3Q3GB

Crystal structure of a-domain in complex with antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
224
structure length
224
Chain Sequence
QVQLQQSGAELVKPGASVKLSCTPSGFNIKDIYMQWVKQRPEQGLEWIGRIDPANDKTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCASEGHYGYDGYAMDYWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stable Coordination of the Inhibitory Ca2+ Ion at the Metal Ion-Dependent Adhesion Site in Integrin CD11b/CD18 by an Antibody-Derived Ligand Aspartate: Implications for Integrin Regulation and Structure-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/cell adhesion
molecule keywords Antibody Light Chain
total genus 44
structure length 224
sequence length 224
chains with identical sequence D, H, K
ec nomenclature
pdb deposition date 2010-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q3gB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q3gB02
1NFDE 4PV8A 1UM6L 3LKNB 4NHUB 4Z7WB 2DL2A 3DV4A 2AJUL 2L0DA 3MCLH 5CZXD 5E2UL 4XTRC 3NCFB 1SBSH 3ALPA 3VGAB 4PJEA 2IGFH 2X70B 3TO4A 3CDGB 2VZOA 3H7BB 4FFZH 2EZ0C 5DD0L 3MX0A 2JCCF 2YPKB 4XCNB 2F58H 1S7QB 5HYFA 5JHLH 4PFEA 4KTDL 1N0LA 4WV1A 5C8JB 3G5VB 3PJSB 1CICB 4TTDC 3GMPA 1JPGB 4I5BB 1GRWA 3GM8A 1S7UB 3VG0H 1ORQA 1L6XA 1HNFA 1MFBH 3R8BB 3T0EA 2A74A 4YHYC 4P48A 1I8IB 2XZCH 4OGAC 3T0EE 4L9LA 1NGQH 1EFXD 2E8ZA 3H9SA 1NBVL 1OAKH 4LSQH 3VU2A 1QSFB 4JLRA 4L4VE 2X4SB 3IKCB 4Q74A 1DQLL 2O5ZL 4GXVH 3CDGA 2KL6A 4Z7UE 3BDYL 5HHME 1WTLA 2BY0A 2R1XB 1CDIA 1HOCA 1BJ1H 1QLFA 4FTVB 4PTTA 3MCKB 5BVPL 4MMZC 4NQCD 1W0WA 5A40E 2AV1A 2RFXB 2DQUH 5HPMA 5SWZD 2GSGB 4ENED 1QRNE 4Y8DC 2R0ZL 2IPUK 4MJ6A 1CFVL 1ZLSL 5CMAA 3RWFA 1HDMB 5JOEA 5A2FA 4GRMB 1DQJB 1D6EA 4PJEF 3PG2A 1QD0A 4NJ9H 1MHCB 5I66B 4KHXH 2A9MH 1G0DA 5E4EB 2ZUTA 1KXVC 3LKNA 1NDMB 4P2OA 3UTPE 5C08B 1KN2H 3O41B 3OZ9H 4DUVA 3IETA 1C5CL 3NH7H 3Q2CA 4PP2A 2E27L 3PQYA 3MNWA 4PJEB 5J89A 3VW3L 2MCG1 2XKSA 4O2FB 4YHKL 5KSUB 2XKNA 3QPQC 4OAWA 1OP5K 3PWPA 5H2BA 1J12A 3D6GA 2GJ6A 4OIIH 5IKCA 4M1GL 4WIQA 1YJDH 3TCLA 1DEDA 5DYOB 3QCVL 5ICYA 5HDQH 4UB0L 4NO0A 1RJYA 4Z0XB 4X9IA 1LO4H 3FT2B 2E7MA 1KLGB 5EC2A 1DANT 4UTBL 2VOTA 1UYWH 3DIFA 3KWWB 4ZQKB 3LRSB 5DEGA 5EBWB 1R5WB 3T65B 1PEZA 4JFPB 3MLSH 4JDZB 5FKAA 3EBAA 2GAZB 3MRBA 2EKJA 4LCIH 1Q72H 2AI0L 1KSRA 2IADB 5EO9B 3BVNA 5SWSB 3QUKB 3HC4H 5JMOC 5KAQG 1A6AB 1SEQL 3O3DA 3O4OC 5C0CB 2XFXB 3E6FB 3BAEH 3UO1H 3VWJB 4Z0BL 2J7LA 2BNRA 2IPKA 2ZPKL 3IFNH 1IM9D 1YY9C 4DKFL 2IH1A 4C58B 1AIFA 2I5YL 2OTPA 5EZOL 3IDUA 1ULVA 4ZAKC 1D5BA 2ZOLA 4G5ZL 4PB0H 3UAJD 5GRYA 3LEXB 3P4LA 4NN5C 1JPTL 3SKMB 4LPXA 3S35X 4NZUL 2Y36H 1I1FA 4PLOB 4JFQB 3GRWL 3IDGB 3WLWD 1JRHH 2Z93B 2L7JA 1NCCL 1CXEA 4A6YA 4PJ7A 3WD5L 3BPCB 4OCXH 4HDIA 3X11B 3X13B 4H88H 1WCBB 4LMQE 1NLDL 3IU3A 5I18L 3L3GB 1JPFA 5MEOB 4Z7WE 2NY0D 4QXUH 4ZPTB 3VXSA 1XIWA 1CDJA 1S7SA 5ACLA 3RNQB 5CP7B 3D69A 2E7BA 4NRXB 1M7IB 1PG7H 3RUGA 5JXEC 2EDTA 4Y1AB 4RGOL 3PUCA 3QFJD 2ZKHL 4JQVA 1F3RB 1FZKA 1UGNA 1UB6A 4EN3A 4YK4C 4GAYB 4TSAH 2FGWH 1E6OL 2VLLA 3WJLC 4PRHE 3AROA 1IILE 4G8EA 2NY3D 2V5RA 2EIZA 5CEYA 1BJ8A 1H5BA 4UNVA 3DETD 1ODAA 5E9DD 3GJEA 3T0DA 2V2TB 2LAGB 1A47A 1AO7D 1UJ3C 4ZS7H 3ROOA 4ZS6D 3ARGC 1FYTE 3HZVA 1PQZA 1UA6L 1A21A 3BUTA 3FOMA 1BJ1J 1YNKL 2VITA 1TZHB 3UMTA 1MJJA 2NY4D 3V5DB 5KVFH 4RDQF 5F1NB 5J7CC 3F62A 1L4IA 3PIQB 1A5FH 3WFDH 2DJUA 4PB0L 4QRSA 3FB5A 1GZPA 4OZ4A 4M5YL 5T5NF 4F9PA 5BW7A 3MFGB 1FIEA 3W81A 3K1DA 3IAQA 1YEFH 4KUZL 1QUNA 1ZA3A 3OB0K 5D2LA 4CBPA 3FO2B 3WE6A 1PX4A 3MV7D 4XC1L 2VAAB 1PZ5B 1MCQA 5IFAH 1SM3L 1WIUA 1UB5A 3VFWA 1HWHB 1EZVX 2F53B 3VE0B 4L4JA 3LQAC 1F4YL 1H8SA 3CFDB 4W6YB 4HG4J 5GZND 5I30H 2C26A 5IIEA 4NYLA 2VR9A 1F00I 1BPVA 5EZIL 4LLVA 4JAMA 3PQYB 5CP7A 5TFSH 4G9FA 3D39B 5CCKH 5T3XH 2NXZC 4GW5B 4KVCL 2VWEC 3ZSTA 2VDOL 2DI8A 3D0VA 2GJ6B 1NKRA 3LB6C 4L3EA 4ODHH 4XI5D 5HYJA 4NBYB 2H26B 1BEYL 4KDWA 3MV11 2NNAA 5C9JB 5F71A 2QSCL 3MO1B 3MLZH 1Q9WA 1H5BB 1P9MC 3BT2H 2P8MA 5C86A 4OLXL 3IKKA 3IDIB 3EOTH 4DGIL 4X6BA 3GBLA 2P44B 4M03A 4X6CF 2GQHA 1EMTL 1OGTB 3DMMB 4JO2L 4GKNB 1KB5B 2EYTB 3CLEH 4G43B 4I77H 4KK8C 1JGUL 3MLVH 1PX3A 4NNXA 1O7SA 5DRNA 1D6VL 5I1HH 4LHJB 3VXPB 4ETQA 1LD9A 5D93C 3QQNA 2F9BT 4WCYH 1DBKL 3IT8D 4FABL 1W72A 1N3NA 4JZJC 4AEHH 3RUGE 2YD7A 2Z31B 4KWUA 4XVUC 4EZMA 3QDGD 4X6CB 1RJLA 5EZLB 2FIRT 2YOCA 3IF1B 3VXSE 3RVXD 4EI6B 5LVEA 5I1DB 4KMLB 3D18B 5DRWB 4WWID 5KVDL 3QZWG 2EE6A 5IHZB 2OZ4L 5B39G 3TCXA 2BVTA 1DEEA 4ZUSA 4PJHB 1A14L 1EEYA 5I1EL 4N0CC 2RR3A 4Z76B 4XBGA 4YNYA 5FECA 3MLTB 2IAMC 5B8CB 1XT5A 4R26L 1N3NB 2R23A 3FONB 4D8PB 1AI1L 3DI2B 1FP5A 1I9JH 2WANA 3S98A 4U1SA 4GSDH 5KJRH 1U8LA 1EAPB 1UKQA 3LIZL 2HWZL 1QLRA 1WCQA 4OCWL 2ZCLH 5BO1L 3T8XA 2AQ2A 4OFPA 2YA0A 2VABB 4MXWL 2CUIA 4PTUB 4UILL 1NQBA 1TLKA 1TITA 2BNQE 4HK0B 4ZNCD 2BY3A 1YPZB 3IXTB 4YZFF 3HUJE 3OXSB 1U95A 3ARFD 3K3QA 5DFVD 1HSAB 5CEZD 5E4IA 2EC8A 3LD8C 5DJDA 3HUJB 4HJGB 4P5MB 5LCVH 5DD3L 1GAFL 1T0NA 5D96B 4Z7VE 4LLUB 1CE6A 2B4CL 5KVMC 3O11B 3VXNB 1WAAE 4LDLB 2A6DB 3V7AG 4NBXB 2H32A 2HFEB 2IADA 2DM4A 5EWIH 3SCMA 1LE5A 5IM7B 5FHAH 3QXTA 1BQHA 3QXAA 4MZ2A 3O3AB 4U6YA 1MFEL 4Z7OE 3RWEB 2BSRB 1FH5H 2PXYB 5T1LA 3OF6D 4YX2L 4QXTA 3WHE1 1JZ6A 4WI6A 4GKZA 4LCYA 5H8DA 3SY0A 4XHJC 1JHKH 4QOKE 3CFCL 5DC0A 2DKUA 5I1KL 1HXYB 1A6ZB 4S1QH 2I60H 3RPKA 1QHPA 5EG6C 1K85A 2NTSP 1AY1H 3I6LD 4ZSOE 1IC7L 2CKBL 2GITB 3PDOB 3VXNA 2CK0H 1TTFA 3KJ6H 4I3SL 3SJVB 4NWUL 4TUJA 2FJGB 4N5UA 2IMNA 5D1XD 2ZUQB 4U3CA 1CBVL 1SY6H 4Q6YA 4KHXL 4M6AA 1X5GA 4ELMF 1RIVH 2XI9A 5F9WC 5EORL 3F5WA 3H3PL 3JWDL 3P4NB 3HZKB 3LEVH 4OCNC 1QRNA 3QZWB 4J6RL 4QRUB 2JJTC 3V95A 5I6XB 1MRFL 2CDGA 4NM8L 5DMYA 2OBGA 5MHSD 1CGTA 2F54E 5HDOA 1F3JA 4NM4L 3ARTA 4L3EB 5DRZA 2GKIA 5DJ2B 4TUKH 4HUWB 2R1YB 1FNAA 4N8VA 2V5TA 2ZZUT 3ILQD 3VRIB 1CICD 3TA3A 5K59F 1K8IB 4UMGA 2P8MB 3V4UL 1CICC 4B0MM 3U46B 5L7XL 4HD9A 3KPLA 4QRTA 2DBJA 1FVDB 1Y18A 2EYTA 3CIQA 4QRUA 4OUUA 1IFHL 3K2UH 4B50A 5K9OB 1AXSA 1PVHA 5B38A 2OSLB 4HHAA 3CVHB 3QDJD 4FQXC 3WS6A 2R1WB 3MR9B 4MVBD 1PLGH 4L8CB 2PO6D 4UOW1 3LKQA 5LJYH 1X4ZA 3QCTH 1NAKL 3DHJA 2G5BA 3VI4F 3ZKMD 4CN1A 1HCVA 1K6QH 5HY9A 3RGVA 3VH8A 2CLVB 3FAWA 1U3HA 1CIDA 2FSEA 1MAKA 1UB5B 2J8OA 4RWHA 4AIZA 3LQZA 3FQRB 5ALCL 1KEML 3ULUL 5LXGH 2MQ3A 1KIRB 2BC4A 3MA9H 2H45A 5DJ8A 5LBSL 5FOJA 2OP4H 3DBXA 1CXIA 1NLBH 3NN8B 5SWZE 5I75B 3P4NA 5IGXL 3EYVB 2DYPB 2WUCL 4LCCA 4P9MH 1A6VH 4GFTB 5EO9A 2AK4B 4LRNH 2JELL 1MCIA 3IDYC 4LLQA 1EH9A 5IB2B 1K5NB 4LGSB 1MCPH 4X98B 5ERWA 1F4YH 3PP3H 3MXVH 3WSQH 1IEAB 5HY9B 4ODXB 5LWYL 1MCPL 1P7QD 4XGZA 4KTEH 4X5XB 2ZOKB 5IEKA 1MVFA 4JRXA 3RJDA 2KQNA 3WIFB 2Y23A 2J4WL 4RX4D 4POZC 4K8RD 5FF6A 1UWGL 3BD4A 2NY5C 3PL6A 5GGSB 4CU8A 1H3UA 3ZE1F 1CDBA 1IC4H 1W0YT 4I0CC 1T6VN 2R2CA 4X7SL 4KVNH 5D7IB 2ED7A 3UTZA 2H1PH 1X6NA 5LXGL 1QBML 4HC1A 5A3IC 4QRRA 2HT4D 2CK2A 3IJYA 3QDME 4MA3B 1TZGL 4FQ1L 4Q9RH 4A6YB 4FG6C 3S36L 4S10A 5FO9A 4XC1H 2PYFA 1IEAA 1RIUL 3MV8B 5KVFL 1RJLB 4H0GA 1KG0B 4IOSD 5J1SC 3FN0H 2JB5H 2BNQD 4ONFL 5D7LA 4JFYA 4JFEA 2O5XL 5HGGS 1OAUL 5HPMB 1D7FA 2R56L 3SPVB 3HNSL 5DTFB 5E5MA 1PLGL 1X9QA 3S34H 2XWBB 3RGVB 1E4WH 3PGDA 4TRPL 3KYAA 4YEEA 4NZRL 3EUUA 4Q7DA 3GMOB 3AGVA 3KS0H 1Z9OA 3TN0A 2VLRA 5KSBA 4KK6D 2FLBT 3A6OA 3D3VA 1JYNA 2KH2B 4NQUA 5C0JB 4GAJL 5DR5H 4C4KO 2EDHA 1WBXA 2PW1A 2VDNL 5IVXA 3TWCH 5IT2L 1MFCL 4Z7NF 4NPYB 1OB1A 3WFHB 4CMHC 4HGKC 2OXHA 2CR6A 1BQSA 4N90D 3VFNB 3PHSA 3GSOA 2FO4A 4BH7B 3QIUC 5F3HA 4TTGA 4M6OL 3OGCB 1F4XH 5DTFA 2NPLX 5JOFB 3LPGA 4HX1B 4KPHL 1G9MC 1KEGL 4X5LA 2AJSH 1U8NB 3CH1B 1A7QL 2JCCA 3OJMB 1JYWA 1LDPH 3GEWB 4JG0H 3LCYA 5B3NA 1CD9B 1UM5L 1TQCB 4YXLL 1MI5B 1S7XA 2H41A 1NMCC 2I25N 3M8OH 1NCDH 3DIFB 1A6PA 4R90H 3ZT7A 1JWMA 2CDEB 3KYOB 3BZFA 3VA6A 1BD2A 2VAAA 1IC4L 3K8KA 1OAYL 2YEZA 2HKFH 2W9DH 5BZDA 5FV1L 2RJMA 1IM9A 4R96A 1FFQA 5MENA 2P7TB 2X89D 2I9LA 2PW2B 1SVZA 2QEJA 1YY9D 2XFXA 5E99L 43CAB 2HVJA 4MDIB 4LCIL 2W9EH 3PXJA 2Q6WB 4QCIA 2Q87A 1YEHL 2YZ8A 4PJBB 5GRVK 3KYKL 4JHAL 3HMWH 5IMKA 5F96L 1EGJH 3LV3B 4APQB 5HGAA 2D03H 4WU7B 2ZG3A 3KPQB 3CAFA 5INCA 4Z95H 3GSXA 4N0FB 1DFBH 3D25A 5D1ZD 4HUUB 4EKXA 3DGGB 1ZA6A 4PJBF 3MV7B 2ZJSL 2HFGH 1DFBL 5HGBA 1J0ZA 1XCTA 2VXUH 1EEZA 1IGCL 2P49B 2ARWA 3MV7E 5TE7H 3RDTD 4QHKI 1W8NA 4NSKA 1YNTB 5CINL 5F97E 2DI7A 4RMWA 3BOVA 4M00A 4NO5A 4PJAE 2J6EL 2Q6WA 3BSZH 4YGAB 3RWHB 2HMIC 4RNRB 3QPXH 4LNVA 1QR4A 2Y06H 3S3SA 1IEHA 5ERWB 2D7PA 4MAYA 4NRXA 1GGCH 2JCCB 3PQYD 1KPUA 3QDHA 5FB8A 4M43L 5GGVH 5L2KD 2OMBA 3VFMB 1HWGB 3M17A 3WNPA 4YFLI 3EYUH 4N8VB 4X6FB 2ZG1A 5CEYB 1IMHC 1U3YA 4JJ5A 5FDWB 1YQVL 5CP3H 1A1MA 3HLAA 5IHZA 1KJ3L 1UFUA 1WZKA 4WWKA 5JDSB 3KPLB 4QRTB 5K9QI 2R0WH 2Y1VA 1CFTB 3RWFB 5A3ID 5KVEL 1CFSB 4PJIB 4U1JB 3I9GL 4OF0A 4JO3L 5D1QC 3ZE1E 4Z77A 4LVNB 4XP9H 2FR4B 4BQ8A 2DMKA 2VXVH 3RWIA 1BBDH 3GMQA 1Z3GL 4FZEH 1KPUB 4OZIA 3MNZB 4U7MA 5BV7H 3PWUA 4U1GC 4D9LL 3VD7A 4M61A 4U1NA 1EAPA 3QYCA 3W82A 2NY0C 1ETZA 4HXAH 4DVRL 4KKLC 4GRLB 5ILTL 4Q2ZB 3NPZB 1AXTH 4LSUH 5C0FB 1DVFA 5F88B 4CVZA 5ESVB 2K3TA 1FCGA 1ES0A 2P8LB 1DUZB 1Y0LA 1D6VH 2FH6A 2YWZA 4HUUA 3IJSA 3VXRA 3G6AA 5FUCC 3WN5A 3FTGA 5E8NB 1SJHA 1I3VA 3NOIA 4O9HH 5JZ7D 3B9DA 1RVFH 2F58L 1OP3H 1FE8L 4NWUH 1HYRC 2FR4A 3ZE2F 3KWWA 4WW2F 5CILH 2CRIA 2NY5L 4BQCA 4JPIB 2GTWA 4JZNB 3RVTC 4J23A 3PXHA 4FS0A 4LNRA 4DTGL 3EOBB 3B9KA 1QBMH 3RIFF 1CBVH 1SYVB 2ZP0T 4QT5B 2BDNH 4JVWA 1UACH 4KJYA 5DVKA 3TBWB 1TVBB 3OG4B 1RU9L 4FG6D 4EBQL 4PGZA 5TF1H 1BFVL 1YPZE 3SY0B 4MVBC 2VISB 2OTWA 2KPNA 4FQXD 1BIIA 1JV5A 3OF6A 4RGNC 3BIKB 3OHXB 3VXRB 4AG4H 1IQWH 4WI2A 5HHVH 2PXYC 3T3ME 4U31A 3AS3A 3P40A 1AIFB 5KS9E 3GMRA 2R0KL 5CBAB 4PJGF 2YBRB 3RZCD 2XWJA 2ESVE 2UWEF 3OB0H 1TVHA 1G1CA 5DD5L 1JN6A 3VXME 2BSTB 1M4KA 1UJ3A 4H5SB 4MDJA 1T22A 3B2UD 5LCVL 5LKNA 2P5EB 1GOFA 4WVRA 2FNBA 3ES6A 3QEGL 3ZDXE 4YBHA 5GJSL 5E2WH 5D5ME 1Q9OA 4PJ8C 2QV2A 1UENA 3EYOA 3LPFA 5F93C 5SV4A 2H2PD 2ADFH 1KIPB 4MZ3A 3CFEA 2WINB 1VADB 1MCWW 4MJ5B 3TBTA 3FQNA 3F58H 1QYGH 2X89A 5F7WC 2CRYA 2HWZH 3BDXA 4ZTPL 4C56B 5J1AB 4WV1B 2CLRB 3BUYA 4K3EH 4MNGB 1YY8A 1WBXB 2PW1B 3NTCH 4OLZH 2E3VA 3BZEB 1FFPB 4D0DB 5ACMA 1FQ9C 3NH7L 3W2DH 3BESR 2D7QA 3QCTL 5D6DC 2OR9L 5C07B 1EEYB 4XVJH 4AY0A 4Z76A 2PTVA 2W0KA 3VXUE 4F37K 4OCRH 5JXAL 1F3DH 5E95B 1VACA 3MYZA 3QEUA 4P46D 5ACZA 3NCYS 1KNOB 2GUOB 3Q5TA 1FC1A 1FNSH 5DHVA 4RCAA 4Y16C 3IKCA 1MWAH 4BQBA 4LEOB 4EQ2A 1MCFA 4OUUB 4RAUB 4N9OB 2DWDA 2DD8L 2B8OT 4PTUA 4RGMB 4JFDB 2VN7A 2K7QA 5F1OB 5BJTA 2XKUA 4I1NB 4RGMC 4JHZA 4OZGE 4L4VD 1ZHLB 4IRJB 4HIJA 1CGUA 3IDJB 1QOKA 1IKFH 4Y16A 3TNNB 3A6CL 1WV7T 5FDWA 2N4IA 4MJ6B 4NM4H 1EHLL 1YEEL 4L3ED 5EOTA 4OZGB 3IS0X 3P0VH 3R0MA 3DTXB 3FRPG 3HA0A 1LO5A 5FYKH 1FL5B 4Q58C 3SCMB 5HHXH 5T3ZD 2LV4A 4LLYB 1IAKB 3IFOB 1I7TB 5ID0B 4YUEH 1XGQB 1VFMA 3RZCA 5J3HD 4QXTB 1NAML 4OLUH 4U7SA 1NC2B 4NC2B 1LK2B 2B0SL 2XY1A 2NW2B 3UEZA 3L95B 2XQBL 1T21A 1P4BL 5MERB 1CTOA 5DC9B 1OCWL 2AK4A 5DVNA 2X9XA 2YUWA 3CLFL 4IS6A 1INQA 4IMLB 4JRXB 4D3CH 1TZGH 3GHBH 1QP1A 5KSVA 1IGTA 5C07A 4JPVL 1DUYA 3WIIH 3MGTA 3KPRA 3L3DA 5E8PA 1EEZB 2HN7A 1KGCE 4E41B 3NIDE 1HCFX 3E1F1 5TFSL 3T2OA 5MI0B 1QSFD 2CMRL 3QNZB 5IHLB 1N0XL 4JDZA 4YE4H 4CJ1A 3VFUA 3CX5J 1UEMA 5DFWH 1DBJL 1L7IH 1B3JA 1MJ8L 4KI5E 5IHUL 4DW2H 4KUZH 2W91A 4ONHB 4Y5XA 3U0WH 4B5EA 5DMKB 4YBQC 4XX1G 3SDAD 4F8TA 1A6AA 1GC1L 2E9IA 3H7LA 4OFYD 1DBML 1ZT7A 2X7LA 2JELH 2B4CH 5BS0B 1MPAH 1T7XA 1Z2KA 2Y07H 4XVTL 4WW1B 2VE6A 2WUCH 5DD3H 1OD9A 2NYYC 5JPNA 4P46C 3MBEA 3MGTB 3KXFA 3QDAA 2APWA 3O0RH 3VXRE 4R7DB 4G6FD 4MD4B 2QR0B 4U1HB 1H3VA 1ND0A 4RZCA 1KJ2L 3PWVA 3EYFB 4FQCH 4JPVH 5TF0A 1YPZF 4MD0A 4X6DF 3I6GA 4I0PC 1JWSB 3PGCB 1BOGB 3IU4H 4HMDA 2A77L 1FG2A 5K9OA 4LPUA 5FUOL 5ISZD 4HK3N 4JDTL 4ZUVA 1UADC 1OAXL 1DVFC 3FONA 5C0AD 1PG7L 1LE9B 2H2PC 4JCLA 1A0QH 2X4UB 3MV9A 4F7MA 2ZCKL 3ORJA 2NXZD 5GISH 4K2UL 1U3HB 2EYRB 1AKJA 1QA9A 2FGZA 1DE4B 4XPTH 4MS8D 1M05A 5ETUB 2XTJE 4C56A 1U8PB 1G7MB 5IVXF 4JRYA 2R4SH 3IAPA 3QIWB 3TFKC 3WS3A 1EHLH 2ATPA 2J88H 4LHUD 4U0QB 4X0KA 2NMSA 5D1ZC 1MREH 2VH5H 4L9LB 3AS1A 3NABL 1DBKH 3B83A 5ICXA 3RTQA 2WWKT 5D1QB 3ZE0F 4QTHA 3WDJA 3MRRB 5HBBA 4JM2F 2VLKE 5EU5A 3FQXA 4NQCA 1A9BA 4RWYL 4GMTH 3IDXL 1H3PH 1WWWX 1FL6B 4BSVB 4PJXB 4F57H 1NDGA 2RGSA 2YUXA 2BNUB 3OKEB 2EDXA 5J12B 3O2DA 1YZZA 4ONOA 4M7KH 4HK3J 3GZKA 1JF1B 1T3FB 1XF4A 4KRPB 1MCSA 5FKPB 2WAHA 3FAXA 2IAND 2NY4C 1QPXA 3DURA 1NKOA 2ADFL 2DQFB 3FO2A 2PO6B 3AU1B 4KROB 2GAZA 4XPAL 1MI5D 4XCEA 2V2WA 32C2A 1JFQH 1YMME 4UT9L 4YHOH 2DQGL 4TSBL 5JNYB 2OJZH 4ZTPH 3WDIA 3RI5F 5C0DA 1HNGA 4NRYA 3LB6D 4NGHL 4XI5C 3TBYA 3FQXB 5CFHA 1JYVA 2J4WH 5FK9A 3FRPA 4JY5L 4V1DB 2UY7A 1RZFL 3VFVB 3MV8A 5DD1L 3DXAE 2ZUYA 2DLEA 1NDGB 4GT7A 3LKSA 3MGAA 4KVNL 4JAMB 1DBJH 1GGTA 5J56B 4QLRA 3QIUD 3PV6A 3QRGH 5FA4A 3QQ9C 2VRAA 4YDJB 1BD2E 4NT6B 1GIGH 2AK1H 4Z0XA 3SQOH 1FGNH 3EO1B 4OV6F 5H35A 5ESQB 4NKOB 2AGJH 4XNYL 3WL9B 5KSVB 2X2YA 3K74B 2VR5A 4M5YH 4PB9H 3QFDA 3VFSB 3DXAA 1CFTA 1JHLH 1WWAX 7FABH 4FXKB 4HQQL 3K4AA 1BM3H 4YC2C 2B7DT 2AJ3A 3C6LB 2ZUSA 1LDPL 2UZIH 4MXVF 4DGYH 4ZPTA 4UV4L 1C16A 4W4NA 5BMFH 4ETYA 2A0LC 3NIGE 3MA7B 2ICEB 1G9MH 4OIBA 1EJOH 2BHZA 1HOCB 1QLFB 5IJKA 1E27A 4KI5F 1YDPA 1ZHLA 5GXBB 2XZQL 1FVEA 3DX7A 4OZIB 1KCUL 2X9YA 4JREC 4FZ8H 3C6SB 1S7TA 4PJDE 1NMAH 1V7NL 3BZFB 1FL5A 2HT4C 1ES0B 1S7RA 3BKJL 3GSNH 4XMLH 1JJUA 5DQ9B 2F5AH 5C0FA 2CLVA 1FORL 2ERJC 3E3QC 2IAMA 3TYGH 4XPTL 2DQHL 3R06A 1DQJA 5F7DA 2J8UF 2VLKA 1CR9H 3WN5B 1P6FA 3LHPH 4O02H 4BFEA 4Q9QH 3CCHA 3C87A 3VXSD 1MFNA 1UVQA 4TVPD 1WZLA 5ESAA 4LLDA 1S7SB 4WUUA 3TWCL 1T2XA 4XXDA 3HPLA 2YSSB 2VYRE 5BRZE 3ULVF 4F7EA 2JKXA 4JRYE 1DTUA 1XCQB 4M5ZL 2N1KA 3QPQD 1VEMA 5FM5O 5E2UH 1UWXK 1B0WA 3ABZA 25C8L 1SYSB 1FBIL 5IB5B 5AD0A 2B1HH 4LGPB 3ZZ1A 3O45A 3QG7H 4I77L 5EZOH 1G6VK 1KV3A 3CSBA 4HJGA 4IHOA 5I2IA 2NX5B 2UVFA 3EOTL 4DGIH 2KQMA 4LCWE 3O0RL 4NO0B 4QYOB 4JEGB 4Y2OA 2VDML 1JZ4A 1G0YR 2GHWB 2Y36L 3H9YA 5JHDA 3BJ91 3BW9A 4ZAKD 1QLEL 4Y19B 2IQ9L 4OFVA 2BSTA 3L1OH 5DMJB 2X10A 3MACL 3MCLL 3VFGL 3VDCA 3K0WA 1HKLL 1I1RA 4O4YL 3ARUA 4EXPX 5SWSA 3TA3C 5D4QA 2P24A 3MRPA 3QUXC 3ZDZF 2PO6C 1GZPB 4RBPH 2D9CA 5KG9A 3ARGA 3WYRA 3BVNB 4N0UA 2FECI 3MJ7B 4JY5H 4J3TA 1UCTA 2GW5A 35C8L 4TNVK 4XXCA 2HRPL 5CS7A 2J8UA 1PKQB 4NZTL 1AY1L 1IGIH 5EOCH 35C8H 5D2LB 2ADIB 4JM4L 2QR0A 4WWKB 4HWBL 2IQAA 3EFDL 3SO5A 2EDRA 2EDYA 3MOAL 5F9JA 2ZUWA 2Y6SC 3FT4A 5DK2A 2GITA 3PDOA 4LSRL 1A4JB 5EO1A 3AVEA 5HHVL 3GI8L 1BBJA 4XPBH 4S1RH 3OR6A 4UTBH 4KK6C 3HAEB 5JQ6L 5IOPA 3DUUA 5JNYA 1AD9A 2XICA 1K6QL 4K3DL 4NFDA 4EQ3A 2Y4SA 2ORBL 4RMRA 1N2RB 4YAQB 3MYJA 5CAYB 1TVDA 4FQLH 3OR7B 3QXVA 5AZ2L 5C92A 1HN1A 3RX7A 3E8UL 4WENB 2R29L 4ERSL 5ENWB 1LQSR 3BGMA 5ESVA 1A7NL 5C71A 5FYJE 5HHXL 4ZPVA 4ZSOB 1OCWH 2B2XH 4QTIL 1LILA 1I1AB 4NQSA 5HYIA 1AO7E 1GVIA 5E2TH 3ZYOA 1A3QA 1FFNB 3BKYH 4Q6IB 2XIDA 1H9VA 4RQQA 5L0QC 1AD0B 2HTKC 5F1IB 4OD1H 4KGLA 1LHZA 3CFJB 5B8CA 1ZTXH 4PRHD 5JIPA 1BLNA 4ENEC 2K7PA 5GGUA 3MOBL 1N7ML 3PNWB 3F7VB 1OAQH 1MHPL 3QR2A 1D3CA 5BZWA 4AL8L 4ODVH 5IBLD 1RAMA 3LKPA 3VI3E 1HHGA 4OZHB 5FFLA 4RGOH 3RL2B 5C70A 4EIGB 2F5BH 1S7WA 2ICEA 2CUHA 4M7LT 3P73A 5IBTH 2X4QA 3V6OC 2R4RL 3HRZA 1KCVL 1RHHA 3NCEB 3HMXL 4Y4KC 1P53A 1ZMYA 3OB8A 2O5ZH 4JFDD 4QHNA 1MFCH 3GB7A 5F7KC 3V6OA 3MRNA 4BZ2L 4R4NC 4D9LH 3QP3A 2DQCH 1L9NA 1ERNA 4LCUB 5FUCE 5K33A 1OWWA 4JE4B 5JA8B 3QXAB 3RAJL 5CUSH 3DLQR 4XVSH 4X6DB 4P2RA 2JB6A 2R29H 4ERSH 2ZCHL 2B1AH 2XPGA 1SJEB 1OVZA 3LMJH 1S9WB 5D5MA 2A74B 1FN4B 2MOVA 3BEVA 2PCPA 4IOFD 3LN5A 3NN8A 5GS0L 2WINA 4J3OC 1P1ZB 2EDWA 2X4RA 3T4YB 3CFDA 1I3GL 4GRWH 1F6LL 4DOHE 2DAVA 4FFYL 1J7VR 3OKOB 3KR3H 3CFEB 1DANU 1QVOB 4GOSA 4X98A 1T20A 1LP9E 4JFXA 4UQ3B 5EN2A 5KS9F 4CU6A 4PJGE 5E8OA 2C3VA 2UWEE 3B2VH 5I19L 3QULA 3PDGA 2GT9B 5FF6B 3MO1A 2WBJD 4N0CD 4JRXD 5FO8B 3MBEB 2AK4E 2X5PA 5HYJD 4FXGA 4P3DA 4X4XB 2V7NB 3SGEI 3L7FA 4U1MA 3BE1H 1OTSC 3GRWA 5EU7E 5SWZB 3FFCD 2BNQA 2Z8WC 3QXWA 1JFQL 3MLXH 3FB8B 3TBSA 5GGTL 2FZ3A 3EO9H 5HI4D 5CSBA 3QJHB 4P2RE 3OKOA 4H8WC 1S7WB 4K7PY 5CEZH 2KZWA 4GKOA 5CD5C 3KPPA 4Y16D 2O5YH 5JMRA 5BO1H 4OZFG 4M93C 5IB1B 4ZUTA 5HYSA 5E8OB 3QNYB 1T1YA 4Z5RB 1HIML 4PGCB 4WI7A 4MXQC 1VFAB 3CC5B 4HFWA 1KTDA 1AKJB 1I3RA 4P23A 4MQ7B 5C6PB 3ZDZE 4CN4A 3P9WB 2DTMH 4GAGH 2W0LA 3LN4B 1YECH 4U2YA 4OZGA 2HT3C 2WWMC 5C2BH 1NAMH 4M1CD 1OPGH 4JFOA 4NJ9L 3MJ8B 3BIAX 5TGBB 1N64L 1QBAA 4KJWD 4AM0A 5ITBL 1G7JB 1DQMH 2A1WH 1I4FB 1IAKA 3GDBA 3IFOA 3MFFB 1JWUA 3G6AB 4HHAB 1H3XA 5HHOB 1KIUA 3WNLA 2R1WA 3MR9A 1FNGA 1G6RL 4B7LA 1X5IA 5FGCB 4YNYB 2DQEL 4YGVB 1KC5L 2I26N 1JPST 4PJ7F 2AEQH 4ZOAA 4X4YA 1EEUA 2QL1A 2VZVA 4MYWB 2G5BB 3EHBD 4ELKB 4QOKD 3UJJH 1E4KC 3B2UC 2R4RH 1JPGA 4I5BA 3QUXD 1AO7A 4PBVC 5F72S 5FIEA 1AJ7L 3TA3D 4HUWA 1A6TB 4HULB 1K8DA 4GLRI 2OR9H 3F7RA 3OPZH 3QEHB 3KVQA 4URTB 1AH1A 4Q6IA 4N8CL 4YK4B 4LIQH 4MAYC 4NZUH 2EIDA 1MAMH 2EE3A 2OM5A 4F9LA 4KDTA 1TCRB 3H2WA 2CLZB 4JHWH 4UNTA 2JK5B 3TC9A 3U0TA 3PHQA 3I75B 4Y4KB 3VG9C 2AEWA 5FHBH 4E5XA 5EUOF 3CLEL 2ED9A 2DMCA 5E5UB 5DLML 2ZNWA 5FOBA 1JZ2A 1YEDB 3ARGB 3KLAB 4GAJH 5DR5L 4DGYL 3B3IB 5E6ID 4X7FC 3ILPA 3HHRB 1FAIH 3DX6B 4QWWC 3SCMD 4HQQH 2A77H 3VXMA 4RRPG 3RGVD 2F8VA 3NFPB 3K80A 3TN0C 4LSVL 1BFSA 1EX0A 4LCYB 2O5YL 4LU5L 3VXTA 3DHMA 1MFAH 5MEQA 4QHNB 1D6EB 4GXUN 5I8OL 5C6TH 4G6ML 2ZUUA 5B4MC 5D7IA 4U2ZA 1SM3H 3TT3H 5L2KA 4X99B 5J1AA 1IGIL 4RFNC 4AYFA 5KZCD 2Y07L 1JHTA 3INUH 3S5LG 3DXAB 3N85L 3KPTA 5JW4N 1JI2A 4KI5C 5T5FH 1XR9A 5DUBA 2XTJD 3WIHH 5D2NB 4LLQB 2P5WA 2VXQL 3WLBA 3RWDB 3TT1H 1KELH 5CEXB 2W0FB 5HVHC 5ICYB 2E27H 2X1OA 4L9DA 4H0IA 2WMPA 1AO7B 2YS4A 3U36A 2HKFL 4YIQA 5TDPA 2YWYA 1L0YA 4O9HL 1WAAF 1M71A 3WIIL 3U0PB 3V4PH 4OIIL 4UILH 2B1HL 1CGYA 5MP6H 2FX7L 3P30H 4KXZH 1T5WB 4ZFOA 4GBXB 3DECA 1J1XL 2FO4B 5DUMH 3BHBB 3TIEA 3ZO0A 4ZO8A 2DQCL 2M1KA 3DX8B 3O8XD 3WJJA 1I7ZB 5DUPH 1QSFA 1PYWB 4QHMB 5I1JL 3DX6A 3CXHJ 4Z7WA 4LLDB 3OAYK 4X9FA 5DWUH 3BRFA 5IW6B 5B38B 1PFCA 5ILTH 1UM5H 2CPCA 2BNUA 4F7CA 5BS0E 4UDUA 2F53D 5IVXE 1X7QA 4JGJA 5I18H 4OGYH 3MQIA 1RZKC 2X70A 4M62L 2AV1B 2AJSL 1ONQB 1NCWH 3O2VH 1FZJA 3LKQB 5KSAD 2ZKHH 3BJLA 4OBRA 5E2TL 3P11H 1LK3H 3HN3A 3O6FC 1MEXL 5E2VH 3VXMD 2VXSH 4YFDB 4D0CB 1RUKH 5D1ZB 4BQ6A 3DNKA 1HYSC 2ESVD 1ZK9A 1FNSL 1FJ1A 2ARJA 3CSGA 4S11A 5C8JA 3R0NA 3JWOH 3C2AH 5HVWA 4P2QD 1U58B 1FO0A 4QXUL 5C0BD 5JW3H 3RDTB 3S5LA 3IU3B 4NQDD 5MEOA 4FMFA 5JW4M 4HDIB 3X11A 3FOLA 1WCBA 1AGDA 1KTLA 1MRDL 3ARDD 1I7RB 2ITCA 2R4SL 3MRGA 1MRFH 1KB5A 4NNXB 5LGJA 1P5VA 3N06B 4Z8FL 3VXSB 4UDUB 3GI9H 4D9RD 2X4SA 1A1OA 3QDMA 2BMKA 4HKJA 5CGMA 5DWUL 2W07A 3CVIL 4KRPC 4OCRL 5CJBA 3GI8H 4YXHL 2P47B 2UWEB 4MNQD 4ODWA 3ULUE 4KGJA 3VD5A 2AV7B 4QGYA 3V4PL 2ITDA 2VZ3A 5EB9A 4Z18A 4O00A 2DIAA 4NM8H 3VI3F 4NKMB 5DUML 4PRAA 3IDYB 2VSCA 1GIGL 2UZXB 2ADIA 1OD7A 4O2CB 4EI6A 1LO3L 3VFSA 4KZDL 1G1YA 5BQ7B 3DVFA 2HJKB 2QSCH 3SKJH 2MHAA 3GJEB 2GY7B 5FDYA 2VXUL 5DVMA 5C09B 2RAMA 3NMEA 1Q9LB 3VXQA 3UX9B 2P48B 4HMEA 1G7IB 3EKCA 4N0YL 1E27B 1MCLA 1MCRA 1G84A 3VGEA 4P9ML 5IB3A 2PN5A 4OZ4B 3Q1SH 4XBPA 1KELL 2R2EA 3GO1H 2GCYA 4APQA 5JW4R 5LWYH 1E4JA 5I76A 5GS0H 5F9AC 1NFDF 1NJ9A 2VC2H 4GS7B 5EU3A 1CGXA 4HCRL 1L7TL 5C0CE 5IHUH 1ZWIB 3BXNA 4G8GB 1NFDB 3B6SB 3MV8E 4KJWC 5F7YC 3TPUA 4NGHH 1N0XH 1WGOA 1BFVH 4M1CC 3VXQB 4RAHA 5CD3A 3TT3L 2Q8AH 5CGYC 4OLWH 2JTDA 4YO0B 4RFEB 4GG6A 1QFUL 4PJFF 5L2KE 1AXIB 3ULUH 1OL0A 3V0VB 4YHPB 3O4OB 4O02L 4ZFGH 2EZ0D 3UTSB 3GFUA 3RAJH 3VFNA 1CGVA 1WZMA 4YDVB 3GSOB 2DQHH 1UXSA 1QR1B 1JIBA 2VTFA 4MA8H 4CVZB 2Z8VC 3E6FA 1IAIM 2OTUA 3IB4A 5CZXC 4C56E 4IHOB 1Y0LB 4JRWA 5I6XC 2NX5A 5E7FA 4D2NA 2IFFL 4HX1A 2BK8A 2DQJL 4PYHA 1IL1B 4O2CA 3F6IA 4UTAL 2VDKL 4HIJB 1TCRA 3LN9A 1QO3B 4PY8J 1VFBB 5GIRA 2XZQH 1RHFA 3REVA 5EH1A 2ZCKH 2P5ED 4NN7C 5HHMB 4H88L 3DVNA 2D0GA 2XG4A 1G6RH 4PRHB 2DQTH 3O3BA 1CVRA 5C0DB 2JB5L 3FN0L 1BAFH 1I7ZA 3RGVC 1JP5A 3LEVL 2YK1H 4ODUA 4QHMA 2V7HA 1P1ZA 1R3JB 2D31A 4U1NB 5C7XH 4EUPG 3VG0L 5D1XB 1FYTB 1OTUD 4Q9RL 5KOVC 2GJZB 3G6JE 3UPCA 1EO8H 1BHGA 1NMBH 1X7QB 2R56H 4L8SA 4WFFD 2FWOB 3KXFE 3D0LB 3UTTA 5T1KB 1F11A 2ORBH 4PR5A 4I3SH 5MI0C 3V52H 4UIMA 3U30C 3UTPD 3HE7A 1FZOB 3X3FH 3RQ3A 1B0GB 5C0RL 4L3CB 3NCJL 2FX7H 3HKFA 4L4TA 4YAQA 3FT3B 1GC1H 2BOBB 4QOKA 3VG9B 1K8IA 2DQDL 3NGBC 4NFCA 5EC1A 4DOHB 3ARWA 3MV01 1YNTA 1XCTB 3DRTB 3N1PC 5ENWA 3O2DL 4OLXH 5SWZA 5CKAA 2BZDA 5DI8B 4LLVB 3L3OB 1BREA 1A7PL 3UBXB 3O6KL 1JTOA 4K94C 1IRAY 4N68A 3C60D 3E2HC 3ZKSD 5ITFB 2R0LL 3M1BA 4L1HA 4ZSOA 1KUMA 4LVHC 4PLJD 2YA1A 5C6TL 2MWCA 1WZ1L 4O4YH 2I9TA 2VZSA 4LP4A 3QXDB 3VFMA 4MQTB 4PBXA 1OF2A 1J0YA 2D03L 4LCWB 1FH5L 1FG9C 1KTDB 2BOBA 4KRLB 1LE5B 3BFOA 3VH8B 5GZOC 3LZFL 5FV2A 2YKLH 1J88A 1I3GH 2W1NA 4P59H 3ARBA 3NGBB 3BWAB 1BOGA 4OLUL 5DZLA 3DARA 1TTUA 1RJZA 1O7VA 5I8CB 3IETB 2CRMA 5T1DH 3WO4C 1BX2A 1AP2A 1PG7W 2JJWA 4AG4L 1CGWA 5C7XL 3L5WA 5BOPA 1UVQB 3GSRB 1ORSB 4HIHA 3UTTD 2AQ3A 5FCUL 4U7KA 3WO4B 3DGCR 3CFKA 1UACL 3PWPB 3WNNA 3MRNB 5K9JH 1J11A 1U8JA 5FHBL 5HHPB 5GZOD 5IMLA 1HXMA 5LGKA 1EHAA 4UUJB 4S0SD 4P23C 5IQ9B 3W5MA 5D7LD 1DVFB 5F88A 4WEMB 4YHLH 4X5WA 4PRBA 3QI9C 4LEXH 3L5XL 4DQOL 1ZANL 1GGIL 1RUKL 4JZOA 3FTGB 1H0DB 3HE7D 1GGIH 1T7ZA 3SKUD 4E0RA 4QGTA 1Z3GH 2P1YA 1BP3B 4JKKA 2R23B 4LLAA 2BFVH 3DVIA 2AJXH 3L95A 4NOFA 4IJ3B 4QNPF 3IJHA 3SGEH 3ZKXB 4U6XB 3V6OE 5ITBH 2CKNA 4JPKH 4R0LA 5BS0D 5F7UA 3QUYA 3P9MA 1LEIA 1PG7X 1AR1C 2Z35A 1JGUH 1FZKB 1U8JB 4AENA 3HI6L 1KTKE 3K81A 3KNBB 3O6FB 4JDTH 2FHFA 2R2BA 4QY8A 3VWKA 3MRMB 5FUOH 3E6HB 1MRCL 4JVUA 1FNEB 1EV2E 2VO5A 3GMRB 4LOUD 5ABDE 1XF3A 3SKMA 2BNQB 5JXAH 3G6DL 4J1UB 2Z0BA 3BZ4B 2VQ1B 1YNLL 5ISZB 1A4JA 5EO1B 3REVB 2VERN 4WJ5B 1QFUH 5GRXG 3U2SA 1YECL 2XA8H 2Z4QA 4ISVB 1OQXA 5I1IL 3DYMA 4OLWL 1T1ZB 4HF5L 4DFHA 4Y4KD 3DO7B 4PG9B 4JFZL 3IFPB 3MLYH 4NPYA 3L7EB 4MSWB 4JFFE 2BSRA 4OD2A 1I8LC 4M43H 1UKSA 1Q9OB 1DDHB 4OBSA 4HIIB 2V5YA 4CNIA 3G6JB 4G8GE 2EICA 4IMKA 4MD4A 3ARXA 4XNYH 3JV5A 1IAIH 5DHXB 3VWJD 3PV6B 2OL3B 4Z95L 1JHKL 3EJJX 2IF7A 3U36B 4LVEA 4R4FL 2X05A 4OZFB 3Q1SL 3N1QC 5GGTA 5T3XD 1YUHA 3HUJA 4JHBA 5HVHB 5HSFA 1KCLA 1IGCH 1PZUB 5M95B 3R1GH 1FFPA 4D0DA 4I48A 5A16B 2DYPA 2R2HA 5DS8A 2GYSA 1KOAA 4KHTL 3KHQA 2CDEA 4MQXC 3GBMH 3EYVA 2Q8BH 1PY4A 1S5IH 4G8IB 1MCWM 5F1KC 4OAWB 2BXZA 4MJ4A 3G9VA 4OKVA 4R4BB 4DZBB 4J8RA 5DVOA 3RGHA 5BZDB 5IGXH 7CGTA 1N6QL 1B6DA 2X41A 5HYEA 4KRMB 3BPOC 4ZMAT 2YC1B 1XF5B 3BQUA 3FB5B 1FLTX 3NCCB 4N0UE 3OAUL 2X4QB 3LKRB 5FEBA 1JPSL 5FCSH 2WZPD 4F7PB 1T03L 1U92A 4H25B 1TQBB 3CXDL 4PV9A 3IDJA 4Y16B 1ZA3B 3TNNA 4JQVC 3ARDC 4EJ1C 5JOPD 5KJRL 1KCVH 5IFJA 5DS8B 2FGWL 1GCFA 3BX7C 1P6AB 2H8PB 2IEPA 4NQXB 1CE1H 3S5LB 1JK8A 3AC0A 4APQD 5J6GB 2C1OB 3IFPA 3V4UH 1KCKA 2YUVA 4MQSB 3NIFF 3NFPA 4PPTA 3HZYB 4S2SB 3O8XB 3VXTB 4QHUB 2PCPB 4O58L 3I9GH 1K9TA 1ORSA 4FXLA 3FQWB 4Y5VC 4XNXL 2DD8H 2A73A 1A3LL 5ETUA 2NY6D 3QWOB 4FZEL 1F4XL 1JE6A 1P9MA 1MHPH 4F2MA 2PF6A 2DKSA 5IMLB 1LO2L 1OB1B 5I1JH 4JJ5B 4UTAH 1DL7L 2W38A 4X7TB 5CJQH 4UOW0 4XVJL 3TA3B 2NY1D 3TVMD 5D1QA 4P2QB 2FX9H 3WLBB 1U8IA 1ZS8A 4FFZL 5DD0H 1RIHL 4D0BB 1E6JL 4XH2A 3PHOA 1NMCB 3ZL4H 4ONHA 2CKBH 1IM3B 3H9ZA 3ZHKA 3AXLB 4FFWC 1QNZL 3WHXB 2X4PB 4HWNA 5D71H 1NANH 3M07A 4YHMH 4Y5VB 3SGJA 5IFHH 2AGJL 2P45B 3LQAH 2BY2A 1BIHA 2VE6B 3ARGD 1H8NA 5T3XL 4EI5D 4Y88A 3Q0HA 2J1KA 2GCYB 4OLVL 1UYWL 1BZ9B 1WEJL 2NXYC 1CF8H 3O11A 5DZOA 3ME0A 4XB8A 2X4NB 5TF1L 3TIEB 4PRNA 2QJDA 4KKNA 1FRGH 5DJYA 4GBXA 2Q1EA 5D7SL 1VB9A 4G6MH 4HCRA 1BGXH 1FRGL 4YO0A 4JR9L 3MA7A 1MFAL 4NNPL 5CGTA 5MEPB 1JGDA 2HVJB 5FUZH 4WI5A 1NLBL 4HKZB 3OR7A 3CFKB 5DD6A 1QLRB 1VKXA 5HGHA 1CN4A 2DQIL 5TH2B 2BDNL 3MNWB 2EH8L 1H15B 3C09C 1K5NA 4MA7L 5CIPB 5F44A 3BO8A 1ZLUK 5F7MC 1DL7H 2VLME 4WHYH 2G2RB 2WLYA 3WKMH 4XVSL 2IQ9H 4HAFA 2JIXA 4ELME 4U33A 4I0PD 2VISA 3S88H 3JWDC 1F4HA 4CDGC 4Z8FH 1RIHH 1YUHB 3EDKA 3QRFM 2DM2A 2EC9U 5TDOA 5I0DA 2XACC 5T1LD 3V0AC 4OD3H 2ADGA 3MJ9L 4BKLB 2EO1A 1XF2A 4F7TB 4N9GB 2PR4L 2C5DC 3V6ZB 1EO8L 3GM0A 3G08A 2NY6C 4Z7UA 4XXDB 3LHPL 4QTHB 3S7GA 1FLRH 2YSSA 3DX9B 2B39A 5D70L 3UPAA 1NBZA 4JFDE 1MQKL 3C2AL 5DT1L 3CNKA 3RL1A 5L2JB 1EXUA 4JKPH 4QRPB 3SDAC 1FVEB 3DX7B 5DJAA 3BKJH 4XMLL 2ENYA 5TQ2L 2IPTH 1P2CA 4WI8A 2CIKA 3HE7C 4YHZL 1JGVL 5FM4A 3MRFB 4OV5B 3NABH 2LAAA 3LEXA 3U6RA 1T3FA 5D7LE 4AQOA 1IQDB 1KC5H 3EDFA 3VFRB 4JO1L 2D2OA 2QSQA 3KYNA 1B0GA 4QKXB 2IFFH 3BRDA 1GPOH 4L4VA 4HGMA 3HPJB 1F8TL 3U9UB 1X44A 2WWKO 3D5OF 1MHHA 2OK0L 5D70H 1LO0L 4XZUA 5HYQB 3EW3B 2MKLC 4DUWA 2P5WB 2FB4L 3BMVA 2OX5A 4OCYH 5CHNA 3GK8H 5GS0D 5GS2H 4KY1L 4XBEH 3MV9E 1NJ9B 4K3EL 3K8LA 1RIUH 1WBZB 5GGRB 1I1YA 4YIQB 1U8NA 3VFRA 4DN3L 2VDQH 3HZMB 4YHYB 5KW9L 3OR6B 1DLHA 3AMKA 2NY2B 4QNPE 2GFBA 3TFKD 4YWGL 4JPIA 4EN3D 3MUHL 3N9GH 5C0ND 1DBBL 2YD4A 3DBXB 4ZXBA 5C9KA 4EDXB 4ODSH 4LK4A 2ICES 3H0TB 4OKVB 4ZFOB 3F7PC 3V0VA 1CU4L 2WSKA 3QRGL 1I85A 3RKDD 4K7PH 2BVQA 5CJOH 3BGMB 2W9DL 4OQTA 3PIQA 2ZSWB 3QDGE 5EWIL 3W0WE 3MRHB 5F1NA 3DMMD 2VXTH 5GGRA 1UWEH 1G6RB 1LK2A 4MLIA 2IQAB 2F74A 1BIIB 3LMJL 2HTLC 1S9KC 8CGTA 2H9GA 2A9NH 2V9RA 3A6BL 3D39E 4OLEA 3E2HB 1SQ2N 2CR3A 2VDRH 1BZ9A 1UH2A 3ZMRA 4F57L 3T1FA 2DQGH 2ENSA 4N5EC 2MSPA 3I3BA 3NFNB 1V3MA 3VGGA 1QSEA 4XPAH 2OXGA 1OWRM 3V0WL 5F9WB 1KN2L 1GGBH 4LCWD 5DJXA 3BD3A 4G6JL 3U4EB 5FO9B 4MB3A 3S4SB 4RISH 2A2QT 4IIQA 2NY5H 1AR1D 1WFNA 4ODUB 1NPUA 5E1AA 1FE8H 3OKMB 4XTRD 1ZLWK 1F4AA 1CL7L 4HMCA 3QSKB 5T1KA 1YMHA 3SO3C 2B0SH 2QKIB 3L6FB 1MRDH 3QDJB 4L8SB 1WFUA 2BMKB 1I1YB 2Z31C 4MAYB 4AEEA 3KPSE 2A6KA 5E08H 2YN5A 3G5ZB 2SEBB 2FJGA 4X7EC 1ZVHA 4U1IA 1WWBX 4UU9B 2F54A 4U1LB 1E4XH 4LSDA 1MWAB 4OTXL 4MXVE 4LVOC 3HNSH 3NA9H 5C3LD 2ICWB 5I1AB 1AGCA 2BVPB 3L3GA 3X12B 2ZUQC 5E6IA 3DUSB 1J1PL 4Q0XH 1F6FB 2IALB 3PHQB 2FJFA 4J6RH 4XP9L 1YQVH 2GUOA 2FIKB 3RHWK 2VDLH 2CJUL 3VXPA 4ETQB 1FO0L 1CDGA 3OQ3B 5KVDH 1WISA 1UG9A 1PSKH 1ZHNB 4ZAKA 2AJVH 1CK0L 4JFDA 1LNUB 4HS8H 1EXUB 1MFDL 1WFOA 3AAZA 4P4RB 4WFED 3L5JA 3C2SA 4WW2A 2P8PB 4EIZC 2Z31A 4ZO6A 5EU6A 1PBYA 1P2CB 2BXYA 1TZIB 2VDRL 3S88L 2BHYA 4I3RH 4WCYL 3SE4C 5CINH 2HFTA 5ICZA 4XP6H 1N64H 4GUPB 3NIFE 1PGRB 1FYTD 4HV8B 2NW3B 3ARBB 2OL3A 1IQDA 1RZIB 3T2NL 4MA7H 4Y4HB 1XIWD 3MRKB 3QPXL 5HHOD 4YR6A 4V1DE 5CWSA 2YEZB 5EU4A 3Q6GH 5D96C 3BWUC 3FQUB 5A16A 1BX2B 1KPVA 4R8WL 1BBJB 3GO1L 1AE6H 1UXWB 4PLJC 4PIRF 43CAA 2GJJA 1X4XA 1Q8MA 1MLBB 3EAKA 4JKWA 1WAAA 4NRZB 5CEZL 3OKLA 5F21B 3MA9L 2ZJSH 3ESVF 1D5XA 3SEPA 3LV3A 4M1GH 1QG3A 2W0FA 3B9KB 4WTZG 4C83B 5HGAB 5E2WL 3H9HB 3H3BC 5D1QD 4LLMB 5HHPA 1T5XA 3S96B 4X8XA 4MNHA 2YC1A 4N1CA 3X3FL 4HWZB 1DUYB 4JN1L 2DJ4A 1ZE3C 5DJ8B 2NZIA 5MEND 2CSPA 4H25A 4KKCD 3O9WD 2FHBA 1QFPA 1T0NB 3HMXA 4IRZL 1W2KT 4DKDC 1GOHA 4J3WA 4XPGH 1MCJA 1BQHB 4LSVH 3O4LE 1J05B 2CJUH 1OGAE 4OGZA 4R0LB 3STZB 4WFGD 2HFEA 3HG1D 1D5XB 2CQVA 3TV3L 3IRPX 3ARDA 1GPOL 1XZ0A 4WNQA 3RL2A 2A83B 3L3JA 2O26U 3RJQB 5CJQL 1R5VB 1RFDH 3UPRA 3QUYC 4P2CG 3UCRA 1BOYA 1OT1A 2F8OA 3UC0L 4WU5A 3RDTC 1KYOK 5JDJA 1WSST 1E6OH 2FWOA 3GUTB 3UTTB 4JREB 3V5HB 4JANA 2Y6SD 2YD5A 3RZCC 1EEQA 1YC8A 2DWEA 4Y4KA 1C1EH 5TQ2H 3VWKC 1TJIL 3O3UN 4LDOB 4M48H 5EBMA 5I1GH 3GSUA 4PJIE 3MZGB 4GRLC 3B3IA 1ZGLM 3SGDH 1U8IB 5FGBA 1A7BA 4R0LC 3RWGB 3DRQB 2OS7A 3DPBA 4NN7B 5J11C 2APBA 3DSNA 4PRDA 3MV9B 1W72H 4DN4L 5C1MB 4JFHE 3HCVB 2KKQA 4LVNC 3CFIC 2Y5TA 3GUTA 3FFDA 4OZIF 4YQXH 3O8XC 3CFBB 3ZE2E 2X4TB 4HWZA 3HS0A 1MLCB 3LSOB 5DRZB 5CGYD 3SHSA 4OD1L 4HGWB 3MROA 1F3JB 1U36A 5JZ7C 3GSUB 3QXDA 4U1LA 3DYOA 1S9VA 3WXVL 1MWAA 4XWOD 3QWRA 1FSKB 1QEWB 4P4KD 4HWEL 4U1SB 3NCMA 1K4CB 1TJHH 1WBYB 3DYPA 1OOAA 4R9HA 3AREA 2BX5A 4ZUWA 2QSVA 3B8SA 4KKLD 3FB8A 3E0GA 3RNKA 2DIJA 5JOFA 1T66C 5HD8C 5IJVB 3BQUB 4PUBH 2VXQH 3GBML 1OGAA 4AEIH 2H1PL 2YXFA 1N6VA 1RULL 3QNXB 2IPKB 4BZ1L 4HT1H 4WEBH 4HWBH 3VGBA 4PV9B 5D72H 3P9LB 4WO4A 2EKSB 1C08A 2ESVB 1NCAH 1MH5A 4KI5D 3FN3A 1U91A 1TZIA 5TE7L 3O2WL 4UINL 5LGHH 5CBAA 2FSEB 4UB0H 4ZO7A 2AJYH 4GW1B 5IM7A 5K59E 5I19H 3PWVB 4ZO9A 2R0KH 3WLWC 2E6PA 5D71L 2M8XA 1UZ8A 4NQVB 5AG8A 2ADGB 4JDVB 4L8DB 4WY7H 1VPOH 5L6YL 1NUNB 4KK5C 4NHCL 4TSBH 5GRUL 1LP9F 4FFYH 3EYOB 3OV6A 3VJ6B 4K8RL 3QUMA 1SBBA 4I13B 2BHUA 2OQJB 4NN6B 4DZ8B 3IDXH 2G60H 2FECL 3WUWG 3D2UA 3UTOA 3RPIB 3BDBA 3RY5A 1MCNA 2LFGA 3B5HA 3TLRA 5IEKB 5INDB 2MPAL 4F9PC 4YUEL 4CVUA 1OHQA 4ODXA 1ZGLB 4G3YH 1GC1C 4UV7H 1JYXA 2C4FT 5MENE 1S9VB 1U93A 1ROWA 1HH6A 5FO7B 1MJ7H 5DJZA 4I0PB 1FNEA 2VL4A 2DJSA 4KQ4L 4ZUWB 4HUVA 2Q20A 3T77A 3T0BA 4U6VH 4HZLB 2X4PA 1KCSL 2B5IB 3MRCB 3KDMB 5JIKA 1OGAB 5C2UB 1IM3A 4HBCH 4MS8C 43C9B 4KJQC 4F80A 2DQEH 5HYQA 2YD3A 4WW2B 2JCCE 3RVWD 3Q5YA 1JVKA 2V17H 4AL8H 2AEIT 1KG0A 3RBGA 4NKMA 3D1MC 4G7YL 4OJFH 3BISA 4U6HB 3MLZL 4PYGA 2Y7QA 3GMOA 1KULA 1NL0L 1EVUA 1NGZB 1Q0XL 5KVEH 4HUXA 3T0AA 1UH4A 4NBZB 3RDTA 3V8CA 4XP4L 1U8HB 4PGEB 1JGLL 1KXQE 4L9LC 1AXSB 4MAUH 3Q48A 3D3VB 3H9SE 4PJ7E 2J3SA 5E8DH 2FX8L 3MRCA 1RUQL 5L6YH 1CXLA 3H3PH 3C8KA 3OJ2C 2APFA 3ZKMC 1A9EB 3D3VE 4N1HB 4PJ7B 5DD6B 5EZJA 3PWUB 4RRPA 3E8UH 4WTXA 2X9WA 3KLHC 4FQQB 3S35H 4FN0A 4FQLL 2NY1B 4LEOA 3TVMB 2YPKA 4Q2ZA 1S7QA 4Q0XL 4P2RD 2JIXB 3LZFH 5BV7B 1UWGH 1CVSC 1QSEE 2P5WD 2FRGP 4U3HA 1WLHA 3AM8A 1DN0A 2BNRE 3GBNH 3GGWB 3CD4A 4NJAH 4XWGH 4PJEE 5FHAL 1HSBB 3B2VL 4E41A 1OW0A 1T04A 2W9EL 2CIIA 3EFDH 5SWQA 3STZA 1BD2B 4D3CL 4Z7NE 3T0WA 3QDGA 3ZL4L 2FJHB 1X5XA 3BWAA 1A64A 3C6LA 4G42B 3QHFH 1TXKA 3D9AH 3TBWA 4NUGL 4XAWH 1MUJB 1ZT1A 2A38A 2W59A 3B5TA 4IRSA 1G7QB 1T21B 4IOFC 4GW4A 3OJVC 3BIBX 1UWXH 2EKSA 4L4TE 1FAIL 3O4LD 4OZHF 3ROLB 4U1HA 2OJEA 1U91B 3Q3GA 4LOUC 4RIRA 5F9DC 4GAYA 1WT5A 2A9NL 2KUTA 1M7DB 3A6BH 4EUPA 3C9NB 4XNXH 3KYNB 5KANI 4ZS7L 3PV7A 1MHEA 5T1MA 4HS3A 2NYYD 1J5OH 3F12A 2IH3B 2CO6B 1VGEH 4ORGA 4WHYG 2YK1L 3QUXA 2V9QA 2AJZA 4P2QA 3L7FB 4OCSL 3MREA 4LSQL 4OF7A 3TESA 4JQIL 3EHBC 4AH2A 2XYCA 3QISA 1ZHNA 4LVOB 1NCCH 2XZCL 5IQ7H 3BN3B 5FYKU 1Z5LA 5EUKB 1I1AA 4IRJC 1R0AL 1HHHB 1M05B 2AABH 4I2XB 3KYMB 4K2UH 3AAZB 4JO3H 4P4RA 5TE6L 1AHWB 4NOBA 4TQEH 5F1IA 3WS3B 1LK3L 4ORZC 5BRZB 5HHOE 5L7XH 2IG2H 3H0TA 1MWAL 4RZCB 1FIGH 1MIEL 1NEZA 1JMXA 3QA3B 1DZBA 5GGUB 1N6QH 4HUVB 4HSQA 4Y2DC 3PGCA 3HE6B 3T2PA 5DFVC 3QUKA 4E41D 3GJFB 4LHUA 4PGBB 1Z5LB 1A7OH 1OTTC 4PJAF 4RFOH 5HHOA 3U48A 3T1WA 3I3DA 4NWTH 3ARYA 5EIQA 5CD5D 3BN9D 3UYOD 5J3HC 3VFTB 2Z91B 5I17B 3BYYA 4UAOB 4D9RE 4K9EC 1MCKA 4GG6E 2LU3A 3MNZA 1KLFA 3IDMA 3PABA 3IF1A 5C08D 5I76B 1A7RH 1QA9B 2P46B 4PRPB 5HDQL 1B6UA 3BO8B 3N1GC 4ODHL 4D9QE 4ELMA 5J1TC 2HFGL 4NQDE 1V7ML 1ZSDA 2YZ1A 3U4BH 3TPUB 1IKNA 4KKBD 4KK9C 4OCLC 4L8DA 4QOKB 1JNJA 5TQ0L 5FA3A 3NCYP 2D0FA 3X14A 1J0IA 1NFDA 3B6SA 4XAKE 1P7HL 2I9LB 1TTGA 4J4PC 3LDBC 5IOPB 3U1SL 3VFVA 4FTVE 4EDWH 5B21A 3RVXC 4F3FA 4HKXA 2EDQA 4RGND 1FFOB 3WIHL 5I15L 2C3HA 5GGQH 3GMNB 4DZBA 1QVOA 3LS5L 3MRDA 4XP1H 1IQWL 3QCUL 3L1OL 4WU7A 1L7IL 3P0GB 4JG1L 3RIFK 1O5DT 3NCBB 4JY4A 3REWB 4QRPA 4PP1D 3HG1A 1RZJC 3MJ7A 3KR3L 4BSJA 2OJZL 4M3JA 3GMMB 4A6YL 2NXZB 2C3VB 3B9KD 4CDHA 1I8MA 4QHLB 4WU5B 1DSFL 3VMPA 4R97C 3BKCL 4O5LL 5IMMB 5E6IB 2OI9B 2E7LA 5JO5B 1B4JL 4I8DA 3UTSE 5E1HB 4L1DA 5ALCH 1CE6B 1CD8A 25C8H 1HINL 4PJFB 2YD6A 4HIEB 1HHJB 3T09A 1L9MA 2FIKA 3X3GL 5EOCJ 2R0ZH 3VXUB 2P5EA 2ERJB 3NA9L 2PUQT 5FYLE 4XHJD 3W0WD 3GSWA 2UUDH 1ZT1B 1CLOL 3GSVB 5EBGA 2GSIB 1SHMA 5D7SH 2FATH 2ZCLL 2CO7B 1FFRA 1QKZH 3BP6A 4KJPD 4HV8A 5GZNC 4DVRH 4BJLA 2EXYC 4LFHG 3TH4T 5TGBA 3QWOA 1RD6A 3WUWB 3BZ4A 3EZ8A 3T3MF 3D0LA 3C08H 1EFXB 2UYLA 1F11B 3EYSH 1MLCA 3LSOA 4YR6B 4JKPL 3I2CH 2IC2A 1JWUB 3UJJL 3K4ZA 3AREC 1K4DB 3BEWB 1VACB 4ZFGL 1PW3A 1XH3A 2F8XC 3WNKA 1P7QA 3WFEH 3BH9A 4JZJA 1A0QL 1FHGA 3HPLB 3WO3B 5D93B 1BVZA 3I02A 4CUCA 4EI5A 3HZKA 2EYRA 3IFLH 3RVTD 1UCBL 4HPYL 1PYWA 2MQ0A 3TGXA 4PRIA 3JWDH 2OYPA 1ACZA 5JQ6H 2NNAB 2ZUXA 4WFGE 3C5ZB 5CZKA 1DQTA 1YN6A 4JKLA 3RWCB 2F74B 2ADJA 2HH0H 3UYRH 2NY7L 2QADC 2R2HB 2ZPKH 3IFNL 4X6BB 4GW1A 4JY6B 1KJ2A 5T3ZL 3JV6A 1J8HB 3TO2B 3T1FB 4DN4H 4OF6A 5GGVY 2HKHL 1P4IL 3WCYA 3ARPA 4M9OA 1CZ8H 1XR8B 3ALWA 5B8CC 4PG9A 4ALAL 3RIAK 3GSNB 4NDMB 1I9EA 1GGUA 1U6AL 4MHHG 4RFNB 2NW2A 1TJIH 5L9DH 1R5VA 2G75A 4DN3H 3N1FC 4DKEH 3QDMB 2HLFC 4RIRB 4OLYL 4MCZB 5INDA 3LKOA 5HHNB 1YJDL 3LY6A 1U8KA 4PGDB 2ITDB 2VIRA 4NO3A 1G0XA 2PNDA 1JK8B 2Q76A 5FO7A 5FK9B 3ZE0E 2P4AB 3OBAA 3IRZA 5IEHA 3HNTH 1U93B 5D2NA 2EDEA 1I8IA 1RMFL 1CLCA 3EZJB 5B22A 4JFZH 4QEGA 3THMH 3MYJB 1EHXA 5E8DL 3I3EA 4EBQH 4JFFA 4M1DH 1HEZB 1IE5A 2HMID 4PREA 4MD5B 3VFUB 1YEGL 4WFEE 5C09A 4EVNA 2G75B 2PTTB 5E8EA 3STLA 4NC1E 1U3ZA 3P9MB 1HQRA 5FYJL 3CVHA 4OCWH 5HPOA 3UP1A 2OLDA 2YPLD 1P7KA 4XCFH 1I9JL 4BZYA 5AUMB 3HG1B 5DJCA 2ADJB 5IG7B 1YNKH 1WTGT 3FCTA 3P11L 2NCMA 4PRID 1HYSD 1IGJA 5BVPH 2AERT 5A43C 4FZ8L 5KSAC 3GJFA 4TUKL 4NO0D 2KBGA 4Y4HA 1NDMA 4P2OB 1HHIB 4Y5YC 3O9WA 1CXHA 1I4FA 5IT2H 3CGTA 2F5AL 1G9ML 4RDQG 3TZVD 4OZHE 1EMTH 5EZJB 3U9UA 2RB8A 1W8OA 1U8QB 4ACPA 4OQTL 3QFJB 4U3XA 4GQ9L 5C0AE 2ARJQ 2EEAA 5DVLA 5MHSE 4Y8AA 5AUMA 4NQEA 3VD3A 4X4YB 5DXWA 2NY3B 3G6DH 4PJHF 1S7RB 3S34L 4ZFFB 3JTSB 3NZ8A 4ZNEE 3AB0B 1FO0B 4PY8I 1EUUA 1MRCH 5HYSG 4P46A 5E9DB 4ZS6C 1WBZA 1FJ1B 2ARJB 2E8YA 2PYEB 3UTSD 1LEKA 4E42A 1G7HB 1UM4L 4QRQB 3DVGA 1I7RA 4HBQA 2NY4B 3LRSA 3QIUB 1PKOA 3RVUC 5EC2B 1QRND 3HC3L 3QEQD 2IFGA 3RTQB 3NIGF 5I1CL 4JR9H 4PG2A 2I5YH 4POZD 2BSSA 2DMBA 3CU1A 4MD5A 2Q86B 1ZHKB 3A67H 3PF2A 3BYTA 4G42A 4LRNL 3CPLA 3NZ8B 3QO0B 3MXWL 5L9DL 1AGBA 1HH6B 5IMMA 4KTEL 3V7AE 1KJVA 3OXRA 3KHOA 1WZ1H 1KGCD 3U0PA 2LTQB 4AT6A 1IGJB 4G6AD 4HZAA 4HPOH 1F6AA 2HJFA 4P5KA 2R0LH 4I9WE 4KAQL 3C60A 4N9GA 1I1AD 4DVBA 1HI6A 5I8KL 3DROA 1MY7A 5DMIH 5EOCL 5AYUH 2V2WB 3Q3GB 3TZVA 8FABA 1NFIA 2ICWI 3O4LA 4YDIL 3TIDB 1Q9LA 1KBGH 1H3WM 1ZHKA 3TPKA 4TTDD 4AIXA 1LP9A 1P4BH 2ID5A 1OP9A 2IH3A 2YUZA 1KTRL 2IMMA 15C8L 3ZHLA 4BK4A 1R3LA 4QWWD 4G9DB 4XBPB 1ZLVK 1QFWH 2DICA 2R2EB 5JUEH 4A2LA 5EC1B 3N0PB 2H32H 3QO0A 1YNLH 5C6WH 3ULVL 3VFPA 4AH2B 4M61B 1R3KB 4CN6A 5L88L 2Y7QB 5EU3B 2XRAL 1PKQE 2YRLA 3LKSB 3MMEA 4JG0L 4U6HA 3V2AR 1HDMA 3OKDA 2VH5L 1Q0YL 1NCUA 4KV5F 1GGYA 5T3ZE 1C5CH 2JJSA 1EFXA 2UYLB 2VUYA 2VLLB 4YLQT 5FA4B 2HVKB 4EN3B 1YEIH 1I9RH 4OGYL 3QIUA 2VXTL 4UU9A 1NGWB 4RMSA 1A9EA 1QHOA 1WC7A 4JGUA 3E3QE 3VXOA 2FL5B 4D8PA 1MREL 3ILQC 4MCYB 4K7PL 4PJ9D 3FOLB 2OTUB 3IXTA 4ZAKB 1MJJB 1XGPA 3V5DA 4LPVA 1TVBA 4AZ8A 4HS6A 1Z9MA 3FB7B 3CXDH 1DN0B 4Y2DB 5IVOA 5K9JL 4X6FA 3WD5H 4BFBD 3KPSA 3EDDA 2D4FA 4JY6A 3T4AB 5I71B 4OI8A 2VLJD 3NTCL 2WWMD 5FGCE 2GK2A 4OB5L 5I74C 3UJIH 2LU4A 4TULL 5FM5M 1VDGA 1JL8A 4LASH 1XEDA 3IU4L 5D1XC 1T1XA 3GSXB 1SBSL 4MXQD 1CLZL 3MLRH 4FQ1H 4LFHD 1A9BB 3MBED 1NBYA 2VLKB 3KXFD 2YD8A 3O3DB 2V7HB 3I85A 3VA2C 1EAJA 2R39A 3T08A 4ZYKA 3ECBA 3VE0A 4PV8B 3MRJA 3MRHA 4NSKB 4IJ3C 5KVGH 4YGVA 2EDKA 1UQSA 2DQTL 1A6ZA 2D7TH 5SV3A 1CI5A 4U1KB 3INUL 1J1OH 3HC4L 4PJ8D 1MFEH 2VLRD 4RGNE 2AJUH 4O51B 1AQDB 2P5EE 4FTVD 4GW5A 3B9AA 3BKMH 4KZEH 1P4LB 1CFNA 4GRWB 5IEHB 3F12B 1JTPA 2CGRH 1Y6KR 3IXAA 5T1MB 1A7PH 3RWJA 3SDCD 4M02A 3IDIA 3HR5A 4LLWB 3ARZA 1CTNA 2PXYD 5E4EC 1N5YL 2J8UE 4LPWA 2K9UA 2HP4A 3T0XA 1BQUA 3BW9B 4MA1C 4YHIA 4Y19A 2BSSB 2Q86A 4M7JL 5AG9A 1ADQL 2BVOB 5GS3A 3L3OA 5D7JC 3FQTA 3HG1E 4PJ9A 4S1DD 3PDDA 5DK0B 2YRPA 1E0OB 3HNVH 1AI1H 4M7LL 3SE9L 1P4LA 2W0PA 1EFQA 2XQBH 1UJTA 2XRAH 1OARL 4PJGB 5GQBA 1EZVY 4NQTA 4JG1H 5C0IB 2GSIA 3C8DA 2DLFL 4NKDA 1ZHBB 1DDHA 4MXWH 1N5AA 4LCWA 1RUPH 4AT6B 1PDKA 3MV8D 4NKIL 5C0EB 4JGMA 4X99A 1OAZH 3BDYH 2OR8A 4GXUM 5F9JB 2R9HC 3ARFA 1WF5A 5D6CB 1NFIB 3O4LB 1JF5A 4TSAL 3QAZC 1F3DJ 5I66A 4H5SA 3QFJA 1SJXA 2PW2A 3VCLA 3CU7A 3G5XA 4L8CA 1TFHA 2Z91A 5BV7L 4LQ1A 3RP1A 4WHTB 4LP5A 2WQ8A 2C3WA 4U1KA 5EIVA 2OCFD 4YHLL 3J8F7 3EOBA 1RZKH 3MLUH 1S7TB 3BGAA 3I02B 3KAAA 1IT9H 4Z78B 1PJ9A 5D1ZA 4FQJH 1CFNB 2NW3A 1JNHA 4KC3B 4JO2H 4P9HH 3MJ8A 5DO2C 5GSRA 3R06B 3AMLA 5F7DB 4TNWK 4OLZL 4W70A 1RURL 3ZKXC 9CGTA 4PRBB 4TOYL 1A2YA 4L8BB 5IVZB 3W11D 4NP4H 1A7NH 1NC4A 4KV5E 3CFJA 4RISL 1FNGB 1EJOL 5KSBF 4E0RB 3QI9A 2IANE 4YXKH 3V79C 1OAXH 4L4TD 1UM4H 1QBBA 5CZVL 2YKLL 3D0VB 3P3YA 2XXMB 3V6FB 4GKZB 3LKPB 5EU6D 3BPLC 4PS4H 3CDYA 2DWDB 4GQPH 1SEBB 1DJSA 1A6TA 1RIVL 2NY0B 3MUGA 3FZUC 5I30L 1Q72L 3GHEL 1B0RB 2E9JA 1ZHBA 4UT6L 1MF2H 2I9TB 3Q6FA 5I1LA 5JDSA 5IF0A 3U30B 1ZVSA 1FL3B 3QH3B 5J12C 3C5ZD 4P2QE 2LE9A 3LS4L 4W68A 4HBCL 3TBVA 5D6CA 1J8HE 1JWSA 3TT1L 2WM0A 1I1FB 3VD4A 3KPSD 2I60L 1FG2B 4ZODA 4NQED 5IESL 5F96H 4PLKC 4TUOB 5CJ5A 3RTQC 5EU7C 2Q7NA 2QQNH 1GOGA 1Q1JL 4XVUD 2OL3H 1J86A 4NRZA 5IB3B 2LABA 1F58L 3BP6B 1FN4A 5DDHB 4L29A 2D9QB 3QHZH 4H20H 2QHRH 3PP3K 4DZ8A 2Y5EA 4J4PA 3TH2T 5MERA 3BP5B 5E0QA 2N7AA 4MNHB 2HJLB 4CADA 4P57A 4RGNB 1EVTC 3NAAL 2VAJA 3RVVC 1T20B 4UQ3A 1T03H 3GHBL 5F89A 4LSTL 2PTUA 1A6UL 4I4WA 3IVKB 5FO8A 2BCKA 1U9KA 4WGVB 1KPRA 3QULB 3DETC 4UT7H 2GIYA 5IBTL 4RA3A 5AYUL 4EI5B 4LNRB 12E8H 4X4XA 1CCZA 3OX8A 4K3JH 4XNZC 2OL3L 2WW8A 5EPMB 4JFHD 5F6HI 1HH9B 3ARDB 1NL0H 2VXVL 2XQYK 3EJZC 2E7LC 4OM1L 4NQCE 4HXBH 4U0RC 1FDLL 5JXED 1NEUA 1TPXB 4GSDL 4XWGL 4OJFL 4HLZH 4B7IA 4R7NA 5DJDB 2WP3T 1AQKH 1U8QA 1EA9C 1RZGB 3RX5A 1B0RA 2Z35B 1FORH 2RHEA 3MROB 2QSTA 1A3LH 2GSGA 3OJDA 4HJJH 2UUDK 3P0VL 5KVGL 3GIZH 2EE9A 1S7VA 1IAIL 3BP4B 3P0YL 3QIBA 2QQNL 2I07A 3HI5H 2VDPL 3TBVB 4ZOBA 1ADQA 1MJUH 4U1GB 5EBLB 3MGOA 5FYKE 2BRRL 5I1HL 1NLDH 1U8OA 3D48R 2I24N 4JFOB 3RZWA 3WFCH 2C1OA 4ONGL 2PR4H 1NEZG 3U4AA 1IGFH 3EYQC 2C1PB 4GG6B 4KTDH 4CW1B 1DN2A 5IW6A 4ZNEA 4NDMA 3HB3D 1EBPA 1HXYA 2APXA 3UO1L 4QHUA 2QHLA 4OGXL 2QQLH 4Y4HC 1OLLA 1FZJB 5F6HJ 4W81A 1OPGL 2JJUA 4PS4L 1KJMA 4X5XA 1OP5H 2EDFA 5JR1H 3QIBB 2H2SD 4F2MB 4PR5B 2I07B 3EFFA 3WL9A 1U58A 3GIVA 2FEEL 3UROR 6FABL 4R2GC 4ZUUA 4IRSD 5J0BA 1IAOB 2NY3C 3KPNB 3PL6B 5GGSA 2JJTA 3ARED 5EZIH 5C0BE 3W11C 3QIWA 3PGFH 3U79A 4JM2B 5T5NG 1ND0B 4ZQKA 4Y1AD 2DRUA 5HI3D 4U6VL 3FHAA 2HJFB 3CSPA 4P5KB 3KS0J 3H42H 2X4RB 3SDXB 3T4YA 1IAMA 2FYYB 3QUMB 1YEIL 1S5HA 3O3BB 2EXYD 3DOSA 2PYFB 3S97C 1MCCA 1ZANH 4R3SB 4J8RB 3CDFA 4AJ0A 2A6IB 1W0VB 2CMRH 3L9RB 3BGFB 1LO3H 3L7EA 1XZ0B 4MSWA 4NNYB 1MUJA 4XNUH 5D72L 4PJCF 5C0IA 2BNRB 4KROC 2VMFA 1AGFA 1DLFL 2GT9A 2YMXH 2J2ZA 3PGDB 5J9PB 2GEEA 1IGMH 1S7VB 2X4NA 5CHNB 1YYLL 1GZQB 4F7PA 5CJXA 4HIXH 1I1CA 1QFOA 3NPSC 4K7FA 4QXGH 3U7AA 3PWLA 3ARFB 5D7KE 3W9EA 1OARH 3NIDF 5FCUH 1P84J 1YEKL 4LIQE 1TJGL 4LHQB 3V8OA 4HUNB 3V5KB 5SX5H 1MHEB 2ATPB 2E9BA 1JZ7A 2F19H 3P4OA 4HKZA 3P4MB 1U42A 3SE3C 2RBLA 4IRZH 3AFLA 4HPOL 1JI1A 1ADQH 1UZ6E 3B9KC 4YPGA 4XPHL 3C5SA 4ZXBB 2VLJA 4KHTH 3TJEL 5C0GA 2CXGA 4OZFH 1ZLVH 5B39A 5JW3L 2RFXA 3QDJE 2JIXD 1T89C 4GRLA 5HI5D 4N8CH 2W60A 5F3HB 2BVQB 3QWQB 5JPMB 1F45A 4X7DC 3SDYH 2HAZA 5ITFA 2VXSL 5GSRB 2PYEA 5KTEL 1NGXB 3JSSA 3ULVC 4P46B 5E9DA 3FO9B 4PLKD 3MLPA 1YA5A 1IAOA 3F7YB 4RAVB 2YN3A 1JF1A 2QQKH 4ZOEA 1MFBL 2DI9A 1OSZB 4QYOA 2EIBA 2QQQA 5D9SA 5C08A 4C55A 4GXVL 1JWMB 3H3KA 4X7TA 3SN6N 4LLUA 1QZ1A 1OAUH 3QJFB 1CG9A 1BF8A 1T1XB 2VITB 3N1MC 1BJMA 4D0BA 4XH2B 3U9PH 1J10A 3DO3A 1LEIB 1J8KA 3RNKB 4NCC1 4ZYKB 3PP4L 4H8WL 1K8DB 5MP6L 4RMUA 2XOTA 3MLVL 3RBSA 4ZDHA 3FN9A 3UBXI 2XTLA 1A6WH 2CIKB 5CZVH 5JHLL 4AEFA 1ZLUH 3KJ4B 4GQ9H 2XN9D 4PY7B 4NUJB 5GRWA 4Y2DD 1MFDH 2F15A 1ONQA 3BPNC 4QRRB 1NC2D 1R3IL 2DOCA 5IQ9A 4BH8A 3HFMH 3UTZB 3DVNB 1JF6A 4JPKL 5DO2D 4JKMA 2F54B 1GGCL 4K8RC 4YPGB 5DD1H 1X3DA 3F6LA 4P59L 5D7JA 4Z0BH 4NYLB 1AC0A 3VMOA 5E5MB 4JFFB 1F90H 4FQXB 4ZD3H 3F5WB 2W60B 4JFYB 1C16B 1QRNB 5H94B 4GW4B 4P57B 2BVOA 4LSRH 4HXBL 1RJCA 3OKDB 5F6IC 2LTQC 4MNGA 3STLB 5CKGA 2WP3O 3EO0A 1T80A 3ZKND 1YDPB 1KEMH 1ZVYA 4IM8A 3K46A 5AD0B 4LQFL 5KTEH 1TETL 5SX4H 4PJGA 4H26B 1CGSL 5TDNA 3OAYH 2OP4L 3DSFH 3JV4A 1JUFB 1U8MA 3OX8B 1YEHH 3NACH 1EJ6A 3SDCB 3SDXA 2AXGA 3V6ZA 1A1NB 1HHJA 2R69L 4FQXA 4CKVX 3MBXH 4BQ9A 5DHYA 3VCLB 5DMGD 5LG1A 3WFDL 4CL7A 1XGTA 4J3XA 5A2JH 2BERA 3G6JF 4S1DC 5HHQA 4WWKC 1G7IA 4S0TD 5SX5K 2WIIA 1W0VA 4NNYA 1FV1B 1NGPL 3T4AA 5E70A 3WKML 1BZ7B 2G9HB 1C7TA 3QG7L 1B2WL 1RK1A 1AJ7H 1H3GA 1VHPA 1WICA 2BOCB 2MCPH 3GMLB 4Y4FC 4C54A 1TNNA 4GRMA 3MPCA 3BI9X 4LCCC 5I9QC 4RMTA 1T2QH 3PE9A 1IC5H 4TVSa 1A1NA 3FQRA 2C1PA 2JB6B 4V1DA 2XPGB 4XBGB 5GRZA 1NC2A 2APTA 1UQSB 1Z9LA 4OTXH 2HT2C 4XNZB 3ECBB 4S1SH 1KT2A 4Q9QL 4MDIA 4JZJB 4OM0L 1U8LB 4MJIE 4Y5YB 4DAGH 2GTZA 3T8XB 1M7IA 1I8KB 2JF1A 1IJ9A 4ESKA 4YHPA 3RUGF 2WBJA 4XNMB 1RV6X 5F9OH 3B9VA 5KG9B 1M7XA 1H5BC 3L5HA 1U95B 4NKOA 3WHE0 5ECJE 1BECA 3TO4C 2EDDA 3KJ6L 3GRWH 4U1IB 2C7UA 3RVUD 4Y4FB 3F7YA 4OF3A 4RAVA 3RWCA 4AK1A 5I1CH 4BA8A 4PJDA 4RQQB 3F58L 4JZOB 1AGDB 1KTLB 5F7EL 1QFWM 2AKRA 1IL1A 4LPCA 5IF0B 5IJKC 3OKKA 2GK0A 3HI5L 4TOYH 1T7YA 3JV6B 1UM6H 1KT2B 3V0WH 4MX7B 1K3ZA 1Z0NA 3LQMA 4UV4H 4K9EL 5J6GA 2FX9L 2VL5B 4G9FB 3KJ4C 3RI5K 4OT1L 3TIDA 5TJWK 4FQJL 5IMOA 2IWGA 3BPNB 4JY4B 7FABL 4KROD 2O93L 5AAMA 2LVEA 3B9EA 4MWFA 4FQPA 3TZVC 4G7VH 4MQ7A 4PJ9C 3CMOH 3SPVA 1TQCC 3LN4A 3GSNL 2AK1L 4MD0B 3CLFH 3PL6C 2HRPH 1T2QL 1M7DA 3WXWH 4EUPB 4R6UA 2VLRB 5DT1H 1G7JA 4Z7VF 2BCKB 4M6NH 3TJHD 4ODSL 1YYML 3FO0H 3G5XB 5F89B 1HINH 4LSPH 2O61B 4Z7VB 1VESA 3U4EA 4M48L 3C5JB 1JGDB 3ARQA 5AWNH 1CXFA 2EDOA 1FFOA 1A5FL 2YPLA 5BCAA 3I50H 5LAXB 3D39A 3VW3H 3LAFA 4A6YH 5F8QC 1J87A 3O6LH 4XCFL 1BM3L 1H15A 2H3NA 4ZOCA 2YHGA 4RMQA 1RUML 3U83A 1ETZB 3P2TA 4IEFB 4P4KB 3FO1B 1NGXA 4GKSA 2XWTA 3G04A 1HH9A 5DA0B 5ANMA 4Y1AA 3HB3C 3HI1B 4NN6C 2IAMD 2Z92A 3QNXA 1J0JA 1DUZA 5AYQA 3EYQD 2YMXL 5GHWL 3FFCA 2DQIH 2OZ4H 3UZEA 3LEYH 3TV3H 1FGNL 5FECB 1I1AC 4IRJA 3K8MA 1A4KB 4HXAL 1A7QH 2GK0B 3I75A 1VEOA 4G8IA 3ROOB 5BRZA 1T4KA