3Q2TA

Crystal structure of cfim68 rrm/cfim25/rna complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
207
structure length
205
Chain Sequence
GNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Human Cleavage Factor CFI(m)25/CFI(m)68/RNA Complex Provides an Insight into Poly(A) Site Recognition and RNA Looping.
pubmed doi rcsb
molecule keywords Cleavage and polyadenylation specificity factor subunit 5
molecule tags Rna binding protein/rna
source organism Homo sapiens
total genus 44
structure length 205
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13869 NUDIX_2 Nucleotide hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3q2tA01
4S2VA 2XSQA 3COUA 3U53A 2YVOA 5C7TA 1VC8A 3E57A 3R03A 1PUQA 1NFSA 3X0RA 3SHDA 2W4EA 2QKMB 1MP2A 4YPRA 1TUMA 3EEUA 4YOQA 3Q1PA 3GZ8A 1VC9A 1Q54A 4HFQA 4JZTA 5CFJA 2YVPA 1PVFA 5GHIA 1MUTA 1IRYA 1V8RA 3FJYA 5ANUA 2PQVA 1V8YA 3FK9A 2FMLA 1PUNA 2GT4A 5GHPA 3F6AA 4NFWA 2DSBA 3Q2SA 1G0SA 4NFXA 2B06A 5I8UA 3GG6A 3ZR0A 4S2YA 5HZXA 5LPGA 3A6TA 2AZWA 1MQEA 5ANVA 1F3YA 3O52A 1RYAA 2DSCA 2J8QA 1VHZA 1R67A 1KTGA 2DUKA 5ANWA 5C7QA 1HX3A 1MK1A 3MDIA 1SOIA 1QVJA 1VIQA 3EESA 3FCMA 1NQYA 3A6SA 3HHJA 1SZ3A 4DYWA 3X0LA 2DSDA 2R5WA 4KG3A 3N9UA 5DPKA 5CFIA 1VIUA 5ANTA 1X84A 1XSBA 2I8UA 3BHOA 3I7VA 3DKUA 2ICJA 3I7UA 4ILQA 4C9XA 1KT9A 1JRKA 1G9QA 4ICKA 3ACAA 3O8SA 3QSJA 2KDVA 1PPVA 3GRNA 3Q2TA 4JZSA 3FFUA 1GA7A 3CNGA 5ANSA 2A8PA 3GWYA 5GHQA 1U20A 5GHNA 2A6TA 2O1CA 2QJTA 5DDGA 2JVBA 3SMDA 5GHMA 2KDWA 3X0PA 3P6YA 3ID9A 3DUPA 5FSMA 4ZG0A 5GHJA 3AC9A 1K2EA 4S2XA 2GB5A 4S2WA 1SU2A 2QJOA 2RRKA 1VHGA 4V14A 5FSOA 2YVNA 3RH7A 3WHWA 5BONA 3FSPA 1VCDA 1VK6A 1XSAA 3H95A 1V8WA 3HYQA 3O69A 1V8TA 2DHOA 2CL3A 5C8LA 1PPWA 3X0OA 3G0QA 1MR2A 1V8NA 2I8TA 2YYHA 2Q9PA 4KTBA 4N1TA 5GHOA 3O6ZA 4MPOA 4HVYA 3X0NA 1V8MA 3L85A 3X0JA 3X0QA 4JZVA 3EXQA 1HZTA 1RRSA 1NQZA 3Q4IA 3MDGA 1I9AA 5DD4A 5BS6A 1V8UA 1X83A 4C9WA 5ISYA 1VRLA 1V8SA 2O5FA 3F13A 2ICKA 3MCFA 5DEQA 1NFZA 1V8IA 1Q27A 2G73A 2O5WA 3A6VA 3EF5A 3SONA 5IW4A 2A8SA 4IJXA 1XSCA 2YVMA 3OGAA 1RRQA 5FSNA 3P5TA 2GT2A 3BM4A 4K6EA 3X0KA 1X51A 5FSKA 3BAPA 4YPHA 2B2KA 3A6UA 1KHZA 4KG4A 4KYXA 3GZ6A 1V8VA 3Q93A 3Q91A 3GZ5A 2FKBA 5IW5A 1V8LA 1SJYA 3KVHA 1K26A 3ZR1A 2A8RA 5FSIA 5FSLA 2A8TA 3I9XA 1JKNA 2VNPA 3J7Ye 4N1UA 1MQWA 3N77A 2A8QA 1Q33A 3X0SA 3X0MA 2I6KA 3MGMA 2B0VA 1PPXA 3X0IA 2G74A 1PUSA 2FVVA 3O61A 2PNYA 4JZUA 2VNQA 1OW2A
chains in the Genus database with same CATH superfamily
4S2VA 2XSQA 3COUA 3U53A 2YVOA 5C7TA 1VC8A 3E57A 3R03A 1PUQA 1NFSA 3X0RA 3SHDA 2W4EA 2QKMB 1MP2A 4YPRA 1TUMA 3EEUA 4YOQA 3Q1PA 3GZ8A 1VC9A 1Q54A 4HFQA 4JZTA 5CFJA 2YVPA 1PVFA 5GHIA 1MUTA 1IRYA 1V8RA 3FJYA 5ANUA 2PQVA 1V8YA 3FK9A 2FMLA 1PUNA 2GT4A 5GHPA 3F6AA 4NFWA 2DSBA 3Q2SA 1G0SA 4NFXA 2B06A 5I8UA 3GG6A 3ZR0A 4S2YA 5HZXA 5LPGA 3A6TA 2AZWA 1MQEA 5ANVA 1F3YA 3O52A 1RYAA 2DSCA 2J8QA 1VHZA 1R67A 1KTGA 2DUKA 5ANWA 5C7QA 1HX3A 1MK1A 3MDIA 1SOIA 1QVJA 1VIQA 3EESA 3FCMA 1NQYA 3A6SA 3HHJA 1SZ3A 4DYWA 4J7HA 3X0LA 2DSDA 2R5WA 4KG3A 3N9UA 5DPKA 5CFIA 1VIUA 5ANTA 1X84A 1XSBA 2I8UA 3BHOA 3I7VA 3DKUA 2ICJA 3I7UA 4ILQA 4C9XA 1KT9A 1JRKA 1G9QA 4ICKA 3ACAA 3O8SA 3QSJA 2KDVA 1PPVA 3GRNA 3Q2TA 4JZSA 3FFUA 1GA7A 3CNGA 5ANSA 2A8PA 3GWYA 5GHQA 1U20A 5GHNA 2A6TA 2O1CA 2QJTA 5DDGA 2JVBA 3SMDA 5GHMA 2KDWA 3X0PA 3P6YA 3ID9A 3DUPA 5FSMA 4ZG0A 5GHJA 3AC9A 1K2EA 4S2XA 2GB5A 4S2WA 1SU2A 2QJOA 2RRKA 1VHGA 4V14A 5FSOA 2YVNA 3RH7A 3WHWA 5BONA 3FSPA 1VCDA 1VK6A 1XSAA 3H95A 1V8WA 3HYQA 3O69A 1V8TA 2DHOA 2CL3A 5C8LA 1PPWA 3X0OA 3G0QA 1MR2A 1V8NA 2I8TA 2YYHA 2Q9PA 4KTBA 4N1TA 5GHOA 3O6ZA 4MPOA 4HVYA 3X0NA 1V8MA 3L85A 3X0JA 3X0QA 4JZVA 3EXQA 1HZTA 1RRSA 1NQZA 3Q4IA 3MDGA 1I9AA 5DD4A 5BS6A 1V8UA 1X83A 4C9WA 5ISYA 1VRLA 1V8SA 2O5FA 3F13A 2ICKA 3MCFA 5DEQA 1NFZA 1V8IA 1Q27A 2G73A 2O5WA 3A6VA 3EF5A 3SONA 5IW4A 2A8SA 4IJXA 1XSCA 2YVMA 3OGAA 1RRQA 5FSNA 3P5TA 2GT2A 3BM4A 4K6EA 3X0KA 1X51A 5FSKA 3BAPA 4YPHA 2B2KA 3A6UA 1KHZA 4KG4A 4KYXA 3GZ6A 1V8VA 3Q93A 3Q91A 3GZ5A 2FKBA 5IW5A 1V8LA 1SJYA 3KVHA 1K26A 3ZR1A 2A8RA 5FSIA 2CZRA 5FSLA 2A8TA 3I9XA 1JKNA 2VNPA 3J7Ye 4N1UA 1MQWA 3N77A 2A8QA 1Q33A 3X0SA 3X0MA 4J7GA 2I6KA 3MGMA 2B0VA 1PPXA 3X0IA 2G74A 1PUSA 2FVVA 3O61A 2PNYA 4JZUA 2VNQA 1OW2A
chains in the Genus database with same CATH topology
4S2VA 2XSQA 3COUA 3U53A 2YVOA 5C7TA 1VC8A 3E57A 3R03A 1PUQA 1NFSA 3X0RA 3SHDA 2W4EA 2QKMB 1MP2A 4YPRA 1TUMA 3EEUA 4YOQA 3Q1PA 3GZ8A 1VC9A 1Q54A 4HFQA 4JZTA 5CFJA 2YVPA 1PVFA 5GHIA 1MUTA 1IRYA 1V8RA 3FJYA 5ANUA 2PQVA 1V8YA 3FK9A 2FMLA 1PUNA 2GT4A 5GHPA 3F6AA 4NFWA 2DSBA 3Q2SA 1G0SA 4NFXA 2B06A 5I8UA 3GG6A 3ZR0A 4S2YA 5HZXA 5LPGA 3A6TA 2AZWA 1MQEA 5ANVA 1F3YA 3O52A 1RYAA 2DSCA 2J8QA 1VHZA 1R67A 1KTGA 2DUKA 5ANWA 5C7QA 1HX3A 1MK1A 3MDIA 1SOIA 1QVJA 1VIQA 3EESA 3FCMA 1NQYA 3A6SA 3HHJA 1SZ3A 4DYWA 4J7HA 3X0LA 2DSDA 2R5WA 4KG3A 3N9UA 5DPKA 5CFIA 1VIUA 5ANTA 1X84A 1XSBA 2I8UA 3BHOA 3I7VA 3DKUA 2ICJA 3I7UA 4ILQA 4C9XA 1KT9A 1JRKA 1G9QA 4ICKA 3ACAA 3O8SA 3QSJA 2KDVA 1PPVA 3GRNA 3Q2TA 4JZSA 3FFUA 1GA7A 3CNGA 5ANSA 2A8PA 3GWYA 5GHQA 1U20A 5GHNA 2A6TA 2O1CA 2QJTA 5DDGA 2JVBA 3SMDA 5GHMA 2KDWA 3X0PA 3P6YA 3ID9A 3DUPA 5FSMA 4ZG0A 5GHJA 3AC9A 1K2EA 4S2XA 2GB5A 4S2WA 1SU2A 2QJOA 2RRKA 1VHGA 4V14A 5FSOA 2YVNA 3RH7A 3WHWA 5BONA 3FSPA 1VCDA 1VK6A 1XSAA 3H95A 1V8WA 3HYQA 3O69A 1V8TA 2DHOA 2CL3A 5C8LA 1PPWA 3X0OA 3G0QA 1MR2A 1V8NA 2I8TA 2YYHA 2Q9PA 4KTBA 4N1TA 5GHOA 3O6ZA 4MPOA 4HVYA 3X0NA 1V8MA 3L85A 3X0JA 3X0QA 4JZVA 3EXQA 1HZTA 1RRSA 1NQZA 3Q4IA 3MDGA 1I9AA 5DD4A 5BS6A 1V8UA 1X83A 4C9WA 5ISYA 1VRLA 1V8SA 2O5FA 3F13A 2ICKA 3MCFA 5DEQA 1NFZA 1V8IA 1Q27A 2G73A 2O5WA 3A6VA 3EF5A 3SONA 5IW4A 2A8SA 4IJXA 1XSCA 2YVMA 3OGAA 1RRQA 5FSNA 3P5TA 2GT2A 3BM4A 4K6EA 3X0KA 1X51A 5FSKA 3BAPA 4YPHA 2B2KA 3A6UA 1KHZA 4KG4A 4KYXA 3GZ6A 1V8VA 3Q93A 3Q91A 3GZ5A 2FKBA 5IW5A 1V8LA 1SJYA 3KVHA 1K26A 3ZR1A 2A8RA 5FSIA 2CZRA 5FSLA 2A8TA 3I9XA 1JKNA 2VNPA 3J7Ye 4N1UA 1MQWA 3N77A 2A8QA 1Q33A 3X0SA 3X0MA 4J7GA 2I6KA 3MGMA 2B0VA 1PPXA 3X0IA 2G74A 1PUSA 2FVVA 3O61A 2PNYA 4JZUA 2VNQA 1OW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S2V A;  2XSQ A;  3COU A;  3U53 A;  2YVO A;  5C7T A;  1VC8 A;  3E57 A;  3R03 A;  1PUQ A;  1NFS A;  3X0R A;  3SHD A;  2W4E A;  2QKM B;  1MP2 A;  4YPR A;  1TUM A;  3EEU A;  4YOQ A;  3Q1P A;  3GZ8 A;  1VC9 A;  1Q54 A;  4HFQ A;  4JZT A;  5CFJ A;  2YVP A;  1PVF A;  5GHI A;  1MUT A;  1IRY A;  1V8R A;  3FJY A;  5ANU A;  2PQV A;  1V8Y A;  3FK9 A;  2FML A;  1PUN A;  2GT4 A;  5GHP A;  3F6A A;  4NFW A;  2DSB A;  3Q2S A;  1G0S A;  4NFX A;  2B06 A;  5I8U A;  3GG6 A;  3ZR0 A;  4S2Y A;  5HZX A;  5LPG A;  3A6T A;  2AZW A;  1MQE A;  5ANV A;  1F3Y A;  3O52 A;  1RYA A;  2DSC A;  2J8Q A;  1VHZ A;  1R67 A;  1KTG A;  2DUK A;  5ANW A;  5C7Q A;  1HX3 A;  1MK1 A;  3MDI A;  1SOI A;  1QVJ A;  1VIQ A;  3EES A;  3FCM A;  1NQY A;  3A6S A;  3HHJ A;  1SZ3 A;  4DYW A;  3X0L A;  2DSD A;  2R5W A;  4KG3 A;  3N9U A;  5DPK A;  5CFI A;  1VIU A;  5ANT A;  1X84 A;  1XSB A;  2I8U A;  3BHO A;  3I7V A;  3DKU A;  2ICJ A;  3I7U A;  4ILQ A;  4C9X A;  1KT9 A;  1JRK A;  1G9Q A;  4ICK A;  3ACA A;  3O8S A;  3QSJ A;  2KDV A;  1PPV A;  3GRN A;  3Q2T A;  4JZS A;  3FFU A;  1GA7 A;  3CNG A;  5ANS A;  2A8P A;  3GWY A;  5GHQ A;  1U20 A;  5GHN A;  2A6T A;  2O1C A;  2QJT A;  5DDG A;  2JVB A;  3SMD A;  5GHM A;  2KDW A;  3X0P A;  3P6Y A;  3ID9 A;  3DUP A;  5FSM A;  4ZG0 A;  5GHJ A;  3AC9 A;  1K2E A;  4S2X A;  2GB5 A;  4S2W A;  1SU2 A;  2QJO A;  2RRK A;  1VHG A;  4V14 A;  5FSO A;  2YVN A;  3RH7 A;  3WHW A;  5BON A;  3FSP A;  1VCD A;  1VK6 A;  1XSA A;  3H95 A;  1V8W A;  3HYQ A;  3O69 A;  1V8T A;  2DHO A;  2CL3 A;  5C8L A;  1PPW A;  3X0O A;  3G0Q A;  1MR2 A;  1V8N A;  2I8T A;  2YYH A;  2Q9P A;  4KTB A;  4N1T A;  5GHO A;  3O6Z A;  4MPO A;  4HVY A;  3X0N A;  1V8M A;  3L85 A;  3X0J A;  3X0Q A;  4JZV A;  3EXQ A;  1HZT A;  1RRS A;  1NQZ A;  3Q4I A;  3MDG A;  1I9A A;  5DD4 A;  5BS6 A;  1V8U A;  1X83 A;  4C9W A;  5ISY A;  1VRL A;  1V8S A;  2O5F A;  3F13 A;  2ICK A;  3MCF A;  5DEQ A;  1NFZ A;  1V8I A;  1Q27 A;  2G73 A;  2O5W A;  3A6V A;  3EF5 A;  3SON A;  5IW4 A;  2A8S A;  4IJX A;  1XSC A;  2YVM A;  3OGA A;  1RRQ A;  5FSN A;  3P5T A;  2GT2 A;  3BM4 A;  4K6E A;  3X0K A;  1X51 A;  5FSK A;  3BAP A;  4YPH A;  2B2K A;  3A6U A;  1KHZ A;  4KG4 A;  4KYX A;  3GZ6 A;  1V8V A;  3Q93 A;  3Q91 A;  3GZ5 A;  2FKB A;  5IW5 A;  1V8L A;  1SJY A;  3KVH A;  1K26 A;  3ZR1 A;  2A8R A;  5FSI A;  5FSL A;  2A8T A;  3I9X A;  1JKN A;  2VNP A;  3J7Y e;  4N1U A;  1MQW A;  3N77 A;  2A8Q A;  1Q33 A;  3X0S A;  3X0M A;  2I6K A;  3MGM A;  2B0V A;  1PPX A;  3X0I A;  2G74 A;  1PUS A;  2FVV A;  3O61 A;  2PNY A;  4JZU A;  2VNQ A;  1OW2 A; 
#chains in the Genus database with same CATH topology
 4S2V A;  2XSQ A;  3COU A;  3U53 A;  2YVO A;  5C7T A;  1VC8 A;  3E57 A;  3R03 A;  1PUQ A;  1NFS A;  3X0R A;  3SHD A;  2W4E A;  2QKM B;  1MP2 A;  4YPR A;  1TUM A;  3EEU A;  4YOQ A;  3Q1P A;  3GZ8 A;  1VC9 A;  1Q54 A;  4HFQ A;  4JZT A;  5CFJ A;  2YVP A;  1PVF A;  5GHI A;  1MUT A;  1IRY A;  1V8R A;  3FJY A;  5ANU A;  2PQV A;  1V8Y A;  3FK9 A;  2FML A;  1PUN A;  2GT4 A;  5GHP A;  3F6A A;  4NFW A;  2DSB A;  3Q2S A;  1G0S A;  4NFX A;  2B06 A;  5I8U A;  3GG6 A;  3ZR0 A;  4S2Y A;  5HZX A;  5LPG A;  3A6T A;  2AZW A;  1MQE A;  5ANV A;  1F3Y A;  3O52 A;  1RYA A;  2DSC A;  2J8Q A;  1VHZ A;  1R67 A;  1KTG A;  2DUK A;  5ANW A;  5C7Q A;  1HX3 A;  1MK1 A;  3MDI A;  1SOI A;  1QVJ A;  1VIQ A;  3EES A;  3FCM A;  1NQY A;  3A6S A;  3HHJ A;  1SZ3 A;  4DYW A;  4J7H A;  3X0L A;  2DSD A;  2R5W A;  4KG3 A;  3N9U A;  5DPK A;  5CFI A;  1VIU A;  5ANT A;  1X84 A;  1XSB A;  2I8U A;  3BHO A;  3I7V A;  3DKU A;  2ICJ A;  3I7U A;  4ILQ A;  4C9X A;  1KT9 A;  1JRK A;  1G9Q A;  4ICK A;  3ACA A;  3O8S A;  3QSJ A;  2KDV A;  1PPV A;  3GRN A;  3Q2T A;  4JZS A;  3FFU A;  1GA7 A;  3CNG A;  5ANS A;  2A8P A;  3GWY A;  5GHQ A;  1U20 A;  5GHN A;  2A6T A;  2O1C A;  2QJT A;  5DDG A;  2JVB A;  3SMD A;  5GHM A;  2KDW A;  3X0P A;  3P6Y A;  3ID9 A;  3DUP A;  5FSM A;  4ZG0 A;  5GHJ A;  3AC9 A;  1K2E A;  4S2X A;  2GB5 A;  4S2W A;  1SU2 A;  2QJO A;  2RRK A;  1VHG A;  4V14 A;  5FSO A;  2YVN A;  3RH7 A;  3WHW A;  5BON A;  3FSP A;  1VCD A;  1VK6 A;  1XSA A;  3H95 A;  1V8W A;  3HYQ A;  3O69 A;  1V8T A;  2DHO A;  2CL3 A;  5C8L A;  1PPW A;  3X0O A;  3G0Q A;  1MR2 A;  1V8N A;  2I8T A;  2YYH A;  2Q9P A;  4KTB A;  4N1T A;  5GHO A;  3O6Z A;  4MPO A;  4HVY A;  3X0N A;  1V8M A;  3L85 A;  3X0J A;  3X0Q A;  4JZV A;  3EXQ A;  1HZT A;  1RRS A;  1NQZ A;  3Q4I A;  3MDG A;  1I9A A;  5DD4 A;  5BS6 A;  1V8U A;  1X83 A;  4C9W A;  5ISY A;  1VRL A;  1V8S A;  2O5F A;  3F13 A;  2ICK A;  3MCF A;  5DEQ A;  1NFZ A;  1V8I A;  1Q27 A;  2G73 A;  2O5W A;  3A6V A;  3EF5 A;  3SON A;  5IW4 A;  2A8S A;  4IJX A;  1XSC A;  2YVM A;  3OGA A;  1RRQ A;  5FSN A;  3P5T A;  2GT2 A;  3BM4 A;  4K6E A;  3X0K A;  1X51 A;  5FSK A;  3BAP A;  4YPH A;  2B2K A;  3A6U A;  1KHZ A;  4KG4 A;  4KYX A;  3GZ6 A;  1V8V A;  3Q93 A;  3Q91 A;  3GZ5 A;  2FKB A;  5IW5 A;  1V8L A;  1SJY A;  3KVH A;  1K26 A;  3ZR1 A;  2A8R A;  5FSI A;  2CZR A;  5FSL A;  2A8T A;  3I9X A;  1JKN A;  2VNP A;  3J7Y e;  4N1U A;  1MQW A;  3N77 A;  2A8Q A;  1Q33 A;  3X0S A;  3X0M A;  4J7G A;  2I6K A;  3MGM A;  2B0V A;  1PPX A;  3X0I A;  2G74 A;  1PUS A;  2FVV A;  3O61 A;  2PNY A;  4JZU A;  2VNQ A;  1OW2 A; 
#chains in the Genus database with same CATH homology
 4S2V A;  2XSQ A;  3COU A;  3U53 A;  2YVO A;  5C7T A;  1VC8 A;  3E57 A;  3R03 A;  1PUQ A;  1NFS A;  3X0R A;  3SHD A;  2W4E A;  2QKM B;  1MP2 A;  4YPR A;  1TUM A;  3EEU A;  4YOQ A;  3Q1P A;  3GZ8 A;  1VC9 A;  1Q54 A;  4HFQ A;  4JZT A;  5CFJ A;  2YVP A;  1PVF A;  5GHI A;  1MUT A;  1IRY A;  1V8R A;  3FJY A;  5ANU A;  2PQV A;  1V8Y A;  3FK9 A;  2FML A;  1PUN A;  2GT4 A;  5GHP A;  3F6A A;  4NFW A;  2DSB A;  3Q2S A;  1G0S A;  4NFX A;  2B06 A;  5I8U A;  3GG6 A;  3ZR0 A;  4S2Y A;  5HZX A;  5LPG A;  3A6T A;  2AZW A;  1MQE A;  5ANV A;  1F3Y A;  3O52 A;  1RYA A;  2DSC A;  2J8Q A;  1VHZ A;  1R67 A;  1KTG A;  2DUK A;  5ANW A;  5C7Q A;  1HX3 A;  1MK1 A;  3MDI A;  1SOI A;  1QVJ A;  1VIQ A;  3EES A;  3FCM A;  1NQY A;  3A6S A;  3HHJ A;  1SZ3 A;  4DYW A;  4J7H A;  3X0L A;  2DSD A;  2R5W A;  4KG3 A;  3N9U A;  5DPK A;  5CFI A;  1VIU A;  5ANT A;  1X84 A;  1XSB A;  2I8U A;  3BHO A;  3I7V A;  3DKU A;  2ICJ A;  3I7U A;  4ILQ A;  4C9X A;  1KT9 A;  1JRK A;  1G9Q A;  4ICK A;  3ACA A;  3O8S A;  3QSJ A;  2KDV A;  1PPV A;  3GRN A;  3Q2T A;  4JZS A;  3FFU A;  1GA7 A;  3CNG A;  5ANS A;  2A8P A;  3GWY A;  5GHQ A;  1U20 A;  5GHN A;  2A6T A;  2O1C A;  2QJT A;  5DDG A;  2JVB A;  3SMD A;  5GHM A;  2KDW A;  3X0P A;  3P6Y A;  3ID9 A;  3DUP A;  5FSM A;  4ZG0 A;  5GHJ A;  3AC9 A;  1K2E A;  4S2X A;  2GB5 A;  4S2W A;  1SU2 A;  2QJO A;  2RRK A;  1VHG A;  4V14 A;  5FSO A;  2YVN A;  3RH7 A;  3WHW A;  5BON A;  3FSP A;  1VCD A;  1VK6 A;  1XSA A;  3H95 A;  1V8W A;  3HYQ A;  3O69 A;  1V8T A;  2DHO A;  2CL3 A;  5C8L A;  1PPW A;  3X0O A;  3G0Q A;  1MR2 A;  1V8N A;  2I8T A;  2YYH A;  2Q9P A;  4KTB A;  4N1T A;  5GHO A;  3O6Z A;  4MPO A;  4HVY A;  3X0N A;  1V8M A;  3L85 A;  3X0J A;  3X0Q A;  4JZV A;  3EXQ A;  1HZT A;  1RRS A;  1NQZ A;  3Q4I A;  3MDG A;  1I9A A;  5DD4 A;  5BS6 A;  1V8U A;  1X83 A;  4C9W A;  5ISY A;  1VRL A;  1V8S A;  2O5F A;  3F13 A;  2ICK A;  3MCF A;  5DEQ A;  1NFZ A;  1V8I A;  1Q27 A;  2G73 A;  2O5W A;  3A6V A;  3EF5 A;  3SON A;  5IW4 A;  2A8S A;  4IJX A;  1XSC A;  2YVM A;  3OGA A;  1RRQ A;  5FSN A;  3P5T A;  2GT2 A;  3BM4 A;  4K6E A;  3X0K A;  1X51 A;  5FSK A;  3BAP A;  4YPH A;  2B2K A;  3A6U A;  1KHZ A;  4KG4 A;  4KYX A;  3GZ6 A;  1V8V A;  3Q93 A;  3Q91 A;  3GZ5 A;  2FKB A;  5IW5 A;  1V8L A;  1SJY A;  3KVH A;  1K26 A;  3ZR1 A;  2A8R A;  5FSI A;  2CZR A;  5FSL A;  2A8T A;  3I9X A;  1JKN A;  2VNP A;  3J7Y e;  4N1U A;  1MQW A;  3N77 A;  2A8Q A;  1Q33 A;  3X0S A;  3X0M A;  4J7G A;  2I6K A;  3MGM A;  2B0V A;  1PPX A;  3X0I A;  2G74 A;  1PUS A;  2FVV A;  3O61 A;  2PNY A;  4JZU A;  2VNQ A;  1OW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...