3Q3CA

Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with nad
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
295
structure length
294
Chain Sequence
KQIAFIGLGHMGAPMATNLLKAGYLLNVFDLVQSAVDGLVAAGASAARSARDAVQGADVVISMLPASQHVEGLYLDDGLLAHIAPGTLVLECSTIAPTSARKIHAAARERGLAMLDAPVSGGTAGAAAGTLTFMVGGDAEALEKARPLFEAMGRNIFHAGPDGAGQVAKVCNNQLLAVLMIGTAEAMALGVANGLEAKVLAEIMRRSSGGNWALEVYNPWPGVMENAPASRDYSGGFMAQLMAKDLGLAQEAAQASASSTPMGSLALSLYRLLLKQGYAERDFSVVQKLFDPTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Studies of Uncharacterized Protein PA0743 from Pseudomonas aeruginosa Revealed NAD+-dependent L-Serine Dehydrogenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Probable 3-hydroxyisobutyrate dehydrogenase
total genus 101
structure length 294
sequence length 295
ec nomenclature ec 1.1.1.387: L-serine 3-dehydrogenase (NAD(+)).
pdb deposition date 2010-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3q3cA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3q3cA01
1X1EA 5BSGA 5K6AC 4WLOA 1XIVA 4NFSA 4OOFA 3SLKA 4DIFA 3TZKA 4PZDA 4KQXA 3UFXA 1VM6A 2D0IA 2WWRA 1L7DA 3QSGA 3H5NA 4GSKA 4YAKA 4OL9A 1D4FA 2X9GA 2FR0A 2FN7A 1U3TA 4GKVA 4Q3CA 2WTBA 3STHA 4DC0A 4WEQA 2YDXA 2B36A 1V3UA 3ETEA 5JBIA 1P74A 2EWMA 4CM5A 5F3RA 1CYDA 1OFGA 3I1JA 1F12A 4L75A 4ZQHA 3G3EA 3TDKA 1C0IA 1EK6A 4CV3A 4E31A 1A9ZA 4GVLA 1BDMA 5ICMA 4OQYA 3VKVA 4FOSA 4YJFA 2X22A 1MG0A 2VRBA 1EVZA 4MDHA 3QWHA 3B6ZA 3GEDA 2C0CA 3GC6A 4PGFA 1ENZA 1E5LA 1GEEA 1NQTA 3COSA 3NX4A 1IHYA 4URFA 3NDIA 3JSAA 2OP1A 4JX8A 1XEAA 1U4OA 3OJLA 1R12A 4TVBA 1PU2A 4UAGA 3INRA 1FJHA 2AMFA 2POQX 3Q1LA 4CMHA 3OEYA 3NT5A 4UUOA 1YL6A 1HWYA 1NWCA 3F9IA 3BTVA 4XB2A 4CR7A 3AU9A 1PS9A 4A7PA 3E5MA 4RPLA 1Q2XA 5CG2A 1KEVA 3PRJA 4J6FA 4MVJA 5ILGA 5K0ZA 3CMMA 3DB2A 1GDHA 4IMRA 1GZ4A 5A9TA 1HDGO 4OHUA 3DMTC 3GK3A 3FBGA 5TX7A 4E5MA 4JQCA 2PZMA 2Y66A 5HS4A 1PJSA 4B7UA 3CEAA 3A9WA 3PDUA 5F1KA 3JYNA 4LK3A 1ZJYA 1B26A 4QX6A 4N18A 1PS8A 4YT8A 1NYTA 4J3FA 4GX5A 3KM0A 3G1UA 4YEDA 4CMEC 4BNXA 3S1LA 1DEHA 1XWFA 1N1EA 1E7MA 3BMOB 3OQ6A 2FSSA 1K89A 1IL0A 4ND5A 2V7PA 4E33A 1NVTA 4BO9A 1ZVMA 3WMWA 4YAEA 1PZEA 2A4KA 4I1IA 1A7KA 4ALNA 2XPCA 2J5KA 3G0OA 2BELA 1M6HA 1LC0A 2WE8A 2YQ5A 3NDRA 4J9UE 4AL4A 2Y1CA 4PG5A 1K0UA 5TT0A 5DULA 1XSEA 4R01A 4OJNA 5BSHA 4NU5A 5THQA 1LDGA 3P2OA 4N7RA 1HEUA 1PGJA 5TC4A 3F5QA 3DTYA 3L4SO 5AOVA 4DQXA 2C54A 1E6WA 1M2WA 4PLPA 2NVWA 5DOZA 5C5IA 4R1SA 1TVEA 5KIAA 3F3SA 4Z6KA 2O3SA 1O9BA 5AQ1A 2GLXA 1W73A 4ZU3A 1YOVA 2WYWA 5ER6A 3BHMA 2NLOA 5U9CA 3CSDA 4EW6A 2O2YA 5CDSA 1RJWA 4RVFA 5IF3A 2VT2A 4CUJA 5L95A 3U09A 4NFHA 3JYPA 2D4AA 5JSFA 4ZICA 1R0LA 1MP0A 1QYXA 2HMTA 4FJ0A 4OO3A 1A27A 4DUPA 4EUFA 3JQAA 1UXHA 4ND2A 3EW7A 4D46A 3BMCB 1WNTA 2JHFA 3WYCA 2V65A 1W0CA 4L9RA 3ZHBA 5KJ6A 5L4SA 4Z9XA 1VJ1A 5ES3A 4A2CA 2DPHA 2NQ8A 3JV7A 4WLVA 4AVYA 1I36A 3JQ8B 3GHYA 3L6DA 2PZLA 2X23A 2J3JA 4LMRA 3PHGA 2C7VA 4UVDA 1TT7A 5LDGA 5EQFA 2P9GA 3R3SA 3CZRA 1MA0A 4GMFA 1K6IA 4A03A 1D7OA 1NPTO 4ND4A 1B8VA 4H3VA 1KVUA 4BKUA 2P4QA 4II3A 1E6EA 2GNAA 5DCUA 4AJEA 4XZ3A 4FD3A 1PJTA 2OXIA 5GZ1A 3LLVA 1LNQA 2GPTA 1I0ZA 3P7MA 4Y9DA 3QIVA 1YL7A 1NQAO 1TEHA 3W8EA 2HU2A 2PLAA 3GVXA 3ONEA 2X0JA 2D3TA 1WZIA 3BTSA 1BTOA 4YJGA 2FHSA 1GPDG 3V8BA 2DQ4A 2P68A 4HBGA 3F4BA 1ONOA 1EFKA 1DJNA 2G1UA 3PJEA 2CF6A 3CMCO 4UVHA 1LQTA 2HK8A 5FFFA 4E6PA 2W8ZA 2X5KO 2PH3A 2VZ0A 1T24A 4HNHA 4LN1A 1EDZA 2O3UA 5EL0A 3WSWA 3AUAA 3BAZA 3AY7A 3GF4A 3R1IA 3ZW8A 2GN6A 4QEDA 4II2A 4XDZA 1X7GA 3WGTA 3ZGYA 1UAYA 4P22A 5IZCA 3WDSA 1A4UA 1KVTA 3W4KA 2BFMA 4I5FA 1C1DA 5A4DA 2YFQA 1N7HA 2B4TO 3LT1A 9LDBA 5JNLA 3CIFA 2DUUA 1OC2A 2D5CA 3WS7A 2WE7A 3DONA 2J5RA 2YHUA 4FFOA 2AQKA 1XDWA 4LW8A 3SXPA 4CQMD 2V6FA 1R4MA 4CM8A 1ENOA 1SNYA 5IXSA 1LDYA 4DBVO 1G1AA 1GD1O 4R3WA 1LC3A 2CVQA 1T26A 3ZU3A 4Z0TA 4I9HA 1H93A 1B2LA 2JHGA 5BR7A 3LC1O 4XJSA 4B79A 3DO5A 3UUWA 4E0BA 4IUYA 4MVJF 5L40A 1B3BA 2DC1A 2QYTA 3GDOA 3GLQA 1GU7A 2B0JA 4FFMA 2VWQA 1JWBB 2EKQA 1CDOA 4TWRA 5JYDA 2X5JO 5JCJA 1MV8A 5DNAA 3JD4A 3ZU4A 1HDCA 2GYYA 1GCOA 3BMCA 3GFBA 3ZNOA 4DTIA 4JNKA 4NFYA 3MZ0A 4Y67A 1ZNQO 3F1KA 4WASA 1UZNA 3WXBA 1E6UA 1LRKA 2Z1MA 3NJ4A 2HJSA 5I7VA 1ADGA 3MOGA 4XGNA 3FF4A 4CV2A 1M75A 3KEOA 2B5VA 4NQZA 4RO0A 2OHXA 4E2YA 4L76A 3IL2A 2GN4A 4PLCA 4WLUA 4YQYA 2WMDA 4IXTA 3E5RA 3BMNA 5KOIA 5L7WA 1P77A 3VZRA 4ZA2A 2GO1A 1EDOA 3DOJA 4NBWA 1GADO 4FGWA 1ADBA 4DLAA 5DN9A 1WVGA 1E77A 2Y1OA 3RVDA 1R4NB 1AXEA 1W8DA 1E7SA 4FBGA 5DT9A 3DZBA 5AXBA 1EZ4A 2ZCUA 3ZH2A 3VOSA 4MP8A 3JQAD 2AG8A 4BMNA 2F00A 2HCTA 4HUJA 3AI1A 1KC3A 4EJ6A 5C7LO 4TRNA 1O95A 3JQ6A 5JDCA 3DZJA 4XB1A 3QVXA 5JMWA 3DC2A 1CF2O 4GL4A 3RASA 4DXHA 4NBUA 4B4VA 5A1TA 2ZB8A 4KTVE 4Q3AA 4AFNA 3LT2A 1HYHA 4FS3A 3T4XA 4JXKA 3IMFA 4CQMA 1JN0A 3QLJA 1GV0A 2JFGA 1KVSA 1FDSA 1Z75A 1KYQA 3OEWA 1BXGA 3ROQA 4ITUA 3I52A 2JJYA 3ENNA 3WLFA 3ADPA 4OQZA 2BFOA 2YV1A 3ZWNA 2PKRA 1N8KA 4E5KA 5DF1A 1GUZA 1WMAA 3IJRA 4U0JA 2C2YA 3AM4A 5JLAA 4R1UA 5KCZA 4IXWA 4E5PA 2ILTA 1GUFA 3TF5A 1RM3A 3F4LA 3HB5X 2IRWA 1AXGA 2X0IA 2NVUB 1ULSA 3TZHA 4AG3A 3FWNA 4XKJA 5JO0A 3AJRA 3DXFA 3IP1A 1P31A 1I24A 2Y05A 1F14A 5A9SB 1FDTA 3JQ9A 2JCYA 2P2SA 3RUFA 3ONFA 1Y7TA 3HUDA 2R6JA 3PZBA 4TKMA 4WCFA 3AK4A 4RVSA 3GVIA 3BYZA 5AXDA 4LVUA 3JD2A 3MJEA 1MC4A 4BKOA 1BWSA 3F1LA 4FGSA 5AXCA 3H9QA 2BD0A 3PP8A 2FOIA 1ZXBA 2QHXA 1FDWA 3AU8A 1DIAA 1T2AA 4RF4A 1ZKMA 4PG6A 1LLUA 4ROSA 5GZ3A 1C0KA 1K6XA 2IXBA 4KUHA 5FI3A 1NQ5A 1VJ0A 3KLMX 5DZSA 1Q0LA 1HF3A 4BL5A 3VC7A 2HQ1A 4RVHA 1QR6A 3RUIA 2UUOA 1X14A 4YXFA 2DBVO 1G0OA 4FFLA 4BS9A 1EVYA 2BHLA 2DT5A 3OP4A 1UZLA 3O03A 2EGGA 2GR9A 4WEOA 1ZSYA 1GZ3A 1SMKA 3IP3A 4MO2A 5IZ4A 4K6FA 1FK8A 4JGBA 5L4NA 1P1IA 1PL6A 2HKIA 3FNEA 3INTA 4OKIA 1PJ2A 5JPIA 1I8TA 1T2CA 4D0SA 3KRTA 1HT0A 3TWOA 4J16A 2I65A 4BNJA 5K9ZA 4L4SA 2C5AA 3JCZA 3ZWYA 3WTBA 2RHRA 4BGEA 5KJFA 5KTKA 2O7QA 2J6IA 4ZRMA 2I76A 1P1RA 3Q0EA 4I5GA 4IJWA 1S6YA 2D2IA 2FWMX 2VWHA 3PJDA 4Z0HO 5ITWA 4S3MA 4IINA 2HSDA 1J4AA 4WOJA 1GCUA 3CPSA 4QTZA 3AI3A 2WD7A 4J7XA 2NADA 2A92A 5JDIC 3DMTA 4YRAA 4BO7A 5TLSA 3AUTA 2Q1WA 4KUEA 4Y98A 2IYOA 1E7RA 3VTZA 2I3GA 2VT3A 3GVCA 3KYCA 4AJ2A 1BXGB 2C20A 4GLLA 4CUZA 2B4QA 2I66A 1GYQA 1ISJA 3NEPX 3QA9A 5I9MA 3LF2A 5FEUA 2YHIA 1SB9A 1C0PA 2IXAA 4EUHA 4FQ8A 4BKQA 3GVPA 1YE3A 3WGYA 3AUUA 3O38A 4OMUA 1HE5A 2HMSA 4PVDA 4EI2A 4PIVA 4IS2A 2ZYGA 3Q2KA 4D45A 3GG9A 1DIGA 4RPHA 1WPQA 1PS0A 4Y6SA 1JVSA 3E9QA 4L0QA 2LDBA 1PQUA 3FPCA 1XELA 1YS4A 3PI7A 4RDHA 4Z9YA 1E3IA 5H81A 1E7QA 4QQRA 1BRMA 4X54A 4KTTE 4BVAA 4S1VA 3BA1A 3I9KA 3V1YA 4J2OA 4ALIA 1E5QA 3WX0A 1QLJA 4KWIA 3SC6A 1Y1PA 3JTMA 2IZ1A 3OM9A 5KVCA 1MGOA 2RH8A 3UW3A 3MTJA 1ONNA 5B4UA 3WFJA 1PGPA 2O3TA 2VN8A 4E12A 2V6BA 2PD3A 4MVJE 3LYLA 1H6AA 4R4JA 3VVCA 1MLDA 3TL2A 3HFSA 4W6ZA 5IG2A 2PGLA 1NHWA 2PGJA 1QYDA 3ZDFA 3ZI0A 1HDYA 4Y6PA 5IDXA 4ZQGA 3CTVA 2VRCD 4CM3A 2CVZA 2P91A 4F45A 2H5LA 1YRLA 1RM5A 2QYSA 1RYDA 3K2BA 5CEFA 2IZ0A 4ZN6A 1PTJA 2JKVA 1XU9A 3RFVA 3VPGA 1XCBA 3OQ1A 1H0KA 3HG7A 3ANNA 3H65A 4RZIA 4DPMA 3RUDA 2QRLA 4LRSB 3W4JA 4L4RA 2BKAA 4BNMA 1Y9EA 4E3ZA 1VL0A 3KLPX 1HTBA 4O59O 1KS9A 2VHZA 3KHUA 3FR7A 3SEFA 4WGGA 4UEJA 1XQ6A 1ZK4A 4J2HA 4A0SA 3AM5A 1NR1A 5L51A 5G0VA 3FNHA 4J91A 3VZQA 3TL3A 1TLTA 5G2OA 5G0WA 3JQFA 4H16A 3VPHA 1H5QA 2GDZA 3MTGA 4TSKA 2HAEA 4Y6RA 4BMVA 1SOWA 2B5WA 2PKQP 2ZYDA 1CQIA 4RF3A 3DR3A 1ONPA 2FR1A 4ZQFA 4BB5A 1PGOA 5JAZA 2XAAA 1OBFO 4CMGA 3TFOA 1KEWA 5LDHA 3PVZA 3U4DA 5DP2A 5F5NA 1EBFA 2PD6A 4R54A 5L45A 4XQ9A 4CL8A 4R41A 3WNVA 3DBHB 4CLHA 3MJTA 4BNKA 1R6DA 1V9LA 3IUPA 4QXMA 5IDYA 3RD5A 4RQUA 4NPCA 2I3AA 1H6BA 4MINA 4YTEA 1Q7CA 3ULKA 2GSDA 1B0AA 2Q1TA 4AJPA 3WGHA 4CM8B 1KETA 3ORFA 5T8KA 1DRUA 1Z73A 4HP8A 4N54A 3RC1A 3W8DA 3MJVA 5TT1A 3WYBA 4JP2A 2X8LA 2QW8A 4HFNA 1VE9A 4M87A 5CAEA 1DC5A 4MKXA 4ZGWA 1D3AA 4W9NC 5TRTA 3GY0A 1UXIA 1GYPA 5JC1A 3ZV4A 5I9LA 1Y5MA 3PHHA 1YVEI 4CM4A 5CPFA 2BLLA 3G49A 5CFZA 1PGNA 4J4HA 1U28A 1U3UA 3FWZA 3IKVA 4XRGA 3O8QB 3K92A 4RF5A 4BGUA 1N5DA 3EZYA 2Y0CA 4GVXA 4XGKA 1U9JA 4A5OA 3M6IA 2EHDA 2Z1NA 1TXGA 5A04A 1JAYA 3PGXA 3RKUA 1Y81A 2CZCA 4UREA 4OKNA 5L53A 2QX7A 2E6UX 1PL8A 2P4HX 5CDUA 4I08A 1IUKA 3CUKA 3BTUA 3BMNB 4WE3A 1LA2A 4A10A 4IS3A 4CLOB 1GAEO 4DPKA 2ZQZA 1TB4A 2Y0DA 2ZCVA 4BQRA 3V1UA 3RC2A 3VAZA 3UF0A 3VPXA 1CEQA 2W2LA 4M49A 2B83A 3TOZA 2C5EA 2JD2A 4AJHA 5ENDA 1DJQA 1OMOA 1X0XA 2OORA 4DWVA 4D3DA 2YZ7A 1DC4A 3NTOA 5B4TA 2DBQA 1D8AA 5GZ6A 3X2EA 4CODB 2AEMA 3PZRA 2X0RA 2UDPA 1I10A 3U62A 4UULA 3T7EA 2B4RO 3HFGA 2PZKA 1B8PA 2A9FA 1NNUA 1Z7EA 3DZKA 3HNPA 1ISIA 1MX3A 4PLZA 3AY3A 1I5RA 4EBFA 1WMBA 3BXXA 1YONA 4M8SA 5H82A 1ISHA 2HJRA 3FTPA 3JQEA 1P0FA 4CQMB 3JD3A 2GERA 2NU9A 3IS3A 3UOGA 4NG5A 2HMUA 1SAYA 1OC4A 2PD4A 3LC7O 4XIYA 5C3MA 1YXMA 4E13A 3SJ7A 1P9LA 2AQIA 1DPGA 4E2WA 1BW9B 1ZFNA 2ZJ0A 5I9NA 5EQDA 3FHLA 1BDBA 1GFSA 4MVJD 1DRVA 4D3SA 5T64A 3I4FA 4IJUA 3PPIA 2VYVD 4ND3A 4CM1A 1UUFA 3AOEA 3RU9A 4FFPA 1Q1NA 1NPYA 3PFWO 4WCDA 2DU8A 3RC9A 2W98A 2Y1DA 4H7PA 3Q9UA 2J5QA 3RAJA 4GAEA 1VLLA 3KBOA 3H9UA 4UUNA 1KEPA 1HKUA 2VWPA 1OAAA 3JQ7B 4PLTA 1ZSVA 3KXDA 4TZKA 3PYLA 3ZWVA 4YBZA 2E4AA 2X0NA 5BNFA 2BGKA 2PK3A 4R51A 1C3VA 4XRRA 1DXYA 4A73A 1Q0QA 1GY8A 1EK5A 4I5EA 7ADHA 3KSDO 3BMQA 3GT0A 4NBRA 4FJ1A 3KB6A 4XDYA 4BNZA 4KP7A 1UDBA 2CDAA 1C1DB 1H9BA 1AUPA 3I9OA 4EUEA 1GQQA 1IPFA 4Q3BA 1LDNA 1Z82A 3PJGA 3EDMA 1ISMA 2VUSA 1R16A 3ZWXA 4MP3A 1LLDA 4NU6A 5JE8A 3RUAA 4RJTA 2EERA 3O8QA 4CLRA 1JKFA 3TPCA 4ALLA 5IFLA 2VRCA 5EESA 3VH1A 1QYCA 1VKOA 4FFNA 3TSCA 1LBEA 5DP1A 1FMCA 5CEJA 4B7CA 4CLXA 1DOHA 3ZHXA 2HK9A 4IZHA 5HTOA 1NFRA 4XEHA 1T1SA 3C8MA 4TRMA 3RFXA 1NX6A 4RGBA 2ZQYA 3DBHA 4BNGA 3BZUA 2ZTLA 4B8ZA 1OZAA 2W2KA 1DIHA 3EYWA 1RPNA 2GN8A 4JCOA 1HDXA 1V8BA 2ET6A 2IZZA 1YO6A 3CZMA 3WJ7A 3H4VA 4HKTA 1V3TA 2VNSA 4G5HA 4NDNE 2YW9A 2NNLD 1E7YA 2ZYAA 1ZK3A 4PCVA 3C7DB 2VWGA 4J90A 4G65A 5KVVA 1N9GB 4UUPA 3GQVA 4M89A 4YCAA 2AA3A 3MJCA 1FXSA 1QRRA 3SJUA 4J9VA 3V2HA 3BIOA 4PG4A 3K6JA 1Y8QA 1GR0A 4RPKA 4WNCA 3GR6A 5G4KB 4MKRA 3IUSA 2VTEA 4MP6A 4FC6A 1YBMA 3U3XA 2O3JA 1IZ9A 1YJ8A 2GGSA 3EC7A 3K73O 4GX1A 3AM3A 1PEDA 1WXDA 4XYGA 3JQAB 3DDNA 3I6IA 4M54A 2H1SA 2FMUA 4R1NA 1U8XX 3CTMA 1A7AA 2QRKA 3ROKA 3ZCXA 1H2BA 3ROPA 1BGVA 1UDAA 4GPD1 3V2GA 2FP4A 4E32A 1K3TA 5C7IO 4TKLA 3D3WB 4K9DA 4QECA 3GNSA 1GTMA 5ILOA 4BUCA 3LF1A 3LSYA 4ZRNA 3JQGA 3DOOA 3C85A 1YKFA 3EK2A 4Y8VA 4BNFA 3F46A 3GVHA 5I8ZA 4BO8A 5AYVA 1WDLA 2XF8A 1I3NA 4RPJA 1TT5B 3MEQA 1W6UA 4L74A 1UDCA 9LDTA 2ZB3A 1WDMA 3ROMA 1QYWA 1CWUA 2VTDA 3OIDA 4BNVA 5I7SA 2IDZA 3V5NA 1JA9A 4A26A 2AEFA 3B1FA 5KVSA 1AN9A 1M6WA 3UXYA 3P2YA 4MVJI 1NVGA 4AICA 3JQDA 4PN3A 4E2ZA 3PWKA 3RU7A 3PQDA 1LDMA 3UCFA 3HQ4O 1NPDA 3WIDA 4MIOA 1C0LA 1DHRA 2JL1A 5ENVA 3ZNNA 5JXWA 4L4XA 1JVBA 4QFDA 1A71A 3INGA 4YAIA 1IHXA 5U4QA 4XYEA 4QT0A 1IULA 1T2EA 1VPDA 3GEGA 4DYVA 1X7DA 1O94A 1H2HA 1B16A 1LXCA 4DQVA 3ANMA 4I9UA 1ZXLA 2CUKA 3GZ4A 1P45A 3K31A 4HFMA 2AEJA 1AE1A 4DIOA 3GPIA 1UZMA 3EGOA 4Q39A 1MXFA 4IY1A 3CKYA 2DBRA 2FPPA 5A02A 2B37A 3NGLA 2QIOA 3AW9A 3F5SA 2VNAA 5I8WA 5A3VA 3GAFA 4QFCA 3N58A 4INAA 3ZHYA 2JCXA 3MWDB 1UXKA 5L3ZA 1E3WB 2OMEA 1KVRA 1N9GA 4AJ1A 2NWQA 3RKRA 3HZZA 3OIFA 4I5DA 4BNNA 4TROA 1CJCA 1UJMA 3OFSA 5TGDA 5TJHA 4HV4A 1ZO8A 3BMQB 4DMLA 1Y8QB 3MOIA 1O5IA 4CLDA 1SC6A 5IZCC 4O63O 3H3JA 2OOSA 3WOHA 1PJBA 3KO8A 3OHSX 3RBZA 2X7HA 3ASVA 2NVBA 4LGVA 2RHCA 1HSOA 5ER9A 3K30A 2PNFA 1C14A 5EMHA 4MIEA 3NV9A 3DAGA 1G6KA 1D1TA 3KETA 5DCWA 1VL8A 1E3EA 1DB3A 1N92A 2IEBA 3K2EA 4EDFA 5KJ1A 1EUZA 4AJIA 2VCYA 3JQFC 3M2PA 5C37A 1YBVA 4WJZA 4PLGA 1NHGA 1N2SA 1PX0A 1LU9A 2C2XA 4GQAA 3L07A 4GH5A 3I5MA 3ZN2A 3B20A 3ZWPA 2BFAA 2AQ8A 4UUMA 4C7JA 1KBZA 3I9JA 2EGHA 5TNXA 4JBIA 3AFNA 2PZJA 3AOGA 3RUHA 5U1PA 2YHIB 2W2LD 2I5PO 4NK4A 4BNHA 3IIEA 5LC1A 1ZH8A 3PLNA 3ADOA 2DM6A 1T2DA 4IJVA 4AJKA 3P19A 2EJWA 1ENPA 4R9SA 4CLOA 3I23A 1NQOA 2UV8A 3OQBA 1HETA 3L6EA 1X7HA 4P4GA 3VDRA 3KV3O 3PLRA 5CHEA 1TI7A 3GMDA 4D44A 4RF2A 1QG6A 1HZJA 4MVJH 5DBFA 1PJ3A 3U0BA 3X2FA 5GMOA 3UGKA 1CQJA 5JCXA 2VYVA 4W99A 1BSVA 1R15A 1IB6A 3P5SA 3IC5A 1YB4A 1UP4A 3DTTA 4YB8A 4AJNA 2HMWA 1T1RA 6LDHA 4ALKA 1R0KA 2OBNA 2X4GA 4FPXA 4ZD6A 3S2FA 3ZV6A 3DHNA 2OL4A 1Q7GA 1K5HA 3EZLA 3D1LA 3TRIA 3QQPA 3B70A 1SEVA 1T4DA 5KJEA 4Q9NA 3VH3A 1Z6ZA 1QORA 2EF1A 3V2UA 1F0YA 1EEHA 1I3KA 3OF2A 2J3HA 3ETGA 3JQBA 3QWBA 4YDRA 1KEUA 1IYZA 1EFLA 4E21A 1PGQA 4IGFA 4LMPA 1HL3A 4U6QA 2H9IA 4B3IA 3EVNA 3M2TA 3PTZA 3ZWWA 3GZNB 5JY1A 3WR5A 4J7UA 5JW6A 3CXRA 4R9RA 4WCFB 3PWZA 1HE2A 4XQEA 1ADCA 4G2NA 3JQBC 2XXJA 3B1JA 4QO8A 3FSRA 4Q3EA 4BO0A 3K96A 5T6BA 4OH1A 5THKA 3S2GA 2A35A 4C7KA 3ICCA 3LK7A 1UXGA 2NUAA 2QZ9A 3VDQA 3PDJA 1AHHA 5L9AA 2JFHA 1PJQA 3JQ7A 4PFJA 1NTOA 4R5MA 3WNQA 1GEGA 3TQHA 2G0TA 3WQRA 1RM0A 4P4NA 1ZCJA 2AE2A 1B8UA 4XIJA 4KDEA 2QQ5A 1XR3A 4WUVA 4U8GA 3LQFA 3FBTA 2NU8A 4NJMA 3FPLA 3RC7A 3ZZNA 4XYLA 1DIBA 4NMHA 3R6DA 1ZMOA 4CPDA 2ZTUA 3QVWA 4RCVA 3UAGA 4IDCA 2ZJ1A 1U8FO 3C3XA 1EUDA 2BI7A 3WSVA 4L8VA 3PFFA 3ZWOA 3RUEA 3DBLB 1UH5A 4FR5A 2J8ZA 4MVJP 3H9EO 2HRZA 3L4BA 1HXHA 4FOOA 1LEHA 4KZPA 4CLRB 3GDGA 3ZU5A 3HWRA 4HNGA 3DFUA 4WNIA 4YT4A 5IAAA 3D5QA 3KTDA 3GA0A 4MOWA 2HO5A 4MVJG 3OA2A 1M67A 4OYRA 3C1TA 3HDYA 4F46A 1LI4A 3WJAA 4CQLA 3FRJA 2FR8A 3D3EA 2Y1GA 3RBVA 3C1AA 2VOEA 1T2FA 2ZKLA 4KOAA 2EW8A 2ZB7A 4BNUA 3ZWCA 4AJLA 2O2SA 4LCJA 2E37A 1AHIA 3WQQA 4W7HA 5TQVA 4GWKA 2CDCA 1GPJA 3TZQA 2DBZA 2FSVA 3ZV3A 1X0VA 4B3JA 4MKZA 3KYCB 4B3HA 1NR7A 2Q1UA 4NK5A 4CMIA 4J0FA 5L7TA 2OFPA 3VPFA 2JAPA 2Y1EA 1BXZA 2P9CA 1JWAB 1NAIA 2W2KB 1R4NA 1B7GO 1VC2A 3E18A 3ASUA 3KVOA 2VZ8A 3GGGA 4P8RA 3FNGA 3VVBA 1DLIA 4IDDA 2UVDA 4CM6A 1EQUA 1LLCA 3L4BC 1DLJA 1DSSG 1QMGA 2X9VA 1MFPA 2Q3EA 3Q9NA 2XOXA 2AE1A 4IM7A 3D4NA 3GOHA 2PY6A 1DO8A 3G1TA 1I32A 3DZIA 2E49A 1AGNA 3KYBA 4NZ9A 1SEPA 1HDRA 4GX2A 2F1KA 1VSVA 1CETA 1DAPA 1EVIA 1O6ZA 4HX5A 4BNLA 4E5NA 2Q2WA 4IGEA 2HLPA 3QJ5A 4FFRA 1U3WA 1LSUA 3ONDA 4IMPA 4EJMA 1GZ6A 2O3QA 3DAFA 4XQCA 4RVGA 1HLPA 3U4CA 2V6MA 3QWAA 3BHJA 1YDEA 3WIEA 4ESOA 1Y8RA 4IBOA 2O4CA 1QSGA 4GSLA 4R16A 1U2GA 2EP5A 1A5ZA 3ZV5A 1LRLA 3OJFA 1I2ZA 4Z3KA 1JW9B 1YQGA 3H5RA 3Q2IA 3D3WA 5F21A 5B4VA 4YRDA 5KKCA 3FCOA 1SB8A 4K26A 3A06A 3OH8A 1PQPA 2ZK7A 5T57A 2VOJA 4GMGA 3MWEB 5TF4A 1J6UA 4UVEA 3EVTA 1P44A 4RQTA 1HYEA 1TT5A 1A72A 2C07A 3ETDA 2UUPA 3QWFA 4I8XA 2JAHA 1DIRA 3GUYA 4L73A 1M66A 4XCVA 2TMDA 4DVJA 2HRBA 2VUTA 3RWBA 1ZEJA 3QV1A 4DL9A 3PXXA 5EINA 3HB4X 2GZ1A 2B69A 4D3FA 2EG9A 3WYEA 3UH1A 4ZQBA 3D7LA 2PA3A 1Q7BA 4HWKA 3H9JA 5DBGA 4E5YA 4BGIA 2YY7A 3PIIA 1XKQA 1YGYA 2Q1SA 4J4BA 1Y6JA 3K8ZA 5BT9A 4EEXA 5BNTA 1TA4A 4YA6A 1CIVA 4OXNA 1E3JA 2IE0A 3NRCA 3NT2A 4QO7A 3QW2A 1CERA 3WBBA 1G0NA 1NWHA 3KSZO 1Z45A 1BVUA 5TS3A 4YJGB 4YAJA 4JP3A 4J1NA 1LJ8A 3H9GA 5COBA 3UCXA 3I9NA 1E3LA 4BHTA 5JDCC 2BGMA 2EV9A 2O48X 2EEZA 3RIHA 2Y99A 3K5PA 2NU7A 2V6GA 4M86A 3RROA 5KWEA 3D4OA 5A03A 4OXYA 4BKRA 4PRLA 1DFGA 1CRWG 4CMJA 2YFHA 4BIIA 3H2ZA 1EE9A 3D4PA 2X6TA 1GQYA 2Q4EA 3PHIA 3C1OA 5HBRA 1QLHA 1PJ4A 3H2SA 3IDSA 5A9SA 3NYWA 4CV1A 5JC8A 4YT2A 3GFGA 5T5QA 4JJIA 5GY7A 2EP7A 1PWXA 4J43A 4P4LA 4B4OA 2Y0EA 1HDOA 3AI2A 1E3WA 1YDWA 1ZSNA 1WW8A 4J7CA 4EJ0A 5A5FA 2WD7B 2NQTA 3KYDB 3DBLA 1DHTA 3UICA 2BI8A 4JLWA 3KOUA 2GZ2A 4R68A 1ZEMA 4WCFC 1WP4A 4JJFA 2E48A 4BO2A 5JY6A 2OGUA 1PR3A 1ARZA 4YR9A 4F3YA 1GYRA 1QKIA 2NV6A 4NBVA 3ITDA 4LCEA 3KEQA 2AW5A 3B1KA 4ILKA 3SBOA 1DFHA 1I2BA 3GN1A 4WLEA 3GAZA 2BFPA 4ONEA 2EKLA 5T8KC 4WK6A 4E4YA 3HDJA 2CD9A 1YB1A 2Q99A 3ZNQA 1EE2A 1F17A 4RL6A 3GDFA 3I9MA 4JBGA 2AG5A 4WLFA 5G0SA 2AQHA 3DZGA 3ANLA 4CUKA 5DCYA 1XG5A 3DHEA 4R5HA 4OIMA 3JQ9C 3QVTA 4J1TA 4CR6A 1SCUA 2Y67A 2UYYA 1ENYA 5KKAA 4JIGA 4HXYA 1ISGA 3O4RA 2ZTMA 5IDWA 3D64A 1HZZA 2JD0A 4HY3A 3L6OO 2QRJA 2SCUA 4FSHA 4J0EA 5BQFA 1F8FA 2PWZA 1GUYA 5FYDA 2IEDA 3R3JA 1P1FA 4J1QA 3LT0A 3WBFA 5B12A 2BMAA 2NVUA 4WOKA 4BV9A 4DBZA 3A14A 2X5OA 1VKNA 3MJSA 4LVCA 4QUKA 3VH4A 3WLEA 1DRWA 4BQPA 5CDYA 3LT4A 1E1LA 1DDOA 4K6CA 3I4CA 5CPBA 3H5AA 3GG2A 1KC1A 5JAQA 1JAXA 4B7XA 4E2XA 1XA0A 2GCGA 3M1LA 1RM4A 3SLGA 4B4WA 1W4ZA 5LCXA 1U3VA 2BGLA 5HM8A 1ZMTA 4R3NA 4LISA 3BTOA 3UKOA 4DPLA 2W4QA 4DMMA 3RCBA 5CEEA 4IIVA 1NVMB 1QV6A 1RYEA 4H15A 2DAPA 3DZHA 3NKLA 3OMLA 4UEKA 4BO3A 5IJZA 3WFIA 3MJ4A 1IPEA 4IQ0A 4PRKA 5JO9A 1PSDA 3WTCA 2J3IA 1J49A 2X9NA 3A4VA 4XX0A 3S2EA 3U4IA 2OBYA 3W8FA 1X13A 2DUWA 1FDVA 5J23A 3DEYX 4W4TA 3WGOA 3KUXA 3PEFA 3IKTA 4CM9A 1UP6A 4GI2A 4F6LA 2R00A 1Y8RB 2YQ4A 2D59A 3PJFA 1O8CA 2VHWA 1Z74A 3H7AA 3PK0A 1HE3A 3GZNA 1A4IA 1NAHA 1LDBA 4DC1A 4U5QA 3TNLA 5JFOA 1PL7A 3A28A 2OUIA 3QHAA 2LDXA 4ZHSA 1KY4A 3IAHA 3LC2O 3GRPA 4IIUA 3L9XA 1J5PA 1MB4A 3L77A 3PWSA 4RORA 1VL6A 4XGIA 2DVMA 3LU1A 4G81A 3FR8A 5HWSA 3PYXA 4TMFA 4BGVA 1LDEA 2GASA 3U49A 4U6SA 2NSDA 4CMEA 1B3RA 1NXQA 5DBIA 2I9PA 2P5YA 3G17A 5A9RA 2JFFA 2DPGA 4HFRA 2R2GA 4RLHA 5CDGA 4YACA 3GUCA 2HMVA 1LSSA 5IXYA 2P9EA 3KSUA 4MJLA 3NUGA 3FD8A 3GH3A 2ZATA 4BNYA 1E7WA 4RLSA 3HDHA 1S7CA 2DFDA 4EZBA 4N5MA 1JQBA 3SC4A 2NTNA 5AVOA 4IZIA 1R0SA 1OOEA 3UN1A 1E92A 1NASA 3AFMA 4NR0A 2OZPA 1YBAA 1FF9A 2EXXA 1KERA 5MDHA 1U2DA 1E3SA 1HSZA 5KJCA 3OA0A 4CMAA 2Q4BA 4XD2A 3HDQA 4YJHB 3K9QO 1ZW1A 3DMYA 1IY8A 4WPGA 1PQWA 2CDBA 2Z5LA 3W6ZA 1PZHA 3HHPA 4OXKA 1SPXA 5G4LA 2G17A 2WYUA 3OIGA 1GV1A 4NH4A 1KOLA 4CV0A 2CF5A 3IQDB 1PJCA 4D43A 4D0RA 4KDFA 1LX6A 5IN4A 5KNLA 4BO6A 4WECA 1YL5A 3TOXA 4A27A 2P5UA 3NGXA 1HDZA 2X58A 3O9ZA 2H6EA 3TZCA 4LRTB 3OECA 2EW2A 1R4MB 1T4BA 3CH6A 3DOCA 1UP7A 4CQLB 4NJOA 2DTXA 1ZK0A 2HUNA 1LLQA 4BO4A 2DKNA 1WAMA 4PLWA 5I7EA 1L7EA 4YQZA 3WWZA 4FW8A 3JYQA 4PLHA 4PLFA 5EJ2A 4YRBA 3WGIA 5BSFA 1I2CA 1I30A 1QXSA 5A05A 1I33A 4EITA 4U7WA 1JU9A 5JMPA 3TZ6A 1N1GA 3H3FA 3E9NA 3ON5A 3QE3A 1WDKA 4CMIB 3GMSA 2G82A 3WGGA 2RCYA 2Y68A 1O0SA 3G79A 4FDAA 3U5TA 1B14A 4TVOA 2YV2A 4F6CA 1ZJZA 4R69A 2D1YA 5L4LA 4BKPA 1PZGA 4TQGA 5DOVA 1U4SA 1QV7A 4YT5A 1R37A 3E82A 1ZZEA 3DZFA 1I3LA 1U7HA 2Q50A 4XA8A 3OJOA 4LSWA 4PVCA 1XQ1A 4E30A 3D0OA 3GGOA 3GGPA 4M55A 1A9YA 1YJQA 5FF9A 3S55A 3C24A 3N7UA 4FC7A 1GQ2A 4RZHA 1MG5A 4NIMA 3ZNPA 2IODA 2NTJA 1H6DA 3L0DA 4M1QA 5K6AA 1L1FA 1VSUA 1EBUA 3DFZA 5FWNA 3UHAA 1VJTA 3ENKA 4FB5A 2C82A 1LQUA 3DL2A 2R00C 2ZTVA 3WGZA 2NU6A 1ISFA 3EHEA 2C29D 5ICSA 2HDHA 5HRUA 2VHYA 4Q3NA 4W9NA 2DLDA 1U1IA 1WLYA 3UVEA 3I9LA 2CSUA 1J0XO 2QG4A 4YJDA 4J4TA 3VH2A 5COAA 3ITKA 2I99A 1YQXA 1B15A 2GRAA 1KVQA 3HE3A 5JAMA 2Y1FA 1YH3A 3NDJA 3QRWA 4BOYA 1UAGA 5BNIA 3KZVA 2O50A 2WDZA 3NTQA 3VZSA 3C7AA 1ZK1A 3DBRB 4CM9D 3JYOA 3RJ5A 4C4OA 1SBYA 1V3VA 5CP8A 4Q3DA 3NTRA 4YVFA 4TZTA 4BB6A 5IDQA 3Q11A 3PIDA 4RV9A 4IDFA 2VUUA 4XYBA 1YB5A 2AHRA 4KQWA 4XJTA 2OO5A 2PKQO 5A5EA 3HJAA 2VHVA 1HE4A 3QVSA 3DBVO 4GGPA 2AXQA 4YJHA 4ZVVA 1DBVO 3DWFA 3EMKA 5G0UA 2YUTA 3O26A 3DQPA 4CL3A 2GUGA 2O7SA 4CMCA 4FJ2A 1ZUD1 3RFTA 1DC3A 3WWYA 2WEKA 3VZPA 1Y5RA 2Q46A 2UAGA 4DA9A 1P0CA 3EAGA 3JD0A 3ZHZA 5EPOA 5BSEA 3QY9A 2Z95A 3GHHA 3ZU2A 1BG6A 1I01A 1XLTA 2CY0A 2JCVA 1EMDA 3MCVA 2FZWA 3VHRA 4FCCA 3M1AA 3E6AA 4JBHA 1NFFA 3RBXA 5H83A 3DHYA 2VZ9A 2Q2VA 3ZWBA 4ND1A 3AWDA 1SZJG 5ADHA 1EUCA 5A3JA 4BO5A 3RUCA 4DLLA 3AUSA 4GBJA 3ABIA 1JDJA 3E48A 1VRWA 4I9NA 4IPTA 3S2IA 1XYGA 4KMSA 4IQ8A 4P38A 4IDAA 3W1VA 1K2WA 3LZ6A 3NJ8A 1PZFA 2NACA 3JQCA 3ZW9A 1MC5A 1QYVA 1M76A 1V6AA 4O6VA 1C1XA 1E1NA 5A06A 2B35A 1PIWA 4JJGA 3GRKA 4PLVA 5F1OA 2C59A 2JD1A 1BVRA 3I6QA 2E82A 1WWKA 3FTNA 4ZQEA 3AOEC 3OJEA 4KWHA 3WMXA 3WGQA 2O4UX 4U0KA 4UVIA 1HLDA 1X1TA 4XR9A 3W6UA 4DRYA 5G4KA 1YQDA 2VHXA 3I3OA 1PWZA 4RVDA 1T25A 5KVQA 2EIHA 1P1HA 3E8XA 3NT4A 3WG9A 3QP9A 5B37A 2PGDA 3OBBA 1YOVB 3KYDA 1DC6A 1IE3A 4EEZA 4ID9A 1GL3A 2PR2A 4RPGA 3S8MA 1ORRA 1LSOA 3Q6IA 2RAFA 4XR4A 3HSKA 5HS6A 1WZEA 4ZJUA 5FI5A 4GGOA 4IQGA 4PZEA 4Z9FA 1YWGO 2WSBA 1XU7A 4W7IA 1ID1A 1U5AA 4B4UA 3EY4A 2I67A 1QP8A 4OAQA 1BXKA 4CM4B 4GWGA 4TRRA 1BW9A 4W82A 4AJOA 1NM5A 1K6JA 1D1SA 2EJVA 4JROA 4Z3DA 3DBRA 1P33A 4OGWA 2GN9A 3D5TA 3ICPA 2G76A 4CMKA 1I3MA 1O89A 1E1KA 4JK3A 4LSMA 4WKGA 3WQSB 1XHLA 4D7AA 2CNBA 3DAPA 4N5LA 1JKJA 2FY8A 2NM0A 2OP0A 2W90A 1MXHA 3CE6A 5I7FA 1H9AA 2X86A 3JYLA 8ADHA 2PH5A 3QWIA 3JQ8A 4ALMA 1Q0HA 2WYVA 1BHSA 3RSHA 4BNWA 3C7CB 4UEOA 4BO1A 3JD1A 3WICA 3WB9A 4CLEA 1XGKA 2WD8A 3IOYA 4HADA 5HA5A 3TJRA 4YAGA 3PYMA 1PJLA 4MVJM 2H63A 4R1TA 4IDEA 3VPSA 2EKPA 1HYGA 6ADHA 3Q3CA 3U4HA 2PTGA 4K28A 4O1MA 1BMDA 1P1JA 1ML3A 3LLSA 2NTVA 4J1SA 2VYND 1EVJA 4YJFB 5MGBA 4DIBA 5TJ9A 1LRJA 4KUGA 2RIRA 2ZB4A 1IOLA 4XWYA 4DLBA 2CMDA 4ALJA 2WM3A 3A1NA 5G0TA 3OETA 5AXAA 1LSJA 5JAIA 1FDUA 3U9LA 1V0JA 4AJ4A 4NI5A 3LDHA 3GNQA 3UCEA 4J49A 4OM8A 2VYNA 4NNJA 2X1HA 4XYMA 4OSOA 1MFZA 1F06A 2YYYA 2YDYA 3BHIA 4MIYA 4NBTA 4XQGA 3LVFO 2VQ3A 3E1KA 4NJMB 2YV3A 5EIOA 1ULUA 1V35A 3E9MA 1ZIDA 3FI9A 4QSMA 1C1XB 2BRUA 3E03A 1JLLA 1PR9A 5C7OO 3HN2A 2GF2A 1P3DA 2FRDA 2Q45A 3AY6A 4RVUA 2Q49A 3H8VA 2Q2QA 1NP3A 5JCJD 1RWBA 2I6TA 1UR5A 3GPDG 3FNFA 1UXJA 1U7TA 1EQ2A 2PV7A 1MUUA 1JKIA 4CJXA 4K1LA 1P1KA 4B8WA 1HRDA 1SOVA 1SO8A 2QZZA 2HK7A 3R0IA 4RDIA 7MDHA 3ZWMA 2IYPA 3OICA 1Z7BA 4PLYA 2TMGA 2YJZA 4WLNA 2FZEA 1KIFA 4GKBA 1X15A 4YYZA 3PHJA 4O5OA 4EYEA 4UVGA 3IJPA 3FN4A 4OSPA 4YPOA 4YWJA 4BMSA 4PG8A 3TN7A 1JTVA 2FPGA 4JN6B 2DFVA 4GLOA 1ZK2A 2GD1O 4OOEA 4CR8A 2G5CA 1U5CA 3L9WA 4N5NA 4TRJA 4Z0PA 4IDBA 5DDIP 5EN4A 4DQUA 2A94A 3NAQA 5F5LA 3CINA 3N74A 3HADA 1DAOA 3ST7A 1VI2A 3GNTA 1N7GA 4FN4A 4EGFA 3ZWAA 2PFGA 4AJJA 3PGJA 3V1TC 3EUWA 3RI3A 3JQGB 5TIIA 2DTDA 2D8AA 3QVOA 5JS6A 1NBOA 3VTFA 4BNIA 8LDHA 2J3KA 4CMBA 5COQA 1DFIA 5IN5A 4BNTA 2O3RA 2XXBA 4CM7A 3GN2A 3PQEA 4IDGA 1E0DA 4PG7A 1OI7A 3H6KA 2DTEA 5T67A 5B1YA 2CVOA 1R66A 3OJ0A 1LUAA 3OSUA 3RQSA 5L7YA 4D41A 5EERA 2RBEA 3RJ9A 4FIZA 2D5AA 4HFJA 2GZ3A 3BMOA 3T4EA 1LTHR 1KY5A 2Y93A 3T7CA 3HN7A 5JDIA 2BF7A 2BH9A 3F47A 5TSDA 5ITVA 1RKXA 4NHEA 1ADFA 2O23A 4BV8A 2C7GA 4DYDA 3VKUA 3PHLA 1H94A 5CDTA 4PZCA 3F6YA 5CG1A 4DGSA 3W4IA 1IZ0A 1ZBQA 2FPIA 5F1PA 3SVTA 1F8GA 1NFQA 3PQFA 4GX0A 3I83A 4MPDA 4D42A 2RH4A 2ZIZA 3TFQA 3SX2A 1E1MA 4D79A 4IJKA 2CFCA 4DREA 3GEMA 5JYEA 2WJPA 1Y9AA 1H6CA 4O0LA
chains in the Genus database with same CATH superfamily
5BSGA 1T9KA 5JAPA 2PKXA 3K9HA 4QD3A 5K6AC 4QGHA 1J5EB 4EG7A 1Y0BA 3TLGB 3SLKA 3TZKA 2GILA 3HXLA 5EJ6A 3QSGA 3Q3JB 3BH7A 2F3PA 2IUSA 4ZJPA 3DTVB 6PFKA 2E7ZA 1ZPDA 3LYUA 5JQGA 4M36A 5A4IS 2WU0A 2O8FB 2IYAA 1A98A 1CUWA 1I4TD 3ZLJA 1S8FA 2FSHA 5E6RA 4MMYB 4KIWA 3KJGA 1EA5A 4WEQA 1M2NA 4DC0A 1IQPA 5CCXA 3ZDDA 1NIJA 3A70A 2P67A 3ETEA 1XZPA 3STVA 4RKQA 4C4AA 3SEAA 4ZO4A 4NARA 4ZZ2A 4L75A 3G3EA 2ZQ5A 3GELA 4MWTA 1C0IA 1EK6A 3IEIA 1NMQA 1IMJA 1BDMA 1K6EA 3FMPB 1PDWA 5ICMA 4D8VA 3VKVA 1A04A 4F2HA 4HCJA 1U0EA 4PR0A 1N1MA 1F60A 1XZQA 4MGKR 1AUQA 5E3IA 3WBKA 1MG0A 1T91A 4Q6WA 1FP7A 4Y2SA 3RUPA 1Y9DA 3B6ZA 3CB4A 4HQLA 4B2YA 2C0CA 3GC6A 1VPTA 3KOMA 3QU5A 4KC0A 4ZVPA 3V48A 4DLRA 1ENZA 3HWX1 3QENA 2OGTA 4MQFA 5HFAA 1NQTA 1Y80A 1IHYA 1LS1A 2XNSA 3FIUA 1JXMA 3GGSA 2VUHB 3JSAA 4WD3A 2OP1A 4PF1A 2IS4A 3OWHA 1JH8A 4GYYA 1R12A 4TVBA 1L8OA 1PU2A 4DIKA 5GAJA 3OEHD 3VA7A 5IAKA 3NO4A 2IZ6A 1U8AA 4OHBA 1FLAA 3BTVA 3C14C 3F9IA 2BH2A 1AQIA 4GOKA 5I45A 2HPAA 3R3ZA 5KOJB 2WJJA 3PEWA 1RLTA 5BXQC 1AJEA 1U6IA 5D01A 3FZQA 1Q2XA 2NV0A 3KQTA 5ECWA 4AY3A 1B41A 3L3BA 3CZCA 5AW4A 5K0ZA 4MVJA 1Y7PA 3WLLA 1IY2A 3CMMA 5K8JB 3WGKA 1WZNA 4OIFA 3AR9A 4CM5A 1GDHA 4IMRA 4AF7A 4C5BA 2FUG1 4OHUA 3PEEA 1PP4A 4ZV4A 3DLAA 2AOTB 3QH4A 2EVWX 3RVQA 3CVUA 3KB2A 3N2EA 5MN4A 5TPZD 3I12A 1MAVA 1NBIA 3PDUA 2I6FA 2FPPB 5F1KA 3CN7A 4LK3A 1ZJYA 2XVXA 3TBHA 4YMUA 1F51E 4N18A 3DD1A 4TXMA 4YUVA 3UFBA 1Q0RA 1Y1LA 4PGHA 4TVKA 1DZIA 4A8JA 4W6QA 4GOOD 3BWDD 5K05A 3S1LA 1DEHA 3VR5A 2BTQB 4J7AA 2H08A 5DX8A 4BV2A 1E7MA 3THOA 2PRJA 2FW9A 1U0FA 2FSSA 2DOKA 1K89A 2ZJYA 4E33A 1J8DA 3QF4B 2NYUA 4JT8A 4PQYA 3OOHA 4BO9A 1Z6PA 4I1IA 5HIAA 4U4AA 1A7KA 2XDWA 4S1OA 5A5VA 2J5KA 5KSWB 1M6HA 2C2MA 2X14A 4J9UE 1B43A 2Q5IA 3UW1A 3ZS9A 5F9FA 4YWHA 3ZY2A 4BE9A 8AT1A 1O4WA 2JLSA 3KHKA 4EK9A 1T1JA 2KLHA 3X1JA 4K9SA 4NU5A 3EAQA 2XMQA 3EJWA 1LDGA 3KOZA 2H2IA 1TNDA 4WERA 5DISB 3ZVKA 1M7BA 5D1HA 1ND5A 4V0KA 3IEVA 3B82A 3TKLA 4C43A 4FI3C 6GPBA 5FRDA 1X39A 4UW9A 3UBTA 2VJLA 2PX3A 4KIUA 5A7HA 4BWGA 2NSYA 3OPQA 1KH2A 4I1OA 5FR2A 4GRIA 3R74A 2IYNA 1YB7A 1KAGA 2UZIR 5CXQA 3BCUA 3AEXA 1W73A 2EATA 5F64A 1YOVA 2WYWA 4ZU3A 4GS5A 1CY1A 3IKMB 1YZUA 5C0OE 1PTKA 3CSDA 5D00A 3UWSA 4EW6A 4LZNA 2P8JA 5CDSA 1HQKA 1W19A 5IF3A 2VT2A 3AF3A 3T7RA 5L95A 3U09A 2WQ7A 3ERCA 5K0CA 4MCJA 2ADFA 2D4AA 1U99A 4I1YA 3AEQB 5J9FA 4D4HA 4N8DA 3T9CA 1MDFA 2WJHA 4ZICA 4FYJA 2C98A 3RVOA 2VDVE 4D0LB 1NLMA 4L8YA 1MP0A 2VXCA 1QYXA 2HMTA 5AI6A 4OO3A 1A27A 1NVAA 4FN5A 2BZGA 3I92A 2QGFA 1CRQA 4GOND 3BMCB 4L95C 1RQNA 4G6ZA 4J0IA 1R0ZA 1GKUB 3CO0S 1WNTA 4A0RA 2A9OA 4FMBB 1WZCA 4MV5A 4QVKA 1XNGA 2ZKIA 4DNXA 5IW8A 4I46A 2Q2NA 2V65A 1JDSA 2C3PA 2Y9YA 1BS9A 1W0CA 3EXIA 1PDVA 4MR8B 5CFRA 1ZVJA 5L4SA 2QN9A 3CR7A 2VBCA 5GVRA 2G1AA 3IA2A 2OFXA 2NQ8A 5IS2A 2SNIE 4RH1A 4WLVA 4MEAA 3JQ8B 2EYQA 2VAPA 2WHRA 3GIDA 3M7IA 4EW3A 5F77A 3KU4A 1JFFA 2ECFA 2BJVA 2PZLA 4TYPA 5GJCA 2J3JA 4JI2B 2C7VA 4IWYA 4UVDA 3HJFA 4LC9A 2P9GA 5SZIA 1IEXA 1LPAB 3T7TA 4GMFA 4EFMA 2V4UA 2ZJ4A 3BRCA 3UGQA 3L93A 4V24A 2QG9A 2BGUA 2G0AA 3F97A 1E6EA 2VAVA 2GNAA 3C2QA 3OT5A 3R7DA 3UK0A 2BCJQ 1US8A 4IEIA 4WGFA 4RY9A 2OXIA 1PJTA 2WFMA 1KKUA 1RTTA 3KQLA 3JARB 4URXR 4UQOA 3P7MA 4CNBA 3B1WA 3W8EA 1T8PA 2REOA 4UZSA 4EFKA 2HU2A 5EP3A 2FNAA 3GVXA 3MTDA 4Q66C 1G3IA 3Q7EA 2MINB 3MAGA 2OMKA 4K6GA 3O1LA 1XZGA 4Q01A 4YJGA 4EA8A 1GPDG 2HGZA 3A4LA 3NIBA 3E2MA 3LC0A 1IZZA 2IT1A 3F4BA 2E9SA 4IQFA 3T61A 3UB4A 4ZCRA 4OVKA 5KPJA 3KVRA 3CMCO 2XR1A 3FBWA 1VBMA 4HDNB 1V1MA 4G67A 2GA8A 1O96A 2G40A 2W8ZA 1W2WB 1NUAA 2X5KO 1T13A 2VZ0A 3DVQX 3FKJA 2O3UA 4G5QA 4HNHA 9MHTA 4QGSA 1JPNA 2BBSA 3BAZA 4HYTA 4AMUA 4E08A 3GF4A 1IHPA 3W5IA 2YX1A 3HZRA 4WW0A 4IDQA 3SNHA 3CS3A 3VO2A 4QEDA 4DFDA 4E1VA 2XOKD 1DC8A 2JLZA 2QE6A 3CUEF 2ATEA 4P22A 1O1YA 2JCBA 3GBPA 3HFRA 3QUAA 4L6CA 4OTZA 1A4UA 4J0DA 1I3CA 3A0RB 2GKSA 1J97A 5D7NA 3ZDZB 4ZZ3A 3WA7A 3AXSA 1J2UA 1N7HA 3PRKE 3WNCA 3AJAA 9LDBA 2Z43A 4PANA 5EAIA 2DXIA 3VYWA 3VMMA 4PYOA 5H7XA 3CIFA 2WE7A 1CYEA 2W8BA 5AW9A 2R1UA 3PXAA 1O4VA 3OG9A 2EKDA 4X92A 3FY4A 1A82A 1T36A 2BVNA 2HJVA 2IYYA 4CQMD 1E60A 2RI6A 4CM8A 3PQ7A 2E5LB 2C94A 1A9XB 4RD4A 1FUUA 5D3ZA 3OE1A 1Z5VA 1XCMA 2CEAA 2H1HA 1CVRA 2XKBA 4ER3A 1G1AA 1Y8CA 3DVRX 3FIJA 4QRHA 5I4KA 1DT3A 4QVIA 3WNZA 5K03A 3THYA 1FY2A 2D1SA 2XCUA 3ZU3A 2GEVA 1PNRA 4MI1A 2QJRA 4C0LA 1KSFX 3SNKA 3O8NA 3TLAA 4D6YA 1SVSA 2G72A 3H1BA 1Y1KE 2PZ8A 3DO5A 2QUZA 4LOHA 2ZXFA 3WLJA 1KQFA 2HWKA 5FOWA 4MVJF 1RU3A 1QHFA 4E0BA 5L40A 3A6ZA 5T4EA 4DXDA 3GDOA 4QULA 2GK4A 1Y1RA 1MDBA 2QGNA 3GLQA 5EE5B 3TIGA 5BY2A 1GU7A 4FFMA 2PE5A 5AVJA 4TWRA 2IYLD 3NIFB 1MB2A 1MV8A 4TTQA 2Q5EA 5D5HA 5DNAA 4XLZA 3ZU4A 3QLVC 1J1IA 3GFBA 1M2GA 3W5HA 4Y67A 1U9ZA 5M34A 4ZQCB 3D4BA 3F1KA 3RFCA 3UT0A 4AMBA 1E6UA 3OC6A 1LRKA 3M9WA 1AUXA 2Z1MA 1YVDA 2YNMA 2HJSA 1AB5A 2APJA 2P40A 1J99A 3ZCUA 3DLTA 5I7VA 2ZUFA 4U7PB 4XGNA 4EH1A 2OHXA 4E2YA 2ZUBA 3A26A 4GSYA 1RQRA 3RABA 3U16A 2OCPA 4F5WA 1P77A 2GD6A 1ICEA 2WG2A 2HQOA 2E4ZA 3M6LA 3VZRA 1QB7A 1MKYA 2NXCA 4FFDA 1GADO 3UMGA 1T8UA 1X8KA 4Y2UA 1U2SA 2XUOA 3RIEA 3RYIB 5B7NA 5JRDS 1ECPA 5K0FA 5DT9A 1E7SA 4C6RA 1BGXT 2EF0A 5IM4F 2EYUA 1EZ4A 2OXRA 4XARA 1W4LA 1FDOA 1FFCA 3ZH2A 1Y37A 1QYRA 2GJKA 4RJLA 2AD5A 2HCTA 2QTVB 1JYSA 4PWYA 4EJ6A 4XWKA 1F4LA 3H3XA 3U9SA 5C7LO 3UPUA 5G02A 1IVSA 3WYFA 3GCXA 1AKUA 1QFZA 2BM0A 2PU7A 3MG9A 4NHOA 1E1QD 3T9DA 2FLWA 4NBUA 3AR8A 4ZVOA 2QTNA 5CBKA 1PJZA 1I9GA 1LLFA 4Q3AA 4V03A 1JDPA 4FR0A 4AFNA 4YRLA 1SUAA 1HYHA 3LT2A 4L4ZA 1PV4A 1OI2A 2YC2C 1IM8A 2X3FA 4JXKA 1JN0A 4CYMA 4ER7A 5AKJA 1DUSA 1GV0A 4O2RA 4Q4CA 4PGGA 1RE0A 4LKOA 4Z2YA 2RHMA 1KYQA 2ARKA 1P9NA 3ROQA 4H17A 4PQGA 5FADA 4V0QA 2YOHA 3NWJA 3TQOA 4DBLC 5C8ZA 2AMLA 3UJHA 2JJYA 3ENNA 1NF2A 3CPEA 4KQIA 5AVKA 4JVLA 5IHPA 5DWQA 3FTEA 3GAAA 5FJIA 3N2YA 5DF1A 2CCKA 1Y4AE 5HKOA 2QYHA 3RT7A 5L3RA 4FOPA 1ESCA 3PC3A 3KCNA 3TF5A 1GUFA 1ZCFA 3ZLBA 1RM3A 1NW7A 2XMCA 3BSWA 2IRWA 2X0IA 3GUVA 2XVAA 2VDPB 1ULSA 2ESRA 3DT9A 3FWNA 1EG7A 3AFOA 1JJAA 2B7CA 2J07A 3AJRA 4P33A 2PZGA 1JFFB 3PB3A 1F14A 3M6XA 4EB0A 3JQ9A 3H11A 1RWWA 2P2SA 3AHGA 5E9WA 3REQB 3LBNA 2B30A 4ZPXA 4Q1BA 1OI3A 3PZBA 1FS4A 2WAMA 3L7JA 1G19A 1FEZA 1AKQA 1KI6B 1E9AA 2O2ZA 1NN3A 2W6JA 4MWSA 5AM4A 5EJMA 1EZ1A 3QFSA 3Q12A 4OYHA 2A0KA 2ZITA 1MC4A 4WZ6A 5ALEA 5A5DA 3CR8A 3F1LA 4BZZA 2DKFA 1JIKA 2QTBA 1F38A 2O0LA 3DF7A 1R64A 3JARA 4UNSA 2PIDA 3OZRA 3PP8A 4BYGA 4LIPD 3SC2B 4QQNA 1ZXBA 2QHXA 5E9QA 2NW6A 5B64A 1EJ2A 2AMYA 2H1IA 4LV5B 4RF4A 3O7WA 4ROSA 1CRLA 3STUA 2GAIA 4REOA 4A15A 4PRYA 1D1QA 1Y3FE 2HY7A 4D98A 2VDUE 1CUCA 1Z6YA 1Z3CA 2VT7A 3GH1A 4JMPA 1Z0SA 4EGSA 1Q15A 4LWOA 4OFWA 4HOYA 3I53A 4WMLA 2PX6A 4N7JA 4JGIA 3UJNA 2JHCA 1GQSA 3GLGE 4NEQA 1X14A 2R84A 3UHOA 1EX6A 4BS9A 4QICA 1MENA 3QXHA 3IQHX 3L1HA 3O03A 4FKBA 1FPMA 4XD7D 4IZOA 4WEOA 2YV5A 1J7KA 1XRJA 3CNNA 4IEFB 1GU1A 1I0LA 3IP3A 1GZ3A 3FH0A 3G5AA 2JIBA 3AHEA 3WLRA 1AM4D 3PFHA 1Y9JA 1N78A 3A6FA 3INTA 1P7CA 2FQYA 1K8ZB 4OKIA 2EQAA 3AONB 5JPIA 4D0SA 1E2DA 2R6FA 5AI5A 3OIWA 3VYTB 4W8HA 2MCFA 1NVFA 5BNZA 5BN4B 1OX6A 2QE7A 3HY4A 4KXUA 4J16A 3HHEA 3KQPA 3VOBA 4X64B 4BNJA 1CJTC 2QE7D 3RK0A 1RVV1 5KJFA 5JZMA 1P2FA 2X1LA 3HCEA 3OHMA 1W47A 2J6IA 2PZEA 2VQSA 3I6MA 4RXMA 4TL9A 4ZRMA 4MR7A 1IDOA 3N2ZB 4M1EA 1W581 5ELLA 1A9XA 2AFHE 5E7IA 2FWMX 3PJDA 1SHJA 1FRFS 3QELA 5CCDA 4S3MA 2IY8A 4DZTA 5EIEA 4JOQA 1J4AA 4WBXC 1GCUA 3CPSA 2BONA 1MEEA 4MCHA 2NADA 2JGFA 4AS3A 1MW8X 2P9TA 3DMTA 4ZT5A 4ETMA 1L4HA 4YRAA 1RZVA 2CXPA 1EPUA 4BO7A 1K7EB 3AUTA 5KQMA 5TLSA 2IEAA 5FNVA 3OKCA 2BFFA 4CTJA 2J08A 3R4CA 4NL4H 2IYOA 1EFCA 3D7SA 4CDGA 1V4VA 4OU4A 4EJFA 2HBQA 4HQNA 1PT6A 3L8ZA 1BXGB 1CS4C 1ULHA 1EKXA 1E20A 2DH5A 5FULA 1GYQA 2Y2UA 2F1JA 1C30B 4MRMA 2QN1A 5I9MA 2CL6X 2QSYA 1AMUA 4D26A 2F7SA 4LK2A 4V0ME 4DM3A 1R50A 5EJGA 1BS2A 1NUHA 1R9GA 2KE5A 1GOTA 2Z2KA 4ER6A 4R7ZA 3K6SA 2CNKA 2I4IA 3GLUA 1HE5A 1TZCA 2ODBA 3DHVA 3O93A 2ZWPA 4EI2A 4KI0A 3VX4A 4GRDA 1DIGA 1IRXA 4RPHA 2JFWA 4MPJA 1FP1D 1NRXA 4F97A 5JH7A 4L0QA 2LDBA 1RC0A 4QNRA 1PQUA 3FPCA 1DS6A 1XELA 3OCVA 5AW5A 4KCGA 2WBLC 3E3NA 1M8FA 3TQQA 4MA5A 4XDGA 3II6X 1GGHA 2VK4A 3NHWA 1OH5A 3L7NA 4MV9A 2Q6LA 1UINA 4LXXA 4R71A 4LECA 1H0HA 2W48A 3W06A 4IRMA 3V1YA 1GN8A 2PVPA 3VC1A 5I7OA 1E5QA 3LUJA 4LWQA 4WESB 5TXGA 1WXGA 1A7JA 4TYMA 1QLJA 1J33A 2SHKA 2YIMA 2YFYA 3OM9A 4OBBA 1UKZA 1P61B 4LYGA 1MGOA 2KBFA 3UW3A 4ZMRA 1EIWA 2OCKA 1U1EA 1WF6A 2R79A 3K32A 5LXTF 1RTKA 3ADCA 3DJFA 3ZVRA 2XWQA 1Z6QA 5ALZA 1H6AA 4EYSA 2DUMA 3VVCA 4GNKA 3HFSA 1J1UA 4P82A 3PNSA 4JA0A 1SVWA 4W6ZA 3EPLA 1I9CA 3DOFA 3ZDFA 3BDVA 1S2LA 5C1IA 3RC3A 4M7WA 2P91A 4RHUA 5AJZA 2JIOA 1YRLA 1NULA 2WIFA 2WIKA 3JVDA 1FQOA 4YREA 3KLNA 3QU9A 1PTJA 1HFKA 2JKVA 3DXXA 4G1BA 4GZMA 2GN0A 4UUQA 4YH1A 3VPGA 2QGZA 4R81A 1PF7E 1H0KA 2GJSA 1JLLB 1WMDA 3H65A 4RZIA 4DPMA 3RUDA 3W4JA 1TUIA 5FL3A 1YCFA 4BNMA 8ATCA 1TIPA 3FCXA 4P5PA 3EZGA 4DXAA 2HXGA 3UT5B 1XQ6A 4BMSA 2C3YA 1JDBC 4YV2A 1BGWA 4HEJA 1GTRA 2OCXA 4ENSA 3TL3A 4NYJR 1KO8A 5AI0A 4MUYA 1W44A 5JWOA 1J22A 1XCPA 2FPSA 3T3NA 4H16A 1WLSA 4PV7A 3VPHA 1WXQA 1SHLA 3MYYA 4TSKA 4E94A 3LPNA 1EWRA 3R4VA 2PKQP 1CQIA 1N32B 3DR3A 3ZTTA 1G8GA 4D0NA 2AEEA 3D6FA 4HPXB 5TQ2A 3ND5A 2XQFA 5JAZA 1P73A 2XAAA 1KZ9A 2DLNA 4CMGA 3RS0A 4BQEA 2XSZA 1EFAA 2ZS8A 5L45A 1A2KC 4QUHA 5BN1A 3RYFA 1APBA 4MV3A 1GFZA 2B3DA 3WNVA 4H6PA 3N86A 2ID7A 3IRUA 4IIBA 3FPHA 1P2DA 2VPXA 5ULLA 1SD2A 1U6JA 1R6DA 1JT2A 3TLMA 3M9XA 1V9LA 2Z58A 5IDYA 5A4FS 2WJ3A 5JS2A 2V0GA 4FE4A 4LMAA 1LBSA 4JVSB 1Q7CA 3LRTA 2CJXA 5FR1A 5ALTA 2G9RA 3I45A 4YCCA 4QATA 1DMRA 2Q1TA 4MARA 5KHAA 5T8KA 3RC1A 4HAIA 1HY3A 1RHMA 1OTXA 1NI4A 1SOUA 2DQSA 3E22A 1G8KA 5I9BA 4AKSA 4W5OA 2ICAA 2E1PA 4TTPA 4R8VA 3GA5A 4HFNA 3TOCA 1M6YA 1K08A 3DAYA 1VE9A 1WHTA 3P1JA 1YS1X 4M87A 5H0IA 4UDOA 4NBNA 2W6CX 4KOEC 1T4CA 3MJRA 5BWMA 3OQNA 1R74A 2E55A 1JA1A 1YD7A 1V11B 3G9XA 1ZNZA 4C2TA 1JZQA 4KJZA 2XX3A 3L0ZA 2XTJA 5EKUA 1E4YA 3ZJ4A 1Y5MA 3PHHA 2I87A 2OLJA 4JFRA 3SOZA 2XE7A 2FRDC 4LJ9A 4TTAA 4CM4A 5CPFA 3G49A 5AKEA 5DM2A 5CFZA 4U2GA 2NUTA 1QE0A 3IUMA 4XOIA 4CF4A 5KYXA 3PWTA 2AR9A 1C1YA 2CXNA 2QTFA 2RI0A 3FWZA 1KOFA 1QGOA 5HSGA 4RDXA 2XNHA 3L5OA 4FZJA 3MWJA 2H54A 1VTKA 1GTSA 1QU2A 1JQDA 3T3OA 3K92A 4RF5A 1N5DA 2NZUG 3BILA 3EZYA 1KDPA 2DECA 3ESXA 4S05A 4GVXA 4XGKA 1U9JA 1ZRHA 1XTJA 4A5OA 4I3HA 3QU7A 4KNVA 3SZ3A 5IJ9A 1TXGA 1JAYA 2FE1A 4I1UA 2YIDA 4D3ZA 3FOWA 1FYEA 2E6UX 2XCRB 4O29A 5GWXA 1XDGA 2I54A 3BTUA 3ED1A 4WE3A 3SDZA 4CLOB 1GAEO 4DPKA 1HEIA 2OEPA 2XYGA 3PFCA 1Y63A 2PT5A 2ZCVA 3JPWA 3ZVLA 1AVTA 3UGJA 3ZHVA 1X94A 3RC2A 1O03A 1CEQA 4ZALA 1KFBB 2BFDB 1RLUA 3TOZA 1SIWA 4BAUA 4F9FA 3UHPA 1G5TA 1DJOA 2PSFA 4AJHA 2CXUA 5ENDA 1DJQA 1OFCX 1EIZA 1I51A 1OMOA 4N48A 1X0XA 4JSYA 1XVUA 1Y1SA 4OL0A 4D3DA 2I8AA 3U13A 3G8AA 1E2KA 1ZMRA 4HWGA 5JJLA 2CJYA 3PUVA 5GZ6A 3JU3A 4LDRA 2OK7A 4F91B 3BWCA 4X6XA 3PGKA 3UWDA 2QZSA 4DCPA 1I10A 4ZEWA 4UULA 4ZC1A 1KGDA 3S27A 4DV4B 1VLJA 4IP0A 3HNPA 1G3QA 3BC1A 1B8OA 1NNUA 2OCYC 3DZKA 1BHO1 2FSUA 2G9ZA 4PLZA 3T0FA 5A4JA 1ZJJA 5AHKA 1I5RA 2PYDA 4EBFA 3O7MA 2XYQA 4I6JA 3DD5A 4YAWA 1MF7A 2V96A 1ISHA 3O0DA 4U3JB 5H82A 3UJDA 4D8TA 3GLFE 1TYDE 3CKKA 2UZ1A 1RQGA 4OQFA 1VG1A 3UOGA 2GERA 2NU9A 3IS3A 3R0ZA 1FX0B 4JKYA 2LIPA 2HA5A 3BRQA 1DXHA 1RWKA 1RBYA 1YXMA 2PWBA 1P9LA 3RVLA 1M2HA 4XWWA 2YXLA 4E5SA 1EJ6A 1P2BA 1TJPB 2ZIGA 1ZD2P 4C78A 2C2WA 1NBEA 1GFSA 1DRVA 1KR2A 1ULAA 3NOXA 5F78A 2C31A 5T64A 5CUQA 2ZS7A 2EX4A 1R8YA 4H59A 3H5OA 2R6CA 1WU7A 3VZCA 2Q8QA 2ZRNA 2HGSA 3AOEA 3RU9A 4FFPA 5CBPB 2PJRA 4H1WA 1Z07A 4EY7A 2AN4A 1CP2A 1EX1A 2DU8A 2PRKA 2Y1DA 3LXRA 2J5QA 4JA2A 3RLIA 1DQZA 2HTEA 2OCDA 4XJVA 5ERXA 5GVSA 1VLLA 3KBOA 3FHOA 3H9UA 4KO1S 4UUNA 2AJ8A 2FK8A 3QI7A 3W04A 1KEPA 2EFDB 5FQOA 1HKUA 2VWPA 2IFTA 2YRWA 1YI8A 3H2HA 3MA0A 4TS3A 5E6UA 4I1SA 3IEKA 4DRXB 3JQ7B 1ZSVA 1AY0A 1BA2A 1C4XA 1QIJA 1NURA 2H29A 1PWYE 4DR7B 2E4AA 5BUSA 2PZAA 1A5AB 4HR7A 2GPNA 4LGMA 1RAGA 2PK3A 2AUTA 2R6ZA 3AI7A 4OK3A 3ADBA 3F78A 2J7PA 2KBEA 2VS1A 3D2CA 2G25A 4I5EA 1E5XA 1RKVA 7ADHA 2O8EA 4US2R 4NBRA 4JKIA 2VH1A 4FUTA 1W36B 3K4QA 4C5AA 1U80A 4BNZA 4KP7A 4PCAA 1UDBA 1QHEA 2B7LA 1CZKA 1N57A 3MYRA 3U7JA 4KQGA 5BVGA 1CUGA 1SKMA 1DX4A 3UNXA 1LDNA 1WULS 1J2YA 1ISMA 2VUSA 4QUDA 3RODA 1NBAA 3JQPA 3ZWXA 1XTIA 1DP4A 2XV1A 1QUFA 1RP7A 5EMJA 1LLDA 2FZ4A 5SYAA 5K2MA 5HZGA 1GNRA 1GSAA 1EEXB 3EIHA 3RUAA 2YYAA 4RTOA 1SBZA 4I19A 4IVNA 1VKJA 1JKFA 2B2NA 1JG7A 1QIFA 3FNRA 1P3JA 3HKDB 3OPYI 4FCVA 3LO8A 1Q3TA 5EESA 2DPXA 1J5XA 3TTYA 3OBIA 3FE2A 4KO3S 2XGGA 1GAQA 3ZHXA 2PQ6A 2HK9A 2MSWA 4IZHA 4HRYA 4TS1A 4F12A 5HTOA 4M6WA 5CDFE 4F2DA 1L0BA 1Z18A 1RRCA 1NFRA 4OLBA 4BX2A 1T1SA 3C8MA 1G38A 4TRMA 3WWPA 3GA7A 4WFIA 3SEZA 1N3BA 3BZUA 2PFSA 2FA9A 4V39A 4B8ZA 5IAEA 1OZAA 4AZ0A 3ZD6A 2AN1A 2XMDA 4ZYXA 2Z6QA 1VIAA 4B6SA 3EYWA 2JGNA 1RPNA 2GN8A 3BDAA 3SYNA 3ZHUA 3CRW1 2FGJA 2IZZA 2FFJA 3HM2A 4G0UA 3DT8A 1ZI9A 1R88A 5IEBA 1OROA 3AC0A 4UM5A 2VNSA 5J3JA 5BWCA 1U8EA 1DEKA 2Q3DA 2YW9A 4MHOA 3O8OB 3RF6A 1JQ3A 2ZYAA 1Y6GA 2KI5A 3ND8A 2C9MA 1U7DA 2P2CA 2VWGA 4RIFA 3MW8A 1B1AA 1WB4A 1PUJA 3E9CA 4YCAA 3GQVA 4EPWA 1XC7A 3ZD7A 1IHUA 1H2ZA 3MVEA 3SJUA 4J9VA 1TKRA 2QX6A 3AEUA 2WAAA 4C4YA 1USGA 3ND9A 3BIOA 3V2HA 3VV2A 1JECA 4ETNA 4Z4CA 4EYQA 3C3WA 2ZAMA 5FNVB 4OLAA 2BT4A 1V11A 1UOOA 4PG4A 1QGYA 1GNPA 2CMHA 1R18A 2JGKA 3GT3A 1M1ZA 1VA4A 3GJYA 2NG1A 3IUSA 1P7WA 1G8FA 1YBMA 1ZESA 1RZ3A 3U3XA 3EFBA 1Y89A 1UBUS 1NE2A 2O3JA 3OZUA 4YDQA 3NIWA 3ZK7A 2NUTB 4R7TA 1SZCA 1VLHA 1I7SB 1WXDA 4XYGA 1WEHA 3JQAB 3WHKA 1FBNA 4TKUA 1G60A 4M54A 3SS7X 2FMUA 3HNOA 4R1NA 1U8XX 2GAJA 3CTMA 2QRKA 4PS0A 1LD3A 1K7YA 3WWEA 1VYVA 2XNKA 2AYZA 4DZRA 4PSCA 1U0LA 3F90A 3V2GA 2FP4A 2J46A 2I33A 3DVAB 1AMNA 2R4UA 4M0MA 4R9VA 1WABA 5AKHA 4X24A 1UKAA 5HF6A 4MQEB 3ZGXA 5AVZA 4QECA 3B1ZA 2XKKA 1N6HA 2DHEA 2Q3MA 1VMIA 2QZPA 5H4GA 1UPXA 4BUCA 1I7QB 4IIJB 4BUZA 1HT2E 4KAJA 4J16C 5FTJA 3A7DA 2JBHA 1YKFA 3NWEA 4Y8VA 5HIJA 1ZG3A 4BO8A 2XCIA 3EQ2A 4U02A 5I8ZA 5AYVA 1WDLA 2XF8A 4AQDA 1YJBA 1VE1A 1TT5B 2YMLA 9LDTA 2HLDD 1R0CA 1WDMA 3CM0A 2QLLA 4DAEA 4HS4A 3P27A 1QYWA 5KOYA 4A26A 3BUSA 4GPTA 2AEFA 3B1FA 1AN9A 3UXYA 3FYUC 4C03A 1BD4A 3R5XA 5A0VA 4L0MA 3TI9A 2J9FA 2BZSA 1JLHA 4E2ZA 1Z7GA 3PWKA 3D81A 1PFUA 1RS0A 4DLNA 4GGMX 5LZ8A 1TAUA 3PNYA 1CPYA 4EPRA 3KR2A 3KZOA 4MIOA 2EFJA 2JL1A 3EXG2 4NE2A 4H1VA 2WUVA 3MBIA 1JVBA 2I1VB 4L4XA 2VP6A 1A71A 2AC7A 1UODA 3INGA 1IHXA 3VBCA 3WGNA 2ZYVX 1UIRA 2WTAA 5FLKA 4CF3A 1JSRA 3FPAA 4TM8A 5LJLA 1RQPA 3HU5A 3I09A 3GEGA 4DYVA 3GJ5A 1FP4B 1G7RA 4FLFA 4GUAA 3BL5A 2X41A 3ABQB 2OECA 2PBZA 3PDWA 3TRFA 4I1PA 1B16A 1LXCA 1KU6A 1TAGA 2ZYTX 4MCIA 4YRKA 3ICQB 1DQYA 1QBKC 2O14A 2DSTA 4GPIB 4KQ6A 2C9CA 1EP3B 1QJCA 2CUKA 1P45A 1DKMA 4C7OB 4B2LA 5A5GA 1MRSA 1VBNA 1R5NA 1TC1A 1DU4A 4H7FA 1P6QA 1E79D 2WJZB 4B4KA 1E1RA 2GSWA 3JYHA 4IY1A 1CC1S 3EY9A 1P9WA 3NGLA 2QIOA 1VCHA 2QQ0A 3AW9A 2GBPA 3F5SA 3KZKA 3TMYA 5JQGB 5DLEA 1QK4A 4XE5A 5I8WA 4IX1A 1SUPA 4QFCA 4Y9UA 4O4LA 2FUCA 5JNUA 1IBLB 2WFAA 1FYFA 1KJZA 5HM6A 3K9LA 4LMBA 3BERA 5E6RB 5L3ZA 1KVRA 2OMEA 3ER8A 1N9GA 2HA2A 2NWQA 3RFUA 4FMDF 3HZZA 3C6XA 4JC5A 2KW5A 3N2GB 4I5DA 2GAAA 5E3JA 3CZ9A 3RWMB 1BCSA 2AGVA 4HH1A 4IDHA 1PV2A 5E0KB 3OFSA 2Q9CA 5KAPA 5TJHA 5TR9A 1P6UA 3GU3A 3E8MA 4CGZA 4PZ0A 3BMQB 3I42A 4IGIA 4QGGA 2D54A 1JEYB 1VQ1A 5KYWA 2D0DA 2AFHB 1ZJ6A 4CLDA 1KDOA 1DXOA 5IZCC 2IPXA 3OE4A 5LD2C 3H3JA 4BLTA 2CKMA 1PJBA 1DEAA 4C0QC 1FRQA 4XVQA 1WHSA 3IAS1 1JIJA 5JJ5A 4HEA6 1L4EA 4BQFA 5HCUA 3PA8A 2ONZA 1W5TA 3GRUA 1VPLA 4XEUA 2PNFA 2W43A 4MIEA 5FLEX 5HDBB 1QR2A 3DW3X 3GGJA 1IBKB 1XA3A 3HKDA 4KBFA 1SG0A 1Q57A 4FIDA 1VL8A 1E3EA 4EDFA 3KETA 2NVOA 1KO4A 3I2YX 5DM0A 3SSNA 2M6SA 2VCYA 2J4DA 4B9AA 1FFGA 3HA7A 3EF1A 4WJZA 2YXNA 4PLGA 3VNRA 1NHGA 2EQ5A 1AO3A 2PUEA 3NHLA 3TIIA 2ZYIA 4GH5A 4R83A 4HNTA 1EINA 4NCJA 2OG2A 4YMLA 4PQRA 2AQ8A 4X94A 5SZHB 4C7JA 3REOA 3I9JA 2EGHA 1IQUA 3MFYA 4JVMA 1XPUA 1DRKA 3H5TA 4P2GA 5CT9A 4FSXA 4JBIA 3AFNA 2XRMA 1ZQ9A 1E79A 1N6IA 2O5VA 5KYUA 3D8UA 5IABA 5AUOB 5FBQB 4NK4A 4BNHA 3T1VA 2AN3A 4EKYA 4JBNA 4IJVA 2O8BA 1YJXA 2CYCA 1ENPA 4H1TA 4MB2A 1DEOA 3DCYA 1NQOA 5ESDA 5K3CA 1GRQA 4F4JA 2AYYA 4P4GA 2QF7A 3OF3A 2HK6A 2Q7OE 4LY6A 4YCMA 3TRKA 5LVAA 1KYZA 3A1FA 3KV3O 5CHEA 4MK4A 1TI7A 2NZXA 2XT9A 1FW6A 2FQ1A 2PO7A 4RF2A 2GXQA 3A05A 5EY5B 1YA8A 4MVJH 2DT8A 3X2FA 4JUAA 1HM5A 1FQWA 2M9MA 1OB5A 7YASA 3FYSA 3MJFA 3OX1A 3OUTA 3P5SA 1R10A 2PX0A 1L3CA 1KEEB 2FJ0A 4YB8A 4AJNA 3ET5A 4RA9A 2HV8A 5JAUA 2BBTA 2HMWA 3PNQA 1JU4A 1R1DA 4ALKA 1U11A 1C8VB 1R0KA 2V98A 3JVUA 5FAKA 3HRKA 1UPTA 1CLEA 5CA0F 2GZHA 3C97A 4ZD6A 1PZMA 3ELDA 5FFMA 3DHNA 2BM9A 3EVFA 4UM7A 1UEJA 4CFYA 3D1LA 3B70A 4AMVA 2OD2A 4DDVA 4RD0A 3GI1A 5REQB 2V0CA 1Z6ZA 2X3UA 3RNOA 3VH3A 1FX0A 3MS2A 2I4LA 3PENA 4EATA 5LMCA 2J3HA 1E2GA 4PPYA 3X1WA 4TN5A 1KEUA 4BX9A 1XPOA 4FS8A 1XRPA 2A1TR 2IW1A 4LMPA 4EHHA 3O4GA 2POCA 4QDZA 2ZE7A 3IEUA 4A4DA 4ZIRB 2VTBA 3IQZA 2DQKA 3DWGA 2PUGA 4J7UA 5F12A 1WETA 2OKCA 2VJAA 3O47A 4MGHA 3ZHCA 3KPJA 1LFDB 1KYIA 4QDTA 4ATNA 4JD5A 4EI7A 3B1JA 4PYIA 5DHUA 1RCUA 4NE9A 5DXAA 2BW0A 1AUOA 2ECPA 4IVQA 2GARA 3DE7X 1GNTA 1U04A 1UXGA 2GBLC 1T6NA 3UHFA 1X9IA 3VDQA 2AJLI 2J3MA 4XIIA 1EFRD 4M9UA 3PDJA 5DPMA 1J25A 5ECDA 3TRDA 4BMPB 5BWBA 3BWXA 2PHZA 1MEJA 2Q6OA 3K0HA 4I9GA 4WXPA 5L9AA 1GVHA 2AOWA 2X5NA 5CGQB 3WQRA 2RG1A 2VKQA 5ALXA 4DCSA 5B3KA 3RYCA 1ZCJA 3CE9A 2AE2A 3KYIB 4I50F 2VK2A 4KDEA 3MUOA 4M2LA 5A4KA 3DC7A 4NJMA 3BWYA 3BD8A 3RC7A 2OWDA 3ZZNA 1DIBA 1GUAA 4H0CA 1W49A 1JR3D 2A9QA 2IOFK 3CRRA 1ZMOA 2QD5A 4CPDA 4RCVA 3BGOS 3MPOA 5FWYA 3IELA 4A6DA 1ORVA 2QXUA 3RLFA 2QMEA 3WSVA 2I7XA 2J85A 2ODNA 2Z8YM 1SVUA 3H97A 2YHSA 2GXSA 3RUEA 1XAJA 4HQ0A 4FR5A 1ODTC 2ZRKA 2OHJA 2HRZA 2HA6A 2QQGA 3L4BA 2XE4A 3QLVA 4YMTA 2R86A 4O2BA 4KZPA 3OZTA 4S35A 3WFZA 2BSQA 5EIBC 3HWRA 2N46A 2QY9A 5KSYA 1Z2NX 3CNLA 2OHGA 4YT4A 4CDMA 2RBGA 3D5QA 4LHVA 3I9V6 1OTHA 3HYRA 1WCIA 4FHDA 4OKSA 2C4TA 3WRVA 5FOSA 3DDSA 2H2DA 3D02A 1JG1A 3TSZA 3BS4A 5AKZA 4MR9B 5JR3A 5FTNA 1DNPA 1CDEA 1GQOA 2ZI5A 3AZQA 3C1TA 3ESQA 2CNWD 4M6WB 3L7IA 1LI4A 3QX7A 5C46F 4MVCA 4PSUA 1NF9A 1TA9A 2FDXA 2BKLA 3H1FA 4KXMA 1Q19A 2ZU6A 2EFEB 4OHKA 2R44A 1L6RA 3D3EA 1J90A 1FPQA 2Q4OA 3FYHA 3PD7A 4L5CA 1FUEA 1AKNA 1RD4A 3JZDA 2RHHA 5HQ3A 4MUFA 3LV8A 2CXOA 5HCIA 4KQCA 4GKJB 1G20A 3KAPA 5TQVA 3TIFA 5KYXB 4GWKA 3EF3A 1XUOA 1RP1A 2DBZA 4B3JA 2R6AA 4LZZA 3KYCB 4B3HA 3NBUA 2ZPUA 2Q3HA 4AK9A 5L7TA 4CMIA 1RYFA 1F2DA 3VU8A 2WRZA 2Y1EA 2GUWA 2JASA 4ZOLB 5AKXA 3W5SA 1JWAB 3TXXA 5I7UA 1VJCA 3ESBA 1A97A 4IFBA 4LYAA 2LE0A 5C1PA 1AS0A 2VZ8A 4R0NA 3VVBA 3RO7A 1V7ZA 4IDDA 3UJ9A 3QA3E 3BFKA 2BSAA 1JAZA 2OXEA 1ODKA 2PX5A 3QU2A 4LZAA 1LLCA 3MIZA 1QGDA 4P3XA 1CY6A 4P3NA 3FJYA 4HAVA 1K3UB 3Q9NA 3WL8A 5HGJA 1ZNYA 2AE1A 2XWPA 2G09A 4L50A 5FO1A 1E8NA 2CMGA 4GPEA 3JAWA 5K0TA 4MZDA 2BGRA 3NATA 3SGLA 3SK0A 2RB5A 3LKZA 4NZ9A 1SEPA 3WKDA 4NZPA 4GX2A 2AWNA 2QM7A 1FMJA 1YZHA 4Y30A 4Y0NA 3BREA 1CETA 1O6ZA 2PWAA 1FFXB 1ZD9A 1PFVA 3P2IA 1C7IA 4FFRA 3QVJA 1TF2A 3CKMA 2C2HA 1WXFA 2I3BA 1GZ6A 4OG2A 2DR0A 2O3QA 3DAFA 3QEMB 2HEGA 4LJ4A 1YDEA 2VP0A 4BLOA 3BGDA 4G5FA 1SUSA 3VO1A 1Y8RA 1TFUA 2HRQA 5BWLA 4XW2A 4IXDA 4LXYA 4Z7NB 3ZXYA 4B87A 1KHTA 3OJFA 1QGZA 3DO6A 4YJ3A 1TLFA 5B4VA 1HT3A 1RHUA 3FCOA 2FPWA 1SB8A 1A8UA 1Q1BA 3KKKA 3Q3GE 4CHGA 3A06A 1F8YA 5JHHB 3HEAA 2C3UA 1IXYA 5T57A 2VOJA 2NU8B 3UEOA