3Q3GB

Crystal structure of a-domain in complex with antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
224
structure length
224
Chain Sequence
QVQLQQSGAELVKPGASVKLSCTPSGFNIKDIYMQWVKQRPEQGLEWIGRIDPANDKTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCASEGHYGYDGYAMDYWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Light Chain
publication title Stable Coordination of the Inhibitory Ca2+ Ion at the Metal Ion-Dependent Adhesion Site in Integrin CD11b/CD18 by an Antibody-Derived Ligand Aspartate: Implications for Integrin Regulation and Structure-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/cell adhesion
total genus 44
structure length 224
sequence length 224
chains with identical sequence D, H, K
ec nomenclature
pdb deposition date 2010-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q3gB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q3gB02
2ZOLA 3GJFA 5C3TA 4Z0BL 4P2RE 4X8XA 2UYLB 4ENEC 3L3GA 5JUEH 2PXYA 1MHEB 4Z9KB 1H5BA 5DO2D 1OAQH 3FT4B 5DVLA 5FXCH 3UC0H 1KJ2B 5CJ8A 3VMPA 4QEGA 4JRYE 2AQ3A 2XA8H 4JVPA 5EOCH 2CLVA 3BYTA 1UB6B 4RRPG 3TH2T 2Y25A 4X4ME 3VG0L 2PO6D 2X4NA 4NQCD 2A0LC 4I1NB 1V5JA 3SCMA 5IKCA 4X83A 3IDUA 1MCOH 2P4AB 5HI3C 3SE3A 4YHNB 3T1FA 5C07B 1G7QA 3WIHL 2A74B 1OAXL 4ZTPL 2AI0L 2HJLA 2YC1B 1IT9L 3GDBA 1T1XB 5L2JA 2W9LA 3C08L 2NX5E 2XA3A 3GBMH 4BFIA 4HDIB 5KG9B 1QSED 5IOPA 3ULUL 4PJ9C 4Y89A 1CK0L 1OTUD 3TO2B 4PRHA 1R3KA 1M05B 5DHVA 1TQCC 5AAMA 2I60H 1SEQL 1T2JA 1MOEA 3UJJL 3H6JA 5EN2A 5K9QG 1NH6A 3KXFD 3QDGB 4RFNB 1NCCL 2R0KL 1R3IH 2VLLB 4K7PY 1JF6A 4NC1C 3VXPA 3WLBA 4XCFH 3GMNB 3U46A 3V5HA 4HUWB 4K7FB 4PJGB 5D8JH 5AZEH 5I66A 5D1XA 5A16B 1NCAH 4MAYC 1WICA 1GGBL 3OKDB 2IQ9H 2ARJA 4L4TD 2DQFA 1DUZB 4O00A 5DJ6B 3IDYC 4IMKC 3WN5A 2VQUA 4X4ZA 2XZZA 3HCVA 5I1HH 4WDIA 1IL1A 1P4IL 5FUZL 4N9GA 4C56B 3BAEH 4ZNEE 5HHMD 3P0YH 2I9LA 1I75A 1XGUB 2E7BA 3GUTA 1N64L 2ZKHH 1QG3A 1UJ3B 1RIUH 3BKCL 1CFTB 1S78D 1Q0XH 1CGSH 2F8VA 3LQMA 4RAVB 1D6VL 1S7SB 3DJ9A 4MD0B 5SX4H 1D5XA 2DICA 3O3AA 2ZUVA 2LE9A 1ADQL 4PB9H 2V2TA 4WTXA 5C86A 3D9AH 2DBJA 5JNYB 3BXNA 1IBGL 4WEBH 3EHBC 3HC3L 3QG7L 4U1MA 3IFNL 1JNNL 4JFQB 2GTZB 3BN3B 5FOBA 2BSED 3RZCA 1G1YA 1ZT1B 3BPNC 3B9KD 5DMGC 5DA0B 4AH2B 1P1ZA 3ZTJH 3L3IA 2APXA 1CL7H 4ZOCA 4QRSB 2B2XL 5EOTB 3W2DL 3QBTB 3S34L 5ILTL 3L5HA 1SJXA 4I0PA 3DX9B 1RUKL 1A6AB 2G9HA 5L2KD 1RULH 2C4XA 3BN9C 3V4PL 4L1HA 1EMTH 3QAZC 3RVUD 3TBSA 2E27L 2A83A 3I3BA 3RVWD 3G6DL 1T6WA 1R6VA 3STLA 4K71C 1D3CA 2VLKA 2UVFA 4FZ8L 2PF6A 1ZE3C 4GH7B 4WJ5A 3WD5H 3O4LE 3TJHC 1NANH 2XPGB 3UBXA 4UOW0 3WUWB 5C0FB 3QIWC 4UQ3B 1F00I 2XV6B 3KPQA 1TENA 4OQ1A 3VGBA 3QUXC 1GZPB 4F57L 2R9HC 1TZIA 2ZG1A 3IXAB 4XAWL 3RUGE 4OLUH 3SQOL 3KYOA 4Q74A 3HNSL 3JTSB 2ESVB 5GSVB 1OP3K 1J11A 4R4BB 3T0VA 2YBRA 3IXTB 4BSVB 3GMQA 2VH5H 2N4IA 4LPUA 2HA1A 4R7NA 1CXKA 2E7MA 4KHTL 2X4QB 2C26A 4RBPH 3EFFA 1S7UA 3UTSA 3ULVH 3CFJB 1QRKA 2XACC 3U7YH 2I9TB 4ZS6C 4PRAA 1TXKA 4LIQE 5EDXA 3IU3A 3B6SA 5HTSA 1RMFL 3WYRA 2OQJB 3S3PA 4M4PA 2VTFA 4CMHC 3EJYD 4AT6A 3RDTA 3AU1A 2IALA 3QZWG 2YRZA 1C1EH 5D1QB 5C2BH 3ECBB 3QULA 4ODVL 5CGYD 2FHBA 1WGOA 5DWUL 2YMXH 4PFEA 3MUZ1 1N4XH 2XZAH 1X5ZA 2Y06L 2PR4H 2B0SL 2WLYA 3D87B 1RUAH 4L3EB 4DQOH 3L1OL 2WQ8A 1G7MB 5KTEH 1RURH 4XVTL 4MA3B 4FFVD 3RWGA 4DTGL 5ECJE 1CLZL 3T2NL 3K4AA 5IEHB 4Y0GA 1PLGH 1DQTA 1I8LA 3VJ6A 5FO7B 4F9LA 1FZKB 4LLAA 4OKVB 1VKXB 4U1KB 4RDQG 2FGZA 2F54A 3LOWA 4PRPA 4XPTL 3FQXA 4CW1B 1FL5A 1NGQL 1OQXA 3ZSSA 4AEHL 1EBPA 5F9JB 4U05A 5J1SC 5JHDD 2Y36H 3I6GA 4FQJL 1FLRH 4HIIA 1QNZL 1BLNA 1MCDA 3O2DH 4NQSB 4TRPL 1E4JA 4OLEA 5B8CA 3LAFA 1LO4L 3E6HA 3L3KB 4KPHL 4C4KT 5I75B 1K3ZA 4M7KH 3DUUB 4PJHB 5EO9A 2IAMA 4OT1L 4XMKL 2OR9L 3QFJB 4HZLA 4FZEL 4GRLD 1CDGA 3RNQA 5EBGA 4PGCA 4F7CA 2F5AL 1YUHB 4MNGE 1I8MB 3D3VE 5FHBH 2FX7L 5DQDH 2NY1B 4P3DA 3F7QA 4KXZH 3DURA 3TT3H 5A3ID 1R3HA 4D0BB 5J9PB 3KPPA 3QCTL 1JWSB 1INEH 3VFUB 1TCRA 4YXKL 4M7LL 4HIHA 2YPLB 1PVHA 2EC9T 2DQTL 3LKOA 3ZTNL 1A7PL 3QWRD 3UCRA 1YY8A 5HGDA 3S8WA 4LLVB 2A1WL 2GT9B 1JTOA 2DLHA 4R0LB 3NN8B 1Q9WB 1MCPH 1MFEL 1QBMH 3B9AA 4Z7UA 4HV8A 5IMMB 1FV1A 2VAAB 3CH1B 5D70L 5I1DA 5C0AA 4QRUA 1FN4A 2AQ1A 4JFXB 2MHAB 1HINL 3N85H 4M8QA 1ED3A 3IF1A 4WGVB 4ODHH 1KCUH 4FP8H 3MUHL 4IOIA 1WLHA 5D2LF 3TCLB 2VRAA 3KLAA 3P73A 5CFHA 3V6OC 1EX0A 4XC3L 4U1NA 2DLGA 2WBWB 4JRXE 5DO2C 5JDJA 3ARQA 4JG0H 1YDPB 4HEME 3SGJC 4TOYH 4JDZA 3DX8B 1NLBL 5B4MD 4R96A 4FFYH 43CAB 5A2FA 4ZG1A 2GJ6B 1R0AL 5EZIH 5F8RC 5CEYB 2BOBB 4FQ1H 5IW1A 3HUJA 2HT2D 4ZXBA 1CGVA 1I1YB 1KN4L 3DYPA 3B2UD 5J12C 2NXZB 4KZEL 3HI6L 3T1WA 4V1DD 2CIIB 1MHCA 3AB0B 3V5DB 5FYLE 3RBSA 3QDMD 4JEGB 1CS6A 1PQZA 2HYMA 5A1AA 2BVPB 5SWSA 1NBQA 3IFLL 1I1AD 4QHKI 7FABH 1YEHL 3KYKL 3E3QE 3B4NA 5E8PB 4MX7A 1DQLL 3T4AB 3BPCB 4WFGD 2I07B 3MNZB 2X4OA 4S1QL 4HIEA 1RZKL 4XGZA 2FRGP 1HSBB 3T0EA 1FFPB 3GHBH 4ZO6A 2AEQL 2CK2A 1HIMH 3ME0A 3F6LA 3BVNB 4NM4H 5I30L 3ARDD 4U6HA 1I7RA 3TO4A 4LLYA 1GOFA 2AEIT 2AEPH 4XMLH 5LBSH 3WEXB 2ICCA 4CJ1A 3D85B 3QWOB 4ZAKA 2FBOJ 4KROD 3OF6A 5DGRA 4G80B 2ARWA 5JIHA 3HS0A 5F7NC 3MOAH 5EUKB 4GT7A 3MCKB 1MFAL 4HWBH 4JAMB 4CN6A 4Y5VA 2EDLA 1EJOL 1QRNA 1MRDH 5CIPH 3MX0A 4WUUE 4NN7C 5JHDA 1AH1A 5LAXA 4HPYL 1DL7L 1BAFH 3GIVB 4WFED 2HT4D 1CGXA 3SE8L 1MY5A 1Q9OB 2EDYA 4LP4A 1NGYA 4E41E 5JLZB 4MCYB 3GI8H 5GISL 3BX7C 1RZJL 2J8UF 3FRUA 4KI1A 5GXBB 3CMOL 3VD5A 1YMMD 3HRZA 4UUJB 3JSSA 4Z8FL 4HD9A 1I7ZA 1IEHA 2QSVA 1JN6B 4JDVB 3B9VA 5JHLL 3MREB 3TN0D 1TTGA 2V2XA 3RVUC 1XEDA 1KG0A 2QQLH 3NCJL 2MWCA 5EU4B 3CZFB 1M7DB 3X14B 5DD1H 4WGWB 4JPIB 5D7JD 4QGYA 2D7MA 1CXLA 3RWCB 2DMCA 2G2RA 1NMBL 3PWUB 1DLFH 3QO1B 3FO9A 1CDBA 1P2CB 5E56A 4NJAL 1P6FA 4WO4C 5E70A 4OB5H 3DMMD 4YUEL 1TJHH 3BPNB 1Y18A 3SJVE 3TFKC 3BDYH 1OTTD 2RIKA 1FO0H 5FV2A 1YEIH 1GIGH 2A2QT 2APTA 1RJLA 3ILQD 3M1BB 3EOYG 5DRNA 1NC4B 3ETBF 1QFWH 1KPRA 1RZ8B 1U2CA 3LKNB 2FX9H 3HZMA 3QAZB 4PR5B 1JYVA 5ELIA 5IESL 5EA0L 1F02I 3WSQL 3R0MA 2OTUA 1UM6L 3DHMA 3RHWK 5D93B 4RAUB 4X6DE 4L3CB 3STZA 3DOSA 1S8DA 3EJYC 3BKMH 1I9IH 2XN9B 5DDHA 5GS0H 1KPUA 2Q7YA 2XIDA 1F3DJ 3OKKA 3QIWB 1L9MA 1U3HD 4G8GA 5JZ7C 4Z5RA 2WK2A 3MRBB 5B39A 3AS2A 5F1IA 1HXYA 1DUYA 3IGAB 4FQIL 2B8OT 4FFVC 4IRJB 1EUTA 3VI3E 3NFNB 1MJUH 1FDLH 2OL3A 3TBYA 3MRNA 2V17H 5HGBB 3KPSA 1I3GL 4P4KB 4R90H 2EH8L 3O6FA 1EO8L 2EE3A 5ESQA 3MGTA 1I1AA 4UIMB 2ITCB 5BJTB 1JYWA 3QPQC 4XP1H 3H9SE 5DZNA 1MH5A 4JO2H 4Z7VE 5HHVL 1IEBB 5CP3H 3L3OB 4U1GB 3OAYK 4KTDH 3T3PE 4JCLA 2GAZB 2P47B 4JHZA 3VXSE 2UYLA 3P4LA 4ZPTB 3VH8G 3WO4C 1MHEA 1KOAA 3BQUC 3MXVL 1NUNB 3DBXB 3NCYP 4OCRL 3RI5F 1KCRH 3FT4A 1A0QH 1KJ2A 3PDDA 2DL2A 4KFZC 4YIQB 1UB6A 2BNQE 5GRJH 3HE7D 4GAGH 1NC2B 1ULVA 3BD3A 4HXAH 4ONGH 1A6PA 2X40A 5KAQG 3K74B 4KUCD 4L3ED 4YHNA 4FTVE 4K3DH 5C07A 3UTTE 4UINL 4RWYL 4HEPG 4X5XA 2A74A 4F8QA 5IVNA 2NMSA 2YC1A 1A6VL 1WTLA 1CE1L 2DQCL 1A7BA 4OZHF 2NY2D 1T1XA 3VFGL 4LL9A 4LOUD 3N1MC 5D2NE 4HDIA 5KG9A 4NO5B 2X09A 2IG2L 3MRKB 3TO2A 1DBMH 3A6CL 4X7CC 3CFKB 2VL5B 1UB5B 4L4VB 3QDGA 2DM3A 2VLLA 4PJAF 1NDMB 2YPVL 5EOCJ 1FG9C 2DRUA 2VN4A 3GMNA 4HUWA 4K7FA 5D5MF 2W92A 4MB4A 5A16A 2NY5H 1AGDB 4QRRB 3W39B 3MV9D 3OKDA 4DZ8B 5DJ6A 1DUZA 1UH2A 3NIDF 5F1SA 2VDNL 2VMFA 3NIFF 3X12B 2BZDA 4C56A 2DBLL 1N0XH 1RK0B 2VLJB 2ADFL 5C09E 4O51B 1NCWL 3T0AA 4YGVB 3VXOB 3U0WL 1B0RB 1XGUA 2R0LL 3GK8L 2VABB 1J1PH 1N8ZB 1UJ3A 4AG4L 1A6TB 5TQ2H 2NY1D 4MD5A 1CFTA 2XQYG 1MAML 4RAVA 1YC8A 3OL2A 1S7SA 3B2UC 2X42A 3OKMB 4MD0A 5C6TL 1SBSL 4G9FB 1I9JH 1DQML 3SPVB 4JLRB 2VLRB 3QUZD 2R69L 4U0QB 5CEZE 2FZ3B 3EYSL 4BQ6A 1H3PL 5JNYA 3AS3A 5J89A 1EHNA 3QIUD 3NA4A 4PS4H 1M7IA 4JFQA 5FGRA 2GTZA 3WKNA 2VE6B 4JFHE 4PRHE 3ZZ1A 1ZT1A 4AH2A 1ACYH 5INDB 4U7SA 1WIOA 1NFKA 4QRSA 3UO1H 3ZLQC 5EOTA 5HJ3B 3CU7A 3DV6B 4ZTOH 3P2TA 4KJQD 1JZ3A 2NY0D 2QADD 3BP5B 3UMTA 4WFHD 2YHGA 3QDJD 4M43H 2L7JA 4GQPH 1RV6X 1PY4A 4C4KO 4I3SH 3V6BR 1BM3L 3RQ3A 3N9GL 2WANA 3MBXL 4XP6L 2A73B 4MNHB 4WTWA 3SE9L 4MJ2A 4KROC 3LVEA 3SOBH 4PJBE 3MROB 3SDAC 2XPGA 3KHOA 3WUWA 5C0FA 4UQ3A 2X4PB 5CUSH 1J88A 2HRPH 1GZPA 4YFLF 5DK3A 4J3OC 4PJGF 2IJ0C 3HR5B 3K0WA 3CDGB 3CSBA 3IXAA 5JXED 3PV6B 1T1YB 2OS7A 5GQBA 3JTSA 2ESVA 2JJSC 5GSVA 1KBGL 3HLAA 4R4BA 2GK0B 4WV1B 3K2UL 4XMPH 3IXTA 4GQ9L 4BSVA 1Q1JH 1X7QB 4P5TD 2X4QA 1G9NH 2ZCLL 1AGFB 3MA7B 3CFJA 4M6AA 1N5YH 2FO1A 4XWOC 2A38A 2J8HA 2E9JA 1CI5A 1S9VB 3EYUH 4JVUA 2OQJA 3MBED 4P0DA 1TIUA 5ACLA 4PJCA 1OAUL 3SDYL 3U4BH 3ZKSD 5L88L 4U1HB 5E6IC 1X9QA 4WHTA 4EQ2A 4JCMA 4P2OD 3ECBA 4E42B 1KB9J 4LP5A 4AEEA 3R8QA 4L3EA 1HQRB 5D7JC 1RSFA 1G7MA 4G6KH 4MA3A 2DQEL 2VLKE 4UIKH 5IEHA 2OL3L 4K3EH 4NN7B 3E8UH 1UACH 3HA0A 4N0CC 5FO7A 3DMMC 1JCKA 1MEXH 4XBEL 43C9B 4NHCL 3FB7B 1FZKA 4OKVA 1VKXA 4QXUH 4U1KA 1UH4A 4CW1A 3PJSB 3GKZA 4DKFL 5F9JA 1L4IA 3C8KB 1OAYL 4OBSA 4LSPL 1WAAA 4X7DC 5CJXC 5E2VH 4LSVH 1UWGL 4N1CA 4IEFB 4NQSA 3THML 2EEAA 3VFTB 4OV6F 1IC5H 4G6JL 3A67H 3IFOB 4GRWE 1LE9B 3ZKMD 3L3KA 1KJ2L 4YHKH 5C0DB 2ZJSL 1M7XA 5F21B 5LQBL 4PJHA 4GG8B 4K3JH 4EQ3A 3WJJA 1N5AB 4OCYL 3QFJA 2DQJL 3D39D 1ZXQA 2O26U 3V79C 1YUHA 4NQCE 1I8MA 3LS4L 2BHYA 4WO4B 3VDCA 5IJKA 4NO0B 1OW0C 2ZNWA 4LSSH 3QFDB 4WHCA 3PXHA 4K94L 5J9PA 3QXDB 4R26L 4P9HL 3QUKB 4RMWA 2Z0BA 2VDPH 5F7DB 1ZEAH 2MFNA 5E08L 4XVJL 1JWSA 4ZFGL 5FM5O 3VFUA 5I1GH 3QIUA 5KVMC 1Y6MR 1S3KH 4LLVA 1GGIH 3MRPB 2GT9A 3KPOA 4U6XB 1SVCP 3LV3B 4R0LA 3H3KA 3NN8A 1Q9WA 2W9EH 5IMMA 4YHOL 2F54E 4JM2D 4PRPE 1FYHB 2VAAA 3CH1A 5GS0C 4KMTH 3BWUC 4JFXA 2MHAA 5DD6B 2E8ZA 2R56L 2RCSL 1FIGL 5CILH 5GRUH 4KWUA 2JIXD 1S7WB 2H6PA 3TCLA 5I76B 4WWID 3GSOB 2ICES 3S37H 1WZKA 5DK2B 3T0BA 3QEGH 1YDPA 2AJVL 1NCTA 3MLXL 1I3RB 3DX8A 4CU8A 4ZDHB 5HYSB 43CAA 4K07A 2GJ6A 3IAQA 2EYSB 2QQNL 3F5WB 4JM4H 5CEYA 2BOBA 3O81A 4QRTB 4R3SB 5I1IH 1I1YA 2YUVA 2YKLH 3N06B 2IFGA 1FPTH 1T2XA 3BPOC 1CU4L 4BQCA 3MLVH 3F12B 2CIIA 2NY2C 2X89A 4RMQA 4LOUC 3V5DA 4DGIH 2F74B 3DUSB 4EXPX 3BGFC 2BVPA 5DI8B 2Z8WC 3KJ6L 4UT9L 3CLFH 2D0GA 3QHZL 4O2EB 1LP9B 4Z7UE 3WO4B 5E8PA 5JQ6H 1G1CA 1OGAB 3BQUB 4C55A 4Z7OF 5IVXB 2DIJA 5C0AE 4PYHA 1I7TB 4RQQA 3T4AA 3BPCA 4TVPL 4DVRL 1KENL 2I07A 3MNZA 2X5PA 5D7SL 3MV7D 1JPTH 1RFDH 2HWZH 4KVNH 1VEOA 2EDEA 3MV8D 1IGIH 3ZYOA 2GJJA 1CD8A 1FFPA 4I3GA 5GZNC 3EFDH 3BVNA 1LO2H 3CNKA 1MIEL 1S7XB 12E8L 3ARVA 2BVYA 4H8WL 4U0RC 5E5UB 3CUPA 3WEXA 4G7VH 4EDWL 1IGYB 3D85A 3QWOA 5FYJU 4FABL 4G80A 5CJQL 3QXAB 4HH8A 4JO1H 4EN3D 4YHPB 4XPFH 3W0WB 1I8IB 3HUJE 4HWZB 1UG9A 5EUKA 3SE4A 1JZ4A 1W72B 4QTIL 5E5RB 5F3HB 4RX4D 4NJ9H 5FM8A 2FD6L 1NDGB 4Y5YB 1IKNA 3QUZC 3QCUL 3VFNB 1A4JB 4PJXF 1JZ7A 3G5VB 4H88H 3GIVA 2AJXL 3L5IA 1S5IL 4DUWA 1Q9OA 4JHWL 5JLZA 5FGBC 4MCYA 2DM7A 4N9OB 4JGUA 5C7XL 1RJYB 1T3FB 4F8TA 3C60C 4G6AD 5IHUH 3ET9F 4UUJA 5CCKH 1QSVA 3LPFA 5JIPA 4N5EC 1ERNA 4H20H 1JN6A 4JDVA 3V4VH 1DSFH 3MREA 4Y8AA 2WBJD 4CU7A 4PGJA 1J1XH 1HNFA 5EU4A 4EKXA 4C59B 3CZFA 1M7DA 5MEPB 3X14A 4KJPD 1CD1B 1D9KD 4JPIA 1A6WL 1P53A 1UM5H 3RWCA 1I1FB 3PWUA 4NO3B 3VWKD 3QO1A 3UBXI 4BZYA 3V0WL 1P2CA 1TQBC 5EORL 5DUPH 1H9VA 4MWFB 5BVPH 15C8L 5TPWL 4MNQD 3MRJB 4FQLL 2ZCHL 3VW3H 4JZJC 4PBWD 4XTRD 1I85C 5JXEC 2IH1B 1JWUB 1MREL 5HI4D 4MB3A 4M6MH 5I19L 1QRNE 4X7SL 4POUB 1LWRA 2YD4A 3M1BA 5JHDE 3EO0B 3R0NA 4NP4H 1NC4A 1EHAA 4KTYA 1RZ8A 1DTUA 3L3JB 2RR3A 5E8DH 5EUOB 3LKNA 4GXVL 5DR5L 2D4DA 1ZVYA 1IKFL 5A2KH 1MVFA 4PR5A 1ZT4B 3G04B 3WDIA 5I1EH 1JZ8A 4NIKB 4YHIB 4RAUA 4L3CA 2XN9A 5BV7L 5I16B 1IAIM 1MPAH 1TPXC 2JJTC 2XKNB 3SDAB 3W82A 1EEQA 3FRPG 4MLIA 4P2OC 3QIWA 3MOBH 4OLZH 3STBA 2IPKB 1WCQA 3MRBA 5CSBA 5MP6L 5IQ7H 1NQBA 3PE9A 4YHZH 2VLMD 3K4ZA 3IGAA 4UTBH 2VXTL 4IRJA 5KVEH 5T3ZL 1KB9K 4F58H 1BQHG 4WY7L 3MRHA 3GMLB 5HGBA 1DQQB 4P4KA 5T1LD 3FAWA 3I9GL 1OHQA 4I3RL 4L29B 4UIMA 3LS5H 5BJTA 1ZGLP 4Y2DD 2Z9TA 3U4EA 4D3CL 4WEMB 1IEBA 1IGJB 4FXKA 3L3OA 4RGOL 1SJEB 2R0WH 4OF8A 5LGJB 4RBPK 3MLUH 2GAZA 5EO0B 4LSRH 5E6IB 1JMXA 1G7IB 4ZPTA 5DA4A 2ZUQB 4PJFE 5DF0A 5CIPB 1KC5L 3TZVC 4Z77A 4IOSD 1NEUA 5KJRL 3DBXA 3LN9A 2BMKB 5IBLD 1S7QB 4OFKA 4YIQA 4GW4A 1RZ7L 1NC2A 4NZJA 2JLLA 3GB7B 4JFDB 4P46D 5C1MB 4UDUB 5DMKB 3X3FL 6FABL 3BESR 4G8GE 2YPKB 2EXYC 3FN0H 5HVHC 5ADOL 5C0BB 2Q3AA 1MFDL 4R8WL 4X8JB 4RGNB 4K7PX 1WEJL 4Q9CA 2M1KA 2EIZB 1FH5H 1A1NB 3I50L 4RFEB 3KPSE 4NO5A 4Z0BH 5E8EB 3MRKA 4OKDA 4KKAD 3RFZC 1ZSDB 4K8RH 3CFKA 3LIZL 4ZS7H 2VL5A 3LB6C 1UB5A 1AKJB 4L4VA 5CJOH 1F4HA 4U3CA 2R29H 3P30L 4YO0B 3DXAB 1NDMA 5K93A 5J1TC 1OSPH 4G6FD 3K1DA 2PYFB 3DV4B 1AGDA 3W39A 4QRRA 3QWQB 2XTJD 1FO0B 4F7PB 3IVKB 3AREB 4MXQC 2FYYB 1JNLH 1T4KB 4ZTPH 3MODL 1MCWW 1PX3A 5C9JB 3AGVA 3X12A 3QUYB 5JIIA 3FQNB 1RK0A 3SKOB 5TE7L 3MLWL 2E6QA 4YGVA 1U8HB 3VXOA 2Y5TB 3SO3B 5HVFB 2P5EB 1B0RA 3ULUH 4KMQA 2VABA 1N8ZA 1TZGH 1DFBH 1A6TA 4B53A 2UZYB 1RZFH 3UJJH 4FMKA 3WFHB 2Q8AH 3VXUD 1P84J 4AMKH 3OKMA 5C07E 4G9FA 1NCCH 3SPVA 4JLRA 1C5BH 4RFOH 2VLRA 4PJ8D 2FZ3A 5FYJL 1NGPL 2CRYA 2BCKB 1GGBH 3MOQA 5K9JL 2NY4B 3NABL 2VE6A 4PJBF 1F8TL 3UPRB 4UV7H 3CXDH 3CDCA 2GITB 5F1NB 3V6OA 4GAJH 3TBTB 2PW1B 4CNIB 4XH2B 3DSNA 1YMME 4K23L 1UZ8B 5HJ3A 3DV6A 5ACMA 4XP4H 1B0GB 1NEZB 1Q0YL 3BGAA 2MQ0A 3S4SG 2Y7QB 3BP5A 1VGEL 1VHPA 2ZWLT 5H35B 3IFPA 1ADQH 1K4CB 4WFFD 1Z9MA 3FT3B 4JFZL 1RI8A 2D7TL 4KKCC 4OFDA 3BPOB 4C56E 1IBGH 2A73A 4MNHA 3G6JA 3HC3H 2D3VA 1KLUA 3N1PC 3IFNH 3QG7H 3MROA 3EDKA 1LQSR 3V52H 5T1DL 2X05A 2HTLD 2X4PA 3NACL 3D1MC 5I8KH 3HR5A 3IDIB 4U1LB 3CDGA 5GGTH 2B2XH 3W2DH 3I2CL 2B1AL 7CGTA 3MLSL 4PIRF 5GGQH 1J8HB 1RUKH 1VFUA 1IM9B 2GK0A 5IB2B 3BUTA 4WV1A 1WJ3A 3TM6A 3DX6B 5KSBB 1O0VA 1WITA 3QXTA 5GHWH 3RWFB 2E7LA 1X7QA 1GAFH 2E27H 1R24B 4LDOB 3G6DH 1JZ6A 1AGFA 3MA7A 3RWHA 5E4IA 1D6EB 5DLML 1GPOL 4NKIL 2BVUA 1QSFB 3C6SB 4G6AC 2X4TB 4FZ8H 5I74C 1S9VA 4QHUA 4ETYA 4TVPE 5A2JH 1JPFB 1TMCB 1TJGL 3ILPB 5F9OH 5D7LD 5I71B 1WT5C 2WBJC 4U1HA 1MFCL 5JOPE 2FO4B 3CK0L 1AQKH 4E42A 4XAWH 3S35H 3PWPB 3BP6B 3SDCD 4NQXB 1DBBH 4KJPC 4I13B 5FEBA 3D0LB 3QIBB 1JGLL 4GRWF 4LSTH 1E28B 3VA2C 4MCZA 4F7EB 5JW4M 3VWKC 4KHTH 1F11B 5GS1C 1YYMH 3HTLX 3O3EB 4XTRC 3FB7A 4ZUSB 1CDYA 4Y5XB 2FSEB 5HI4C 3ZDYE 3C60B 2ESVE 1CG9B 3PJSA 4OIIL 1DCLA 3DLQR 2B4CH 3C8KA 1AI1L 4FFZL 4BZ2H 4OUUB 1CLOL 4XPBL 1E0OB 3LD8C 3VFTA 1U95B 5JO5B 4W4OA 1W8NA 2WMPA 3IAGC 4XRCB 3IFOA 1LE9A 4JPKH 4DKDC 2X7LB 5C0DA 4HKXB 4MLSA 4GG8A 1ZV5A 5JPNB 1N5AA 4QNPE 2R39A 4PJCE 1MHPH 2F53D 4WENB 3GNML 1TQBB 5D96C 4OTXL 3VU2A 4L1DA 4UILL 4Z7NE 4NO0A 4JZJB 3KYNA 3QFDA 3ZDZF 3X3GH 3VXMB 1V3MA 4NYLB 3QXDA 4ODTL 4L3EE 3QUKA 5F7DA 1NGQH 5D1ZD 4E5XB 5GRXG 3TH4T 3N1FC 4J4PD 3HNTL 3FONB 1QNZH 2BNRB 2XOTA 3GJFH 3S88H 1JYNA 4WW1B 2IGFL 3MRPA 3PP4H 1XZ0B 4TRPH 3ULSA 3DI3B 3NA9H 3TESA 3LV3A 5KVDH 1LO4H 4LASL 2BHUA 4KPHH 4ELKB 5JXAL 4Y2DC 1IILE 1O7VA 3T77B 4OT1H 4XMKH 5DD6A 4CVZB 1BZ7B 3BIBX 5JR1L 2OR9H 2EH7H 3NVQA 4LHUG 5FDWB 4AY0A 4RGMC 2P44B 3TJEL 2F5AH 3C6LC 1WAAE 1BD2B 2R2HB 2I24N 4GG6F 3WKML 1TPXB 2FX7H 3OX8B 4TN9A 1S7WA 4WRLA 4HJJL 2NLJB 3SDDD 1FC2D 1A9EB 3GSOA 5K59E 4XX1E 3U1SL 3TV3H 3CCHB 5HYJB 2NY6C 1JNJA 5DK2A 1JGDA 1LK3L 4M7LH 1CTNA 3S96B 1I3RA 2B5IC 2ZZUT 2DQTH 3PP3H 2R1WA 5FDYA 1A7PH 4ZDHA 5HYSA 3O6LL 2A1WH 3QFJE 1X5AA 3ARFD 2W0FB 4HQQL 4P46C 2GQHA 3HFML 1UYWH 2DYPB 2EYSA 3F5WA 2HMID 3RTQD 3M8OH 4QRTA 4R3SA 4XCNB 1JGVH 3KPRD 2G60H 5D70H 4NM8L 3QRGL 5DMJB 3BMWA 1PG7W 3B5TA 1NCDL 1G6RB 3F12A 1FBIL 4HSQA 4LKXB 5T3ZE 1L0QA 1MQ8A 3C8DA 1AFVL 2F74A 4FXLA 3KJ4C 5I1KL 3DUSA 5FA3B 3RVTC 3WXVL 1I9RL 5DI8A 1BQLL 1SY6H 3OKNB 3K81A 2DIBA 3UZQA 3OZ9H 4O2EA 1LP9A 5D7IF 1OGAA 3ZDXE 1GRWA 3BQUA 3TZVB 3TA3B 3PHQB 5IVXA 1I7TA 1JHKL 4YFLI 5LKNA 1R0AH 1CXHA 2MMXA 4B0MM 1JTTA 3QEQD 5DQJB 1QFUL 2W9DL 2VDOL 4OZIF 3ARBD 3PIQB 1GXEA 2AV1A 2VUOA 3QDJE 4XPHH 2CO7B 4QHKJ 4GJTB 2WWKT 1CLYH 4KZEH 1S7XA 4F15C 5HVHB 4NBYB 3QPXL 1IGYA 3BFOA 3VXRB 4X6CF 3O2DA 3CFDB 4K8RC 3VH8B 2GJ6E 1FJ1B 1AGCB 3QXAA 2NY7L 4YHPA 3KYKH 3UC0L 3W0WA 1I8IA 4HWZA 4UNVA 2XA8L 1Z0MA 1MCWM 1W72A 1ZAGA 5F3HA 3LPWA 4RRPA 1NDGA 4Y5YA 2YD7A 1RZKH 1FZJB 3VFNA 4PJ8C 1A4JA 5IW6B 3FO2B 1MCOL 4MJ4A 5JPMB 3G5VA 2AEQH 2FLBT 2VOTA 4LCUB 5I30H 2V9TA 4GO6B 4OZGA 3JZ7A 1I8KB 4TSAL 5LCVH 1JBJA 3VG9B 1RJYA 1T3FA 1MFBH 3GBML 3KAAA 3HHRB 5TFSL 4H0HB 5LVEA 4FXGB 2NCMA 3F65A 5TDNB 3S36L 4DCQB 2I60L 1GGCL 1MFAH 2AKRB 2CD0A 1INDH 1HQ4B 1XGYL 4C54A 1RHHB 5IBUG 5MEPA 1WV7T 1EJOH 1CD1A 1G7JB 3CMGA 1B6DA 5D1ZA 5D8JL 4DEPC 1I1FA 2C5DC 1NCAL 5CD3B 4LVNC 4LRIC 4NO3A 3SGKA 4MJIB 3SE8H 2P49B 4MWFA 2HTLC 3MRJA 5J0BA 5D4QA 5GISH 3BAEL 3KPNB 4KH2A 4QXTB 2IH1A 1JWUA 1HYSD 3CMOH 4F9PA 3P0YL 1CICC 3DETD 1E4XI 4NKOB 2ZKHL 3EDDA 1RIUL 1INQB 2N56A 4EUPH 5JHLH 5KZCD 1LHZA 1Q0XL 1CGSL 3EO0A 3ZHDA 1X5HA 4HKZB 4P2YA 3L3JA 5EUOA 4PB9L 1EZVY 3D9AL 1HK6A 2UWEB 1ZT4A 3G04A 4WEBL 4LGSB 4BKLB 2XWJB 3OAZH 4YHIA 1OLLA 1B2WL 5I16A 1BBDH 1BFOB 2IADB 2HJKA 2XKNA 4EIZC 3Q6GL 3WDHA 1CL7L 4EVNB 4M62L 5CZVL 2IPKA 1PAMA 1FG2B 4LQFL 4S1SH 5IHBA 4PJFF 1EMTL 2EDNA 5DRXB 1X6NA 5EIQA 3GMLA 1DQQA 1U0QA 2IFFL 1J0YA 5SX5H 2QQQA 4L29A 5GJSH 2XICA 5IFHL 5HXMA 3LPGA 1UM6H 3VFVB 2VXVH 1DDHB 1CDIA 5CP7B 1IGJA 1KTRL 5IWLC 4XWGL 3O9WD 3WS3B 2VDQH 1SJEA 2GKIA 5LGJA 1RU9H 3PQYB 4HWBA 1XCTB 4Y4KB 5EO0A 4OLUL 2WW8A 1DVFB 3UDWC 3R1GL 1G7IA 5DD3H 2D7OA 1WIUA 5CIPA 2AK1L 3H3BC 2FECL 1MY7A 1FNFA 2VH5L 2BMKA 1S7QA 3DNKA 5ALCH 5ADPH 3UJTH 1UVQB 2XN9E 3UTQA 5J11C 4F80A 4YHYC 3GB7A 4JFDA 5DMKA 1OP5H 1FVDB 1MAKA 2WP3O 4I77H 2F8OA 2NY3D 2YPKA 3QXUA 4LHUD 3IYLW 5HHVH 3VWJC 4CVXB 4QXGH 4X8JA 5C2BL 2EIZA 1ONQB 1N4XL 1P6AB 2XZAL 4RFEA 1YEJH 2PR4L 1RUAL 5E8EA 3C2SA 3TVMD 1RURL 1GGUA 1ZSDA 3GSNB 3MXVH 4OCRH 4Q7DA 1O5DT 1PLGL 3MJ7B 1AKJA 4EOWH 4YO0A 3DXAA 1UJTA 5FUCE 4HMCA 3MV7E 1IQWH 3PDOB 4ETQB 2PYFA 5HHXH 3DV4A 4TUJA 2I27N 2ZUYA 3SDDC 2A6IB 2Y72A 1FO0A 4F7PA 1U8KA 3AREA 3IVKA 4FMFA 1MLCB 2FYYA 4UINH 3MRQB 5E7FA 4NQEB 4D9LL 3ARGD 4ZODA 2NXYB 2Y36L 5C9JA 3QUYA 3FQNA 1VADB 1KXTB 3VFGH 2GHWB 3SKOA 5DHYB 2KH2B 1F6FB 3O2DL 1U8HA 2P8LB 3RIFK 5L8KB 1YNLL 2Y5TA 2IG2H 2P5EA 3ARFC 5DK0B 4X4YB 3IRPX 3RTQC 5E94B 5CMAB 1YJDH 5E6ZA 5HDQL 5EO1A 2Z31D 4M7KL 3WFHA 1W72L 1GCFA 4U6TA 3VXMD 4JHAH 4ZO9A 3HMWL 1OP9A 1QHPA 2CPCA 1YEKL 3MCG1 2AXJA 5FHBL 4KKBD 4GKZB 3DECA 5DQDL 5A2LH 1BGXH 3TT3L 2B20A 3QHTC 2BCKA 4RGMB 3C6LB 4AJ0A 2Y9RT 2VDNH 5CS7A 1P9MA 4MD4B 3UPRA 4WU7B 2NZ9D 2GITA 5F1NA 5DEFB 2D03H 3TBTA 2PW1A 3MXWL 4CNIA 2DIAA 4XH2A 3GBLA 2ADFH 1FVCB 2NY6B 4KAQL 1VPOL 1UZ8A 2LU4A 2P46B 1B0GA 1NEZA 4HXBH 4UBDD 1MCPL 3BWAB 2Y7QA 3VXTB 3C5ZD 3ARBC 5H35A 1MAMH 2O61B 1EFXD 4UQ2B 5CP3A 5HHOB 3MLTB 5C6TH 4M5YH 5ICXB 3UPCA 1K4CA 4ODHL 1KCUL 3FT3A 5FYKH 5EC1B 4ZOEA 1CF8L 1MCIA 3W81A 2OXHA 1IVLA 2VDML 2Z91B 4WI8A 3MJ8B 1H8SA 2QV2A 2OK0H 3B9EA 2ERJC 4JG0L 2FNBA 4KK9D 2AXFB 5EU6D 4TOYL 3IDIA 4U1LA 4OD1L 3MYZA 4LPXA 4XVUD 5EU5B 1KIRB 1BEYH 2VQ1B 2AK4B 2VLRE 1J8HA 1TJIH 5EZIL 5DUML 1IM9A 5IB2A 4FQ1L 4XHJD 1U6AH 3DX6A 5KSBA 3RWFA 3VD9A 2LFGA 1BREA 1R24A 4HT1H 5ANMB 4IS6B 3GGWB 1BM3H 1VENA 1U93A 4M7LT 4J2XA 3C6SA 1QSFA 4NOBA 2X4TA 1T1ZB 4XP6H 3GBNL 2XYCA 4P2RD 3SE9H 4QHNB 5DEZA 3DVIA 5JOFB 3NH7H 5FO9B 1JPFA 3LRGA 3ZDYF 1WFTA 3ILPA 1T03H 7FABL 4JRYD 2JCCB 1EK3A 2FO4A 4WI9A 2C3XA 5EH1A 3MMEB 3PWPA 1A7QL 3BP6A 4NQXA 2CRMA 4PJDA 3RGVD 3D0LA 4Z7WB 1VSCA 5L0QC 3QIBA 2CUIA 3FL7A 4GQ9H 1NMAL 1E28A 4F7EA 4NGHL 3G6JE 2MKLC 4LMQI 1UKQA 1F11A 1IC7H 2ZCLH 4DVBB 1CN4A 5LBSL 1G9MC 3O3EA 2NX5D 4QRPD 4ZUSA 1HYSC 4Y5XA 2FSEA 1WIPA 4LLQB 4EZMA 3LQAC 4KUCF 4Z7NF 3C60A 3JUZA 2N7BA 2H41A 4PTUB 3MOAL 4G43B 4L8BB 4OUUA 4P5KB 3BZDA 3J7HA 3KR3H 1BFSA 5JO5A 4PJIB 1LO0H 4XRCA 3L3DB 5EU3B 3BJ91 2F19H 1FL6B 1J05B 2X7LA 4HKXA 5BRZB 1H8OA 5DJZB 2OL3H 2LVEA 1VCAA 5JPNA 4LVNB 4DUVA 2YUZA 1JZ5A 3GI8L 4CN4A 5HD8D 2WWKO 4JR9L 4I0KA 3IU4L 4JZJA 1YQ2A 3W5NA 2AV7B 3VXMA 1KSRA 4NYLA 4OI9A 4LCWD 2A9NH 4BFEA 4E5XA 1VACB 1CICB 4WTZA 3OKOB 4Y4FB 5IGXH 2QQLL 4P2QB 3FONA 4AQ1B 2BNRA 1UWGH 3VGHA 3T4YB 1AXSB 4WW1A 3OV6A 4UNTA 1IE5A 5DD1L 1XZ0A 4G6JH 3O41B 5E2UL 4BA8A 3IDXH 4J7RA 5IQ9B 2BY1A 4L8SC 3ZMRA 3QA3B 5LQBH 3CAFA 5KSVB 2OJEB 4I18C 3T77A 3K8MA 4OCYH 4CVZA 1BZ7A 2DQJH 5FDWA 3HB3D 1FQ9C 3KGRA 1D5BB 2GTWB 1T5XB 1BD2A 2R2HA 3OX8A 4MS8D 3C5ZA 2NLJA 5F72S 4TNWK 1GC1C 1FO0L 1A9EA 2XTJE 4XCYB 1YEIL 1GIGL 3BD5A 4K94H 3MLPA 4P9HH 4GOSA 3AM8C 3CCHA 4JQXC 4XNQB 5E08H 1V8HA 4FQHB 1UGNA 3SY0B 3L5XL 4QRQA 2VWEC 1C16B 3S96A 3MCLH 2FX9L 1ORSB 3VFPA 2W0FA 2DYPA 5IT2L 1NFDB 5J6HB 3IT8D 2NY3C 4Z7QE 4L3AA 1FC1A 4XCNA 4F7MB 3UTPE 3CZJA 4M03A 4JO3L 5GS0L 4ODWB 3H9YA 1G6RA 5L9DH 2R56H 2RCSH 1FIGH 4LKXA 3I6LE 4GRMB 2I5YL 3JTTA 5T1KB 5FA3A 4A6YH 1HSAB 3OKNA 5F1OB 4WIQA 2IMNA 1N7ML 3TZVA 1BQHB 4P57B 3ZHLA 2QKIB 2V17L 3TA3A 3PHQA 4R90L 2GY5A 3JWDH 5I1AB 4Y4HC 4X6EB 3RWEB 4DUXA 4XBPB 4AENA 4P23D 5DQJA 1S7RB 1KIQB 3MRMA 1A7OL 5HGAB 5J11B 4FRWA 4YHYB 3P9WB 4JO2L 2DLIA 3PIQA 4IMLB 3EOBB 2VJXA 3SBWC 1X5LA 5DC9B 2H32B 3ARGC 1CU4H 1BQSA 5HDBF 4KTDL 4WFFE 1IZKA 3VWJB 2QSTA 3FMGH 4HUUA 4GKSB 5F6IB 5BMFH 3OSKA 3V4UL 3VXRA 3CFDA 2J5LC 3VH8A 1F42A 3ULVE 1FJ1A 1AGCA 4OFYA 3KJ6H 1KCRL 3D18B 3QHZH 3QI9C 2C1PB 4R2GC 5GRJL 4GAGL 3HI1B 2Q8BL 1DBJH 1FZJA 5IW6A 3FO2A 1LMKA 1F5WA 5IROA 4MXVE 1T83C 2UY7A 5JPMA 4X6BB 4NQDB 4K3DL 4YDIL 4LCUA 4LRNH 2EDWA 2NZ9C 4OFPA 1I8KA 2ZUSA 1LP9E 4JFFD 5FAAA 3BJLA 1OGAE 4KU1A 4YZFE 4EDWH 1FNSL 4OD3H 5IVXE 4NPYB 4FXGA 4UBDC 5TDNA 1DBML 1F6AB 4K9EH 4DCQA 1X5YA 4IJ3C 4NKDB 4NWUH 2AKRA 1KLGB 4QTIH 4LFHG 1HQ4A 1JI2A 1MCSA 2FD6H 1OWWA 1I4FB 1RHHA 1CCZA 1G7JA 1E4XH 4NT6B 3QCUH 2ICWI 3D3VD 4UAOB 1U36A 3NMEA 3AFLA 4A2LA 5CD3A 3CVIL 4MJIA 1S5IH 3ZE0E 1E27B 3TF7C 1HHKB 3W0WE 5HBBA 4PY7B 4J23A 2DJUA 4ZQKA 3KPNA 4QXTA 4XVUC 1BFVH 1P7KB 4N0FB 4AIOA 4NKOA 4K3HA 1J1PL 3BKYH 4HLZH 1INQA 5TQ2L 4B50A 4XHJC 1UKSA 1HE7A 2J6EL 2BVTA 1QTYT 5ITFB 4AYFA 5DD0H 2HFGL 4HKZA 1XIWC 1I9JL 1JUFB 1UM4H 4OZGE 1QPPA 2Z8RA 1A6WH 5BXFA 2UWEA 4XXCA 3NCYS 4NNPH 1Z3GH 4TUOB 2XWJA 4BKLA 4PS4L 2X9YA 4MVBD 4FQXC 4PBVC 1BJMA 4IIQB 2OM5A 1OPGH 2H2PC 4JM2F 4JRXD 4BQBA 3E6FB 4W6XB 1BFOA 1DANU 2IADA 5KAQF 1ACYL 3QJFB 4FQLH 5MEQB 5IP4A 3UO1L 4EVNA 4BZ1H 1PBYA 1MREH 1JHLL 3C87A 3WFCH 1FG2A 5I19H 2EDQA 3AMLA 3RGVC 1AO7D 3D2UB 1FYTB 5KSAD 5L8LB 5FUOL 3SEPA 2FEEI 3PGFH 3HZKB 5DRXA 3PL6D 4M43L 4HULB 5E2JA 3ARYA 4GXVH 3D0VB 4KJWD 2CKBH 3ZE2E 1IKFH 2R23B 3P0GB 5FYLD 3LKPB 4ISVA 4LVEA 4FNLL 3VFVA 1P7QD 1KEMH 2BDNH 2OCFD 1DDHA 2EZ0D 5BV7H 4NKQB 5CUSL 2HRPL 3CIQA 1SYVB 3PQYA 1ZVHA 4Y4KA 3WFZA 4APQC 1WT5A 1DVFA 5EUOE 5KW9H 3E2HC 2AJZB 5TJWK 4XMPL 4MJ5B 5F44A 1UC6A 1EXUB 5L0QB 2HVJB 3QP3A 2HN7B 1UVQA 1FGNL 1PKQE 1QYGH 3FQWB 4Y16D 5HD8C 1N5YL 5AZ2H 4I3RH 1NL0H 2ADIA 2DB8A 4U1SB 1FVDA 3MRCB 2XY2A 3ABZA 2DKUA 4NZRH 3TNNB 3EYUL 1ROWA 4CVXA 4RGOH 3U4BL 1KF9B 1G6RL 4GUPB 1ONQA 4ZFOB 2DKSA 4RA0C 2JB5H 3RNKA 5B3JF 4HFWB 4FG6D 1JL8A 25C8L 4WUUD 3QQ3B 5SV3A 4L4JA 2V2WB 5KJRH 1WWBX 4X9FA 1CXFA 3ULUD 3MJ7A 4TNVF 4K3EL 4KY1L 2HRLA 1KULA 5BS0B 3E8UL 3BPLC 1UACL 1N6UA 5TDOB 5GS2H 4E41D 1RZ7H 2D9QB 1UH3A 3BZEB 4W6YB 1MEXL 4ELMF 4Q58C 3PDOA 4ETQA 5TH2B 3QEQE 6FABH 4QXUL 4MS8C 4OF6A 2A6IA 5KANI 1MLCA 4JB9H 3VI4E 2FECI 3MRQA 3NZ8B 1ZHNB 4NQEA 4EUPB 4IRSD 3GM0A 5BRZD 1VADA 1WEJH 4LLWB 3ZT5A 4OAWB 2EO9A 2OMBA 3I50H 5E2VL 2B7DT 5DHYA 3T2PA 2YD3A 1IC5L 2P8LA 3EGSB 1NPUA 1C08B 4WWKD 2NR6D 2HKFL 4X9GA 1CVSC 3BOVA 3A67L 3DGGB 5DK0A 4X4YA 4JFDE 5T33H 1LD9B 5E94A 4P9MH 5CMAA 4N8VG 3LIZH 1BP3B 4K3JL 1MVUB 4L8SB 1IEAB 3RL1B 3U36B 3FT2B 5DJAB 3GJFK 4LHQB 4RGNE 1LEKB 3OJ2C 4GKZA 3SJVD 1FZMB 3E1F1 1CZ8H 1T7WA 1QQDB 3EO1B 3C6LA 2QLVB 4JN1L 2VDPL 1ZEAL 1Z6JT 3MODH 4MD4A 4WU7A 3LDBC 4F37K 5DEFA 5I1GL 1FVCA 5GRVL 1S3KL 3MLWH 1GGIL 3DXAE 3O4OC 4P23C 1TNMA 3BWAA 3O6ML 3VXTA 1B6UA 2BSSB 3AAZB 5H94B 2O61A 1A14L 4KMTL 4UQ2A 4ONOA 5F71A 2WSKA 5F96H 3MLTA 1VDGA 5HHOA 4DGYL 5ICXA 3PP3K 5CILL 1LDPL 5GRUL 4HUMB 5EC1A 1KXVC 3U9PH 4JKMA 1KEGH 4URTB 5FYJH 2Y07H 3L7FB 3RY4A 1EHLH 1NGPH 3KLHD 2Z91A 3S37L 1E6JH 3MJ8A 3S7GA 3NABH 3TWCL 2X9XA 2BRRH 2XZCL 3NOIA 3QEGL 2AXFA 1GGTA 3RY6C 4HJ0D 2AABL 3UPAA 5EU5A 3E0GA 4AZ8A 4RIRB 1Y6KR 1KIRA 2K3TA 1Q0YH 2MJWA 2AK4A 2VQ1A 4V2BA 3V7AG 4LFHD 4JANB 3SQBA 4Y4HB 1Q72L 3H9SD 2YKLL 1FPTL 4M5ZL 1BVZA 4Y19D 5ANMA 3RBGA 4IS6A 3GGWA 2ED7A 5CBAA 1CFBA 4JFZH 1FFNB 3TYFB 3RKDC 4DGIL 2IBBA 1Y0LB 4ESKA 1T1ZA 1NCBL 2EIBA 1UEMA 3OXRB 4M7ZB 3VXSD 4QHNA 1JGUH 3C8HA 5JOFA 2HT3D 5FO9A 4XC1H 4XVSH 1GH7A 4LAJH 3CLFL 2J5LB 2PTVA 3NFPB 5K9QI 3NACH 1K8DB 1I7UB 1I3UA 3OPZH 1EEYB 3TH3T 3MMEA 3I2CH 2OI9C 3QI9B 1ZS8B 1JPTL 2HWZL 3AY4A 1EVUA 4R2GB 1Q38A 4KVNL 5B22A 5F7KC 4Z7WA 4HC1A 3P3YA 2WWMC 3HPLB 1IGIL 4QOKB 5CSGA 5E4EB 2J8UB 3T3ME 4FTVD 1LO2L 3UTTD 1YZZA 2RQ8A 4H1LH 3VMOA 4MQXD 5TF1H 1GVIA 2DDQH 4ZUVB 1HKFA 5DLMH 3QJHB 1GPOH 4G7VL 4QCIB 4HUVB 4NKIH 4J3UA 3DX7B 4K9EC 4LLQA 1HCFX 3H8NA 3KLDA 4JO1L 1TJGH 4AM0B 4PTUA 1S5HB 1BMGA 1MFCH 4G43A 4L8BA 3FO1B 5KSBE 3CK0H 4DFHA 4OGZA 4P5KA 4D0CB 4GKOA 4IJ3B 5E7BA 2CH8A 4EIGB 4GAFB 1XH3B 1KCLA 3L3DA 5EU3A 1UQSB 4RA3A 2VIRB 1QSFE 1M71B 1FL6A 1J05A 1U91B 4H88L 4WHYG 5BRZA 5DJZA 1QLRB 4ZD3H 1QFPA 2PXYD 4OSUH 1E4KA 3LEYL 4WWKA 4AIZB 4NN6C 4OLWL 2WINB 2AJSL 4NNXB 1MJ8H 5IHUL 1U8JB 3PWPE 5F7UA 2AV7A 3T2OA 2FCBA 4PJDE 4NHUB 5KSAC 4H20L 1VACA 1CICA 3V4VL 1AI1H 4WI3A 4FFZH 3OKOA 3PL6C 1QFWM 3EOAB 4Y4FA 3V5KB 2BHZA 4P2QA 1J1XL 1RAMA 4ZYKB 1E4WL 1EEUA 3T4YA 1AXSA 1UZ6F 3NZHL 1ADQA 2DLEA 3O41A 1XIWB 3PGDB 5IQ9A 5JA8B 3GSNL 6CGTA 5CZXD 4BFBD 2XTLA 2JCCF 3NPSB 4I2XB 3LRHA 1CFSB 5KSVA 2OJEA 1HXMB 4IDJH 4PRHD 5DUPL 5BVPL 2Y4SA 4FQXB 4LVHC 3VW3L 3GNMH 5DJ8B 1D5BA 4F33B 4OTXH 1J1OL 4BSWB 1T5XA 5GGTA 3O2VL 2NNAB 3WNKA 5CGMA 3SO5A 1BOGB 4M6ML 1MJ7H 3OAZK 4XCYA 1G0XA 2A6KA 4XNQA 3IDGB 4FQHA 3SY0A 5IVOA 5ALBL 1C16A 3T8XB 5HYQB 1QUNA 1NUFA 3MJ9H 4LPCA 2IGFH 4Y16C 3HAEG 1ORSA 4OJFH 3MGOB 3T08A 4DKEH 2YA0A 1NFDA 2H9GB 4DGVL 5I1EL 5J6HA 3I6KB 4JO4L 5HDOA 2HKHH 2J3SA 3OG4B 4F7MA 3VXME 4HJGB 1Y6NR 1MPAL 4PJIF 5JR1H 4R4NC 4X99B 4ODWA 3RRQA 3FRPA 3G08B 4NCC2 4OD2B 3TJEH 1G0DA 3MOBL 5SX5K 4D9RE 4K2UL 4GRMA 3WKMH 5T1KA 2GSGB 3BKJH 1HSAA 2YRLA 3Q3GB 4YHZL 5KANG 3U1SH 4FG6C 4APQB 2BK8A 4UTBL 2A6DA 3UDWA 1EAJA 4KRLB 3OKEB 3GIZL 3H0TB 2KUTA 3OJVC 1LK3H 1BQHA 4P57A 2QKIA 3WLWD 4GAYB 5I1AA 4X6EA 3RWEA 4HQQH 4XBPA 3LS5L 5T3XH 4OZHB 1S7RA 1KIQA 3EYQD 5HGAA 1BD2E 4MA1B 3UEZA 4PY8I 5AAWA 1N6QH 4MXVF 4I0PD 4IMLA 3EOBA 5ID0B 2XFXA 3CDFA 2A9MH 5GGVY 3CX5J 4IRSC 3MLUL 1LO5B 1FBIH 4GKSA 5LJYH 4IOFC 5GGSB 4LSRL 5A43C 5DURB 4N68A 5I1KH 3BSZH 2JK5A 3WXVH 5JQHC 3P4NB 1I9RH 4Y8DC 1BQLH 4X7FC 3TEUA 2VLKD 3JVGC 3D18A 5D5MB 3NGBB 4CAGA 2C1PA 2ED9A 3OWEA 4NRYB 2KPNA 4OLVL 1F58H 3HI1A 5CKAA 1ZK9A 5HI5D 1QFUH 1CDUA 3EYVB 1G7PB 3FN0L 3V8CA 4X6BA 4M1DH 4NQDA 4YBQD 1KELH 4LBEB 1OTSD 3KS0H 4O58L 4LLMB 1R5VB 4HHAB 3QPXH 4S1RL 5BZWB 3D6GA 2IMMA 1K5NB 3QXVA 4D8PB 3CPLB 4NPYA 3DO7B 3UTSD 2YD6A 3CGTA 1F6AA 2NY7H 5EWIH 4FN0A 4K8RL 1A3QA 4NKDA 4ZS7L 3LN4B 4HCRH 5C08B 5CJOL 3CFEB 1KLGA 2R29L 2XQBL 3RDTD 1I4FA 1OD9A 3O4LB 1MUJB 3OTTA 4NDMB 1OSPL 2R1XB 1W2KT 3CH8A 4NT6A 4YPJA 4HC1L 1JWMB 5INCB 1BJ8A 3VXRE 4WW2F 3KLHC 2CK0H 1JNLL 3RUGB 3T2QA 1NAKL 4M6OH 1E27A 1AGEB 1HHKA 1HOCB 3LRSB 1DP0A 1UXWB 1EZVX 4PY7A 4HJ0C 4TSAH 1CR9H 3GSQB 4QRPE 1QOKA 4GBXC 2M8XA 5IIEB 2FEDD 5TFSH 4U4BA 4YDLB 1P7KA 4N0FA 2MSPA 2VSDA 3S36H 2ORBH 1TZGL 1DFBL 3MLZH 3O4OB 3LMJL 1RZFL 1GGCH 1F2QA 1YPZF 3ARTA 3SKJH 5ITFA 2F54D 4KK8D 4PRPD 2Q8AL 1K6QL 1U8QB 2UZIH 4AMKL 1ZGLM 3HE6B 1XGYH 1HHIB 3DI2B 3WHXB 4HUNB 1JUFA 1C5BL 4RFOL 3OAUH 2V5SA 3EYOB 1BZQK 1YA5A 2FJHB 1IC4L 2KKQA 4S1DC 4TUOA 1S7TB 3REWB 3WJLA 4B7LA 4JGMA 2XRAH 4WHYH 3M45A 4A6YB 2HT3C 4IIQA 3OB0K 4PJ7F 4PRIB 2HH0L 1SY6A 4LCCC 2ZPKH 3E6FA 3BO8B 3OJMB 4UV7L 1F2XK 3CXDL 3MO1B 3QJFA 4GAJL 5I2IB 5MEQA 5TF0A 2ZOKB 2IAMD 2Q76B 3MRDB 1EUUA 4XP4L 4KRPC 1ITCA 1J0JA 1FSKB 2CLZB 3D2UA 4LCWE 4PJEF 1FYTA 4OV5B 4N0UE 5C0IB 4ERSH 3HZKA 1FVEB 4MJIE 5D6DA 4KTEH 4G8EB 3JV4B 4MQXC 3D0VA 4Q6IC 4WU5A 3VGGA 2R23A 4X5WB 4JE4B 1TVBB 3LKPA 1R3LB 5D2NC 1YEEH 3V52L 1B2WH 1CXEA 2CXGA 4L9DA 2APBA 1FRGH 5I8KL 1SYVA 3RY5A 3Q6GH 4NCC1 5GGTL 5C0AD 1ZVSB 2CDGB 4M62H 5CZVH 3PHOB 2W60B 3ZKQD 2I26N 1TZHB 2AJZA 1NMCC 4S0SD 5EZJB 5GGQL 4ODUB 2ZUWA 5DRWB 4YR6A 4LQFH 4EI5D 2UWEE 4MJ5A 4ZO7A 5GHWL 4MNGB 1AC6A 1EXUA 1AXTH 1GAFL 3RI5K 2PXYC 2HVJA 2HN7A 1H5BC 4NNYB 1X5GA 2IFFH 3FQWA 3HAEH 2EECA 4U1SA 3WDJA 5CJ5A 5IFHH 4NQVB 2OZ4H 4NUJB 4KI5E 3MRCA 5IR1B 5IUSA 4TULL 2DS4A 3TNNA 2VXSH 4LCIH 2YZ8A 4KV5F 3S5LG 2Z35B 4XWGH 5F9OL 3WIIH 3SCMC 2WUBL 1PG7X 5C0CB 3EJZD 4ZXBD 2KL6A 4GUPA 3MRLB 3SE3C 1AQKL 2SEBB 4ZFOA 4JGJA 3S35L 4PGBB 3QCVH 1DBBL 3R1GH 4TYUA 1OWRM 1H3GA 1WQVT 3OR6B 4HFWA 2AK1H 3QQ3A 4Q9QH 2V2WA 1EV2E 4LSTL 5F7EL 5SWSD 1ORQB 4JQIL 5BS0A 4M00A 1T89A 2GJZA 3P9LB 5TDOA 1H0DB 1YYML 3BZEA 2PW2B 1KN2H 2VR9A 5TH2A 2VSCA 1II4E 2FLRT 4PGZA 3MFGB 4LSUL 4X7TA 1RVFH 1I1CA 3NZ8A 1ZHNA 3T0ED 2B4CL 3D5OF 4EUPA 5D1XC 1BZ9B 4BZ2L 4KK5D 4OAWA 5HHPB 4HH9B 2CMRL 2F58L 5JOEA 3IJHB 3TO4D 1C7SA 3DGGA 3LSOB 2OXGA 3K2MC 3U48A 2HAZA 4JPKL 1LD9A 2DQDH 4ZAKD 4OLXL 1T2QL 1XMWA 4WI7A 4FFWD 3RIAF 1MVUA 3NAAH 3OF6D 1K2DB 5D2LA 3VGFA 4L8SA 1IEAA 1U3YA 5DEGB 3RL1A 3HG1B 3U36A 3FQRB 2VNCA 1MHPL 1MSPA 3FT2A 5DJAA 1AGBB 2E5EA 4PRNB 1LEKA 4GXUN 4YXLH 5ISZB 5CBEB 3GSXB 1FZMA 1EAPB 5LGHH 3X3GL 1QQDA 1QRND 2IQAB 3EO1A 2C1OB 3DRQB 2UV3A 2HLFC 4D9LH 4POZC 4LVOB 4JFFE 3SGDI 3WLWC 1CQYA 4OGAD 2DLTA 3S88L 5I73B 3RZCC 4HIXL 4LLUB 3PP4L 1YNLH 3NA9L 2CKBB 5DZLA 5BOPA 5KVDL 3EYQC 1MIMH 2OLDA 5M7QA 3P77B 2BSSA 5HDQH 5H94A 4I0PC 1W72H 3KVQA 1GYAA 5ESAB 5GGRY 2R8SH 5BV7B 2EH7L 3HMWH 4NQEE 4Y1AB 2PYEB 3O8XC 1YEKH 5SWZB 3L7FA 3I84A 3JBG7 2B39A 2AW2A 4P5MB 3TV3L 1KACB 4EBQH 3QNXB 4NZUH 4NN5B 1AD0B 3CX5K 1G9EA 3PGCB 4HGKC 4J12A 5DJXB 3MXWH 1YEFL 4KAQH 3AC0A 4RIRA 1U8PB 1VPOH 1TETL 4ORGB 1HZHH 2JELL 1UYWL 4YAQB 3SDXF 4JANA 3M8OL 4Y4HA 1JGVL 1H3VA 2G60L 5JW3H 5BW7A 4IDLA 1CFNB 1OTSC 5DGQA 3QQ9C 1FFNA 3GSUB 1CF8H 3TYFA 4EI5A 1UCBL 4PB0H 1Y0LA 3QSKB 1PYWB 1H15B 1MI5D 3OXRA 2VDMH 4JFEB 4D9QE 5H2BB 5T1MB 1SY6L 3WBDA 1L7IL 1RZJC 3NFPA 4PJXB 3OZ9L 5F9DC 4P99A 2PN5A 1K8DA 4K3GA 1I7UA 4OD1H 3SHSA 3BRDA 1EEYA 4PGDB 5HHOE 3RDTC 3QI9A 1ZS8A 2PO6C 1AO7E 2EO1A 2IANB 5DUMH 4F7TA 4G8GD 3QEUB 1JIBA 3HPLA 4QOKA 2G5RA 2J8UA 2YZ1A 1F4WL 2FIKB 3HC4L 2X4RB 4XPHL 1JNHB 1CLYL 1NAMH 4PJ5B 4ZUVA 4XX1G 1NGXB 4QKXB 3QJHA 4I48B 4QCIA 4HUVA 3KNBB 2E8YA 5KS9F 3B2VL 3KPSD 3WNOA 4OQTH 3W9EB 3GBNH 3DX7A 2FBJL 2FEDC 4JZOB 3O6FD 4PG9B 1OTUC 4F9LC 2NPLX 2AK4E 4P3CL 4AM0A 3S98A 1S5HA 3MV11 3FO1A 4XP9L 4N1EA 5MERB 1A7QH 4XP5H 2R2EB 3WL9B 1XH3A 1UQSA 2VIRA 5E9DB 2Q3ZA 1M71A 1M1SA 1U91A 1NMAH 3LN5B 4GS7C 5J7CC 4NGHH 1WWAX 5ACZB 1QLRA 4R9HA 5B8CC 2PETA 1P4BH 4AIZA 4OBRA 5LCVL 2WINA 3VRLF 5FYKU 3GO1L 4PLKD 2VXUH 1MFBL 4YQXH 5IFAH 4NNXA 2IAMC 3V0AC 2V6HA 4GBXB 4W81A 1LEIB 4NHUA 4Z7WE 2GY7B 4MSWB 3LQAL 1C5CH 4PJ9B 1S78C 2EICA 2X2YA 4KDWA 3V5KA 3EOAA 4ZFOL 1INDL 4CDGC 1TQCB 5C07D 4YDVB 3T09A 4ZYKA 3KWWB 1XIWA 4P2CG 3K4DA 2X41A 4I2XA 3V0VB 3ULUE 1CFSA 1HXMA 2BY2A 4MAYB 2K7QA 3B9KC 4FQXA 4QT5B 3IDYB 2C4FT 4M93C 5DJ8A 4F33A 4LCCB 3LEVH 3QDGD 4BSWA 2LQRA 4JR9H 3DVNB 1UWXH 4ALAL 2NNAA 3S9DB 1BOGA 3IU4H 3BZFB 3OGOE 2BNQB 4HF5H 3ROLB 2H1PH 3GSRB 3IDGA 4KRPB 5GGUB 4X7EC 5BRZE 3T8XA 2MCPL 5HYQA 3P40A 4PD4J 3RVWC 1T7VA 1N6VA 3MGOA 1IFHH 4WNQB 5E2UH 4C56D 2H9GA 4PLNC 4LNRB 3I6KA 4M1CD 3ALPA 3UTZB 1WF5A 1CWVA 4HJGA 4MB5A 3VD4A 1BBDL 3GM8A 4X99A 1EA9C 4ZXBC 2Z93B 3G08A 2X1OA 2ADJB 4P2QE 5K33A 5CJBA 3DPBA 2GSGA 1NKOA 3CSPA 4I4WB 4QHLB 3Q3GA 1JJUA 4APQA 4S1SL 5C0JB 4YXHH 1GC1L 1NMCB 3OKEA 1MCCA 3H0TA 4G3YH 3FKUS 3L5XH 4U33A 1RJZB 2P48B 1N3NB 4UNUA 4P4RB 4U31A 4H1LB 1MI5A 4GAYA 2F5BL 2KQNA 2WM0A 1NBVH 5GJSL 5IT2H 1B4JH 4OZHA 3FFDB 3V9FA 2VXVL 4HK0B 4TVPD 1NGZA 4K71B 3WFDH 5C09B 5ID0A 5I8OL 4YGAB 2VDQL 4JO3H 2R4RH 1RU9L 3MRRA 5JOPD 1LO5A 4KK5C 5CGYC 4LARH 5GGSA 3SCMB 3QUXB 2I5YH 3TC9A 2XZQH 2P45B 3TO4C 4B7IA 5DD3L 3P4NA 4PJAA 3HZVB 1PX4A 2FB4H 4ZAKC 5D5MA 3ALXA 4O2CA 1P7HL 1N7MH 3KDMB 2OYPA 5ALCL 1A1OB 4BFIB 1EEZB 3UJTL 5ADPL 1EGJH 4NRYA 4OZFG 4I77L 1A7OH 1HHHB 3EYVA 4Y5VC 1G7PA 3B5GA 4X9IA 5EN2B 4Q9RL 2ESVD 2YD2A 1X44A 3T65B 4Y19E 4QXGL 4LBEA 3VXPB 1DQDH 2XWTB 3BEVB 4LLMA 4HHAA 4CMHB 5BZWA 1MCRA 2CR6A 1UEYA 4OGAC 2R0ZH 2CIKB 3V4UH 1K5NA 5D1XB 4D8PA 3CPLA 1YEJL 5F7WC 3DO7A 3HMXH 3FB6B 1PGRB 4N9GB 3LN4A 3RIFF 5C08A 5I0ZA 3CFEA 1G6VK 2YEZB 3O2WH 2VDLH 4LPVA 4IRZL 4EOWL 5I9QC 4M6NH 4GRLC 4PJBB 1AE6L 4NDMA 1MCQA 1IQWL 4X9BA 2R1XA 2Q8BH 5D1QD 1NCNA 1JWMA 5HHXL 2RAMA 5A3IC 2VZ3A 3B3IB 2V7NB 4PUBH 2AERT 4YDIH 2MCG1 4JFOB 1AGEA 1HOCA 4AL8L 3LRSA 1UXWA 4CVWA 2D0FA 2V5MA 4JZNB 5C0GB 3GSQA 5DFVD 1FNSH 5F7FA 5IIEA 1P4LB 2ICWJ 4RSVA 4LDLB 4D2NA 1M05A 1YJDL 4N8VB 2EEBA 1U8QA 1R5IB 3G5XB 2J4WH 4JHAL 4NQDE 4OIAA 3HE6A 1HHIA 4BELD 5IEKB 4YHMH 2ICEB 3EYOA 5IB1B 4PJGA 2FJHA 1BGXL 1FAIH 1S7TA 3REWA 5FKAB 3V7MA 3O8XB 3ZKXC 4A6YA 3CVIH 1XGTB 4MMXC 1XF5B 1T66D 4PRIA 5FECB 3BO8A 1VA9A 3MO1A 2D03L 3IRZA 2GSIB 3HI5H 2ZOKA 2DQUH 5B4MC 2ADGB 2Q76A 3MRDA 3QFJD 1ND0B 2P7TB 4HXBL 4PRDB 2JKXA 2CLZA 2J1KA 4OV5A 5HDLA 1JVKA 2HT2C 2J6EH 5C0IA 1T7YA 4P48A 1FVEA 1T21B 2PCPB 4S0TD 4YK4C 2HFGH 4M5YL 3JV4A 5E6YA 5CD5D 2D4FA 2ZUTA 4HUXB 5FYKL 5T3ZD 1A2YB 4X5WA 5B21A 2YPLD 1W0VB 4TUKL 1TVBA 3MUGB 1QKZL 3GMQB 5J1AB 3O6FC 1G7LB 5K9KB 4YBHA 3H9ZA 2H2SD 1IQDB 1GOHA 1I1AC 2OK0L 3OAYH 3R8BB 4N90E 3O3BB 1HHGB 4BQ8A 4GRWB 4YHLL 5IM7B 1RK1B 1ZVSA 1JHLH 1BEYL 1TZHA 2X1QA 3B6SB 3RUGF 5EZJA 4ODUA 5JTWA 1TJIL 3DX9A 4XHQA 5DRWA 4U7KA 1A6AA 1H8NA 1TDQA 3FJTA 2BERA 5FUOH 1U6AL 2PO6B 3H2WA 5EZLB 4MNGA 4NQCB 4KKNA 2CDEB 4BK5A 1V05A 4HT1L 3ARDC 4NNYA 3MPCA 2UY6A 4R6UA 4EXKA 5J12B 4PLKC 2ICWB 3JUYA 4NQVA 4NUJA 3RWGB 4A2MA 5IR1A 1WZ1H 3TPKA 4XT1C 5I0DA 4FNLH 5GS2D 1JZ2A 3NH7L 2BP3A 2GJ6D 3PUCA 1VESA 2CR3A 1BF2A 1QSEB 2Z35A 1T03L 4J3SA 1FYTE 3EZJB 2EDXA 2FH8A 3VJ6B 5C0CA 2YWZA 4ZUTB 3ORJA 3MRLA 1HN1A 2SEBA 4HX1B 2NXZD 1MCJA 2DD8H 3KXFB 3OR6A 2X89D 3ZO0A 4YC2C 4JJ5B 1ORQA 1IC7L 2HT4C 3P9LA 1FGNH 1H0DA 3VFWB 4L4TB 1V7NH 5J6GB 2PW2A 3BYYA 2YD5A 2I9TA 4HS8H 2EEDA 1VFOA 5FCUH 4DFIA 5HHMB 5E9DD 1FNGB 3TN0C 4MYWB 4PPTA 1G6RH 1BZ9A 2DQIH 5D1QA 5HHPA 3KR3L 4HH9A 3JV5A 4KC3B 5HI3D 3IJHA 1LO0L 3LSOA 1MLBB 25C8H 4LEXH 2F19L 4Z76B 3D85D 5LGKA 4M1CC 1TCRB 3WO3B 4GG6B 3HPJB 2IPUK 3UROR 3MA9H 1K2DA 4PD4K 4KY1H 3I75B 5DEGA 3SGDH 3HG1A 3FQRA 1UJ3C 1MFNA 1PZUB 1BWMA 1AGBA 4PRNA 4ZSOB 3GI9L 4OZFH 3C09C 4ORZC 1KIPB 5ISZA 3VDAA 3B9KB 5CBEA 3GSXA 3F58H 1EAPA 3V95A 4M93B 2DM4A 1OTTC 5I1DB 2C1OA 2BRQA 2K1MA 3DRQA 2A9NL 3IJYB 4J3VA 8CGTA 1YECH 4AEIH 3TCXA 3ILQC 3SKNB 2KZ1B 5E24E 2CDFB 1REIA 5IGXL 4IOIB 5MENB 4TNWF 5L2KB 1J9CT 1MQKL 5BS0E 4DAGH 4LLUA 1RZGB 3F6IA 2HKFH 3UTSE 5E5MB 2CKBA 3IDXL 4D0DB 2O5XL 3NCBB 2YOCA 3P77A 2BC4B 3KYAA 4LSDA 3DUUA 4WI6A 3EKCA 5ESAA 4MZ3A 2W1NA 4UMGA 4Y1AA 2PYEA 4JPWH 4U6VL 3U9UB 1IJ9A 5D7IB 3QHFH 5SWZA 1KB5H 1U3HC 1QLFB 4X0KB 5KN5B 1CXIA 1WZMA 4HS3B 4D0BA 4P5MA 4DN3H 3QNXA 5EU7E 4JN1H 1AD0A 1LGVA 1MCKA 4CMMB 3PGCA 2VDRH 4HLJA 5DJXA 3U82B 4OZIB 1YQVH 2YPLA 5D2LE 1OAKL 3MCLL 3H42H 3EHBD 3GRWL 1PQZB 1U8PA 2E9BA 3HAEB 1BWWA 4YE4H 4ORGA 3NIGE 3EYFB 5C0ND 1XR8B 1XGRB 3O6MH 5DMGD 4N1HB 4X6CB 1A14H 3P0VL 4DGYH 5DYOB 4HPOL 1L0YA 2AJYH 3IKKA 2Z92B 5L9DL 1LDPH 1NC4D 4YDJB 1EO7A 1G7HB 3GSUA 1JGEB 1QZ1A 3BN9D 1A3RH 1H15A 2LAAA 2W0KA 4A6YL 4JFEA 3U79A 1U58B 5H2BA 5T1MA 3H9HB 3TWCH 4J6RH 3MLRL 5JW5B 3VGAC 4PJXA 2XZCH 3MQIA 2UZXB 1YY9D 2AABH 3WFEH 4HKJB 2JF1A 4PGDA 1MNUH 3K8LA 2XN9D 3JWDL 3HE7C 3TJHD 5CSZB 4TQEH 1GHFL 2IANA 3S3SA 1CBVL 3QIWD 2WIIB 3QEUA 4Q97A 5IBTL 1Q72H 1U8IB 5JDSB 4NCDA 3U4AA 2PTTB 2R9HD 2FIKA 1HH9B 2X4RA 1JNHA 4N0YH 4M5ZH 3TLRA 4NQUA 4IRJD 4PJ5A 5F3BB 2IBGA 3FMGL 1NGXA 5BMFL 4E9LA 5DJ0B 3KNBA 2BVQB 4AIXA 4JQVA 2VISB 5ENWB 5JHDB 2GIYA 3GSWB 4P4KD 1NCBH 3W9EA 4JZOA 1ES0B 3L5WB 5DXWA 2MQCA 1AP2B 1OLZA 4ZUUB 5F8QC 3U6RB 3ZTJG 5MERA 5E00B 1DBJL 2R4SH 2R2EA 2RB8A 4HBCH 3WL9A 4PREB 4UV4H 5I9QB 1HSBA 2YK1H 5E9DA 4GRLB 3H7LA 1X4ZA 3LN5A 3HC0B 1ITBB 3JXAA 2VXQL 1T66C 4LRNL 1SQ2N 5H8DA 1RUML 3TP4A 2IC2A 4MGXA 5I75C 3TYGH 4OD3L 3WJJC 4M3KB 5H37G 2G2RB 1NC2D 4B41A 1WWWX 4Q6YA 4GBXA 2LV4A 2VKWA 1LEIA 1F3DH 4K9EL 2X70B 4MSWA 2DM2A 2NY1C 4PJ9A 1X6LA 1V3KA 2CJUH 5IJKC 4RMUA 2J8UE 3MCKA 4NWUL 4JAMA 3ROOB 2XWBB 5IVZB 2BSRB 3KWWA 3BH8B 1E4XL 3WNNA 5CINH 2AVGA 3GSVB 3QIUC 4C83B 1QA9B 3HNVH 1L9NA 3V0VA 4OCNC 5SWSE 2O5YH 5DFWH 1X4YA 3FQTB 3LEYH 4MAYA 3RWDB 4HBQA 1ZMYA 3CFCL 1TTUA 5HYSG 2X9WA 4PJFB 4OLWH 4IMKA 3BHBB 3CD4A 4WCYH 2Q7NA 2AJSH 4LCCA 4L4VD 3OGCB 3DVNA 1BFVL 3BZFA 2CLRB 1QD0A 3BKYL 4KJQC 3GHEH 2BNQA 2NY0C 3ROLA 5DDHB 3T0EE 2QADC 3GSRA 5GGUA 2P43B 4PLJD 4QRRD 3C2AL 1QLEH 3FB8B 5DD0L 2VERN 4ZMAT 1E4WH 1UM4L 3UYRH 3NZHH 4DN4H 1Q8MA 1F4XH 3N0PB 3FOLB 4YK4B 4WNQA 1A64A 1T5WB 4X80H 2VLJD 3GSNH 4L9LC 1Z3GL 4NNPL 1BOYA 4LNRA 4V1DB 4UI2A 3UTZA 3TPUB 1OPGL 2RBLA 3RKPA 3QDMB 4X6DF 5EZOH 1IGCH 1JMZA 2Z93A 1JTPA 1TTFA 1EFQA 5FO8B 4NC0B 4BZ1L 2BXZA 1J1OH 2ADJA 2NXZC 3KLSA 3CFBB 3O2VH 4G9FD 3WFCL 1CFQB 5J13C 4M7JH 4I4WA 4QHLA 4PGEB 3BZ4B 2VLRD 4MAUH 4CRPA 1KYOJ 3FO0H 5FYKE 5C0JA 3AB0C 3LKSB 3PGFL 5ALBH 4P5TC 5DJDB 4I2XE 4OI8A 1RJZA 2LTQC 3VI3F 1N3NA 4P4RA 3CSYB 4H1LA 1NAMB 5HVWA 4NUGH 1KFAH 2CKBL 3MRIB 4WUKH 1A1MB 1U3ZA 3F62A 3ARDB 3ZT7A 2NZIA 4I9WE 3FFDA 4DGVH 4YDKH 1KEML 4HK0A 1FNAA 2BDNL 4JO4H 3LH2H 4NC2B 3MBEC 4OM1L 4X6FB 5C09A 4Z7VF 1SEBB 4N0RA 4KROB 3F7PC 4DW2H 1XGPB 1JV5B 3JWOC 3U0PB 1HWGB 2V5TA 3K7UA 3T3PF 4K2UH 3QUXA 5KW9L 4JG1L 2EKSB 5F6HI 3HZVA 4X5XB 3R06B 3QEHB 4ZOAA 4PY8J 1EO5A 1U41A 3GIZH 3V6ZB 3KDMA 3NFNA 2L4OA 1NLDH 1A1OA 1EEZA 4YC2B 1YEDB 1QYGL 3O11B 5EFIB 1B90A 2HFTA 3SE4C 5AZ2L 4ZOBA 1NL0L 2ITCA 1NBYB 4NZRL 5F7HA 1HHHA 3G5YB 1IKNC 3MZGB 3S5LB 3KYMB 3ZYZA 1YMMB 4P59H 2CGRH 3F8UB 3T65A 3BRGC 2CXKA 5IHZB 2XWTA 3BEVA 1S7VB 3IETB 4MA8L 4XCCH 2CIKA 5TQ0L 3TN0B 4U2ZA 1MI5E 2JB5L 2YA2A 3FB6A 2LAGB 3VRIB 3ZKMC 3H7BB 1EH9A 4OZHE 2WAHA 1WFOA 5D7JB 1VFAB 2EDHA 3PDGA 3PWVB 2YEZA 3UJIL 4U1IB 1K3IA 4OLVH 4PJBA 3VXNB 1N2RB 4Q2ZB 4OM0H 1XF3B 5CLTA 4MD5B 1N26A 5D7KD 3DMMB 3B3IA 5EIIB 2V7NA 5GRZA 3C09B 3EZ8A 4JB9L 4PJAE 1CGUA 4JFOA 3QZWB 4O58H 5D5ME 4S1RH 4JZNA 5C0GA 5A40E 4QF1B 1X3DA 3MJ9A 3NIDE 1RIHH 1M7IB 1P4LA 4KVCL 3NIFE 4F37F 1XT5A 5T33L 1UA6L 4JY4B 4PYGA 5C0NC 4P9ML 2XY1A 2KQMA 4N8VA 3QUMH 4JM2C 3OR7B 1R5IA 3G5XA 3L95B 2XQBH 2QHRH 2IBZX 1BBJB 4HGWB 1IM3B 1JK8B 5IEKA 2ICEA 5MEND 4HC1H 1Z9LA 4FQPA 5IB1A 3EIFA 2WZPD 3PWJB 1CZ8L 5FKAA 2DTMH 3O8XA 3G9AB 4DZ8A 1EIBA 1XGTA 1U3HB 1XF5A 3GKWH 5FECA 1NAKH 4UB0L 5D93C 5I8EB 4MJ6B 2GSIA 1YY9C 5C08E 3WFBL 2VLJA 4O51A 5H37H 2ADGA 3INUH 1ND0A 2P7TA 3WHE1 3T04D 4PRDA 3CX2A 2COQA 3MJGX 2ENSA 4PG2C 5TE6H 3LMJH 4WO4D 5IFJB 3PXJA 4NO0D 1T21A 2PCPA 1K6QH 5F96L 3UTPD 3IDJB 5HHNB 5GGSY 3TFKD 3EW3B 4IRJC 4HUXA 4LF3B 3HLAB 3U9PL 1A2YA 1KEGL 2A77H 5FHAH 1W0VA 2Y07L 3I6LD 3MUGA 5FF6B 1IC4H 4G5ZH 4P4KC 1EHLL 2X44D 5J1AA 2FR4B 1G7LA 5K9KA 4I8DA 1E6JL 4W70A 4YJZL 3FOMB 1IQDA 2HH0H 2BRRL 2YXMA 1WFNA 3O3BA 4MA7L 1HHGA 5INDA 5IM7A 3ESUF 2QSCL 1RK1A 1VFMA 3QDGE 3VGAB 5FUCC 2VZVA 4U1GC 3Q2CA 3SGJA 3ARUA 5IB5B 4UTAL 4HMDA 4PJCB 3HE7B 4PJGE 2PO6A 5EZLA 4NQCA 3KPMB 4WHTB 2C4FU 1AHWC 2CDEA 2IEPA 5JZ7D 4PRIE 2ATKB 3MRFB 5LG1A 2WP3T 3ES6B 1EJ6A 4POYA 1ETZB 5J8OA 1C12B 2ICWA 3U30C 3BT2L 1JGUL 3S37X 2NY2B 3ULVD 4XC1L 4XVSL 2D7NA 4EN3C 3LHPH 4MDJB 1QSEA 2ATPB 5MHSE 4IHOB 3UAJD 3V8OA 3BGFB 1UT9A 4ZUTA 5I1JL 3KPTA 4HCRA 3OPZL 5D71H 4HX1A 1HYRC 3PV6A 3RA7L 3QPQD 1T1YA 3BDBA 5BVJB 3KXFA 3RAJL 1OCWH 1MCLA 1G0YR 4DOHB 1QO3B 3GJEB 4MQSB 4RMSA 3BW9B 5A2IH 4JJ5A 4C57C 2NW3B 3MV9B 5TF1L 2DDQL 3VFWA 4L4TA 5J6GA 2J2ZA 1OGAD 1ZLUH 3BQUD 4Q0XH 5DSCB 2W38A 4TULH 4U0RB 3WIFB 5B38G 3I3DA 3WNLA 2WUBH 2VUYA 1FNGA 4CN1A 1FE8H 4PLJC 3DYOA 1T0NB 2BY0A 5DJCB 1Z9OA 2WBKA 1VEPA 1NUDA 3ARXA 5CAYB 32C2B 1HQRA 1D9KC 1MLBA 1T0MB 2O5ZH 4NZDA 4Z76A 3ZSTA 4GG6A 3QUZB 2P8PB 4R4FL 2IPTH 5F7EH 3HPJA 3S6CA 5CEZL 1FAKT 2R15A 4ZD3L 4OSUL 3I75A 4JQIH 2D9CA 3QIUB 3BMVA 2IH3B 3W0WD 3KPOB 3RVXD 4ZSOA 1NEZG 5C0CE 43C9A 4JVWA 1MJ8L 1KIPA 2HTKD 3B9KA 3JV0A 5DC0A 4H25B 4LSUH 2MOVA 3QO0B 3IJYA 4OF0A 2H32H 1MCFA 3RPIB 1A7RL 3SKNA 2CDFA 4KDVA 3BE1H 4UZGA 4ZFZB 5MENA 5L2KA 2NY0B 2QADB 2H6PB 1SJHB 1DANT 2CMRH 1KYOK 1RZGA 2F58H 1UWXK 1RPQA 3QDJB 1DBKL 5E5MA 4D0DA 3QQ4B 3NIGF 4GMTH 4HW6A 3ZHKA 3NCMA 4OLXH 1T2QH 2XG4A 2BC4A 5EIVA 4IDJL 4L9LB 3O45B 1Q9LB 1AJ7L 3U9UA 4LHJB 5D7IA 2VO5A 1QLFA 1P69B 4JKPL 4X0KA 4WO4A 4BUHA 5KN5A 1K4DB 4HS3A 1MJ7L 2HLAB 2OMNA 4TTGA 5IF0B 4CMMA 4PP1D 1X5IA 5J13B 1X5JA 3K8KA 1ZHLB 4FQ2H 4OZIA 2VC2H 1WBZB 1QBLL 3HG1E 3MJ9L 2BVOB 4HIXH 3AMKA 5AG9A 3HAEA 4OJFL 4P5TB 1BIIB 2LTQB 4U6XA 4DKEL 3WNPA 1RZIB 2OZ4A 3EYFA 5ISZE 1XR8A 1XGRA 5LWYH 4YEFA 4BSJA 1ZWIB 1C8PA 2HKHL 2N7AA 3QNYB 4X6CA 2M26A 3A0OA 5DYOA 4RQQB 4XPGL 1V3LA 4WV1C 5SWQB 1MRFH 4TPRH 2Z92A 1QR1B 3MBEB 2E7LC 4YDJA 2D2OA 1G7HA 1JGEA 1IMHC 3DVGB 5IMKB 4G7YL 4KQ4L 5I76A 1TCMA 3BKJL 4P2OB 1U58A 2V5RA 3H9HA 1YNKH 5JW5A 5IBLC 3CUPB 4XNXH 4PJHE 4Z7UF 4HKJA 1YEFH 2AAVA 2DMKA 1TETH 1GL4B 5CSZA 2JELH 4Y1AE 5T3XL 2PYEE 3SDAD 3HZYB 4EEEA 5SWZE 4W68A 1A5FH 2WIIA 1N6QL 1U8IA 1DBAL 5JDSA 4Z7OE 2PTTA 1HH9A 4QTHB 1I3VA 2AJUL 2A9ML 1VGKB 3U2SB 1A47A 5F3BA 1FGVH 2FH6A 3P11H 4QHMB 5EBWB 5DJ0A 3BRFA 2YPLE 1UCBH 2BVQA 5CHNB 2VISA 5ENWA 3GSWA 2AXHA 4UT6H 3BSZL 1FLTX 1ES0A 3L5WA 2C7UB 3TT1H 4KKAC 3MZTA 1IZJA 1L7IH 2QEJA 3GMOB 1AP2A 1AXIB 2NTFB 4ZUUA 4XWOD 3U6RA 3HUJF 2V9QA 4LKCB 4HWNA 1F58L