3Q3GB

Crystal structure of a-domain in complex with antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
224
structure length
224
Chain Sequence
QVQLQQSGAELVKPGASVKLSCTPSGFNIKDIYMQWVKQRPEQGLEWIGRIDPANDKTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCASEGHYGYDGYAMDYWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/cell adhesion
molecule keywords Antibody Light Chain
publication title Stable Coordination of the Inhibitory Ca2+ Ion at the Metal Ion-Dependent Adhesion Site in Integrin CD11b/CD18 by an Antibody-Derived Ligand Aspartate: Implications for Integrin Regulation and Structure-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 224
sequence length 224
chains with identical sequence D, H, K
ec nomenclature
pdb deposition date 2010-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q3gB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q3gB02
3ILPA 4XNMB 3C5ZC 4JZOA 4JHZA 4TUJB 5FO8A 3KS0J 3KXFA 1NGWA 1OTUC 3MQIA 4G8FB 1XR9A 2YRZA 1ADQL 3N1MC 3EYOB 3O8XB 4FN0A 4Z78B 4QXUH 5ISZA 3Q48A 3UAJD 1QLEH 1RULL 2FGZA 2YEZA 4YEEA 3W9EA 4GKZA 1KNOA 2X4QA 4F3FB 1DQJB 3P77A 3VWJD 2R4SH 1A3LL 4G8IA 4K8RH 3GB7A 5EPMB 1MWAL 2AW2A 5IFAH 1SYVA 1WBZB 1XGYL 4KUZH 3MV01 3O4LE 1A9BA 1UH3A 5TQ0L 5LWYL 3QNXB 1UM6L 2EDTA 5IFHL 2BSSA 1A2YA 4WHTA 5LAXB 2ESVD 2B4CC 5C2BL 5CP7A 3WHE0 4NT6A 2ZSVA 2BZDA 5CEZL 5CBAB 4JREB 3GZKA 1CTNA 5K9QG 5IV2A 2F9BT 3AS2A 2YXMA 5TPWL 2FGWH 3VXUD 4Z7UF 4F7PB 3VU2A 1XF3A 3AY4C 5C9JA 2H45A 5ETUA 5JW3L 3ARGC 1PG7W 5ICYB 3C60C 3GMRA 4Z76A 2ICWA 5HYFA 4WFEE 4KVCH 3FQTA 4KUCF 2P5WB 2VDPH 4X9FA 5HGDA 3UZVB 5I1DA 5DHVA 2ADJB 1A7RH 4QRRD 4K3JL 3SE4A 3JTTA 5E5MA 4LKXB 4DW2H 4RMVA 5DK2B 4ZUUA 1MPAL 4YBQC 3HNTH 3MLWL 4NO5A 4Q6IA 4WWKC 5ID1A 5T5FL 1CFQB 2MSPA 3G9AB 4Z7VB 2EEAA 4OD1H 3AUVA 3MRGA 1I1YB 2A6IB 1Q0XH 3L3JA 1SYSA 4FZ8H 4GO6B 4KJWC 1NUDA 1IC5H 5GS2H 3SGJC 2PTTB 2CLZA 3O41A 3DXAE 4HGWA 4L1HA 5D8JH 4YHLL 3GIVA 4F7MA 4L9DA 5GGSY 3TBVA 1R3KA 3C5JB 1A1OA 1FAIL 5E2JA 5F93C 1GHFL 4MNGA 1ADQA 1S9XA 3BD5A 4P2QA 3TO4C 2EXWD 5DD3L 3EO0A 3HS0A 4XWGH 4Y5YC 4OUOA 5EBLA 3FQRB 1FP5A 4CADB 2VZSA 4DQOH 4LCCB 4QXUL 2LU4A 4BH8B 2XWBA 4KK8C 3T8XA 1DN0B 4DKEL 1MHEB 3SKNB 3GSOA 4GSDH 5DJ6B 1FVDB 2R0KH 1F3RB 2XTJC 1FFOB 2X9XA 4RA3A 1FO0L 4GT7A 4IIQA 4K8RL 4LHQB 5IFAL 15C8H 2MFNA 3PWLA 3WFHB 1QP1A 3HB3D 4HKJB 3QP3A 4HUNB 3EOBA 3HE6D 5HD8D 3EZ8A 3K4ZA 1NANH 4G43B 1QO3B 1OGAB 3RTQB 3HZMA 5MEPB 3TCXA 2H6PB 1FCCA 3MR9A 1P9MA 3JZ7A 4GKSA 3KJ4C 4U31A 2FJGB 3CX5J 3B83A 1G9NL 5JXEA 4MXQC 3E6FB 3FRUB 5F89B 2AXGB 1HHJA 5IB1A 2UZXB 5INCA 2Y07H 3FB6A 4AT6A 5LQBL 3O4LD 1QFWM 2EXYC 1BBJB 3B3IA 5EU3B 2D0GA 3CFEA 4LEXH 3DV4B 5C08A 1QRNA 3UJIH 4Q9QL 5E99L 4XC1L 4ZS6D 5HHVH 4LPXA 4X7EC 2GSGB 5D7SL 1JF1B 3S36H 1S5HA 5D1QD 3DARA 3O0RL 1QVOB 5EZOL 3K0WA 3V2AR 1NCCL 5FYJL 3MJ8A 5M7QA 3ZSTA 2FIKA 5DTFA 1OM3H 4OGXH 3AVEA 3VWKD 3OR7B 4DW2L 1PKOA 5FKAA 4KJYB 1CDGA 2JELH 4RX4D 1YEGL 3OXSA 3FO9A 5TQ2H 2X7LB 4EUPG 4WFED 3C2AL 4ZSOE 3IF1A 3BDYH 2GUOB 2K1MA 1F00I 4X99B 2OJZL 5FYLE 4BZ2H 2NY5C 3PGCA 5DMIH 5E4EB 4FZ8L 3R0MA 1U8QA 2C26A 2FJHB 4GRLD 4PJBE 2R8SL 5D8JL 1U2CA 5DUBB 5HGHB 1X7QB 1GZPA 1QEWA 1VESA 3O9WA 4FQLH 5E9DA 4Y2OA 3I2CH 3WFDH 5MENE 4AENA 2EE2A 1ZVSA 2XZQL 4XB7A 2AJUL 4XWGL 4D94A 4KJPD 3X12A 4D3CH 5C7XH 4PB0H 3O6FD 4HF5L 3DXAD 5B4MD 3U6RA 2PETA 3X3FH 4GSDL 2LU3A 4PYHA 2A77H 5DF0A 2R0KL 5GS0L 5D1ZA 2YS4A 3GMOA 4P3CH 4P2OC 4WFHE 3JTSB 3L3GA 4LLMB 4NZRL 15C8L 5T5NG 3B6SA 1MCEA 3D5OF 4HC1A 3MJ9A 3MNVA 1JPTL 1P5UA 3ARBB 3L3KB 2ZUSA 5BRZD 1KJ3H 3WCYA 5CMAB 4WV1C 2NY2B 4HPYL 4JKMA 4U1MB 3BZDA 4HX1A 3MUY1 2AVGA 1MJ8L 3B8SA 2JJSC 5KBNC 4UOW0 3PGDA 3QAZB 1YJDL 2BOCA 1F4WH 2IAMD 3C6SA 4NHCH 2Y07L 1C08A 1MRFL 2OK0H 2A9NL 2NY0C 5DD5L 1Z3GH 2JK5A 4LMQI 2R1XA 4KJQC 4OFIA 2FL5A 1MCRA 3K2UH 4L1DA 4LEXL 1U2HA 2ATKB 5EBMB 5FYKE 1R5WB 1YY8A 1G7MA 4G42B 4YHIA 5TDOA 2CGRL 4NRZA 2F8VA 1KN2H 4NQCB 1FJ1A 1V3LA 4OGXL 3UBXA 1Q94B 4H8WC 1G6RL 4N0FA 5I75B 2GT9A 3BPLB 5DK0B 4A2LA 1RZFH 5CD5C 5EUOB 5D71L 1M6OB 2A83A 1JFQH 5F6IB 1LDPL 5JIKA 4X6CF 2SEBB 4P99A 4XNYL 5LGHL 3KYKL 4IRSD 3GI8L 3G6JA 4BZ2L 3TBTA 2GIYA 5DMIL 3RUGA 3QIWC 3T1WA 1INDH 2RR3A 1B88A 2MQ0A 1KJ2A 5K9OB 4YNYB 1QSEE 4BELD 4QCIB 1F5WA 4MDJA 3MMEA 4HK3N 1UFUA 4JDVA 3I2CL 4PJ7B 1L4IA 2ERJB 1A7OH 4MWFA 4K3DH 3QCTH 4JVUA 4DGYH 3EAKA 4KMQA 4R96B 4JM2D 4UNUA 1IARB 5C7XL 1UB6B 4GQPH 2FWOA 1SM3H 2HTLC 4ZXBB 4XCNB 3A6CH 4MXWH 4R4BA 1MCPH 3L5JA 4WJ5A 2G60H 4NC0B 1FH5L 1YDPB 1HZHL 3INUH 4JJ5B 3MRDA 4AM0A 2DB8A 1GGTA 5CEYA 3KPSA 3N1PC 2C7UA 4P3CL 1FIGL 5ERWA 1W72B 3BVNB 3SDCB 2VE6A 4R0LA 3TIDB 3VE0B 4J3OC 5IESH 1FYTA 1PG7H 3IFOB 1KJ3L 2V7HA 2ED9A 2XIDA 5K33A 4NYLB 1T0PB 3ZE1F 2I24N 1KCLA 2Y7QA 4HCRH 4Q0XL 3UTSE 4TVPE 3SKMA 5I1IH 4U6VL 4WFHD 1IE5A 4NHCL 3UTTA 4DKAA 1KB9J 3PJSA 4XP5H 1IGIL 4JCLA 4QRPB 3D18B 3C9NA 4XCEA 4X6EA 3WD5L 2Z8VC 3U9PH 5I1LA 5IT2H 3MCKB 1G7PA 1K8DA 1BX2B 3D48R 1ED3A 2LTQC 4WTXA 3R1GH 3K1DA 2YPLA 1UQSA 3GSQA 2XWTB 4NOFA 1MFBH 1ZT7B 1OP9A 2ZOKB 4MAYC 3OAYH 1FL3A 5CILH 1U0QA 1OAXH 3ULUF 4NWTH 1JZ4A 4RBPH 5JORA 4YDLC 1YNLH 3V4UH 1YN6B 4G9FE 5M95B 2DQDH 5KSAB 3UYRH 2K3TA 3BPNC 2YRLA 5DQ9A 3GMNA 2HA1A 5FYKD 1JFQL 1G9MC 1HE7A 4MHHG 2EO1A 2ADIB 3H9HB 3T09A 4F7CB 5SWSA 4PJFA 4LRNL 4KY1H 1BD2A 1JJUA 1Q72H 1OD7A 2QEJA 3I3EA 2I07B 5A2IH 4F3FA 2DM7A 3IKCB 3DBXA 2Y06L 4CVZA 1I4FA 4FFZH 1R5IA 2N1KA 2OR9H 2Y5TB 5FM5M 2Z92A 4X8JA 4LCUB 3QWQB 2BY3A 4CVUA 1A6TB 5FA4B 3U0TA 1L7TH 2FX9L 3RDTD 4NUJB 5JW5B 4LNRA 1WGOA 3ORJA 5I17B 1CFVH 1J10A 4GMTH 5C0BD 1GJIA 2BHUA 1G1CA 4POZC 2LVCA 1IBGH 1L7IL 1SM3L 1FDLL 1KT2A 1XGRB 1WIOA 4GRMB 3KJ6H 4MXWL 4QY8B 1MCPL 4NHUB 2VH5L 4ZPTB 2WK2A 3ARVA 1WLHA 5ESVA 4HV8B 5EU7C 1D6EB 3EFDH 5I8OH 4JPWL 2P8LB 4EEEA 1PLGH 2EDQA 1HEZA 4MQXD 4ZS7L 5E5UB 5ICYA 4JQXA 3SKUD 4NKOA 3QHFL 1U6AH 3REWB 2ZUQC 5F7NC 2PYEE 2FJFA 3PHOB 3RKDD 3EYUH 1H3VA 2P5WA 3NMEA 4OV5B 4EI5B 3DHMA 3WYRA 3IETA 3NFSH 3TWCH 3U83A 3QPXL 5CZVH 2YKLH 1YNKH 5DURB 5C71A 5DJXB 4HIEB 4NRYB 5IJVB 3FB5B 1FORH 3S35X 2YPKA 5DK2A 2B2XH 4YXLL 5LBSH 3TJHD 2IBZY 3F6LA 1EAPA 1K2DA 4Z7VA 4HUMB 4OZGA 3RWEB 3U9PL 2VUYA 2IGFH 3GNMH 3R1GL 1RUAH 4F8TA 3I75A 1CK0H 3F58H 1XAUA 4L3EE 1GCFA 3R06B 4PTTB 3VCLA 2IEPA 2NLJA 3WFBH 4TVPD 1OAXL 3I9GL 3MYJB 4V2CB 3V5HB 1TZIA 3C5JA 4IDJL 4MSWB 3RZCD 3ARED 2VLKB 3V4UL 1SY6L 3VD9A 3CFCH 5GIRA 1EDQA 4N1CA 5GSVA 1U93B 4P3DA 1BQUA 4K23L 1PFCA 1OAKH 2EH8L 3PV7A 4OB5H 4U1JB 2OS7A 4YDVA 5DFVC 2BNRB 1MHEA 1RURH 1AXSB 1Q72L 5IHZB 1GSMA 3VJ6B 5D7LA 4AEHL 4Y16D 4CUCA 3S36X 5KAQG 3SGDI 1OW0C 2HKFH 4G9FD 1QSFA 5JHDE 1R5VA 1WICA 4PGJA 3TBYB 3QUMB 4UDUB 3WFHA 4TSAH 1E4XH 3KWWB 4ZAKB 2VXQH 4YEFA 1DBAH 1FL6A 1CFVL 5D96B 2AK1L 4GMTL 5DVOA 5FCUL 5BS0B 2H2PC 3PQYB 2A1WH 2LAAA 3OR6A 5HVGB 5MEPA 1VB9A 4D0BB 5H94A 3U2SB 3FRUA 3NCJH 1BJ1H 5F89A 2ZPKL 3VWJA 4Z9KB 3S37L 1RK1B 3EUUA 2P5ED 5DLML 2WP3T 5GRUL 1B0RB 3GMLB 1MQKH 4KKCD 1ORSB 4R7DB 4NJAH 3QFJE 4OF0A 1CXHA 1MCWW 3QYCA 2H2SC 4JPKL 3CXHK 4WW1B 5F3HA 4FABH 1Z9OA 5E7FA 4YC2C 5I19H 3BIKA 1U6AL 1YEEL 3IT8D 3H0TA 4FNLL 2YD3A 3FRPA 3G5VA 4CL7A 3ZE0F 2QHRL 3QUZB 3BPCA 4ZFGL 1OY3B 1QYGH 4C83B 2ESVA 1QVOA 4ZFOL 3E3QC 3KYMB 1X5KA 5C0FA 4P5TD 1U8IA 4LF3A 5ICXB 1G1YA 1FORL 4CMMB 1INEL 4KZEH 1MNUH 1FV1A 2B2XL 2FEEL 1WCBB 3VXUA 3GSVB 5F9JA 3K4AA 5DJDA 1JWSA 1UJ3A 2PYED 3HNSH 5IHBA 3STLB 1QG3A 4KRLB 1XT5A 5BVJB 2GUOA 2IGFL 1ND0B 3NH7L 4OT1L 1AI1H 1YPZB 1T4KB 1X5AA 1Y0LA 3KPRE 2FJHA 4HKZB 2GJ6B 3CSGA 3WFBL 3VG9B 3GK8H 3QQ9D 5DUBA 2CD0A 4M5YL 3RBSA 4Y5VC 1SMAA 4DJMA 4K3EH 3CFCL 4I9WE 4D9QD 3TVMD 2ZWLT 1CDYA 3UYOD 1P4BH 4FQXA 1EERB 3SHSA 5FKPB 4JVPA 1E28B 1QQDB 5SX5K 1BFOB 5GS3A 1HNFA 1OAKL 4OB5L 4L3ED 4P46A 1IAII 3HCVA 3BW9A 1DUZB 1RURL 1V7NL 1B4JH 4PRPB 1MEXL 4JDTL 4AIZA 1JNLH 4DK6A 2X89D 1HXYB 4XP9L 1KC5H 2HKFL 1XGPB 4PJHB 3U48A 3NCCB 1FG2B 1JNNH 3O81A 4H0HB 4PJ8D 2VNCA 1J86A 1RZIB 3MOQA 1E4XL 4JFZH 4HG4K 5FYLH 3ARBA 5DJAB 1VA9A 2A1WL 5ID0B 4K2UH 1OF2B 4S11A 3EJYC 1ZANL 4U1MA 2VMFA 3GFUA 1E27B 5ICZA 1HI6B 5D7JC 4EN3C 3PWUB 3ZDXE 1UXSB 3NCJL 4NNPL 1J1OL 1WSST 2EC9T 4OD3H 3UC0L 1HOCB 2F8OA 4GXVL 3MA9L 1DFBL 4AQOA 1D5XA 3Q1SH 3O2DH 1KIPB 2YC1A 3QT2A 3G04B 5JPNB 3VFOA 2WINB 1MWAB 2DWEB 2EEDA 1CQKA 3ZKXC 3HE6A 1U3HC 2J12B 5EBMA 4H5SA 1IT9H 5C0CB 1OP3H 4I0PD 3UPCA 1HH6A 4APQC 2PTUA 3Q5YA 2JJTC 1IFHH 3MRJB 1FLTX 4Q97A 5GGUA 4XH2A 5EC2B 2VLJE 5CBEA 3DROB 4N5EC 1UYWH 3TV3H 3CVHH 4KZEL 1KG0B 3ULVF 4MA3B 3QFJD 1AGCA 4PJ5B 5TFSH 1BGXL 3STBA 2NR6D 1FFPA 5C0AE 5EUOA 1M6OA 1S9WA 5C0GA 5CHNB 1JN6A 3HNSL 1EBAA 2SEBA 5BJTA 4HKBB 1BM3L 4WO4D 2MCPL 2EZ0D 1I75A 1M71B 4HAFA 4FTVB 1QA9B 5K9OA 4OCRH 3BO8B 1PG7X 4Z0XA 1CCZA 5I1EL 3GK8L 4QRSB 1OGTA 3QPQD 1UGNA 3MRIA 3QDGE 3Q3GB 4P5MB 3D85B 1U8NA 3WE6B 4CJ0A 5I30L 5FHAH 3EGSB 3DVFA 5EIQA 1AQKL 4X5LA 1FYHB 4OCXH 3WFEL 4NZTH 1IGCH 3CLEH 3P9MA 1ZS8A 3KPRD 3QG7H 1L0YA 5BMFH 4YDJB 4LP5A 1DQQA 5IVZB 5EWIH 1YDPA 3MUGB 1QR1B 1JBJA 1FGVL 1XR8B 3RVVD 4JJ5A 1ZWIA 4I9WD 2OMNA 1JNNL 1CGWA 4L29B 2D0HA 1W72A 3BVNA 1QSVA 3TGXA 4RMSA 4Y19A 4JO2H 3VGAC 4DUVA 1BP3B 1U8OB 2F54E 3TN0B 3VE0A 1MI5D 4EXPX 4LSPH 4ZTOH 5FYLL 3T2NH 3O6FA 1QPXA 5JXAH 1RZJC 3B9KC 4K2UL 1AKJD 2EDYA 2YD9A 4M9PA 3OGCB 3OF6D 2QQQA 1G7QB 3HI5H 1YQ2A 4KTEL 3MNZB 3ARWA 5JUEH 4ONHA 3L5IA 1AY1L 1K4CA 3Q1SL 1BVLB 1H8OA 3D18A 3QEGH 5K59E 5D5ME 3OKLA 3FTGB 1KJMA 3DVNB 2XICA 4O9HH 3VXSE 4OFYA 2EIEA 5DEZA 3R8QA 5IEKB 3WDHA 5BRZA 4M6NH 4QTHA 3VFMA 3IU3B 2A9MH 3BGFC 1OAUH 4IM8A 1CXEA 4PTUB 2ZOKA 4QXTB 2G9HA 4GG6B 3W5NA 5DZLA 2HT3C 2IAMA 1WBYA 2DQFB 5KG9B 3VDBA 3WDIA 3GSUB 2V7NB 1JMZA 5KTEH 4KI5D 3T0EB 5DRZB 2LAGB 5KSAA 1BWWA 5E8DL 3MRRB 3X11B 3MBEB 4PRID 3KAAA 4IRJB 3KLHD 1I7ZB 4YHMH 1J12A 1RUKL 1NLBH 3TC9A 3UDWC 3GDBA 3W2DH 2FSEA 3NIGF 1TCMA 3PWPE 2X6MA 1MHPL 2VLJD 2W0FB 4UAOB 3ZMRA 1K3ZA 3RWDA 1HHHA 4MA8H 2XTJE 4P4KB 5IBLD 3V7MA 1A5FL 1EV2E 1A6TA 1QFWI 1XGTB 5JW5A 1G7JA 1W0WB 4NUJA 4I3RH 5IIEB 3EOAA 3VRLF 5IEHA 2OJEB 5FHAL 5EO0A 5I17A 5IBUG 2APBA 2R4RH 5FYKL 3JWNC 4J8RB 4OLWH 4NZTL 4IRSA 4OF8A 3CLEL 4NQXA 5E6ZA 2DM3A 3X3GH 4U6TA 1DR9A 3LRSA 4QY8A 4NHUA 1JE6A 3WV0A 4KDTA 3MRHB 4LLUB 4NKMA 3TNMB 1UKQA 3IFLL 1E6JH 5C0JB 2FYYA 3BP4A 1D6EA 5TE7H 2YN3A 1NEUA 3P4NB 1LP9B 3JWOL 1MJ7H 3ESVF 3WXWH 2DM2A 2CRMA 1BOYA 1EJOH 4JO2L 3REWA 2V5TA 3TZVB 1WBXA 2GK0A 3SDYL 3EJZC 5DQJA 3ZSSA 3OGOE 5JO5B 4OV5A 2XY1A 1D5ZA 1Q9LA 5C6PB 4U1KB 5IM7B 1I7RB 2C3VA 1MCWM 3OKNA 1G7LA 3V6OC 2LQRA 4NRYA 5E2WL 5IJVA 5L88L 1VHPA 3HI5L 3M8OH 3WJJC 3RX7A 5T1LD 5AYQA 4NUGL 3ARGD 1D5BB 2IALA 3DO3A 2RQ8A 3GJFH 3C60D 1OP5H 5BW7C 4LKCB 1A4JA 2VKXA 2WP3O 1PSKL 3RWEA 1EBPA 2X70B 3VFWB 4MLSA 5TE4H 1LQSR 2ILLA 5DC4B 2V5RA 4QOKE 3R06A 4PTTA 5D1XB 3SQOH 1UXWB 5J57B 2W60B 1U8PB 2NX5E 3MV11 4YBQD 3MFFA 2XTLA 2N4IA 1EAJA 4UV4L 4AK1A 2IQ9H 9CGTA 4WWKD 1N8ZB 2BVEA 5KTEL 3FHQA 1XF2B 1KPVA 3CVIH 4H26A 3T77B 2BXZA 3UX9B 3T04D 2X4NB 1JVKA 4QGTA 4KJWD 3MOBH 4YHML 1NLBL 4U1JA 1IC7H 5IHZA 2V9QA 1UKSA 4M02A 1TVDA 4I5BA 4BSWA 2KBGA 1F6AB 3SKJH 4WDIA 1PD6A 2AABH 4TVPL 5DJZB 1EZVX 1UZ6F 3V9FA 4NFBA 4L9LB 3TO4D 1BQHG 3BX7C 1KYOJ 1MCNA 1J8KA 3S88L 5L8LB 3P0VH 4FQJL 2YBRA 2HRLA 3DO7B 3IRZA 4BUGA 4X4XA 1INQA 1YC8A 1UACH 2YN5A 1U8LB 4KK8D 5F9WC 3GSXA 3PWPD 4D0BA 1MJUH 5C07E 3C5ZB 3FB8B 3U2SA 2XTJD 4Z7OE 4CVWA 7FABH 3PWNA 1XH3B 2NY4C 1U8KA 4PGDB 3G6JF 1N2RB 3RUGF 1NGZB 2AJVL 1WFOA 1T1WB 5TE7L 2ICES 3GMMB 1HILB 3L95B 3RDTA 5D72L 3M1BA 4RAUB 1MJ7L 2E9IA 3HC4H 1TFHA 1ONQB 3EZJB 2BMKA 3NA9H 1A6AA 1F6LL 3BN3B 5C0BA 3FCTB 5ANMA 3SDXA 4PJEA 1UM4H 3QUZA 4LAJH 4MXQD 1YMMB 4ELME 3JSSA 1EHLH 3NZHH 3HI6H 5ICXA 4WWID 5FDWA 4CMMA 1UM5L 3M8OL 4F9PA 2R29H 1CFTB 2UY6A 3Q6FA 3BPOB 2WQ8A 2Q3ZA 1IEBA 1SHMA 2EXYD 4XI5D 5CINH 5CJXA 2GYSA 1J5OH 4PJDB 3DRQA 5IR1A 4UTBH 1QBMH 4X4ZA 2NXYC 3PIQB 3NBNA 4OZHE 4Z0BH 3B5TA 3MJGX 4F8QA 2DOCA 4H25A 1ND0A 4PY7A 4WUKH 5TE4L 1BQSA 3NCYP 3PDGA 5T33L 1T4KA 1IAIL 2CKBH 2EYRB 1F4XL 4S1SH 4ZNCD 5LCVH 5GHWL 1IC4H 2P1YA 5J06A 3ZT6A 4I48B 3WS6A 5KW9H 1G7IA 2I5YH 2X1XR 2VDML 4NQDB 4JQVA 3VI4E 2R69H 1XGQA 3IDMB 2EE9A 3IKKA 4Y4HB 1QQDA 1BFOA 5I8KH 3FQXB 3B2VL 2EIDA 4QOKD 3KLAA 4AMKH 1F3JA 5GRVL 1HN1A 2NX5D 4IMLA 4MMZC 4BA8A 4KRPD 1EEZB 4PRPA 1MCLA 1AR2A 4YGAB 1H15B 1HXYA 4U6YB 4F9LC 5DVKA 1AGEB 3DMMD 1FG2A 3LN5B 3O2VL 3P0VL 3RL2B 3ALWA 2FD6L 3PV6A 3VD4A 4DWHA 2PO6B 1UACL 4S2SB 1JGEA 1PZ5B 3IS1X 1FPTH 1KEML 5E8PA 3C8KB 5DQDH 5I74B 2D3VA 5T1KD 1SBBA 4HUVA 4I18A 4MZ2A 1NGQL 2R9HD 1W2KT 5MERB 4PJFF 7FABL 1W8NA 3O3DB 3UTPE 4F33B 3DX8B 2XXMB 4P2OD 3AFLA 1NSNH 4XVSH 1G7HB 4J3SA 5LGKA 1U3JA 4HWEL 4GJTB 2WINA 2DWEA 3BDBA 5IQ7L 3FT3B 5HJ3B 1T7YA 3KPPB 3NA9L 1FIEA 1MREH 2O5ZH 1TQCB 3HMXH 4NWUH 3FFCA 5C07D 2FX8H 5K9KB 1NGPH 2APTA 3NIFF 4ZPVA 4HDIB 1JNHA 1OSPH 1T1XB 3DROA 3WUWA 2P5EA 3Q6GH 2HFFB 3K8LA 5ACMA 5ESAA 4KROC 4OZIB 4KJQD 1YEFH 5BCAA 5IW6A 5H37H 1NDGA 2VR5A 5CEXB 4K71B 2I9LB 5E70A 5JDJA 5CHNA 1DEEA 2PF6A 2VZ3A 4MJ6B 3L3DA 4HKBA 2C4XA 2PNDA 1D7FA 1NAKH 2BOBB 1LD9A 3S3SA 4HFUH 5IW3A 3RL1A 2M8XA 1IEAB 3TT1L 3LEYH 4P5TA 2F53E 4D8PA 2HLFC 1IC4L 1N6QH 4OZFH 1MLCB 5F7EL 4TSBL 5KW9L 1A1MB 3EGSA 2I5YL 2VDKL 2VQ1A 4JFDD 1H5BC 1OAYH 5IW1A 5E08H 4FMKA 2FATH 1F45A 2KL6A 1C5CL 3QIWD 4M7ZB 5I8KL 4PJAA 3BP5A 4LCWA 4NO3B 4YDJA 5DO2C 5D6DC 4HWZA 4KU1A 3N0PB 4OZGF 5IVZA 4KXZH 1QR1A 5I6XC 2X1QA 4NDMA 5D2NE 2HLAA 1PX4A 1T7XA 4LK4A 4OSUH 1FZMA 1KXQE 4DGVH 1A6UL 2GTWA 2WUCL 3TVMA 1MIMH 1YYLL 1EVTC 4ZOEA 5C09B 4JM4H 1A7QH 2ZCLH 4U0QB 3ZKQD 3CFKB 2HTLD 1BFVH 3FONB 2K7PA 1DCLA 3E8UL 4JG0H 4DKFH 5DQDL 3ZLQC 3P0YH 5BZWB 1WIUA 4ISVA 3MV7D 5FF6B 3E2HB 2Z31C 4CBPA 4PG2A 4JHWH 2V2WB 3HI1A 3BHBB 3VFNB 4XVSL 4QHKI 8FABB 3LSOB 4YPGB 5TDPB 2IPUG 4X4YB 4RGNB 3AM8C 4N9GA 4PY8I 1P9MC 1T2JA 3O45A 3E0GA 3O4OB 4PRDA 1NCWH 5JXEC 1OQOA 4JCMA 1JWUB 1VPOH 3RWIB 2AJ3B 1J0HA 2FX8L 5H2BA 3R4DA 2WWMC 2X4UA 4XX1E 1DSFL 1IM9D 1AR1C 2DYPA 4GG6A 4M1CC 1NCDL 2FX7L 1CS6A 3OKDB 4R6UA 3IXAB 3AB0B 2V7NA 2DQEL 2VB5A 1RZ8B 5H37G 5HDLA 4F58L 5DGRA 1IAKB 2XXCB 1SJHB 1KCSL 2YUXA 3LV3B 3TIEB 5JNYB 3GM0A 4I0PA 1HINH 4H0GA 5DMKB 2FECI 3U46B 1JPFB 1MY7A 5E2TL 1U95B 2W0FA 3V6FB 1HIMH 1A14L 2OMBA 1RY7B 3LEYL 4LVNB 2A2QT 4ZFOB 3VXNA 1NL0H 3DVIA 4JG1L 4AL8H 4OZFG 4MA7H 3QFJA 1MCQA 3Q2CA 4NQEE 3GBNH 2CJUH 1JF5A 3WUZA 4Z7QE 1I7TA 1JRHH 1DQTA 43C9A 4MJ5B 5A2JH 4M00A 3O4LB 3SDAB 3QQ4A 4XNZB 3BT2H 5E00B 4HUKB 4WO4A 4XTRC 2DIAA 1K4DA 4ZTPL 4RQQB 2F53D 5IQ9B 4F15B 3H9ZA 2P4AB 3P11H 3TNNA 3IDGB 5F3BB 4KKNA 1JHTB 4G8GE 5BO1L 4OSUL 4PP2A 3U36B 1PKQE 5TDNA 4XC3H 5HHXH 3TM6A 1LP9A 5AG9A 4JZJC 3NGBB 3WN5C 1CGSL 4FQQB 4PJXA 5CJOL 4POZD 3TZVA 4JQIH 4X80L 1FFNA 5JO5A 4KZDH 5DWUH 5MEQB 2XPGA 4DKFL 4KTDH 5IM7A 1I7RA 5C92A 4X98B 4Y1AE 5T3ZE 2CXGA 4I2XE 4DCQB 4JKKA 5DUPH 5HHME 4JHWL 4QGYA 3RAJL 3LN4B 3PWVB 4PV8A 3WO4C 4LKCA 1JGLH 1CG9A 1AO7D 4YDKH 1MI5A 3BEWB 4JY5H 2X70A 1NCWL 1SBSL 2MJWA 4B0MM 5HYJB 1UJTA 1EEYB 1VPOL 1TETH 2VWEC 2YZ8A 3S4SG 4ETQB 2DI8A 2DQJL 5EU6E 4PRBA 4S0TD 1AIFB 1UXWA 2W60A 5EZJA 5GSRA 3RWGA 3QUKB 1MHCB 5EC1B 1ODAA 3WMSA 4ODUB 5KVDH 4M62H 1LO3L 1N8ZA 2WANA 4YWGH 2DJ4A 5T1MB 2Q1EA 4K94H 1KLGB 4YAQB 5D9SB 5I0DA 3ARFB 1OPGL 1FBIL 4HS3B 2BVUA 3D87B 3MFGB 4WHDA 1N5YH 3EYFB 3V5DA 2RBLA 1XF5B 2VITB 3KHQA 4JO1H 1R3HB 3VFPB 2IADA 4JB9L 4DVRL 1B0GB 1NMCB 3D3VB 3GSWA 4E9LA 5L2KE 1S7VA 4M6OL 5KS9E 4AL8L 4LVOB 3ME0A 3H3KA 4UTAL 1CL7H 2W65B 1C7SA 1NGYB 5F8QC 1CR9H 3ZTJG 2GITB 3N1QC 5DC0A 3TA3B 4PRIA 1JRHL 1BIHA 3IS0X 1IRAY 2YD1A 4G6JL 2DQCH 5DFVD 4OQTL 3VW3H 1U8LA 4QHKJ 1U91A 2XN9E 4N0CC 4LPVA 3QUYC 5C8JA 2BRQA 3NFPB 1LEGA 3C5ZA 4PY8J 2HWZL 1KTKE 1TNNA 3BAEH 1NAMH 4U2ZA 3U1SL 5JLZB 1M7DB 3P11L 3QXTA 4JFFE 4YDLB 1FAKT 4RAVA 3LS4L 4XHJC 5F7KC 1J8HE 4NQED 3ARPA 5I1CH 4XC3L 3UZQA 3TT3H 3L7EB 4WU7B 3RVUC 1I1CA 1SJEA 4WW2B 1KSRA 4RAUA 3A0OA 1MCOL 2B1HH 5DJ8A 4FRWA 3DVGB 43CAB 1IGJA 5JOPE 3BXNB 1ZGLB 2H2PD 2VAJA 3BH8A 3HUJA 3FCTA 3CDCA 2ZUVA 4KZDL 5DWUL 3WLWD 3X14A 2DDQH 3MYZA 2EDKA 4YXKL 2XZCL 4G8GD 4PB9H 1S7UA 1XCTA 5B3JF 1QSZA 1MQ8A 1T6WA 4Y4KB 3WIFA 4F57H 5LGJB 4OLZH 3GO1L 5I76B 5DUPL 1ZHBA 4JGMA 4QEGA 4YHZL 3QIBC 2H2SD 4NNYA 4PJDA 4R0LC 3TEUA 4HLJA 4P23C 4OJFL 3VFVB 1A22B 4N9OB 3GHBH 3BZEB 4O2EA 5CJBA 3IU4H 4NRXA 1R3LA 4V2BA 3A6BL 5KSUA 3WIIL 4XCYB 4GBXB 3SE9L 1OB1B 4KHTL 1CT8A 1MFAH 3LKPA 4OI7A 5T3ZD 1TETL 4JLRB 5LXGH 3CX5K 1N0LA 3PF2A 3MV8E 1BIIB 4TNWF 3SGKC 1ACYL 2P45B 5HHMD 1MOEA 1N26A 4LASH 4PJBB 2NYYC 4POUB 3QDJB 2DMKA 4RFNB 3ARGA 4WCYH 4AJ0A 1P4LB 3C60A 2FH6A 1VEPA 3LH2L 2EC9U 2J6EA 4QHUA 5MENB 3HZKA 3QI9C 2IH1B 3IDMA 5AYUL 4FQ2L 4MB4A 4Y4HA 2AK4E 2CIIB 2Y1VA 5EO9B 3HZVB 3I3DA 4P59H 4JO1L 5KVFH 5B8CB 1LK2B 1DANU 3QO1A 1JGVL 3T2OA 3IDJA 5I0ZA 1DBBL 3MLZH 3WNLA 2QSCH 3NPSC 1JZ6A 2UVEA 3IDIB 1E4KC 4UU9B 4WWKA 1F4YH 1CL7L 3O8XC 4E41B 3ZE1E 2C4FU 3CVHB 4UT7L 2AV1B 4L5FH 3RL2A 3FFDB 3VFUA 1P7QB 2A6KA 2RIKA 4KGJA 2X05A 5GGTA 2BY0A 2PO6A 5ENWB 1NLDH 2DQCL 4P4RB 3SGJA 2NY5L 3MLUH 4Q7DA 3VW3L 3OX8A 1RZ7L 1L0XA 4Q9RH 5J11B 3W39B 5L2KD 5MI0B 1KBGL 2HJLA 4XXDA 1D3CA 1NAML 4D9LH 1AQDB 5E2UH 4I1NB 4UT9H 2VC2L 2YR3A 3DX8A 4IRZL 1OARH 1UZ8B 1ZEAL 3C6LC 2E8ZA 3FO2B 3QQNA 3TCLA 2XRAL 1DLFH 2XG5A 4Y5YA 2PN5A 4JFHD 3WIHA 5T3XH 4L4TD 2B1HL 3PNWB 1LWRA 3NFNB 2IG2L 5F9OL 4BZ1L 2BSRB 4PR5B 1QLFA 4RIRB 1RUMH 5IMKA 4KGLA 2X4TA 3TF7C 3WS3B 5K9KA 4GAYB 4JREC 1ORQA 4EN3D 4JJHA 1X5IA 4GKNB 1UEMA 2DDQL 5IBUB 5ACLA 2EIZA 4K9EH 4HDIA 4PV9B 4DAGH 1T1XA 2CSPA 4PB9L 4U33A 4OLZL 4AYFA 1WAAE 5C70A 2BSTB 4M61B 4A6YH 3ES6A 5CEXA 4M48L 3ZKND 5JOPD 4Y88A 4LBEB 3RGVB 4PJIA 4ZMAT 1HQRA 4APQD 5J13B 4OLVL 3FO1A 3MRCB 1FNFA 3O6KH 2Y36H 4GAJH 4AG4H 3GI9H 2VDQL 2D4DA 3CC5B 3ZZ1A 4RMRA 1DQML 3QXDB 1I3GH 1OSZA 4JM2F 4JZNB 3OJDB 4N5ED 2UZIH 1IEAA 2IC2A 4ONFH 2QSQA 4O00A 2H1PL 4LASL 1QSEB 8CGTA 2BERA 4HCRA 2IMMA 1TQBB 1MLCA 4PBXA 4WCYL 1A1MA 4GAFB 4B5EA 2OR8A 4XVUC 4R90H 1A4KB 2L7UA 5DFTA 3TBWB 5GGRA 5EUKA 4TN9A 1ZLWK 1CXKA 1IGFL 4P59L 1C16A 4G7YL 3BN9C 2PYFB 5ECJE 4ZG1A 1R24A 1S9VA 3MLTB 4KMLB 3MLZL 3QUXD 2O61A 4H8WL 4X6DB 4MDIA 1KACB 5F1IB 4MX7B 4NFDA 5I66B 2R23A 3GSRA 5GGQH 4YHOH 4WI5A 4LCCC 4RBPK 5C09A 4CVXB 4L5FL 2LV4A 2AK4D 2EDRA 4P57A 4M1DH 4JHAH 2OZ4A 3MLUL 3T0XA 5JHLH 1S7QA 1XIWB 3V6OE 3SJVE 4WI3A 2BVPB 5IB4A 2V2WA 5ADPL 4EI6A 3HZYA 4HJJL 3UTSB 1DLFL 4QT5B 5TDPA 4X4YA 3EO9H 4ODXB 4M8QA 2VLRB 3RTQC 3RFZC 1X9QA 4X5XA 3PHSA 4XAWH 3B9KD 4KKAC 2XKNA 1TJIH 1U8MA 3TLRA 2V17H 5T1KA 1AGBB 2CRYA 2FECL 3RWFB 2YUZA 1H3GA 4LCIL 5GRZA 1P84J 4U6HB 4QO1A 4U1HB 3OKDA 4ERSL 2HVJB 3J8F7 4P2OA 1T21B 4F37K 4YFLI 5IVXB 2HN7B 4N90D 1OD9A 2Q8BL 3LV3A 4LHUA 4G9FB 5BZDB 2DQIH 1UWGL 4WV1A 4N5UA 5HY9B 5C07A 3QO0A 4GAJL 4XNQA 2VXUH 1JPFA 2E9BA 5D7JB 1KCRL 2JJSA 2DTMH 1FLRH 4JO4L 5F7DA 3V6FA 3R0NA 4ONGH 4E42B 1MF2H 3RWCB 3SDXF 4ONFL 4PJEF 4P2RD 5DRNB 3TO2B 3L3IB 4JRYD 1QBAA 3LKQA 4C56A 2AQ2A 2FNBA 2OTWB 1ACZA 3S5LG 1F2QA 1BHGA 4NKDB 4ESKA 4GUPB 3VD7A 3KNBB 3BD3A 3I02A 4PGCA 3SDAA 3TJEH 4OZ4B 3GJFB 1K85A 1X5FA 3O3EB 5EORL 3ROLB 4ELMA 1EJ6A 1KIRB 1IGTA 5E8EA 3ALPA 4MNQB 1UG9A 5DSCB 1P7HL 3IDGA 4EQ2A 12E8H 2CK0L 3ZE0E 3CH1B 3W0WB 3VXME 4KRNA 1KIQB 2FB4H 4JFEE 4HWBL 1UVQB 5JOEA 4Q6YA 1UWEH 5I15H 4JFDA 4G6ML 1NFDE 4WI4A 1G9ML 2LVEA 3QIWA 4JHAL 3K3QA 3EW3B 5MEQA 5IB3A 2UWEB 5JHLL 2EDOA 4X98A 3ZDYF 3H42H 4W70A 5CGMA 2BY2A 5DFWH 3ZL4H 3CMGA 1VFBA 2C1OA 1I9RH 4OQ1A 4OLYH 4NO0D 4U7KA 1SEBB 2EYTB 3GSNH 3L5HA 3OKOB 3CK0H 4IMKC 4N8PA 2PW2B 1E4WL 2YUWA 2NY2C 4U1SB 4R8WH 3F8UB 4JPVL 4OUUB 4UV7H 3QAZC 5KZCD 1OAQH 1AD9B 3OZ9L 4M7JH 5DVMA 3SJVD 5I9QB 1YECH 3MV7A 4HXBL 4UZGA 2XWJA 2R2HA 1LMKA 1CDBA 1N64H 1S78C 4G8EB 4NP4H 5T1MA 2XQBH 3VXPB 2HG5A 5D9SA 4RNRA 3RWJA 1YYML 1MH5A 4XP6L 4UOW1 1F8TH 4K7PY 4QTIH 3LAFA 4TRPL 4XCCL 3EYFA 4H88H 1XF5A 2DQIL 2VITA 4G5ZL 5MP6H 1EGJL 4OCSH 3IDNB 3SPVA 2FHCA 2CDGB 3ARRA 1KV3A 1GAFH 4G3YH 1IM9A 2B7DT 3VGDA 1FLRL 1N5AB 1HKLH 4HT1L 3KXFE 5I75C 1B0GA 5J9PB 4ONGL 5CUSL 3D3VA 3CPLA 3BPLC 3LHPH 1DVFB 1MFDH 1BAFL 4XB8A 1CD1A 1JF6A 3DGGA 4M6MH 3STZB 2W65A 3QEUB 5F6IC 1BQLH 2DBLH 2P24B 5DRWB 4MD0B 5HHQB 1R6VA 4YUEH 5JHDB 4NZDA 5ISZE 4QHMB 1LEKB 4OM1H 3P4MA 4LARL 3PL6B 3TJEL 1KTDA 1N3NB 5DJ0B 4LPTA 4MAYA 4GKOA 6FABH 4HH9B 2YWYA 4JY4A 3SKOA 2ERJC 3SDDD 5GJTH 1DBML 4HWBA 1CICB 2CKBB 3HHRB 3GRWL 4IBLT 1A8JH 1F90L 3OKKA 4L3CB 2O5YL 3DVGA 1UWEL 2NW2B 3BXNA 4ZXBC 4P9ML 1CU4H 5IG7B 1Q9OB 4GLRH 4X7TA 1BF2A 1JUFB 5IK3B 1FL5B 3TH4T 4KFZC 4MYWB 2NY4D 4HHAA 3VXMD 3KLSA 4TOYL 5JIHA 3MGTA 4JFED 4PJAF 1I9RL 2D03L 3SDCC 1DLHB 4OLYL 5F7WC 5AZEH 1CYGA 4Q2ZB 2H3NA 1UCBL 1QFOA 3JXAA 1RJLA 3UTQB 5L2JA 2WLYA 1I8LA 2CDFB 5EOTA 3O3AB 3V52H 3WNNA 1SMOA 3ZYIA 4R8WL 1JGDB 3G5YA 4M7KH 2D31B 3QH3A 4GBXA 2AXFB 1OB1A 1LO2H 3R8BB 1RZKC 4QF1B 3W11C 4U1NB 1OAQL 1HDMA 1UT9A 2OP4H 1H0DA 3D2UA 5DI8A 3B4NA 5GGSA 2R2EB 3U7WH 1OT1A 4J1UB 1T1ZA 4TVSa 4J3TA 4UINH 1EXUA 1A21A 3CLFH 4U1IB 4OCLC 2AJXH 1N64L 4WUUD 3OPZH 4E0RA 2WNGA 4RGMC 3IFNH 3DRTB 1XZ0A 5DA0B 3P4OB 3WHXB 3MOAH 4X9HA 1AO7A 1NJ9A 1F42A 2VN4A 4W4OC 2AEWA 2WUBH 1F8TL 4QTIL 5IB5B 2GFBB 1I8MB 4AEEA 4PG9B 3HR5A 4OCSL 1WTGT 4YJZL 1AD0A 5E1AA 1K5NB 1BZ9B 5T3ZL 4K3GA 4RFEA 5B3NA 4G3YL 3UYPA 1NCAL 1C5DB 1HKLL 4Z7NE 4MNGE 4HUUB 1WWWX 4P2QE 2ARJA 1AKJB 1MFDL 2QR0A 5KSAC 4EZMA 5I2IB 1CI5A 4HS8H 2W9DL 3L3OB 2FBJL 3FJTA 4M6ML 1IZJA 3CFIC 4AEIL 4E41A 5IVNA 1BQLL 3V7AG 1PGRB 3CVHA 1IMHC 3MGOB 3RNQA 3W9DB 1KTLA 3VXRB 4A2MA 3RY6C 2KZWA 3MTRA 3BGMB 3P73B 4O58L 2WQRA 2XA3A 3VD5A 5CAYB 2BNQA 3KXFD 1RD6A 4PUBL 3G6DH 1AQDA 2ZCHH 5JW4R 1UZ8A 4WFGE 4PREB 2QQNH 4ODVL 4PD4J 2F19H 4KKLC 1I1AB 4FFWC 2VDNH 2EKSA 3EO1B 2XG4A 1F58H 5GZOC 3NFNA 3WFZA 5DHYB 1I8KA 4L8DB 2F15A 1D6VL 2BSRA 4OZFB 1P53A 5EG6C 3MACH 4NN6B 1CU4L 1EX0A 4JO3H 4V1DE 4PJCB 5FUOL 1ZSDA 3WS3A 1NUNB 1TPXB 5JZ7D 1YUHB 4KDTC 4XBEL 1NCUA 1TMCB 4GFTB 4Y8DC 2R15A 4PRNB 3V0AC 1OW0A 3FOMA 5CZXC 2HFEB 2L7JA 4NKIL 4G6FD 1MLBB 3NIGE 3U0WL 5C08E 1QRNE 3MV9B 4KDWA 2C1PB 1L9NA 4Q74A 3G5ZB 2JB6B 4NZUH 5HYQB 4EI5C 5F9WB 4KKBC 5C0AB 4LSSH 4C55A 4M7KL 3WL9A 3CC5A 2Y23A 1BFSA 1YNTA 1MJJB 4PJXF 2OL3H 3QXDA 4J3UA 2OP4L 3ARQA 4G8GA 4BFIA 4ALAH 1RU9H 4JFXB 3WKNA 5MEOA 3GJEB 5F7YC 1ZHNB 3BWAA 4KROD 4UINL 5L7XL 1Q9KB 1DE4B 3QHTC 4JY6B 1OAZH 3ULUH 1TITA 1T1YB 4BKLB 2R0LL 1IM3B 5HYSG 3IFNL 1OCWH 3QDGB 4LGSB 4L8SB 1WWAX 3FOLA 3MBXH 3MOAL 3TBWA 3OG6B 2DS4A 3BJ91 3RIAF 5ALBH 3S8WA 1KOAA 2PYFA 1RFDH 1EPFA 5E9DE 4LEOB 3KYNB 3MC0A 4Z6AT 2VXSH 5L9DH 2HLFD 1YEHL 4JEGB 4X6DA 1S7RA 5CP3A 3O6MH 4RWYL 3S4SB 3WNKA 2VL5B 1GGBH 1HWHB 1OTSC 4YHNB 4KAQH 3K81A 3RPIA 3DYOA 1EFXA 3D25B 3ULSA 3HAEA 1QRKA 1U8JB 5A2KH 3P9WB 1ZHLA 4U1GB 3NVQA 5GRYA 2ARWA 4I8DA 1ZGLP 4ZUWB 1T22B 5HGBB 2F54B 5DS8A 2P47B 4JDZB 4H1LH 4WY7H 1OTTC 4P2QD 4TULL 4AIXA 1LO5A 4Y5VA 2ZCHL 3LMJH 5H35A 1GIGH 1CLYH 3ARYA 4PGBB 4ZAKC 2X4SB 3HLAA 3U7YH 3ZDXF 3QIUB 2VDRL 5FB8A 4QT5A 2I9TA 5D96C 3CU1A 3DUUB 4ODXA 3MA7B 2VDNL 1J1PH 2GSIA 3K80A 4KQ3L 1NBVH 1CE6B 4KI5F 3QJFB 2YMXL 5H8DA 3VXSB 1F11A 4LIQE 2KDGA 1F3DJ 3HC0A 4NQSB 5AG8A 2Z31D 1JWMB 1NBQA 3QNYB 4UQ2B 1I85C 1RZGA 4WFGD 4L4VB 4LLVA 3PHQB 5SX4I 4Z5RA 4HMCA 2EH7H 3EFFB 3MLVL 4OLEA 1AXTL 4L4TA 4ZOAA 1ITBB 4NZUL 1IQWL 5JXED 2H8PB 2ZG2A 4HKXB 4OLXH 4V1DD 4LSSL 1IKFH 3BKJH 4GQ9H 2WWMD 5E5RB 5CZKA 2CLVB 5D7JA 4F2MB 1AR1D 3ULVC 4F9PC 3BP7B 5EU5B 2OL3L 4U2YA 4HS6B 5HGAB 3HUJF 3O2WL 3PWPB 5C0RH 4RWHA 5C08D 3L3IA 1CZ8L 1QRND 3KYOB 1LHZA 1CD0A 4XCFH 1VFOA 4UMGA 2OTWA 3HN3A 1I9JL 3BKMH 1U3HA 4I4WA 1OCWL 2LU7A 3G6JE 3SQBA 2JCCA 4APQA 2W92A 4CNIA 4JFPA 2XT1B 2B0SL 3O3EA 3MRPA 1CLCA 1RPQA 3VG9C 3GJFK 5E94A 5ALBL 4MNQA 2IH3B 4KK5C 4W68A 4Y4FB 1FZOA 5JW4N 1A9EA 4JHBA 1TCRA 5KANG 4MJ4A 1S7SB 3W0WA 5CSBA 5D70H 3EOTL 3OG4B 3O6ML 1TLKA 4NSKB 5HHOB 1GGBL 1QTYT 2AS5M 1U8HB 3VXTA 1Y6KR 5F8RC 5F70A 1EO8H 4D2NA 1T0MB 4M93B 2PXYB 4H1LG 2UWEA 5E9DD 5EOQH 1MFEH 4ZFZA 2X9WA 5D7IB 4WY7L 1BREA 2WIIB 3KPSE 5DUMH 1PW3A 4R2GB 1JZ3A 1R0AH 1S9KC 3DX7B 1IILE 2NW3B 2FO1A 1CLYL 3I50H 5GRVK 1SEBA 2I60H 3T0BA 3U7YL 4NN5B 3OKOA 1DDHA 4FFYH 3ARDB 1EEQA 1FYTE 1B2WL 4L8BB 1J1PL 4U1SA 5B39G 1A1NA 4HBCL 1NBVL 2BJMH 4Z7WB 5D5MF 4TNVF 1FZKA 5DEFB 4HIJB 1G0DA 1MVFA 4O02L 3UTTE 1GOFA 1H3WM 1MAMH 4I3SH 3ESUF 1ROWA 1NAMB 1K8IB 1RVFH 4M7LL 3S98A 3NN8A 3SOBH 4LSUL 4RDQF 3DMMB 3GBLA 3LB6D 1NGXB 5D2LB 4UOJA 4OLXL 3B9KA 1PY4A 5FA3A 3V6ZB 3BKJL 3IDNA 2V6HA 2AV7B 4GW4B 3ZTNH 2AI0H 2DIJA 3CZFA 3PUCA 4FHBD 5IF0A 1D9KB 1SEQL 5J9PA 1MHHA 4XP1L 3CD4A 4TUOB 3MREB 1Q1JL 4XCFL 1CFNB 1IAOB 4MD0A 2VABA 4PJFE 5SWSE 3D0LA 1OWRM 1BOGB 4QHMA 4GG8B 1LEKA 2CUMA 4Y5XC 4RRPA 5DEGA 3IVKA 1FQ9C 3UXFA 3M45A 1N3NA 1Q38A 5I8EB 2DMBA 1RJZB 3EKCA 4PJIF 2VIRB 1T0NB 1MVUB 3TPKA 4P2RA 4JRYA 1FN4A 1KENH 1CICA 5D70L 2CKBA 4YBHA 3NIFE 1ZMYA 1M4KA 4NC2B 2APXA 1KJVA 3QCUH 4S1DD 1A0QH 2DQUH 4XP4H 1HSAA 1KB5H 5TH2A 1N0XL 5E8NA 2NW2A 3MJ7B 3LVEA 3P4LA 2DI7A 4OTXH 1CE1H 1H3PH 3UDWA 1LO0H 5IMLB 3WO3B 4N0CD 3VXQB 3QUYD 4XHQA 4E5XA 1EUTA 4LSVH 5DR5L 3KPOB 3NCBB 4TSCL 1JUFA 3MRBB 5IK3A 3UEZA 3OJMB 1XCQB 4MCYA 4PS4H 3ALXA 5CKGA 2P44B 4UILL 1BEYH 1URLA 3I50L 2WV3A 4QHLA 4YHKL 5DJYB 2I60L 4Q2ZA 5SWQB 1AP2B 3TN0C 2ZCKH 4OGAD 1CGVA 4D0DB 2P5WE 3DLQR 3O3AA 4ODWB 1P4IH 1JI1A 4YO0B 1C12B 1JGDA 3BSZL 1E6OL 3QA3B 2D31A 4MJIB 3G08B 2D7TH 4ZFFA 2PCPA 4YFEA 3GKWH 3Q5OA 3DURB 2PUQT 3Q0HA 2OSLB 4J1UA 1A6WH 4LNVA 3QIBD 1Q8MA 1ZA6A 1J05A 4UB0H 2ITDB 4NO0A 1JYVA 4Z7VE 4JZJB 4K8RC 2Z4QA 4LLDB 4PRHB 4OZGE 1FYTD 3LZFH 3DRTA 3HMWL 3ULVH 3WHXA 3BZ4A 2DWDB 5F88B 3WNMA 5A16A 1LDSA 2BC4A 1X5LA 5CJ5A 3CSPA 3VFTB 4PG9A 2ZP0T 2HT2C 5E8OA 3D0VB 4BFEA 5BV7H 1K5NA 1BZ9A 3SJVA 3W82A 2IPUK 3HMXA 3WJJA 32C2A 5FM4A 1C5DA 1FE8L 4EIZC 2IWGA 1M7IA 1UCTA 3RHWF 2NYYD 3T0EC 5FOBB 4NOBA 1HKFA 1A3RH 4NM4H 1AC6A 4YFDB 4B41A 1KPUA 1FRGH 3MBEC 2X4RB 4IRJC 5BW7A 4OBSA 2BHZA 3IXTA 1IQDA 3D6GA 3QI9D 5LJYH 2EEBA 5DYOB 1R3IH 4LFHD 2HFGH 4PJ9B 5DHVH 4A6YB 5C0DB 1TTFA 1HSBA 4UAOC 5D7LE 1N59B 3TH2T 4P4KC 1DBJL 1OT2A 1CXFA 1P7KB 4PJGA 1GYAA 2QQLH 1QSFE 3ARXA 1LE5A 3IJYB 3O8XD 3AMKA 2EDNA 5L6YH 1HWGB 2X41A 4Z7OF 3PXJA 5SWSD 3QCUL 3BP6B 3EO1A 1MIEL 4HIXL 2QQKH 4L8DA 5DHYA 3HG1B 3RY4A 1QBLL 5J1AB 1KLFA 2PKDA 4OTXL 1LO0L 4ZQKB 2MWCA 3FMGL 4PJCA 4IJ3B 1JMXA 1EO7A 1N4XL 2YD5A 4PRNA 2R2CA 1ADQH 2CLRA 4ELKB 5DZNA 1P2CA 4LLYB 5FO9A 4U1LA 3L6FA 2QADB 4ELMF 4ZUVB 4WI8A 3MV9A 2VKWA 2I26N 1RULH 1CVSC 2ZCKL 3G5ZA 4OFVA 5HI5C 1RJYA 3HNVH 4OIIL 2VAAB 1RHHB 4NM8L 1P4IL 2ESVE 3EYSH 3GIZH 4LQFH 4GW1B 3U9UA 5DMYA 1AH1A 2R0WH 4OZHF 4DUWA 5IFJB 4LSTL 3VXUE 4BYHA 1XGYH 2NY1B 1ZA3B 1ZHNA 5GS0C 4BSVB 5TQ0H 2WIMA 1A6WL 5LWYH 4B7LA 4NBXB 2QKIB 2F53B 4JR9H 1VENA 3LQZB 1YN7A 2P5WD 4CN6A 4JFQA 3VXOA 5C2BH 2BVTA 2L4OA 4TTDC 3LKSB 3RNKB 3KPMA 3QEQB 4BJLA 5CEZH 5GS1B 1Z6JT 4JN1L 5D1XC 3IJHB 1VKXB 4Z7UB 4DFIA 2V5YA 2VZTA 2IANB 3KYNA 3QB7C 3BKYH 1RK0B 1FFRA 3OAUL 2H9GB 4JFYA 1ZK9A 2VXTL 3VRIA 3LPGA 4WUUA 5D2NB 2Q7YA 1REIA 4OD2B 4XVUD 1HHIB 3D25A 4M3KB 2HJKB 1KELL 3GMPA 2G75A 4K3JH 1V7ML 4ZUWA 1MPAH 2X4PB 3BN9D 3CFBB 4JDZA 4IHOB 4L9LC 4RGOL 3AU1A 1CGTA 1MCFA 4R7NB 1XF4A 4NZJA 1Q9WA 2GY7B 2Y6SC 3QIUA 3JV4B 4XMPH 5IOPB 4JPIA 4PLKC 1NEZG 3CXDL 1ZT1A 5HVWA 5HHNB 4PLJC 1ZVYA 4GRWF 5D7LD 4LGPB 5CWSB 4HJGA 4UIMB 1WTLA 2CXKA 5IROC 3VDCA 1FAIH 1GHFH 3GGWB 1QSFD 3WEXB 1JWMA 1FC2D 2R2BA 5DD3H 3NPSB 4F9LA 4L4VA 2BVOB 4G6AD 3PHQA 4O2CA 2R0ZL 3MODH 3PDOA 3AAZA 1DQLL 1OGAD 2CMRH 1ZT4B 2D4FA 4DKEH 1ETZB 5ESQB 1CDCA 3HNVL 1X44A 4KKAD 2H8PA 4NNXA 5FGCB 4KPHL 5F7HA 3OJVC 3EYSL 3CCHA 3GIZL 3L7FA 4LQFL 4NQCE 4TUKL 5C86A 3J7HA 3S97C 1EZVY 2R0WL 3LQAL 1FO0H 2ORBL 5FUCC 3HPJA 3MCLL 3BPOC 4B53A 3C09B 3C6LB 1KUMA 3FT2A 4YHYB 2F5BL 4TTGA 3LEXA 4XPBH 1AGDB 5EUOE 3NOIA 4HC1H 4LRIA 2V9TA 3MJ9H 4JR9L 2ATPA 2RFXA 3LD8B 4R3SB 5F72S 2HTKC 1G9NH 3EDKA 3GSNB 2COQA 4OI8A 3QCVL 4UQ3A 4XWOD 5J1SC 2MHAB 4Y8AA 4FA8A 5LQBH 2KQNA 1ES0B 4Y4FA 1Y18A 2EDFA 4PJ7E 3BKYL 3ECBA 5EA0H 4Q9QH 5E99H 3NTCL 4XC1H 3JV6B 4P5KA 3TYFA 5HPOA 2JF1A 4FZEL 5D7SH 4Y4HC 3MRNB 5B3JE 2QTEA 1PYWA 3O0RH 3H2WA 4TPRL 5EZOH 3REVB 2P8PB 5C1MB 5KVMC 4LOUD 1NCCH 5FYJH 2C3WA 1T0MA 2JIXB 1TZGL 5GRJL 5BXFA 2J2ZA 5GGVH 1K3IA 1NDMB 1HHGB 1YEGH 1BVKA 5HBBA 1N7ML 2JJVA 3W5MA 3C2AH 4Y1AB 5FO7B 4LMQE 3ZKSD 5TF1L 2QV2A 4FQXD 4I2XB 1NMAH 4Y19E 4X83A 4EUPH 3NPZB 2KH2B 5CGYC 5HHMB 2OJZH 2XZAL 4LU5L 2MPAL 1H5BA 2PO6C 4X4ME 4XMPL 4P46D 4WI9A 2GTZB 3H9SA 1KXVC 3KS0H 4JANB 4YX2H 3SGEI 4ZNEE 5I74C 2R8SH 1KJ2H 3CUPB 4Z7WA 5D6DA 1DL7L 1P1ZB 1CDIA 3KHOA 2XZQH 3QNZB 2D2OA 2AJUH 4JRXB 5EU6B 5FM5O 4LAQL 4POYA 4MZ3A 4P9HL 5CIPH 1FGNL 3MODL 5I1GH 3ARBD 4HF5H 1ZTXH 3CFDB 3IGAA 3QISA 2CMRL 5BRZE 2J8UA 5GPRA 1TQCC 1NGXA 5D2LA 5ITFA 2HJFA 4XVTL 4MQ7A 4QHNB 5GS0H 5FGBC 3QULA 1JZ7A 2AV7A 3HPLA 4F7TA 4KV5F 2Z31A 5F96H 1D9KA 3L3HA 1JHLH 1JV5B 4NZRH 1XGUB 4NC1C 2XFXB 3LKNA 5EZLA 4K71C 5HDOA 4B50A 4JFOA 4XPBL 1JPTH 4HC1L 3PG2A 3AM8A 3MJ9L 3C5SB 3P9LB 4HPYH 2FIRT 2AEQL 4GG8A 1HXMA 1MJ8H 4V1DA 4HUXB 4NQCD 1FNSL 1YJDH 3L5WB 4C59B 4Z7QF 2NTFB 4LIQL 1J88A 1MRFH 5F1NA 5I1HH 2A9NH 5DD5H 4HEME 3WKML 3NZ8B 4HWUA 2XN9B 2VIRA 4MNHB 4WU5A 1YEDA 1MVUA 4Y2DB 3KPNA 4UBDC 4PFEA 5EA0L 2YUVA 4JFFB 3BZFA 1S8DB 2J88L 4R4FL 1J8HB 2CH8A 2GJJA 5IMMA 2CGRH 2AQ3A 5TGBA 2EYSA 4M7ZC 4HK0B 2QLVB 1VDGA 3SY0A 4O4YL 3TFKC 1BZ7A 2WBJB 1MFCL 3UBXG 4GW5A 4TYUA 4XPHH 5GGVL 1G6RH 3KPOA 2VOTA 3DYMA 2J7LA 3LPFA 3DX9B 3L9RB 1MCCA 1IGYB 2EDBA 5D71H 4CU6A 5KSVB 5I16A 4X6BB 4X6CB 4EDXB 1NC4B 1LDPH 4U0RB 1IZKA 4XNYH 5LGHH 4D0CB 1NMAL 4PIRF 3KYKH 1IAMA 5SWQA 1GRWA 3GI8H 2ZG1A 2C9AA 3VGGA 3KDMA 2OTUB 1RAMA 1KCUL 1JK8B 3IDYB 2EE6A 3TBSA 2WMPA 4HZLB 1NUFA 4YX2L 4U6XA 2W07A 1KJ2L 2A38A 4XMLL 3JWDL 4QRTA 3OB0H 5KSBA 2J3SA 4MJIA 2CIKB 3E2HC 3CFJA 4AIOA 1FNGB 4MCZB 2AAVA 3MXWL 3DURA 1KPRB 3T1FA 3SDCD 4WNQB 2Q8AH 4Y19D 5IKCB 3MV8B 4RGNC 3TESA 4JZJA 4PRHA 4CN4A 2IQAB 3WN5A 5DJCB 5I1GL 3O4OC 4XGZA 1ZTXL 3CSYB 3VFRB 3U0PA 4OAWA 2ZUXA 2A6JA 4ORGB 3NACL 2JB5L 4K7PX 3EOYG 3ETBF 1FH5H 1TZHB 1NFIA 1HZHH 5INDB 4FQHB 3T0DA 4XPAL 4X6FA 3W11D 4EJ1C 2AK4B 2OQJA 1T5WB 1FIGH 3F7QA 4CGTA 2G5BA 1JYWA 1FSKC 3AB0C 5F96L 3BEVB 1T6VN 4QRPD 1JHLL 2DRUA 5I73B 5EFIB 5FOBA 2IPKA 5DK3A 3SCMB 4YHPB 4RZCB 3BH9B 4OFYD 3MRKB 4FXGA 2X4RA 3CXHJ 5KS9F 4P48A 1CBVL 2YSSB 5DYOA 3E1F1 5C0DA 4A6YA 1T5XA 5HD8C 4Q0XH 4GAGL 4NPYB 4GMSL 5KN5B 4U6VH 3UPRB 1N59A 4LSDA 2R1YA 4R97B 4LVNC 5I1HL 3N9GL 4OKDA 3G5XB 1IGIH 5GISL 5C6TH 1J1XL 3T3PE 3P30L 5KSAD 4XPFL 3WD5H 2P7TB 2OL3B 3FB7B 2NQCA 5F71A 4LLQA 2Q86B 3DSFL 2W9EL 3SDAC 1J0JA 3BP6A 1GH7A 3S3JA 3AS1A 4XNZC 4ZUSB 4MD5B 1WISA 4W4NA 2EDDA 4P2CG 1D5MA 4HPOL 4F15C 4XPHL 2VZUA 3BUYB 3N85L 1I7UB 4DN3L 2JCCF 2P49B 5JIIA 4NBYB 5CJQL 3X17A 2HKHL 2VLLB 3NGBC 3VWKC 4FFWD 4LRNH 3FN9A 2V2TA 1RIHL 3MNWB 5C0BE 5GZOD 5ANME 3E6HB 3SDXE 2EDLA 4PJEE 2BNUA 3OXRA 1RHHA 3H3PL 3VH8A 2Y06H 3DUSB 1EVUA 4GW1A 3QUYA 1LK3L 3VFSA 4OI9A 4R9HA 3RJDA 2E27H 3FQNA 4IS6B 2FX9H 1AXIB 2GJZB 4GRLC 3HRZB 1PQZA 4BSVA 3FZUC 5DZOA 2Q8AL 5D93B 3BE1L 4H1LB 3RVXD 2AKRA 4QRQB 2QKIA 1JZ5A 3LQZA 2MKWA 5EN2B 4J3XA 3BD4A 1L7IH 1FDLH 4HG4J 2BVYA 3LKSA 4KJPC 5ACZB 2IBGA 1YPZE 4XZUA 2VH5H 2F74B 5DURD 4G9DB 4YFLF 4ZYKB 3AROA 1RUQL 1L0QA 2AGJH 4Z7UA 5B4MC 4JPWH 1T83C 1QACA 4CU8A 2Q76B 5B39B 4XRCB 4WTZA 4ZS7H 3MROA 3QIBA 1GL4B 3QHFH 1X6LA 4P23A 3ZDYE 3ARFC 2H32A 4OD2A 4LSRH 1HHIA 4EVNA 3QPXH 4RMUA 4OBRA 5C0IB 1NMCC 4YXLH 2O26U 4PRPE 2VLKD 2JKXA 3SGKA 3FAWA 3QEHA 4N8VA 4LVOC 1ZLWH 3MX0A 1OOAA 5C6TL 1WQVT 2K7QA 3BIAX 2HFTA 5A43C 1OTSD 3TA3C 4RGMB 2EDEA 4ZO9A 2BNRD 3QI9A 2GKIA 4LLWB 2NY7L 3I9GH 3FO0H 4XNMA 4LDEB 5CWSA 4IDJH 4UIMA 4TUJA 1QKZL 1SY6H 3DGCR 4DGIL 1OTTD 3BMVA 4UNTA 4G8FA 3ZDZE 5E2VH 1H8NA 1E4KA 1EIBA 3EYOA 2GCYB 4LDOB 2AJSH 2BVOA 4WW2C 4ZAKD 3O8XA 3VRJB 4K23H 4Z78A 2EH8H 3NCFB 1KEGL 1VERA 1WAAF 3FFCE 5ESQA 3P40A 2XY2A 1T66D 4AEHH 1OLZA 1DQJA 2Z91B 4G7VL 3OMZA 1YEJH 2P5EE 4Y4KC 7CGTA 3F12B 5EPMA 5E6IB 2E27L 4M7LT 2DQHL 1WBZA 3C6LA 1RIVL 4NJ9L 5GZNC 4NQUA 4CW1B 2OYPA 3AXLB 5I1AB 3QNXA 1I8LC 2AK1H 2OM5A 5FCUH 3X13B 4XPTL 1WCQA 3V0WH 3QUZD 3WNPA 1FC1A 5LAXA 1WIPA 3U82B 4J4PC 1MFNA 4GBXC 3SDDB 3GSNA 4EQ3A 1MELA 2DQTL 1Z5LB 4JM2C 2ZPKH 3S37H 4AZ8A 3V0VB 2XNAB 4FTVE 5CBAA 1J11A 3MRMB 5I18L 2E7LA 4S1RL 2MHAA 2AGJL 5DLMH 3VA6A 4LPYA 5GRUH 3PP3H 1ES0A 4F7PA 2GAZB 1F02I 4JPKH 2E6PA 2PR4H 4RFNC 4X0KB 3FRPG 1M05B 1YEEH 1BF8A 3L5XH 4FNLH 4ZO8A 1VACB 5L8JB 2QHRH 4ZFGH 1QNZH 2AJZB 2M1KA 4LSRL 4PJAE 3PDDA 2ADJA 5B8CC 4LCWE 2AEPL 2JIXA 3UJJL 1INEH 4LKXA 1QLRB 2NY6B 5AD0B 4KK5D 3UP1A 2WLZA 1HHKB 1LNUB 1CFQA 4D9QE 1X4XA 1CLZL 1VFUA 1I1YA 3V4PH 2A6IA 3NH7H 5CGTA 4OT1H 4X7CC 5DD0L 4N0UB 1GC1H 2GTZA 5T1DL 4M43L 2PTTA 2Z8SA 4J6RH 1U3ZA 3S9DB 5LKNA 5J11C 3FO0L 2WWKT 3CUPA 4PRPD 4M5YH 4XPGH 5F97E 5MI0C 2FR4B 3OHXB 3TH3T 4Q9BA 1CXLA 3KR3L 2YWZA 1KCVL 4JRXA 5E2VL 1S9YB 3WLBB 3FQRA 2EDHA 3PE9A 4Z77B 2AJSL 3MLSL 1T04B 4LHJB 4CADA 3OKMB 4PJGF 4LCCA 4OLUH 3IFPB 1QHPA 4BH8A 1I9EA 2P48B 1DN0A 3SKNA 5DJ6A 1V7NH 1VGKB 1FVDA 2APFA 1G9EA 1KB5B 1MEXH 4JDTH 1CGXA 4GG6E 4BM7A 4XP9H 1YEJL 1FFOA 1MRDH 4MVBD 4PGEB 4D9RE 1NC2B 2XACC 3BQUB 2NZ9D 3ILPB 4JZOB 5J89A 2DIBA 4HKJA 4XAKD 3VG0L 2DLIA 3DHJA 1EEUA 4NFCA 4O51B 1YEIL 1AE6L 3CU7A 5CSGA 3HE7B 5C0CD 4G43A 3RGVC 1QO3A 1XR9B 1OGAA 3RTQA 5I8CB 2H6PA 3FFCD 3V0WL 5J13C 1ZANH 4KHXL 2FJGA 4OFDA 4RFOL 2OTPA 2ENSA 3E6FA 2AXGA 1J1OH 4NNPH 3UC0H 5ISZB 2NTFA 4LPUA 4GXVH 2HRPL 3W9EB 3MA9H 1DFBH 25C8H 1PJ9A 4GKZB 5GXBB 1KNOB 2EDJA 4PJ5D 4L4JA 1BBJA 5EU3A 2PR4L 1TQBC 3DV4A 2ADFL 3GB7B 3L5XL 4JGJA 2I27N 3F62A 2GSGA 1JF1A 1A9BB 1QNZL 4G6FB 4FTVD 3C08L 3QRGL 1MCHA 2BSSB 1A2YB 4WHTB 3OR7A 1NFDF 4XNXL 4KJYA 5CP7B 4DTGL 5IHUL 4NT6B 5GJSL 3EDFA 3VGEA 2ZSVB 3D85D 3B5HA 1BGXH 4G80B 5IV2B 4HD9A 1AFVL 1LP9E 2X7LA 5BV7B 3K4DA 4PJXE 4WRLA 3IRPX 3U4EB 1JTPA 4X99A 3V4PL 1BM3H 5ETUB 2MCPH 4ETYA 3SEPA 1GC1L 1Z0NA 4LCWD 5HPMB 4Z76B 2ICWB 4HZLA 4J6RL 3T4YB 3FQTB 2O5XL 5I1EH 3MRLB 1XIWC 5HGHA 1X7QA 5HGDB 4AQ1B 2CIKA 5I1DB 4XPGL 3U79A 5DHVB 1BBDL 3T2QA 5I30H 3JTTB 5E5MB 5D7KD 4M1GH 2EICA 4YIQB 1AQKH 5K9QI 3WFEH 1ZGLM 3TN0D 4NO5B 4Q6IB 2WSKA 5A2LH 5ID1B 3V6BR 1MI5E 4OLUL 5KVEH 4ZO6A 3MRGB 5INDA 3L3JB 1SYSB 1FGVH 3EYQD 4ODTH 1MRDL 1T5WA 4HGWB 1NEZB 3JTSA 4LLMA 1C1EL 1QFHA 3BEVA 3GIVB 2DQGL 4I0KA 4F7MB 5EU4B 3TBVB 1XF1A 1R3KB 1W72L 5AUMB 4K07A 1A1OB 1JZ8A 4K8RD 1OWWA 1U42A 4IMKA 3L3KA 3HS0B 5CMAA 1EH9A 2YSSA 3SBWA 1MAJA 1XEDA 4QKXB 2HT2D 4MS8D 2DYPD 3MRQB 35C8L 2XWBB 4KTEH 4D9RD 5FGSA 25C8L 2JJWA 3GSOB 2QHLA 2BRRL 3G5XA 5ILTL 1AY1H 3T0ED 3FHAA 1DANT 1GVIA 4KI5E 4N0RA 2QJDA 2P7TA 2ATKA 2WZPD 4AH2B 4IRJD 4IIQB 4PRIE 1R5WA 1UKTA 2X40A 4G42A 5CFHA 3EOBB 3T0WA 1EMTL 4M8VA 2C4FT 4NQCA 2VTFA 1YEKL 4P4KD 3MR9B 4DZ8B 1Q94A 5HI4C 1JNJA 4GKSB 2EDXA 3BUYA 2J8HA 4N1EA 5DK0A 5IB1B 3F7VB 5E8DH 1U58B 4MAUL 5INCB 4L8CB 2ZUWA 5K93A 1RIUH 2XI9A 3FB6B 1JGUH 2FCBA 1RUKH 3B3IB 1EHAA 3HUJE 5F6HI 2YD2A 3CFEB 3E6HA 5C08B 3I6LD 5EOCJ 4Y5XB 1MHPH 3F6IA 4YNYA 4B7IA 4J23A 1FNHA 1WFUA 5GS2D 4QCIA 2XV6B 4N0YL 4NQVB 1A5FH 2OXGA 3MJ8B 4PJ7A 5FK9B 2FIKB 4PJDE 3EBAA 4M1GL 4EKXA 3QQ9C 2UYLB 5FKAB 4CDHA 4R96A 5FYKH 3VA2C 4NO2B 3OXSB 3TZVD 3FO9B 5HI5D 4PD4K 1UB6A 3KPTA 1T2XA 1Q0YH 4ZXBA 4XCNA 3NCEB 3IF1B 3N1GC 4J3WA 5KVEL 1KCKA 2F74A 2ZKHL 3PGCB 2XYCA 5I9QC 3IFLH 1U8QB 5EULV 4ODTL 2MKLC 2Y4SA 4N8CL 3A67H 3JWOH 1GZPB 1QEWB 3SDCA 3O9WB 3CMOH 2AXJA 5E0QA 4YZFE 3TIDA 4HMDA 4X4MA 3SDYH 1D5IL 4Z7NF 4AENB 3I3BA 1ZVSB 2NY3B 2YPVH 3IFOA 4TTDD 4PJ8C 4ZNEA 3OAZH 4HJ0D 4NYLA 5D1XD 4LL9A 5E2WH 5L88H 4BQCA 4CDGC 3U6RB 5FECB 2J8UF 1DVFC 4NUGH 4QRPA 5D1ZB 1FO0B 1PSKH 3GMOB 1TJGL 3MCKA 4Z8FL 1BX2A 5SV4A 5BOPA 3GHEL 3PL6C 5E56A 3B6SB 2XWTA 4W4OA 1ZT7A 2ZUUA 3CH8A 3MNVB 4IOFC 4UV4H 3SGDH 2A6DB 4HX1B 3D69B 1YN6A 3IAPA 3S37X 1PDKA 3TP4A 2NXZB 2DLGA 1CICC 3PGDB 2BOCB 4OGYH 5ADOL 5SV3A 3C6SB 1RIUL 1C08B 2Y6SD 3MGAA 5SWZB 1WJ3A 4F7CA 2ADIA 3H9HA 1JGUL 2JK5B 2R1XB 1PZUB 2FL5B 4PLKD 4PLJD 3RY6A 1NANI 2P8MB 3P2TA 2I07A 1VGEH 1CIUA 3IKCA 3C5ZD 4TVPH 2Z91A 1YY8B 1G7MB 4YHIB 2Y5TA 1OTUD 4X8XA 2EO9A 4NRZB 4LCUA 1X4YA 3F12A 5FA4A 1DZBA 3VFGL 4GXUM 3S88H 2WWKO 3NABL 4FQJH 3UBXB 3QUML 2BY1A 4N0FB 1FHGA 2GI7A 1YC7A 4UIKH 5DMGC 3T3ME 4PJIE 3I85A 2A83B 2APWA 3F5WB 2H26B 1Q0YL 1XGRA 5JA8B 1YMMD 4FQCL 3AC0A 1NCTA 4GRMA 4EUPB 4ZPTA 3BYTA 4AY0A 2YK1L 3G6JB 2Q20A 3TBTB 3MLRL 3RUGB 1T89C 4HV8A 2AJVH 3WSQH 1KJ2B 1H3TA 3QRFM 2P8LA 3A67L 3GEWB 5D72H 1YZZA 4ZD3L 2D7PA 1BPVA 5KSBF 3CMOL 3MMEB 3BKCH 1CF8H 3D39B 4JDVB 3PHOA 5IB2B 2HTKD 3B9DA 1ZLSL 2YPVL 4EI5A 4YBLB 2IF7A 4JKPH 3MZGB 5CIPB 1ZAGA 5DJXA 4HIEA 3FB5A 1UM5H 4R4BB 4WJ5B 3H9YA 3L1OH 1K6QH 4OCYL 1HHKA 1LNUA 1T2QL 1E0OB 4AM0B 3MRDB 3QWRD 5A3IC 5CEYB 3KPSB 2C7UB 5ERWB 5C09E 4Y4HD 3RJQB 4J3VA 5T33H 1IAIH 5M94B 3ISWA 2F5AL 1F4XH 3MYJA 1HYRC 2V7HB 1IAIM 5GHWH 4MSWA 3V5HA 1T3FB 2VLKA 5MHSE 2Y7QB 3SKMB 2ZUYA 3WLBA 4OGYL 2VDMH 3VDAA 5EOCL 1I1AC 4RGNE 1U93A 3SE8H 3UTTB 5CGYD 3ELAT 5HTSA 3PJSB 2PO6D 1VEMA 3OKMA 3B2VH 5F1OB 3IFPA 4BK4A 3C9NB 4NN6C 4XCEB 1RSFA 2BNRA 3GMQB 4X6EB 1AXSA 5I1LB 1TPXC 1G7PB 5EDXA 1VGEL 3VJ6A 1LVEA 2YPLB 1KB5A 5BOZG 3GSQB 3RU8H 3FQWB 4HGKC 2UY7A 1FL3B 1NC2A 1JPST 5JORB 3TBYA 3D9AH 3O2VH 3QUMA 4UDUA 1G6RB 4EBQH 2FD6H 2RGSA 2VXVL 4LPCA 5GRWA 3KWWA 4ZAKA 5IBLC 4O51A 2DICA 3HE7A 4UIKL 3CJJA 2DBJA 5BS0A 3PQYA 5I8CA 5DQ9B 1KEMH 5L0QB 3AMLA 3GMNB 5HVHB 5TF0A 1A3QA 1NGQH 1KGCD 5SWSB 4PJFB 4JKWA 3WBDA 2ZZUT 2RCSH 1RK1A 1BD2B 4WENB 5DDHB 3DBXB 3WSQL 1B0RA 3GMLA 4R7DA 1ORSA 1I85A 4CVZB 1I4FB 1R5IB 4X7SL 4HWEH 4C56E 4WW1A 2Z92B 1H3XA 5IQ7H 4ZOCA 4X8JB 3BKCL 1CF8L 3U0TB 2FO4B 4L8SC 1TTGA 4LNRB 4WHYH 4C83A 4CU7A 2BX5A 4JKPL 3KYMA 3WUWG 4MHHI 3CGTA 3UO1L 5IVOA 2J5LB 1KT2B 1M1SA 4KI1A 1WCBA 3GSVA 3ZYZA 3FT4B 1QBBA 3L1OL 1K6QL 5EZIH 4G80A 2VL4A 4UBDD 5ESVB 2JLLA 3CAFA 4O5LH 4OF7A 3STLA 4JFDE 5BVJA 5J1TC 3U4EA 1PAMA 1HEZB 4U1GC 4X5WB 1A6ZB 3TFKD 1YPZA 4NKOB 5HPMA 3JUYA 3T4YA 2FJFB 4HKZA 3TT1H 2GJ6A 2F8XC 3MRLA 3OV6A 3V95A 1WZLA 3IETB 4PLNC 3B9AA 4M5ZH 1C5BL 1A7NL 4YXHH 4CRPA 5F7EH 4TSBH 1SJXA 3QIUC 2VDKH 2YPKB 4YIQA 3LY6A 5JW4M 4RMQA 5C09D 5FV1L 3QR2A 1SVCP 3SE8L 5FKPA 1C5CH 1E28A 5I1KL 5E4IA 1EAPB 1K2DB 3QDMB 1OLLA 2BDNL 1DUZA 4OZGB 5HYJE 4P0DA 4HUWB 1WVZA 4MXVE 1UA6L 3I75B 3MV7E 4NQTA 5MHSD 1W0YT 3RU8L 2O93L 1XGPA 4PJHA 3VCLB 1NEZA 2NLJB 1A6UH 5J12B 2WUCH 5IWLC 1WWBX 1YYLH 4RGND 5EU4A 3D9AL 5AUMA 4DOHE 1TZIB 2UV3A 3KYAA 4EBQL 2VSDA 1RZIA 1ITCA 2IJ0C 5F7UA 3K7UA 2BSED 5DJAA 3E8UH 5GIRB 5ID0A 1OF2A 3G9VA 5GSVB 1I3UA 1E27A 4P3DB 1IVLA 3C8HA 1HI6A 3PWUA 3BJLA 3MRQA 1UXSA 4YDVB 2RCSL 1HOCA 1QLEL 1A47A 3D3VE 3S35H 2VQTA 5D7LB 4UI2A 4GRWE 4LRIC 1KIPA 2R4SL 3G04A 5JPNA 1MWAA 4LHUD 4AH2A 1QSFB 5AEAA 3LDBB 1R5VB 4WHYG 1RV6X 5C0CA 4KUZL 2OBGA 1WEJH 1DSFH 1FL6B 3EHBC 3MRJA 1DTUA 2X1PA 5IUSA 5EC2A 3OR6B 1NCDH 2FX7H 4FQPA 4Y4FC 4DZ8A 1QR4A 4KDVA 2NY0D 5H94B 1KG0A 2DQEH 4MA3A 4F58H 4LQ1A 3V4VH 5HXMA 1J0ZA 2FRGP 4PJ5A 4C56D 3VWJB 3F7VA 2JTDA 4HSQA 1KCSH 5EZIL 1U58A 1QFWH 4L8CA 4O5LL 3DIFB 3FKUS 2FGWL 4Z18A 3SDAD 1Z9MA 4XI5C 2Z93B 3CZJA 5F3HB 4K94C 3JBG7 1F13A 4Y5XA 4M93C 1I1FB 1M71A 2PXYC 3BIKB 5E2TH 4FTVA 1QA9A 3H0TB 3BO8A 3G5VB 4KVCL 1A14H 3BPCB 2VDPL 4JG1H 4QRSA 2ESVB 4R2GC 2E7CA 4NQVA 1J0IA 3Q3GA 3MLPA 4P5MA 4M5ZL 1A7RL 3D85A 5FK9A 4YXHL 3WE6A 5C0FB 5CD5D 1U8IB 1U92B 4L3AA 4LF3B 1FNLA 2DJUA 4XVJH 4CMHB 5DXWA 5J6HB 1HK6A 4NN5C 2UYLA 1FV1B 3VXUB 4PYGA 5F9JB 4NN7B 3ARDC 4NO2A 3HNTL 5DJDB 1JWSB 1UJ3B 4MGXA 4ZTPH 3ABZA 4OD1L 4Z7VF 3V8OA 2QSTA 2V5MA 4IOIB 1J9CT 3KVQA 3MUGA 1Q0XL 4OM0H 2D7MA 1XR8A 3G6AB 5BO1H 1IC5L 5EU7E 1Y0LB 4QRRB 4L29A 1CGSH 1X6NA 3FZUD 2FEEI 3QDJE 1I8IB 4KRPC 1U41A 2KQMA 5CJOH 1AHWC 1U8OA 4X80H 3TN0A 3DMMC 1AO7E 1MY5A 5F9DC 5FM8A 4EOWH 5HYJD 4FQXB 5ELIA 3UPAA 3OGCA 1G7QA 4DQOL 1LO4H 4P46B 1D9KC 3HCVB 3BW9B 3MNZA 5FECA 3DX6B 3S35L 3RAJH 3LS5H 5J8OA 1BVLA 3FQUB 1H9VA 2GK2A 1CIDA 4AIZB 1Z9SA 4E41E 2R9HC 1FO0A 3ARFD 3FTGA 3DVNA 5IEKA 1SBSH 3C8DA 3F65A 3IU3A 2B4CH 2DQJH 4PTUA 2Y72A 1WEJL 4QXTA 3O3BB 2FZ3B 3LN9A 2BNQE 2YXFA 2C3XA 3D3VD 1MUJB 1DJSA 2DQFA 2A6DA 5KG9A 3D69A 4K7FB 5ICZB 1FSKB 3GSUA 1LO3H 3V4VL 3T0EA 5DRZA 1QPPA 1QFWL 1OPGH 3MRRA 3TA3D 3X11A 3MBEA 1FBIH 2J6EH 5CCKH 5SWZA 4IRJA 1D5XB 4KV5E 3ZE2F 3VMNA 4HBQA 1I7ZA 2YC1B 1E4XI 4HWNA 4YK4B 3U4BH 3VFOB 4MAYD 1CFBA 2P8MA 3HE6B 3UJIL 4H5SB 4JB9H 4DVRH 2MQCA 3HRPA 5HHVL 1HH6B 3DJ9A 4P4KA 4M6OH 3S36L 4UTAH 5GGUB 1CFSB 4XH2B 3FAXA 2HAZA 5CBEB 1XGTA 1W0WA 2FHBA 1OM3L 5IIEA 6CGTA 2OJEA 4XVJL 1B90A 3ZTJH 1AGCB 2JELL 1FVCB 4G6JH 4OQTH 4J8RA 5HDBF 5GGTH 1FFPB 2PW1B 2KUTA 5TQ2L 1S9WB 3F5WA 2H26A 5C0GB 1JN6B 2EKJA 3BRDA 2HWZH 4EUPA 3U1SH 3BDYL 3M17B 5BJTB 3MRHA 4LLUA 4Y4KD 2E3VA 3LS4H 4OM0L 3TNMA 5D1QB 5C0JA 2OI9B 1V5JA 2NPLX 4Z0XB 3P4NA 5GZND 1MCOH 3VWKB 1OGTB 3WIHH 1WWCA 4FQLL 3IJSB 3MRIB 4WTWA 2C3HA 3D39A 1U8NB 5IB2A 3WFDL 4J4PD 4Y89A 4GBXD 4EOWL 5KOMC 3V8CA 5CIPA 4U1KA 3E3QE 4JE4B 4YXKH 2XZCH 4S10A 5FYLD 4D3CL 3D2UD 4WI7A 4LP4A 3P9MB 1ZS8B 4PB0L 1P6AB 1LO4L 3GO1H 2Y25A 4YHZH 1DQQB 4X6DE 3X3FL 4GRLB 3LS5L 3QDJD 1D5BA 3SO3B 4K9EC 2A77L 4OJFH 4LVEA 1F4AA 1ZWIB 5MEND 3A6BH 1CQYA 3VFWA 4PJ9C 3CX2A 3SE9H 3WIIH 4KHTH 4Y19B 2W0KA 2B4CL 2VDOH 1CDUA 3N50A 5D1XA 1ACYH 4C57C 4UUJB 3O6FB 4WFFE 1U8PA 3DXAB 5DC9B 1T3FA 3BGAA 2LE9A 4S1QH 4E41D 1XF2A 1AC0A 3LH2H 1F4WL 3T77A 4MMXC 4ONHB 4FXKB 5GQBA 2OK0L 2VLRE 5AYUH 1P7QD 2J6EL 2X4NA 1Z3GL 4FQ2H 5CCKL 1K4CB 4DFHA 3OKLB 3GMQA 3K2UL 4ODBD 3U4BL 4F80A