3Q3MC

Toluene 4 monooxygenase hd complex with inhibitor 4-bromobenzoate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 25
structure length 82
sequence length 82
chains with identical sequence G
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3q3mC00
3RMKC 3DHIC 1T0SC 2INCC 3GE8C 3RNAC 2INDC 3RNGC 2RDBC 3N1XC 3DHGC 3DHHC 3GE3C 3Q3MC 3RN9C 4P1BC 3Q14C 3RNEC 3N1ZC 3RI7C 1T0RC 4P1CC 1T0QC 3RNFC 3Q2AC 3I63C 3Q3OC 3RNBC 3Q3NC 3RNCC 3I5JC 3N1YC 3N20C
chains in the Genus database with same CATH superfamily
3PTFC 3L16A 5FR3A 3B9JA 1Q10A 3CSFA 2X8XX 1L6VA 2Y5PA 3NOBA 4B0EA 2WDQB 4YSZB 2PKOA 5DCNA 3DVGX 2OOBB 1L0XB 2BYFA 1UF0A 5C3JB 3C19A 1P7EA 4MH0E 2CJOA 3K9OB 3HIZA 2FBWB 3B08A 3KLSX 3ETRA 2L83A 1NI2A 3JSVA 2X38A 3L08A 2J53A 1V1PA 1JCKB 2L1AA 2FUG1 1WXQA 1QZEA 4FHJA 3SFEB 2MP2B 3EUB2 1V49A 3BVGA 4ITKA 2M1MA 1YN3A 4P16A 4WQOB 2N9LA 2W54A 3TBLD 3W9CB 3Q8BA 2GBJA 3GOEA 2J52A 5AEKB 1V1OA 3ZJTA 4XGAB 1HEZE 4LDTD 2KACA 3ONSA 2RGFA 1LXDA 1SBBB 3HVDA 3HHMA 1FXTB 2WXNA 3IG3A 1AWDA 4ZRQA 2V3PA 2KQ4X 2MBBB 3APDA 4RFBA 1YQBA 3JVZX 1WXVA 3NJTA 4W9FA 4GSWA 1MVKA 3SEBA 3Q6BA 4OVVA 4KKJA 1FNUA 4NNJB 4IM0A 1L0YB 1TBEA 2KVRA 3NVYA 2KFJA 2JRHA 3MFGA 4C00A 5D7GA 2VRRB 2CR5A 2RSUA 4YTMB 1XF5L 2MA9B 4OZCA 3NHEB 4ANUA 1PFDA 1ZPSA 4LNIA 2L0TA 3TJPA 1I4QA 4AUQC 1JRUA 3ABVB 2WP9B 3N3KB 1C78A 3T8MA 4F7ZA 3KUZA 3V05A 2MW5A 1OFFA 4E3CA 2LUEA 5BMGA 2L00B 2GBRA 2M19A 1J7AA 4O1NA 4BOZB 1M94A 3ZQ4A 2I38A 4WQMA 2EKIA 2KX0A 2Z0DB 1J8CA 1NEKB 2PW9A 2R2OA 3RNFC 1MJDA 2L3ZA 3R7RA 1A70A 1E8XA 1JW9D 2GB1A 3ZDMC 1YJIA 4HLEA 4GDKB 1A5RA 2LVOA 2KJRA 3FILA 2M17A 1WH3A 5IKCM 1TS4A 1D5ZC 2D5GA 3TMPB 3UGBB 4JX1C 2BWFA 2AWTA 1L4ZB 1XLNA 2G4DB 2MRPA 3PRPB 3URYA 4M8MA 4OW0A 4EUTA 3BYYB 4BZAA 3KW5B 2C7NB 3TEWA 5EE9A 3NVZA 2WU2B 4DDGD 4WAAA 1VZ8A 3O65B 3I9V1 2LASA 3ZIMA 1L2NA 3MJ5A 1UWXA 4MM3B 3LYYA 4GOCA 4LNKA 3KWLA 4RMAA 3H7PA 5CHVC 1TKGA 1ZXHA 1C76A 4A3OA 2UWQA 3DHGC 3WA0A 2Z0EB 2QC8A 2BB6A 4KGSA 3AM9A 4K1RB 2AL3A 3ZKJC 2N0SB 1EWCA 2ON8A 3RNEC 2KDMA 3SDLC 5LLIA 2G9HD 1WRDB 5HFYA 2MBOA 2BS4B 2CS4A 4D2KA 4IKGA 2WNMA 4PS3A 3GZNB 4HCPB 2BGFA 4BAXA 5CHWA 3UIOB 3N1XC 3PRZA 3WAMA 1OTRB 1R4MB 1I42A 3DQVA 4GLSC 1E7UA 1JROA 3AE1B 4A55A 4AWJA 2FCNA 3QARA 5FK9C 2WXLA 4HK2A 3L0WB 3IHPC 1E8WA 1CK1A 3VHTC 2KD0A 3LXFA 4W9DA 3W5UB 5T8IA 3A1QB 3AE3B 1TY2A 5EE3A 3PZ8A 4HKQA 1FCCC 1GB1A 3VAWA 5DPSA 4L2YA 4F1SA 1HZ6A 3OJ3A 1E9MA 3BY4B 3MC0B 3VH3B 2YVCA 3RZFA 4REZA 2QDFA 2V4IB 4MH8A 3I5JC 3OG5A 1YOVB 2KTRA 2W3SA 2N9PC 1VJKA 4WJNA 2JU6X 1N5XA 5EE1A 3C0RB 3VUYA 3PREA 3QX1A 4GB9A 3OWEB 2JZ3B 2LWPA 4NJ7A 5BMIA 4B0MA 1C3TA 3RUIB 3FKYA 3J9CA 1WE6A 2NTSA 2HE7A 3AEFB 4URKA 1C4CA 2KFKA 4MGYE 1YNTE 4Q2JA 1OGWA 2G45B 5BYQA 5J2RA 3LJ3A 1S3SG 2BBCA 4NY0A 1WJ4A 3AN1A 3AE2B 2BS2B 3ZGZA 1FM0D 3DVGY 4TV3A 2MEKA 3X0WA 2O6VB 2YEPB 3QQ8B 3U52E 4CHKA 3H8HA 4KDLB 2O2VB 2K8CA 4MSMB 2RDBC 2XBBC 2PLPA 1NBFC 4KGTA 2BYVE 3DVNV 3A4RA 2KMAA 1YX6B 1IGDA 2IY0B 3B0AA 2AL6A 1QT9A 5JXVA 1S1QB 2OEDA 2QCZA 3ZRFA 5L95C 3DWMA 4IDIA 4RCOA 3WAOA 2XK5A 3AB5A 4NQKE 1FXIA 1TS2A 1XD3B 4OVZA 4C4VB 3PHWB 4C80A 3P42A 2N7JA 1JWMD 2JUOA 2RDHA 4K7SA 3ZXVA 1CZPA 1D6EC 4LTUA 2BVCA 1SE9A 2KWCA 1HXYD 1ROEA 2KDBA 4W9EA 3DVNU 2W9NA 4YT0B 2A5UA 2M4NA 2K8HA 3ZXRA 4MEMA 5FR6A 3N9YC 3A9JB 3OJ4B 1UELA 2IO0B 4WWPA 3NVWA 3NUHB 4LNOA 1MG8A 4BVUC 4LNFA 2DYMA 3V62A 1AARA 2K0PA 4HRSA 1E90A 4GIVA 3GS2A 4WH4A 4MELA 4G3XB 2ASQA 3IAM1 1PQSA 3DHIC 2WDVB 5FKAC 4LNNA 3DHHC 2BYTA 2VZKB 2AX5A 2D3AA 4DWFA 1D5MC 3E9SA 1OEYA 3ML9A 1XO3A 4XDCA 2LGYA 2D3BA 2JXXA 1T3QA 1ZW7A 2INCC 4ARIA 5MPOA 4EE2A 2KMMA 4ZYSA 1WYWB 3AH7A 3L17A 2L8JA 1HTOA 4P7IA 3W1YA 4MGKE 1XQQA 2DZKA 2KTFA 5BYRA 3RD2A 2BTEA 3DBHB 1EWYC 4FLHA 2Y5CA 4W9KA 5IAAC 4M00A 2XEWA 3EHVA 1TTNA 4XDDA 5D3DA 1P98A 2KZRA 4TQ0A 4TSSA 3WAPA 2KLCA 4KSLC 4XE0A 5E6OA 1VRAB 3JSVB 3OAWA 3LDZE 1KLUD 1WGGA 4IW0A 4TKNA 2PTLA 4BKGA 2LRUA 3Q3FA 3UIPB 3QJZA 3UF8A 2K25A 2NBWB 3CIRB 4LK0M 3VUWA 3VDZA 5TR5A 5EE0A 4ANWA 4PYUA 2D2QA 1BUIC 2K8BA 5GXGB 2JYTA 3T9LA 5DPTA 2GMIC 3HRDD 2KWUB 4BKSA 2KWVB 2DLBA 1B9RA 4I6LB 1DOIA 1I4XA 1V80A 4II3B 1WM3A 3HUIA 3ZRCA 2LFIA 1QQRA 2E3TA 3M62B 1WJ6A 1SJHD 2QHOA 2KQ7A 1EF5A 1WFYA 2K9XA 3AECB 4J3OD 2J0JA 3ZDTA 2YEPF 5JHBA 4WJOA 2I1KA 1QOAA 3R2IA 3Q69A 4H2AA 3B1LX 4JIOU 2PJHA 3KWVA 1Y8RC 2GI9A 3R2TA 2AQ2B 3Q3JA 1NVID 2WQYB 2CHWA 3DBLI 1GOZA 2LGSA 3BWUD 2ACZB 2CHXA 4A90A 4RF1A 1AYFA 4NJ6A 3IBEA 2I2YA 2LXAA 2KXJA 3PVLA 3I63C 5KHOA 1TS3A 4B95A 3CMMB 1Q5WB 2B76B 2PIAA 2DAJA 1RM6C 1DOYA 1IUEA 5E6PA 4HROA 4G50A 1DYQA 1F9JA 2MJDA 1IBXA 1SSNA 3L10B 4MGZE 2JXTA 1G6JA 4ARCA 3EC8A 2A4ZA 1RWSA 1PUTA 3VFKA 1RRBA 1E8YA 3H1UA 3QWZB 2JY6A 1M4VA 1OQRA 2D07B 2RMMA 2WWZA 1YJJA 4PYZA 1HE8A 2KOXA 2HD5B 4S0RA 4CO7A 5L83A 3SU8X 4NPNA 5E6JA 1FD6A 2KDEB 3L13A 1T6BX 4M8NA 4DXAB 3DWGC 1R4NI 4GN1A 3U7ZA 1KF6B 1C4PA 4GGQA 2NMQA 5IP4D 2RDGA 2R2QA 2JRIB 2NBUA 3O13A 3H7SA 5KHQA 3A9KB 2IGGA 3UQBA 4FXCA 2QEJC 2DYOA 3BK2A 4JLCA 3BIID 4NJCA 1ET9A 4WURA 4XX5A 4N6EB 3W1SC 3U30A 3OLMD 2EMSA 2YLMA 4N58A 1HA5A 1WXMA 2ZW0A 4KV2A 1WGKA 2C5LC 3MC8A 1QF6A 1V6EA 3AU4A 5E6NA 4JL9A 3WIMA 4HJGE 4WAFA 3Q8FA 2C7MB 2PE6B 2GBKA 5DPWA 1WR6E 4XC2A 2WDTB 3P1MA 3EA6A 1FRDA 3DDCB 3SR6A 2Y5BB 2KAJA 4HVBA 2IO3B 4OZBA 1SE3A 1ZKHA 2BS3B 2JQRB 3PZ7A 2GBNA 3PS6A 4K7UA 1AW7A 2K1FA 3AE5B 3RNBC 1WMHA 1VD2A 2WXJA 1WZ3A 4FJZA 1UD7A 3LB8C 3R66C 5AZFA 4DBGA 1V2YA 3N32A 1IYFA 4YXDB 2WXQA 5BMHA 2KTRB 2WLBA 3VUXA 4BKSD 2WHIA 3B2FA 4LCDE 3N1ZC 4AQ7A 3ECIA 3HM3A 1SGHA 1GC7A 3V6CB 2FUHB 2INNE 2WXGA 4YL8A 3AEAB 4DDID 1DOXA 4GMVA 2KFKB 1PGBA 2MJEA 3ZNID 4NZLB 1J19A 1WE7A 2KC2A 4MSQB 2J4XA 1L4DB 2IO1B 4HEA1 1E0ZA 2KN4A 4AOFA 3P4PB 2Y3AA 3AEBB 3RZWC 4B6WA 3PO0A 3CF6E 5D3IB 2LHEA 1V97A 3A33B 4J6IA 1STEA 2MP2A 3AXCA 1YX5B 4EEWA 1K50A 2LGDA 4W9IA 3AEEB 1VCBA 1T0RC 3V61A 4TMAB 2WXRA 5JH5C 1YMHE 4MGIE 3N1YC 3BINA 3L4PA 3DBSA 1ACCA 3AE7B 1T0YA 4IOIE 3TEXA 2XK5B 3GE3C 3QHTA 2ZVNA 3RN9C 1KRHA 2N4FA 3ZJVA 2XN9C 3DBLB 1MFWA 2CU1A 3V3XA 4IC7B 2IYDB 2LGXA 5H8YE 4A20A 5LXIB 4KIKA 4E74A 4DXGA 4W9CA 2MH7A 1IPGA 1L5PA 4UDUC 1IGCA 2VH1A 1WY8A 1ZE3D 2EKEC 2REXA 2XNAC 1FO4A 2MX2A 2AYOB 2OJRA 1FFVA 1XLPA 1K53A 5JHAA 1XT9B 1DGJA 4MJSB 1LQBA 3W1SA 3GE8C 1C77A 2MBHA 3MC9A 3DCGA 1PGXA 3QK0A 4N9F4 1MI0A 4LDTB 4K7WA 2MLBA 4EZLA 2D3CA 4GDKA 4JGHB 3I57A 4USAA 1JWUD 2ZCCA 2H88B 1NDDA 4TUUA 4MACA 4ZDVA 1E6EB 2BKFA 5D6JB 2KT7A 1PDXA 1YQ4B 2ZPNA 3TSSA 5BO4B 2L0FA 2NS5A 1SEBD 2NPTA 4M0WB 4PS7A 2LD9A 3VTWA 2JWZA 2QJLA 3U8ZA 2L32A 5D94A 4IM3A 3UQAA 1J0GA 2Z59B 1VR9A 3VRAB 2LHDA 3KUDB 2WS3B 4ZRPA 2WU5B 1WRIA 3M3JA 1EUVB 3Q8CA 5D2MB 1V81A 1SIJA 4AS1A 1UGMA 1JMLA 2ZNVC 2W55A 3RNGC 2FCSA 2NVUI 1B1ZA 3RFZB 2G1EA 1PGAA 2M8SA 4IWPA 4GXBA 5HI1A 3NZ3A 4KX6B 2INPE 3EECA 5LNK1 1N6ZA 2ICIA 1X1MA 4DK5A 4XYCA 1CMXB 3N30A 3PV1A 5IOIA 4IG7B 1V86A 3W5VB 2KJHB 3A4SC 2ZJDA 2ZCBA 1FMAD 1JWAD 1GUAB 2H89B 2BQQA 2UU7A 3Q2AC 1WYGA 3Q3NC 2FIFA 3TIXA 1Q0WB 3VTUA 4BKTA 1XEEA 1SXTA 2KNBA 1WX7A 3MJWA 4TQ1A 2JSVX 4AJWA 2KN5A 1ZOYB 2Z8LA 3APFA 4ANXA 1I35A 2SAKA 1QILA 1FNWA 5JZEB 2RR9A 3T3NA 2LMCA 1FNVA 1EM7A 4PK1A 1VDVA 3C8YA 5HHDG 1F0ZA 1KM7A 2CHZA 2EMTA 3PSEB 4ICUA 2V0GA 2K6QA 2V9HA 2L52A 1N63A 4KGRA 4AJYB 5I4DA 2L76A 3RMKC 3ZNZB 3TEZA 3R7QA 3NS1A 5AZHA 4FULA 2HJ1A 3U2SC 2SEBD 3WALA 5IA7A 4EKUA 1SF0A 2GRIA 4US8A 3QIJA 4K81A 3CWIA 2QILA 4IUMB 3M63B 2MJ3A 1EU3A 2MHJA 1SE2A 2D11A 4ZHOA 1P7FA 2FE8A 4ZRIA 4DHZE 1F1HA 2BF8B 1K51A 4HCNB 2KO3A 1V1PB 4NAWA 1GC6A 1YN5A 2PVGC 2O2VA 4G0NB 3Q3OC 2WDRB 3PRMB 2WXIA 1OEYJ 3AMZA 3ZNHB 4FA6A 3QC8B 3Q8AA 3AV8A 4WJQA 2I1JA 3AULA 4RGNA 1H4RA 4YWGG 1F52A 2MSED 3S2AA 3HM6X 3IT6B 2KVZA 2G3QB 4MT5A 3PZDA 4C4VA 4RGMA 3VVWB 2QIEB 3IVFA 5CTRC 1V5TA 1OQYA 4ZRKA 3ZUNA 2DZIA 3JW0X 4WWNA 5BYSA 4K3BA 1WXSA 2ZVOA 3D32A 1KTKA 2PEAA 4A8XC 2B3AA 2K6DB 2IO2B 2L7RA 4W9GA 1XLQA 5C1ZA 2KJ6A 1KH0A 4GU2A 2V1YA 3GP7A 3RULA 3Q8EA 4XWWA 2ZZPB 4JQWC 1JRPA 4HDQA 3SHQA 1ZUD2 4A6QA 4RH6A 1J7CA 2C60A 3AU5A 3NRZA 1LFDA 1XCTL 5CHFA 2HTHA 2V4LA 4HPPA 1SE4A 3B2GA 1R7SA 1OQQA 4C7YA 1R4MI 1TZ1A 1JALA 2W3RA 2RPQA 2WX0A 3VQIA 2FCMA 2R61A 1XXGA 3BK1A 4S17A 1HQRD 3FILB 4FJYA 3PLVA 2J0KA 3KVFB 3X23A 2HJ8A 3DOWA 1E8ZA 2JYEA 2KK8A 2QSDA 4ACFA 2CKHB 5DPRA 1GPXA 3SFDB 1UH6A 2WYQA 1L7YA 2GBMA 1VZ6A 1WJNA 4P1BC 1XLOA 2KX3A 4RM9A 4DHZB 1BXTA 4GDLA 3QCAA 4N59A 2JPHA 4ZYNA 4E71A 5AUIA 3H7PB 3VRBB 1CQVA 2K3UA 1UBQA 3QAQA 1TIFA 3R8BA 2CJNA 2JT4B 3BVZA 4K3CA 4YSXB 2N9KA 4II2B 4FADA 4HWIB 3AE6B 3PPAA 1WGYA 4ASWC 3ENEA 1WIAA 4L23A 1N5WA 3Q3MC 2OJWA 3AE9B 2BB5A 1I4PA 2KHWB 2PE9A 2PMVA 1RAXA 1Z2MA 1T0QC 1ZXIA 3EFUA 1WXAA 1EF1A 1NI3A 2M0XA 3AE4B 1P1AA 3AEDB 4XWTA 4FN2A 3ZVVA 3PGEA 4KIKB 1QOFA 2NTTA 5IN7A 2V3NA 2KLGA 2O6VD 4BBNF 2LJ5A 1SB3C 1CJEA 1GJZA 5C2TB 4B9KA 4F8CB 4ZOHC 2DYBA 3WANA 5G5GA 1WZ0A 1MPEA 4EZKA 4OVUA 1WI0A 4JWSC 4ICVA 1NYQA 4YSYB 1K8RB 3IT4B 2FCQA 1F77A 2CU3A 2M56B 1YD8U 2WXOA 3EFCA 2WGSA 2E6XA 3VTVA 2KANA 3HK0A 2LJIA 5IO9A 5AUKA 1T0SC 3H6NA 4WWMA 2V3SA 1V5OA 2N7EA 1SIFA 4CQNA 2VH2A 2WXHA 2WXFA 3ZO5B 4IWQA 1YIWA 3DPDA 2QMTA 2KMCA 2BKRB 3NG0A 2NCNA 4I6NB 4X57B 4W9HA 4A9AA 4WJPA 1F2RI 1FXAA 3VXWA 2LUMA 2NPTB 3NZUA 1QLBB 5J18A 1WM2A 3AEGB 1ZDVA 1WJUA 2DNFA 3JYUA 2KQSA 2WXKA 2RPVA 3RI7C 2D3GA 3BYTB 2DHZA 2K22A 3I3TB 2HDEA 4HPMB 5AZGA 1D3ZA 1E5WA 4DHJB 2FIDA 2VZKD 3ZTCA 3A9KA 4ZHPA 2JZZA 2DENB 1L0VB 2N1VA 3DBHI 3IAS1 3IXSA 1TY0A 4HXDA 1ISNA 4RM8A 2MBEA 4JPSA 1SJED 1TGZB 2BPSA 2G4SA 4JE3B 1FRRA 5H92C 1TS5A 3P4SB 2ZW1A 1FPYA 3T3OA 1WX9A 4BOSC 3P63A 4HDOA 1UZXB 2ONQA 2WXPA 3DBRI 5J17A 1C79A 2MCNB 3H9DA 4P1CC 1IP9A 2IDYA 2DX5B 2BYEA 3ZTDA 1KFYB 4R3DA 3NVVA 3ZYYX 2JZPA 1JWBD 1K52A 1XCQL 4HPLB 4OHJA 1HZ5A 4KZ0A 2N9XA 2WX1A 5C23A 1TKEA 1WF9A 3KYCD 1P0RA 2DBYA 1YN4A 2HTME 2K39A 5EDSA 1NYRA 3P4QB 3VH4B 2MWSB 1J7BA 2JVCA 5TSSA 1TJEA 3PHXB 4C7ZA 1ZP0B 2LEKA 3VR8B 1RLFA 1EO6A 1FCLA 1NENB 4IM2A 1Z5SB 2ZPYA 1R4NB 1LM8B 1U4AA 2IBIB 3ZLZA 4M01A 2LZ6A 3KQ4A 1V9JA 2LXCA 3RCZA 1BT0A 4LJPB 3AE8B 1KLGD 1TKYA 1QOGA 4LJOB 3MTNB 1WSPA 4MM3A 4HJKA 1KLVA 1ESFA 2KDFB 1YJ1A 1WX8A 2KDIA 1HTQA 4EOYA 1C9FA 2PVOD 1D5XC 1RFKA 2N9EB 3RPFC 3V60A 3NY5A 1KJTA 4NAWB 1V8CA 1WWTA 1WGDA 3MHZA 1ZDXA 3CSTA 2K5PA 1YQ3B 1UUPA 2J0MA 5G55A 5GMVA 1WGRA 3ALBA 2AQ1B 2LVPA 4W9LA 1Q1OA 1E7PB 4EFOA 1E7VA 1E10A 5G2NA 4W9JA 4RF0A 1I4RA 4QAYA 2EELA 2DZJA 4FHKA 4YTPB 3P4RB 1WGHA 4EZJA 1RYJA 1LO5D 3NS8A 2BW2A 4JWUC 3PLUA 3PT2B 1F2RC 2MQJA 1LGRA 4RGOS 3V6EB 2Q5WD 2M0AA 4KDIC 1FFUA 2DWQA 1Y56A 1VZ7A 5LXHA 4AP4C 3AI5A 2NBVB 1I7HA 3KH0A 2DZMA 1T5XD 3VR9B 3MP9A 3RNCC 3A1QA 1GG3A 1H8CA 2ZNVB 2AQ3B 4DQOC 1I4HA 4P6VF 4WWOA 1BMLC 3L54A 4NQLB 3W2DA 1MHXA 4MJSA 1FIQA 1FEHA 2LVQA 3U7DA 2KYWA 1GNUA 2C9WB 1UGJA 1N62A 3M95A 4OZAA 4KSKC 2N7DA 5G5HA 3P2BA 2JF5A 4KZCA 2GLSA 4WIPA 3KUCB 1TZOA 1IBXB 1I4GA 4PT5A 4BBNC 5CX3A 3N20C 2J7QB 3TCAA 5HG2A 1UWMA 2JWUA 3GB1A 1GB4A 2L05A 4MDKE 2OHFA 4M0WA 3ML8A 2KWDA 2W82A 1JQ4A 1L6UA 2O6VA 3FC4A 2TSSA 3KYDD 1GAQB 1P9DU 3ZW3A 3ZJUA 1N61A 4FBJB 2KC1A 2JX5A 1UNSA 3TL5A 1ET6A 2FAZA 1PYWD 2LI5A 4RNAA 4GDLB 1EU4A 2D10A 4KVGB 2C7HA 1N60A 2J42A 4ANVA 1WR1A 2DAFA 4YTNB 1TYGB 4PS8A 4G11A 3DBRB 4IWOA 3RT3B 1D4BA 3RYTA 5HKHA 2IY1B 1ENFA 3RNAC 4FJVB 1VLBA 2UYZB 3HVZA 4RGTA 1KOTA 2PPHA 3MHSD 3K9PB 3R3MA 2LRWA 3FAHA 3UI3A 2GOWA 3IFWB 4NAMA 4A3PA 2NR2A 4L1BA 2FNJB 1AN8A 3WCQA 3APCA 3A9JA 4C56C 2BT6A 1UBIA 1QOBA 1TT5B 2INDC 3U4EG 2LGIA 1RFAA 3NZSA 4M02A 4KKIA 3UINB 2IZVB 3Q14C 3EGRA 2KKCA 3GZNI 1C4AA 1ZGUB 2IGHA 2BWES 1P3QU 2IPKD 3TUOA 3BZDB 3BVMA 2MBQA 2AEHA 1MHHE 4XZ4A 1QKZA 2IGDA 2RD0A 1WMHB 4HKZE 1MG4A 3E56A 2ZEQA 4US9A 2IJ0A 3QA8A 4I6PA 2N1WA 2WXMA 4LLGM 4CYEA 4DHJD 3TEYA 3ZNGC 4DXFA 4BFRA 3SD5A 1JWSD 4ZRJA 1C1YB
chains in the Genus database with same CATH topology
3RMKC 3DHIC 1T0SC 2INCC 3GE8C 3RNAC 2INDC 3RNGC 2RDBC 3N1XC 3DHGC 3DHHC 3GE3C 3Q3MC 3RN9C 4P1BC 3Q14C 3RNEC 3N1ZC 3RI7C 1T0RC 4P1CC 1T0QC 3RNFC 3Q2AC 3I63C 3Q3OC 3RNBC 3Q3NC 3RNCC 3I5JC 3N1YC 3N20C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMK C;  3DHI C;  1T0S C;  2INC C;  3GE8 C;  3RNA C;  2IND C;  3RNG C;  2RDB C;  3N1X C;  3DHG C;  3DHH C;  3GE3 C;  3Q3M C;  3RN9 C;  4P1B C;  3Q14 C;  3RNE C;  3N1Z C;  3RI7 C;  1T0R C;  4P1C C;  1T0Q C;  3RNF C;  3Q2A C;  3I63 C;  3Q3O C;  3RNB C;  3Q3N C;  3RNC C;  3I5J C;  3N1Y C;  3N20 C; 
#chains in the Genus database with same CATH topology
 3PTF C;  3L16 A;  5FR3 A;  3B9J A;  1Q10 A;  3CSF A;  2X8X X;  1L6V A;  2Y5P A;  3NOB A;  4B0E A;  2WDQ B;  4YSZ B;  2PKO A;  5DCN A;  3DVG X;  2OOB B;  1L0X B;  2BYF A;  1UF0 A;  5C3J B;  3C19 A;  1P7E A;  4MH0 E;  2CJO A;  3K9O B;  3HIZ A;  2FBW B;  3B08 A;  3KLS X;  3ETR A;  2L83 A;  1NI2 A;  3JSV A;  2X38 A;  3L08 A;  2J53 A;  1V1P A;  1JCK B;  2L1A A;  2FUG 1;  1WXQ A;  1QZE A;  4FHJ A;  3SFE B;  2MP2 B;  3EUB 2;  1V49 A;  3BVG A;  4ITK A;  2M1M A;  1YN3 A;  4P16 A;  4WQO B;  2N9L A;  2W54 A;  3TBL D;  3W9C B;  3Q8B A;  2GBJ A;  3GOE A;  2J52 A;  5AEK B;  1V1O A;  3ZJT A;  4XGA B;  1HEZ E;  4LDT D;  2KAC A;  3ONS A;  2RGF A;  1LXD A;  1SBB B;  3HVD A;  3HHM A;  1FXT B;  2WXN A;  3IG3 A;  1AWD A;  4ZRQ A;  2V3P A;  2KQ4 X;  2MBB B;  3APD A;  4RFB A;  1YQB A;  3JVZ X;  1WXV A;  3NJT A;  4W9F A;  4GSW A;  1MVK A;  3SEB A;  3Q6B A;  4OVV A;  4KKJ A;  1FNU A;  4NNJ B;  4IM0 A;  1L0Y B;  1TBE A;  2KVR A;  3NVY A;  2KFJ A;  2JRH A;  3MFG A;  4C00 A;  5D7G A;  2VRR B;  2CR5 A;  2RSU A;  4YTM B;  1XF5 L;  2MA9 B;  4OZC A;  3NHE B;  4ANU A;  1PFD A;  1ZPS A;  4LNI A;  2L0T A;  3TJP A;  1I4Q A;  4AUQ C;  1JRU A;  3ABV B;  2WP9 B;  3N3K B;  1C78 A;  3T8M A;  4F7Z A;  3KUZ A;  3V05 A;  2MW5 A;  1OFF A;  4E3C A;  2LUE A;  5BMG A;  2L00 B;  2GBR A;  2M19 A;  1J7A A;  4O1N A;  4BOZ B;  1M94 A;  3ZQ4 A;  2I38 A;  4WQM A;  2EKI A;  2KX0 A;  2Z0D B;  1J8C A;  1NEK B;  2PW9 A;  2R2O A;  3RNF C;  1MJD A;  2L3Z A;  3R7R A;  1A70 A;  1E8X A;  1JW9 D;  2GB1 A;  3ZDM C;  1YJI A;  4HLE A;  4GDK B;  1A5R A;  2LVO A;  2KJR A;  3FIL A;  2M17 A;  1WH3 A;  5IKC M;  1TS4 A;  1D5Z C;  2D5G A;  3TMP B;  3UGB B;  4JX1 C;  2BWF A;  2AWT A;  1L4Z B;  1XLN A;  2G4D B;  2MRP A;  3PRP B;  3URY A;  4M8M A;  4OW0 A;  4EUT A;  3BYY B;  4BZA A;  3KW5 B;  2C7N B;  3TEW A;  5EE9 A;  3NVZ A;  2WU2 B;  4DDG D;  4WAA A;  1VZ8 A;  3O65 B;  3I9V 1;  2LAS A;  3ZIM A;  1L2N A;  3MJ5 A;  1UWX A;  4MM3 B;  3LYY A;  4GOC A;  4LNK A;  3KWL A;  4RMA A;  3H7P A;  5CHV C;  1TKG A;  1ZXH A;  1C76 A;  4A3O A;  2UWQ A;  3DHG C;  3WA0 A;  2Z0E B;  2QC8 A;  2BB6 A;  4KGS A;  3AM9 A;  4K1R B;  2AL3 A;  3ZKJ C;  2N0S B;  1EWC A;  2ON8 A;  3RNE C;  2KDM A;  3SDL C;  5LLI A;  2G9H D;  1WRD B;  5HFY A;  2MBO A;  2BS4 B;  2CS4 A;  4D2K A;  4IKG A;  2WNM A;  4PS3 A;  3GZN B;  4HCP B;  2BGF A;  4BAX A;  5CHW A;  3UIO B;  3N1X C;  3PRZ A;  3WAM A;  1OTR B;  1R4M B;  1I42 A;  3DQV A;  4GLS C;  1E7U A;  1JRO A;  3AE1 B;  4A55 A;  4AWJ A;  2FCN A;  3QAR A;  5FK9 C;  2WXL A;  4HK2 A;  3L0W B;  3IHP C;  1E8W A;  1CK1 A;  3VHT C;  2KD0 A;  3LXF A;  4W9D A;  3W5U B;  5T8I A;  3A1Q B;  3AE3 B;  1TY2 A;  5EE3 A;  3PZ8 A;  4HKQ A;  1FCC C;  1GB1 A;  3VAW A;  5DPS A;  4L2Y A;  4F1S A;  1HZ6 A;  3OJ3 A;  1E9M A;  3BY4 B;  3MC0 B;  3VH3 B;  2YVC A;  3RZF A;  4REZ A;  2QDF A;  2V4I B;  4MH8 A;  3I5J C;  3OG5 A;  1YOV B;  2KTR A;  2W3S A;  2N9P C;  1VJK A;  4WJN A;  2JU6 X;  1N5X A;  5EE1 A;  3C0R B;  3VUY A;  3PRE A;  3QX1 A;  4GB9 A;  3OWE B;  2JZ3 B;  2LWP A;  4NJ7 A;  5BMI A;  4B0M A;  1C3T A;  3RUI B;  3FKY A;  3J9C A;  1WE6 A;  2NTS A;  2HE7 A;  3AEF B;  4URK A;  1C4C A;  2KFK A;  4MGY E;  1YNT E;  4Q2J A;  1OGW A;  2G45 B;  5BYQ A;  5J2R A;  3LJ3 A;  1S3S G;  2BBC A;  4NY0 A;  1WJ4 A;  3AN1 A;  3AE2 B;  2BS2 B;  3ZGZ A;  1FM0 D;  3DVG Y;  4TV3 A;  2MEK A;  3X0W A;  2O6V B;  2YEP B;  3QQ8 B;  3U52 E;  4CHK A;  3H8H A;  4KDL B;  2O2V B;  2K8C A;  4MSM B;  2RDB C;  2XBB C;  2PLP A;  1NBF C;  4KGT A;  2BYV E;  3DVN V;  3A4R A;  2KMA A;  1YX6 B;  1IGD A;  2IY0 B;  3B0A A;  2AL6 A;  1QT9 A;  5JXV A;  1S1Q B;  2OED A;  2QCZ A;  3ZRF A;  5L95 C;  3DWM A;  4IDI A;  4RCO A;  3WAO A;  2XK5 A;  3AB5 A;  4NQK E;  1FXI A;  1TS2 A;  1XD3 B;  4OVZ A;  4C4V B;  3PHW B;  4C80 A;  3P42 A;  2N7J A;  1JWM D;  2JUO A;  2RDH A;  4K7S A;  3ZXV A;  1CZP A;  1D6E C;  4LTU A;  2BVC A;  1SE9 A;  2KWC A;  1HXY D;  1ROE A;  2KDB A;  4W9E A;  3DVN U;  2W9N A;  4YT0 B;  2A5U A;  2M4N A;  2K8H A;  3ZXR A;  4MEM A;  5FR6 A;  3N9Y C;  3A9J B;  3OJ4 B;  1UEL A;  2IO0 B;  4WWP A;  3NVW A;  3NUH B;  4LNO A;  1MG8 A;  4BVU C;  4LNF A;  2DYM A;  3V62 A;  1AAR A;  2K0P A;  4HRS A;  1E90 A;  4GIV A;  3GS2 A;  4WH4 A;  4MEL A;  4G3X B;  2ASQ A;  3IAM 1;  1PQS A;  3DHI C;  2WDV B;  5FKA C;  4LNN A;  3DHH C;  2BYT A;  2VZK B;  2AX5 A;  2D3A A;  4DWF A;  1D5M C;  3E9S A;  1OEY A;  3ML9 A;  1XO3 A;  4XDC A;  2LGY A;  2D3B A;  2JXX A;  1T3Q A;  1ZW7 A;  2INC C;  4ARI A;  5MPO A;  4EE2 A;  2KMM A;  4ZYS A;  1WYW B;  3AH7 A;  3L17 A;  2L8J A;  1HTO A;  4P7I A;  3W1Y A;  4MGK E;  1XQQ A;  2DZK A;  2KTF A;  5BYR A;  3RD2 A;  2BTE A;  3DBH B;  1EWY C;  4FLH A;  2Y5C A;  4W9K A;  5IAA C;  4M00 A;  2XEW A;  3EHV A;  1TTN A;  4XDD A;  5D3D A;  1P98 A;  2KZR A;  4TQ0 A;  4TSS A;  3WAP A;  2KLC A;  4KSL C;  4XE0 A;  5E6O A;  1VRA B;  3JSV B;  3OAW A;  3LDZ E;  1KLU D;  1WGG A;  4IW0 A;  4TKN A;  2PTL A;  4BKG A;  2LRU A;  3Q3F A;  3UIP B;  3QJZ A;  3UF8 A;  2K25 A;  2NBW B;  3CIR B;  4LK0 M;  3VUW A;  3VDZ A;  5TR5 A;  5EE0 A;  4ANW A;  4PYU A;  2D2Q A;  1BUI C;  2K8B A;  5GXG B;  2JYT A;  3T9L A;  5DPT A;  2GMI C;  3HRD D;  2KWU B;  4BKS A;  2KWV B;  2DLB A;  1B9R A;  4I6L B;  1DOI A;  1I4X A;  1V80 A;  4II3 B;  1WM3 A;  3HUI A;  3ZRC A;  2LFI A;  1QQR A;  2E3T A;  3M62 B;  1WJ6 A;  1SJH D;  2QHO A;  2KQ7 A;  1EF5 A;  1WFY A;  2K9X A;  3AEC B;  4J3O D;  2J0J A;  3ZDT A;  2YEP F;  5JHB A;  4WJO A;  2I1K A;  1QOA A;  3R2I A;  3Q69 A;  4H2A A;  3B1L X;  4JIO U;  2PJH A;  3KWV A;  1Y8R C;  2GI9 A;  3R2T A;  2AQ2 B;  3Q3J A;  1NVI D;  2WQY B;  2CHW A;  3DBL I;  1GOZ A;  2LGS A;  3BWU D;  2ACZ B;  2CHX A;  4A90 A;  4RF1 A;  1AYF A;  4NJ6 A;  3IBE A;  2I2Y A;  2LXA A;  2KXJ A;  3PVL A;  3I63 C;  5KHO A;  1TS3 A;  4B95 A;  3CMM B;  1Q5W B;  2B76 B;  2PIA A;  2DAJ A;  1RM6 C;  1DOY A;  1IUE A;  5E6P A;  4HRO A;  4G50 A;  1DYQ A;  1F9J A;  2MJD A;  1IBX A;  1SSN A;  3L10 B;  4MGZ E;  2JXT A;  1G6J A;  4ARC A;  3EC8 A;  2A4Z A;  1RWS A;  1PUT A;  3VFK A;  1RRB A;  1E8Y A;  3H1U A;  3QWZ B;  2JY6 A;  1M4V A;  1OQR A;  2D07 B;  2RMM A;  2WWZ A;  1YJJ A;  4PYZ A;  1HE8 A;  2KOX A;  2HD5 B;  4S0R A;  4CO7 A;  5L83 A;  3SU8 X;  4NPN A;  5E6J A;  1FD6 A;  2KDE B;  3L13 A;  1T6B X;  4M8N A;  4DXA B;  3DWG C;  1R4N I;  4GN1 A;  3U7Z A;  1KF6 B;  1C4P A;  4GGQ A;  2NMQ A;  5IP4 D;  2RDG A;  2R2Q A;  2JRI B;  2NBU A;  3O13 A;  3H7S A;  5KHQ A;  3A9K B;  2IGG A;  3UQB A;  4FXC A;  2QEJ C;  2DYO A;  3BK2 A;  4JLC A;  3BII D;  4NJC A;  1ET9 A;  4WUR A;  4XX5 A;  4N6E B;  3W1S C;  3U30 A;  3OLM D;  2EMS A;  2YLM A;  4N58 A;  1HA5 A;  1WXM A;  2ZW0 A;  4KV2 A;  1WGK A;  2C5L C;  3MC8 A;  1QF6 A;  1V6E A;  3AU4 A;  5E6N A;  4JL9 A;  3WIM A;  4HJG E;  4WAF A;  3Q8F A;  2C7M B;  2PE6 B;  2GBK A;  5DPW A;  1WR6 E;  4XC2 A;  2WDT B;  3P1M A;  3EA6 A;  1FRD A;  3DDC B;  3SR6 A;  2Y5B B;  2KAJ A;  4HVB A;  2IO3 B;  4OZB A;  1SE3 A;  1ZKH A;  2BS3 B;  2JQR B;  3PZ7 A;  2GBN A;  3PS6 A;  4K7U A;  1AW7 A;  2K1F A;  3AE5 B;  3RNB C;  1WMH A;  1VD2 A;  2WXJ A;  1WZ3 A;  4FJZ A;  1UD7 A;  3LB8 C;  3R66 C;  5AZF A;  4DBG A;  1V2Y A;  3N32 A;  1IYF A;  4YXD B;  2WXQ A;  5BMH A;  2KTR B;  2WLB A;  3VUX A;  4BKS D;  2WHI A;  3B2F A;  4LCD E;  3N1Z C;  4AQ7 A;  3ECI A;  3HM3 A;  1SGH A;  1GC7 A;  3V6C B;  2FUH B;  2INN E;  2WXG A;  4YL8 A;  3AEA B;  4DDI D;  1DOX A;  4GMV A;  2KFK B;  1PGB A;  2MJE A;  3ZNI D;  4NZL B;  1J19 A;  1WE7 A;  2KC2 A;  4MSQ B;  2J4X A;  1L4D B;  2IO1 B;  4HEA 1;  1E0Z A;  2KN4 A;  4AOF A;  3P4P B;  2Y3A A;  3AEB B;  3RZW C;  4B6W A;  3PO0 A;  3CF6 E;  5D3I B;  2LHE A;  1V97 A;  3A33 B;  4J6I A;  1STE A;  2MP2 A;  3AXC A;  1YX5 B;  4EEW A;  1K50 A;  2LGD A;  4W9I A;  3AEE B;  1VCB A;  1T0R C;  3V61 A;  4TMA B;  2WXR A;  5JH5 C;  1YMH E;  4MGI E;  3N1Y C;  3BIN A;  3L4P A;  3DBS A;  1ACC A;  3AE7 B;  1T0Y A;  4IOI E;  3TEX A;  2XK5 B;  3GE3 C;  3QHT A;  2ZVN A;  3RN9 C;  1KRH A;  2N4F A;  3ZJV A;  2XN9 C;  3DBL B;  1MFW A;  2CU1 A;  3V3X A;  4IC7 B;  2IYD B;  2LGX A;  5H8Y E;  4A20 A;  5LXI B;  4KIK A;  4E74 A;  4DXG A;  4W9C A;  2MH7 A;  1IPG A;  1L5P A;  4UDU C;  1IGC A;  2VH1 A;  1WY8 A;  1ZE3 D;  2EKE C;  2REX A;  2XNA C;  1FO4 A;  2MX2 A;  2AYO B;  2OJR A;  1FFV A;  1XLP A;  1K53 A;  5JHA A;  1XT9 B;  1DGJ A;  4MJS B;  1LQB A;  3W1S A;  3GE8 C;  1C77 A;  2MBH A;  3MC9 A;  3DCG A;  1PGX A;  3QK0 A;  4N9F 4;  1MI0 A;  4LDT B;  4K7W A;  2MLB A;  4EZL A;  2D3C A;  4GDK A;  4JGH B;  3I57 A;  4USA A;  1JWU D;  2ZCC A;  2H88 B;  1NDD A;  4TUU A;  4MAC A;  4ZDV A;  1E6E B;  2BKF A;  5D6J B;  2KT7 A;  1PDX A;  1YQ4 B;  2ZPN A;  3TSS A;  5BO4 B;  2L0F A;  2NS5 A;  1SEB D;  2NPT A;  4M0W B;  4PS7 A;  2LD9 A;  3VTW A;  2JWZ A;  2QJL A;  3U8Z A;  2L32 A;  5D94 A;  4IM3 A;  3UQA A;  1J0G A;  2Z59 B;  1VR9 A;  3VRA B;  2LHD A;  3KUD B;  2WS3 B;  4ZRP A;  2WU5 B;  1WRI A;  3M3J A;  1EUV B;  3Q8C A;  5D2M B;  1V81 A;  1SIJ A;  4AS1 A;  1UGM A;  1JML A;  2ZNV C;  2W55 A;  3RNG C;  2FCS A;  2NVU I;  1B1Z A;  3RFZ B;  2G1E A;  1PGA A;  2M8S A;  4IWP A;  4GXB A;  5HI1 A;  3NZ3 A;  4KX6 B;  2INP E;  3EEC A;  5LNK 1;  1N6Z A;  2ICI A;  1X1M A;  4DK5 A;  4XYC A;  1CMX B;  3N30 A;  3PV1 A;  5IOI A;  4IG7 B;  1V86 A;  3W5V B;  2KJH B;  3A4S C;  2ZJD A;  2ZCB A;  1FMA D;  1JWA D;  1GUA B;  2H89 B;  2BQQ A;  2UU7 A;  3Q2A C;  1WYG A;  3Q3N C;  2FIF A;  3TIX A;  1Q0W B;  3VTU A;  4BKT A;  1XEE A;  1SXT A;  2KNB A;  1WX7 A;  3MJW A;  4TQ1 A;  2JSV X;  4AJW A;  2KN5 A;  1ZOY B;  2Z8L A;  3APF A;  4ANX A;  1I35 A;  2SAK A;  1QIL A;  1FNW A;  5JZE B;  2RR9 A;  3T3N A;  2LMC A;  1FNV A;  1EM7 A;  4PK1 A;  1VDV A;  3C8Y A;  5HHD G;  1F0Z A;  1KM7 A;  2CHZ A;  2EMT A;  3PSE B;  4ICU A;  2V0G A;  2K6Q A;  2V9H A;  2L52 A;  1N63 A;  4KGR A;  4AJY B;  5I4D A;  2L76 A;  3RMK C;  3ZNZ B;  3TEZ A;  3R7Q A;  3NS1 A;  5AZH A;  4FUL A;  2HJ1 A;  3U2S C;  2SEB D;  3WAL A;  5IA7 A;  4EKU A;  1SF0 A;  2GRI A;  4US8 A;  3QIJ A;  4K81 A;  3CWI A;  2QIL A;  4IUM B;  3M63 B;  2MJ3 A;  1EU3 A;  2MHJ A;  1SE2 A;  2D11 A;  4ZHO A;  1P7F A;  2FE8 A;  4ZRI A;  4DHZ E;  1F1H A;  2BF8 B;  1K51 A;  4HCN B;  2KO3 A;  1V1P B;  4NAW A;  1GC6 A;  1YN5 A;  2PVG C;  2O2V A;  4G0N B;  3Q3O C;  2WDR B;  3PRM B;  2WXI A;  1OEY J;  3AMZ A;  3ZNH B;  4FA6 A;  3QC8 B;  3Q8A A;  3AV8 A;  4WJQ A;  2I1J A;  3AUL A;  4RGN A;  1H4R A;  4YWG G;  1F52 A;  2MSE D;  3S2A A;  3HM6 X;  3IT6 B;  2KVZ A;  2G3Q B;  4MT5 A;  3PZD A;  4C4V A;  4RGM A;  3VVW B;  2QIE B;  3IVF A;  5CTR C;  1V5T A;  1OQY A;  4ZRK A;  3ZUN A;  2DZI A;  3JW0 X;  4WWN A;  5BYS A;  4K3B A;  1WXS A;  2ZVO A;  3D32 A;  1KTK A;  2PEA A;  4A8X C;  2B3A A;  2K6D B;  2IO2 B;  2L7R A;  4W9G A;  1XLQ A;  5C1Z A;  2KJ6 A;  1KH0 A;  4GU2 A;  2V1Y A;  3GP7 A;  3RUL A;  3Q8E A;  4XWW A;  2ZZP B;  4JQW C;  1JRP A;  4HDQ A;  3SHQ A;  1ZUD 2;  4A6Q A;  4RH6 A;  1J7C A;  2C60 A;  3AU5 A;  3NRZ A;  1LFD A;  1XCT L;  5CHF A;  2HTH A;  2V4L A;  4HPP A;  1SE4 A;  3B2G A;  1R7S A;  1OQQ A;  4C7Y A;  1R4M I;  1TZ1 A;  1JAL A;  2W3R A;  2RPQ A;  2WX0 A;  3VQI A;  2FCM A;  2R61 A;  1XXG A;  3BK1 A;  4S17 A;  1HQR D;  3FIL B;  4FJY A;  3PLV A;  2J0K A;  3KVF B;  3X23 A;  2HJ8 A;  3DOW A;  1E8Z A;  2JYE A;  2KK8 A;  2QSD A;  4ACF A;  2CKH B;  5DPR A;  1GPX A;  3SFD B;  1UH6 A;  2WYQ A;  1L7Y A;  2GBM A;  1VZ6 A;  1WJN A;  4P1B C;  1XLO A;  2KX3 A;  4RM9 A;  4DHZ B;  1BXT A;  4GDL A;  3QCA A;  4N59 A;  2JPH A;  4ZYN A;  4E71 A;  5AUI A;  3H7P B;  3VRB B;  1CQV A;  2K3U A;  1UBQ A;  3QAQ A;  1TIF A;  3R8B A;  2CJN A;  2JT4 B;  3BVZ A;  4K3C A;  4YSX B;  2N9K A;  4II2 B;  4FAD A;  4HWI B;  3AE6 B;  3PPA A;  1WGY A;  4ASW C;  3ENE A;  1WIA A;  4L23 A;  1N5W A;  3Q3M C;  2OJW A;  3AE9 B;  2BB5 A;  1I4P A;  2KHW B;  2PE9 A;  2PMV A;  1RAX A;  1Z2M A;  1T0Q C;  1ZXI A;  3EFU A;  1WXA A;  1EF1 A;  1NI3 A;  2M0X A;  3AE4 B;  1P1A A;  3AED B;  4XWT A;  4FN2 A;  3ZVV A;  3PGE A;  4KIK B;  1QOF A;  2NTT A;  5IN7 A;  2V3N A;  2KLG A;  2O6V D;  4BBN F;  2LJ5 A;  1SB3 C;  1CJE A;  1GJZ A;  5C2T B;  4B9K A;  4F8C B;  4ZOH C;  2DYB A;  3WAN A;  5G5G A;  1WZ0 A;  1MPE A;  4EZK A;  4OVU A;  1WI0 A;  4JWS C;  4ICV A;  1NYQ A;  4YSY B;  1K8R B;  3IT4 B;  2FCQ A;  1F77 A;  2CU3 A;  2M56 B;  1YD8 U;  2WXO A;  3EFC A;  2WGS A;  2E6X A;  3VTV A;  2KAN A;  3HK0 A;  2LJI A;  5IO9 A;  5AUK A;  1T0S C;  3H6N A;  4WWM A;  2V3S A;  1V5O A;  2N7E A;  1SIF A;  4CQN A;  2VH2 A;  2WXH A;  2WXF A;  3ZO5 B;  4IWQ A;  1YIW A;  3DPD A;  2QMT A;  2KMC A;  2BKR B;  3NG0 A;  2NCN A;  4I6N B;  4X57 B;  4W9H A;  4A9A A;  4WJP A;  1F2R I;  1FXA A;  3VXW A;  2LUM A;  2NPT B;  3NZU A;  1QLB B;  5J18 A;  1WM2 A;  3AEG B;  1ZDV A;  1WJU A;  2DNF A;  3JYU A;  2KQS A;  2WXK A;  2RPV A;  3RI7 C;  2D3G A;  3BYT B;  2DHZ A;  2K22 A;  3I3T B;  2HDE A;  4HPM B;  5AZG A;  1D3Z A;  1E5W A;  4DHJ B;  2FID A;  2VZK D;  3ZTC A;  3A9K A;  4ZHP A;  2JZZ A;  2DEN B;  1L0V B;  2N1V A;  3DBH I;  3IAS 1;  3IXS A;  1TY0 A;  4HXD A;  1ISN A;  4RM8 A;  2MBE A;  4JPS A;  1SJE D;  1TGZ B;  2BPS A;  2G4S A;  4JE3 B;  1FRR A;  5H92 C;  1TS5 A;  3P4S B;  2ZW1 A;  1FPY A;  3T3O A;  1WX9 A;  4BOS C;  3P63 A;  4HDO A;  1UZX B;  2ONQ A;  2WXP A;  3DBR I;  5J17 A;  1C79 A;  2MCN B;  3H9D A;  4P1C C;  1IP9 A;  2IDY A;  2DX5 B;  2BYE A;  3ZTD A;  1KFY B;  4R3D A;  3NVV A;  3ZYY X;  2JZP A;  1JWB D;  1K52 A;  1XCQ L;  4HPL B;  4OHJ A;  1HZ5 A;  4KZ0 A;  2N9X A;  2WX1 A;  5C23 A;  1TKE A;  1WF9 A;  3KYC D;  1P0R A;  2DBY A;  1YN4 A;  2HTM E;  2K39 A;  5EDS A;  1NYR A;  3P4Q B;  3VH4 B;  2MWS B;  1J7B A;  2JVC A;  5TSS A;  1TJE A;  3PHX B;  4C7Z A;  1ZP0 B;  2LEK A;  3VR8 B;  1RLF A;  1EO6 A;  1FCL A;  1NEN B;  4IM2 A;  1Z5S B;  2ZPY A;  1R4N B;  1LM8 B;  1U4A A;  2IBI B;  3ZLZ A;  4M01 A;  2LZ6 A;  3KQ4 A;  1V9J A;  2LXC A;  3RCZ A;  1BT0 A;  4LJP B;  3AE8 B;  1KLG D;  1TKY A;  1QOG A;  4LJO B;  3MTN B;  1WSP A;  4MM3 A;  4HJK A;  1KLV A;  1ESF A;  2KDF B;  1YJ1 A;  1WX8 A;  2KDI A;  1HTQ A;  4EOY A;  1C9F A;  2PVO D;  1D5X C;  1RFK A;  2N9E B;  3RPF C;  3V60 A;  3NY5 A;  1KJT A;  4NAW B;  1V8C A;  1WWT A;  1WGD A;  3MHZ A;  1ZDX A;  3CST A;  2K5P A;  1YQ3 B;  1UUP A;  2J0M A;  5G55 A;  5GMV A;  1WGR A;  3ALB A;  2AQ1 B;  2LVP A;  4W9L A;  1Q1O A;  1E7P B;  4EFO A;  1E7V A;  1E10 A;  5G2N A;  4W9J A;  4RF0 A;  1I4R A;  4QAY A;  2EEL A;  2DZJ A;  4FHK A;  4YTP B;  3P4R B;  1WGH A;  4EZJ A;  1RYJ A;  1LO5 D;  3NS8 A;  2BW2 A;  4JWU C;  3PLU A;  3PT2 B;  1F2R C;  2MQJ A;  1LGR A;  4RGO S;  3V6E B;  2Q5W D;  2M0A A;  4KDI C;  1FFU A;  2DWQ A;  1Y56 A;  1VZ7 A;  5LXH A;  4AP4 C;  3AI5 A;  2NBV B;  1I7H A;  3KH0 A;  2DZM A;  1T5X D;  3VR9 B;  3MP9 A;  3RNC C;  3A1Q A;  1GG3 A;  1H8C A;  2ZNV B;  2AQ3 B;  4DQO C;  1I4H A;  4P6V F;  4WWO A;  1BML C;  3L54 A;  4NQL B;  3W2D A;  1MHX A;  4MJS A;  1FIQ A;  1FEH A;  2LVQ A;  3U7D A;  2KYW A;  1GNU A;  2C9W B;  1UGJ A;  1N62 A;  3M95 A;  4OZA A;  4KSK C;  2N7D A;  5G5H A;  3P2B A;  2JF5 A;  4KZC A;  2GLS A;  4WIP A;  3KUC B;  1TZO A;  1IBX B;  1I4G A;  4PT5 A;  4BBN C;  5CX3 A;  3N20 C;  2J7Q B;  3TCA A;  5HG2 A;  1UWM A;  2JWU A;  3GB1 A;  1GB4 A;  2L05 A;  4MDK E;  2OHF A;  4M0W A;  3ML8 A;  2KWD A;  2W82 A;  1JQ4 A;  1L6U A;  2O6V A;  3FC4 A;  2TSS A;  3KYD D;  1GAQ B;  1P9D U;  3ZW3 A;  3ZJU A;  1N61 A;  4FBJ B;  2KC1 A;  2JX5 A;  1UNS A;  3TL5 A;  1ET6 A;  2FAZ A;  1PYW D;  2LI5 A;  4RNA A;  4GDL B;  1EU4 A;  2D10 A;  4KVG B;  2C7H A;  1N60 A;  2J42 A;  4ANV A;  1WR1 A;  2DAF A;  4YTN B;  1TYG B;  4PS8 A;  4G11 A;  3DBR B;  4IWO A;  3RT3 B;  1D4B A;  3RYT A;  5HKH A;  2IY1 B;  1ENF A;  3RNA C;  4FJV B;  1VLB A;  2UYZ B;  3HVZ A;  4RGT A;  1KOT A;  2PPH A;  3MHS D;  3K9P B;  3R3M A;  2LRW A;  3FAH A;  3UI3 A;  2GOW A;  3IFW B;  4NAM A;  4A3P A;  2NR2 A;  4L1B A;  2FNJ B;  1AN8 A;  3WCQ A;  3APC A;  3A9J A;  4C56 C;  2BT6 A;  1UBI A;  1QOB A;  1TT5 B;  2IND C;  3U4E G;  2LGI A;  1RFA A;  3NZS A;  4M02 A;  4KKI A;  3UIN B;  2IZV B;  3Q14 C;  3EGR A;  2KKC A;  3GZN I;  1C4A A;  1ZGU B;  2IGH A;  2BWE S;  1P3Q U;  2IPK D;  3TUO A;  3BZD B;  3BVM A;  2MBQ A;  2AEH A;  1MHH E;  4XZ4 A;  1QKZ A;  2IGD A;  2RD0 A;  1WMH B;  4HKZ E;  1MG4 A;  3E56 A;  2ZEQ A;  4US9 A;  2IJ0 A;  3QA8 A;  4I6P A;  2N1W A;  2WXM A;  4LLG M;  4CYE A;  4DHJ D;  3TEY A;  3ZNG C;  4DXF A;  4BFR A;  3SD5 A;  1JWS D;  4ZRJ A;  1C1Y B; 
#chains in the Genus database with same CATH homology
 3RMK C;  3DHI C;  1T0S C;  2INC C;  3GE8 C;  3RNA C;  2IND C;  3RNG C;  2RDB C;  3N1X C;  3DHG C;  3DHH C;  3GE3 C;  3Q3M C;  3RN9 C;  4P1B C;  3Q14 C;  3RNE C;  3N1Z C;  3RI7 C;  1T0R C;  4P1C C;  1T0Q C;  3RNF C;  3Q2A C;  3I63 C;  3Q3O C;  3RNB C;  3Q3N C;  3RNC C;  3I5J C;  3N1Y C;  3N20 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...