;  1DVC A;  4CDL A;  1B2M A;  4N6V 0;  1BUQ A;  1TUH A;  2GU1 A;  1IT7 A;  1Q7H A;  1X1X A;  1A67 A;  2W6J H;  3LT8 A;  3LOY A;  3D79 A;  1OAC A;  1BNI A;  3LTD A;  1S5A A;  1VQM 3;  3MG3 A;  3OXA A;  3F8X A;  4AKY A;  1GSP A;  1X1Y A;  2V1L A;  2K0M A;  4IIA A;  1WMN A;  4HM3 B;  5CLK A;  1GMR A;  1T3B A;  3KN4 A;  1WMP A;  3LTB A;  1R4Y A;  1TIJ A;  2PZV A;  4MEI A;  2ML5 A;  4R9L A;  3K7C A;  5CXO A;  2CIU A;  2W0Q A;  1YGW A;  4ZM8 A;  1NO3 A;  5KP3 A;  5BVB A;  1JB5 A;  4MJD A;  3RGA A;  4GHO A;  4N6M A;  5AIH A;  2F56 A;  1G02 A;  3F14 A;  1US1 A;  3CPW 2;  1YVB I;  3SX1 A;  2QEX 3;  1OHO A;  4CJN A;  1O7H B;  1FUT A;  1TJD A;  2RCD A;  1M90 4;  3FCS B;  2CKF B;  1BRJ A;  3GZR A;  3CXC 2;  1DMM A;  1X1W A;  4JF8 A;  3BB9 A;  1OPY A;  8RNT A;  1Q9E A;  1LQG C;  1B2X A;  2CFG A;  4FMB A;  2CFK A;  3LTC A;  1DMQ A;  1PY3 A;  2SAR A;  1MGW A;  3SOY A;  1NWW A;  3K0Z A;  3BLZ A;  2CC3 A;  5M19 A;  2UGI A;  4MMX B;  3EN1 B;  2HMM B;  3X41 A;  2JQ5 A;  3PZW A;  2W56 A;  1QMA A;  1KSI A;  2KAA A;  3UB1 A;  2ZHX B;  2W56 B;  1PFP A;  4WYK A;  5AYS C;  1T2H A;  4WYK B;  1A2K A;  1BSA A;  1O7M B;  2HMK B;  4HM1 B;  4LYL B;  5ELJ A;  3G16 A;  3ROB A;  5LC7 A;  2WGQ A;  3MWZ A;  1CYV A;  2LQV A;  3Q1C A;  2XFS A;  3Q3F A;  1MOL A;  2MC8 A;  2F5W A;  3K5T A;  4G1M B;  3CCR 3;  3G6E 3;  1SAR A;  1YHQ 3;  3CCL 3;  1N5P A;  2OTJ 3;  1B2S A;  1IVU A;  4IT7 A;  1M9G A;  5IG5 A;  1FGM A;  1SII A;  2K54 A;  4CPK A;  3EX9 A;  1DVD A;  2YFI B;  2CFD A;  5JPP A;  3FGY A;  1IQY A;  1Y4K A;  3WHO A;  3H3H A;  1W6Y A;  2UX0 A;  1BNJ A;  2O9U X;  1VQ4 3;  1UW1 A;  3RGR A;  1GD4 A;  2XH9 A;  4Q53 A;  3DGN A;  1JKG A;  3EQQ B;  2CW9 A;  5DRE A;  1K9M 4;  3N8B A;  1L5G B;  4HM5 B;  1JKG B;  5IEN A;  1LXE A;  3X3X A;  2Z6B A;  3CC2 3;  2BMO B;  4ORL A;  3CCJ 3;  1BRK A;  3CC4 3;  1W6G A;  1KWI A;  2WO0 A;  2SBL A;  1Q7Y 4;  4CCV A;  2W9Q A;  4H3U A;  3GZY B;  3SVA A;  5GSP A;  3T8U A;  4O2H A;  3NBR A;  3NX0 A;  2CWU A;  4EBG A;  1HYF A;  3JUN A;  3OV4 A;  3H51 A;  5AEU B;  3NV0 A;  2CFL A;  1UUW B;  1RGF A;  4MMZ B;  3ZG5 A;  2W9P A;  3DGY A;  3MPH A;  1ISK A;  1JJ2 2;  4NRE A;  1C54 A;  1LVN A;  3FG3 A;  5ELU A;  3RDE A;  3OW2 2;  5D81 A;  1BSB A;  3HK4 A;  4N6U A;  1OHS A;  1EKM A;  3UL6 A;  1W01 A;  7GSP A;  5AII A;  1IT8 A;  1MWR A;  2GXF A;  4XBY A;  2L1S A;  1LQM B;  1RMS A;  2LYX A;  1YJ9 3;  1BRI A;  1T5Y A;  4STD A;  3GAX A;  4BL2 A;  1QVG 2;  3DMC A;  4BIR A;  2PNC A;  4N6O B;  3CNM A;  1EEJ A;  1O7W B;  3GWR A;  2ZL8 A;  4GL6 A;  1IVX A;  1U5O A;  1UGH I;  2RFR A;  1SIH A;  2AAD A;  3UNL A;  5G1L A;  1LOV A;  1WNH A;  2Q07 A;  2KF6 A;  2YFJ B;  3HX8 A;  3LT9 A;  3HI7 A;  3WMD A;  4WP5 A;  1GMQ A;  3S29 A;  1VQ5 3;  1W2Z A;  1BAO A;  4HM8 B;  3PYJ A;  4AKZ A;  2H0H A;  5AYR B;  3AMO A;  3FLJ A;  3FG1 A;  6STD A;  1IK3 A;  1R4C A;  1ROA A;  1A2V A;  3AMO B;  3SLU A;  2F98 A;  4BTX A;  1CYU A;  2IUK A;  5D83 A;  4EYC A;  1JZD A;  2H0I A;  3KSP A;  4U13 A;  2RBI A;  5JPU A;  1PYL A;  3SXX A;  1FW7 A;  1K41 A;  3B8L A;  4O02 B;  3CNX A;  3NBJ A;  1MWU A;  3AGO A;  3EE1 A;  3WA3 A;  1AQZ A;  1WMO A;  2CG0 A;  2GBW B;  7RNT A;  2BMR B;  3CPO A;  5KP1 A;  2W03 A;  2A15 A;  3S27 A;  4J5G A;  1BRG A;  5EQL A;  2GSP A;  4HYZ A;  9RNT A;  1VQK 3;  3CCV 3;  1QJG A;  2E2U A;  2F99 A;  3QK9 A;  3LH4 A;  1I0X A;  1M1K 4;  1V58 A;  2P05 A;  2RSX A;  3NQZ A;  2GEX A;  1BNS A;  4HVN A;  2CH9 A;  2ML6 A;  3FF0 A;  1JZO A;  1RN4 A;  3KSE D;  1RRH A;  5CF1 A;  3JUP A;  1K28 A;  2KF3 A; 
#chains in the Genus database with same CATH homology
 3I55 3;  2P09 A;  3CMA 3;  3OX9 A;  1KD1 4;  4N3V A;  1YJN 3;  1FGR A;  2OCT A;  3EB8 A;  4OUQ A;  2HMO B;  1F8N A;  1S72 3;  3LTA A;  4N6N B;  1GS3 A;  3HZP A;  3HII A;  5IG4 A;  1DYU A;  1GD3 A;  2I9W A;  5AI1 A;  4J9A A;  2Z77 A;  2KXG A;  2OTL 3;  3NM2 A;  3CCS 3;  4OK0 A;  1W02 A;  2R4I A;  1OHP A;  1QVF 2;  2ZDJ A;  3MKI A;  2B24 B;  4N6L A;  5STD A;  4RZM A;  2QIY A;  2HMJ B;  3WOE B;  5AIF A;  3EBT A;  1IV9 A;  1IVV A;  2O3O A;  3CC7 3;  4RNZ A;  1RN7 A;  3PGB A;  3EF8 A;  3NUV A;  3F9S A;  1K8A 4;  1E3V A;  2IMJ A;  3IPT A;  1EG9 B;  3OWS A;  4HZB B;  2OQE A;  4HM7 B;  3FH1 A;  1JRQ A;  3PCS A;  4OVM A;  1AV4 A;  2XGL A;  3KKG A;  1VQ6 3;  1J2B A;  2Y73 A;  1LNH A;  3G71 3;  3PCR A;  2IUJ A;  4FMD A;  1D6Y A;  1HU9 A;  2D42 A;  1Z1S A;  1C7H A;  3BNC A;  3KFQ C;  1GYB A;  1KC8 4;  5KP4 A;  1VQL 3;  2CFW A;  2XSO B;  3DGM A;  5G2G A;  3JUO A;  4XBT A;  4HM0 B;  3CCE 3;  1TFK A;  5D82 A;  3A76 A;  5FW5 A;  1VQN 3;  3G0K A;  4O8S A;  3G4S 3;  1D6U A;  3EHC A;  3S5C A;  1W7C A;  1OF5 A;  4GB5 A;  1VQP 3;  4XDW A;  1NDO B;  1OF5 B;  1JB2 A;  2CWV A;  5EVH A;  1RRL A;  1YGE A;  3K63 A;  3B7C A;  3BNE A;  1SJW A;  2C10 A;  3WOD G;  5IER A;  2KCD A;  4K61 A;  5AEW B;  3S28 A;  4EV2 A;  3LZA A;  2BHM A;  1VQ7 3;  1E97 A;  1ULI B;  3Q2P A;  2WOH A;  4FMC A;  1EA2 A;  1K73 4;  4HJL B;  4J8T A;  4RBN A;  3V99 A;  4QWT A;  3PS8 A;  4R80 A;  5IG3 A;  1TU5 A;  4MMY B;  3MHE A;  3DM8 A;  1QAF A;  4KFE A;  4LZI A;  1ULJ B;  3U97 A;  1W00 A;  1VQO 3;  1JN5 B;  2JDI H;  4BTW A;  3DY5 A;  3CCQ 3;  2CHC A;  3B4P A;  3EJV A;  1W5Z A;  1Q86 4;  4LSO A;  4TX4 A;  5IF6 A;  3GRD A;  1NU3 A;  3K9M C;  1DMN A;  1GY6 A;  3CCM 3;  1IQX A;  2INX A;  4L8O A;  4HKV B;  2STD A;  3UL5 A;  8CHO A;  2GEY A;  1FUW A;  3FF2 A;  2C11 A;  3O8Y A;  3F8H A;  2E2T A;  4HBR A;  4LEH A;  4NHF A;  4HM6 B;  4N6T A;  3EC9 A;  5EEO A;  7STD A;  5IEP A;  2HML B;  1CEW I;  1QAK A;  3G8Z A;  2BMQ B;  1RKY A;  1AVK A;  1FGQ A;  2WGO A;  1O7G B;  4X2O A;  3NXJ A;  1LOX A;  2OWP A;  1ZX2 A;  4AEQ A;  1TP6 A;  2YFL B;  3M8C A;  4WFO A;  3PXM A;  4RNY A;  3VSY A;  1SQW A;  2MF7 A;  2FNQ A;  3WA2 X;  2XEP A;  2XSH B;  3JUQ A;  3OWU A;  3SOA A;  2B1X B;  3WDG B;  2FXT A;  1AR0 A;  3FKA A;  4LMI A;  4R1K A;  3L0R A;  3ALA A;  1Q42 A;  2W04 A;  5BXQ A;  1W2B 2;  4FR9 A;  1STD A;  3CU3 A;  3CME 3;  1G96 A;  1YJW 3;  3BNB A;  2XRX B;  3UJM A;  4KFD A;  4XB5 A;  2XR8 B;  1EQK A;  3F40 A;  3MYT A;  5DRV A;  4HM2 B;  4K1U A;  3FSD A;  1STF I;  2F86 B;  3X3Z A;  2WOF A;  4O3V A;  3DZL A;  2CWT A;  1IV7 A;  1IU7 A;  3NQY A;  4R4K A;  1N8R 4;  2HMN B;  3I56 3;  4XBX A;  5A0O B;  1WTH A;  1KQS 2;  4FCM A;  1GY5 A;  4R9K A;  2BNG A;  1UI8 A;  1Q40 A;  1M1X B;  5JBS A;  1Q40 B;  3VF1 A;  3DGL A;  1GY7 A;  1VZZ A;  3J7Y d;  2KRT A;  1IDP A;  1YI2 3;  3JUM A;  1YIT 3;  1NJI 4;  2Z76 A;  3VGN A;  3JVC A;  5CF2 A;  2BO9 B;  3GZB A;  2BT3 A;  1E3R A;  2FGT A;  3HIG A;  3FZW A;  4L7K A;  3IMA B;  5IG0 A;  1JV2 B;  3DGO A;  1O7N B;  1O7P B;  1QAL A;  4L8P A;  3IJE B;  1N9E A;  3BND A;  3LXU X;  5FGO A;  3TDG A;  3T8N A;  1OGZ A;  1FGT A;  4HZ9 B;  1VQ9 3;  2P0X A;  3MG2 A;  3FG4 A;  3DUK A;  3N54 B;  1OUN A;  4K90 B;  4EV5 A;  1NB5 I;  4X2H A;  3STD A;  2E2V A;  3EBY A;  3V92 A;  3SED A;  1JNQ A;  2OQE C;  4FCJ A;  3X42 A;  4FMA A;  1OH0 A;  1NB3 I;  1A90 A;  1ZO2 A;  1Q82 4;  1SPU A;  2XGN A;  1AVL A;  1JB4 A;  4FCZ A;  2XFT A;  3GZX B;  2L4V A;  1OGX A;  1ASK A;  5LC6 A;  3ER7 A;  5IEO A;  2CK3 H;  5HGR A;  3D9R A;  2YX9 A;  1VQ8 3;  2P0M A;  4IPB A;  1UUV B;  3DXO A;  3LYG A;  3EN8 A;  1Q81 4;  4JRF A;  1W4N A;  3OWY A;  1WQL B;  1RJO A;  2GU3 A;  3ECF A;  3NV0 B;  2IA7 A;  1JN5 A;  2M7O A;  1IVW A;  3WOF B;  3F7S A;  1FA3 A;  1N8Q A;  4I4K A;  1HKX A;  2Y74 A;  4EXR A;  3T0U A;  4KFF A;  1D6Z A;  3Q90 A;  4BTY A;  1IQ8 A;  4KVH A;  1TFO A;  3NHX A;  2OOV A;  1YIJ 3;  2XF3 A;  1MNL A;  5IW9 A;  3V98 A;  2GBX B;  3N9H A;  1U8C B;  3KZT A;  3QRD A;  1PU4 A;  4PEJ A;  3CCU 3;  4HM4 B;  2QA4 3;  5TGN A;  2P38 A;  1W6C A;  2CG1 A;  3NM7 A;  4WHA A;  3KE7 A;  4H61 A;  3LML A;  3B4O A;  5AIG A;  4WWU C;  4LGQ A;  3X3Y A;  5I97 A;  1N5H A;  1OCV A;  2D1W A;  2RGQ A;  3E99 A;  4K1V A;  2QGU A;  1ROV A;  4KZ1 A;  4XM4 A;  1FGO A;  5CK6 A;  3U1W A;  3D3L A;  4XDV A;  2W2C A;  3I0Y A;  1CQS A;  1N9J A;  1UI7 A;  2Z7A A;  3KII A;  4EC6 A;  3X40 A;  2OOV C;  3MSO A;  3NBB A;  1V74 A;  3MG1 A;  3CD6 3;  3S67 A;  1DVC A;  4CDL A;  1BUQ A;  4N6V 0;  1TUH A;  2GU1 A;  1IT7 A;  1A67 A;  2W6J H;  3LT8 A;  3LOY A;  1OAC A;  3LTD A;  1S5A A;  1VQM 3;  3MG3 A;  3OXA A;  3F8X A;  4AKY A;  2V1L A;  2K0M A;  4IIA A;  1WMN A;  4HM3 B;  5CLK A;  3KN4 A;  1WMP A;  3LTB A;  1TIJ A;  2PZV A;  4MEI A;  5CXO A;  2ML5 A;  4R9L A;  3K7C A;  4ZM8 A;  2CIU A;  2W0Q A;  1NO3 A;  5KP3 A;  5BVB A;  1JB5 A;  4MJD A;  3RGA A;  4N6M A;  5AIH A;  3F14 A;  3CPW 2;  1US1 A;  1YVB I;  3SX1 A;  2QEX 3;  1OHO A;  1O7H B;  1M90 4;  2RCD A;  3FCS B;  2CKF B;  3GZR A;  3CXC 2;  1DMM A;  4JF8 A;  3BB9 A;  1OPY A;  2CFG A;  4FMB A;  2CFK A;  3LTC A;  1DMQ A;  3SOY A;  1NWW A;  3K0Z A;  3BLZ A;  2CC3 A;  4MMX B;  3EN1 B;  2HMM B;  3X41 A;  2JQ5 A;  3PZW A;  2W56 A;  1QMA A;  1KSI A;  3UB1 A;  4WYK A;  2W56 B;  1PFP A;  5AYS C;  4WYK B;  1A2K A;  1O7M B;  2HMK B;  4HM1 B;  5ELJ A;  3G16 A;  3ROB A;  5LC7 A;  2WGQ A;  3MWZ A;  1CYV A;  2LQV A;  3Q1C A;  2XFS A;  1MOL A;  2MC8 A;  3K5T A;  4G1M B;  3CCR 3;  3G6E 3;  1YHQ 3;  3CCL 3;  1N5P A;  2OTJ 3;  1IVU A;  4IT7 A;  1M9G A;  5IG5 A;  1FGM A;  1SII A;  2K54 A;  3EX9 A;  1DVD A;  2YFI B;  2CFD A;  5JPP A;  3FGY A;  1IQY A;  1Y4K A;  3H3H A;  1W6Y A;  2UX0 A;  2O9U X;  1VQ4 3;  1UW1 A;  3RGR A;  1GD4 A;  2XH9 A;  4Q53 A;  3DGN A;  1JKG A;  3EQQ B;  2CW9 A;  5DRE A;  1K9M 4;  3N8B A;  1L5G B;  4HM5 B;  1JKG B;  5IEN A;  1LXE A;  3X3X A;  2Z6B A;  3CC2 3;  2BMO B;  4ORL A;  3CCJ 3;  3CC4 3;  1W6G A;  1KWI A;  2WO0 A;  2SBL A;  1Q7Y 4;  4CCV A;  2W9Q A;  4H3U A;  3GZY B;  3SVA A;  3T8U A;  4O2H A;  3NBR A;  3NX0 A;  2CWU A;  4EBG A;  3JUN A;  3OV4 A;  3H51 A;  5AEU B;  3NV0 A;  2CFL A;  1UUW B;  4MMZ B;  2W9P A;  3MPH A;  1ISK A;  1JJ2 2;  4NRE A;  1LVN A;  3FG3 A;  5ELU A;  3RDE A;  3OW2 2;  5D81 A;  4N6U A;  3HK4 A;  1OHS A;  1EKM A;  3UL6 A;  1W01 A;  5AII A;  1IT8 A;  2GXF A;  4XBY A;  2LYX A;  1YJ9 3;  4STD A;  1T5Y A;  3GAX A;  1QVG 2;  3DMC A;  2PNC A;  4N6O B;  3CNM A;  1O7W B;  3GWR A;  2ZL8 A;  4GL6 A;  1IVX A;  1U5O A;  2RFR A;  1SIH A;  3UNL A;  1WNH A;  2YFJ B;  2Q07 A;  3HX8 A;  3LT9 A;  3HI7 A;  3WMD A;  4WP5 A;  3S29 A;  1VQ5 3;  1W2Z A;  4HM8 B;  3PYJ A;  4AKZ A;  5AYR B;  3AMO A;  3FLJ A;  3FG1 A;  6STD A;  1IK3 A;  1R4C A;  1ROA A;  1A2V A;  3AMO B;  3SLU A;  2F98 A;  4BTX A;  1CYU A;  2IUK A;  5D83 A;  4EYC A;  3KSP A;  4U13 A;  5JPU A;  3SXX A;  1K41 A;  3B8L A;  4O02 B;  3CNX A;  3NBJ A;  3WA3 A;  3EE1 A;  1WMO A;  2CG0 A;  2GBW B;  2BMR B;  3CPO A;  5KP1 A;  2W03 A;  2A15 A;  3S27 A;  5EQL A;  4HYZ A;  1VQK 3;  3CCV 3;  1QJG A;  2E2U A;  2F99 A;  3QK9 A;  3LH4 A;  1M1K 4;  2RSX A;  2P05 A;  3NQZ A;  2GEX A;  4HVN A;  2CH9 A;  2ML6 A;  3FF0 A;  3KSE D;  5CF1 A;  1RRH A;  3JUP A;  1K28 A;  3F7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...