3Q3NC

Toluene 4 monooxygenase hd complex with p-nitrophenol
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
b'SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
molecule tags Oxidoreductase
source organism Pseudomonas mendocina
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3q3nC00
1T0RC 3DHIC 3RNFC 3RNGC 4P1BC 3RNCC 3I63C 1T0QC 3RNBC 3Q3OC 3N20C 3DHHC 3Q2AC 3RI7C 4P1CC 3I5JC 3Q14C 3RN9C 3GE3C 3DHGC 3RNAC 3N1ZC 2INCC 3Q3MC 3RMKC 1T0SC 3Q3NC 3RNEC 2INDC 2RDBC 3N1XC 3GE8C 3N1YC
chains in the Genus database with same CATH superfamily
4M8NA 1RFAA 1Y56A 4DHJD 4PT5A 1WJUA 2HJ8A 2V1YA 2HE7A 2JZZA 4TSSA 3T3OA 2RDHA 3GE3C 5KHQA 3DQVA 3CWIA 2KWDA 1T6BX 1WRDB 2WDTB 2BWFA 1OQQA 1UNSA 4IWPA 4C4VA 3QC8B 3AE6B 1ET6A 1NEKB 2ZCCA 4BZAA 2MA9B 2JXTA 2M4NA 1HXYD 2WDRB 4EZKA 1C76A 2J52A 3CF6E 1XLQA 3OG5A 1YJJA 1WFYA 4OZAA 4YTNB 2AL3A 3MC9A 1TS5A 1E6EB 3BVZA 5AZFA 4RGNA 1WGYA 4W9KA 4K7SA 5L83A 3HUIA 1TT5B 3A1QB 1V49A 2RSUA 3RN9C 1HTOA 1FMAD 1KH0A 2K5PA 5E6NA 5G2NA 1EF1A 1ZP0B 2PE6B 4IWQA 5D3DA 1PGAA 3JVZX 3RPFC 5DPWA 2JY6A 4II2B 2G4SA 2M8SA 1YD8U 5HFYA 2L7RA 2QHOA 2JZ3B 1PGBA 1FNUA 3AEAB 3ZRCA 3VR8B 3Q6BA 2N9PC 3L13A 1QOBA 4WIPA 4YTPB 2JT4B 1OGWA 1BUIC 4W9JA 4IDIA 3V05A 4WURA 3TEXA 1F0ZA 1HA5A 4FLHA 3JSVA 2XK5A 3KQ4A 3PHXB 3UQAA 2LGIA 4KSKC 3ZJUA 2GLSA 2HJ1A 4A6QA 2WDVB 2WXKA 3C8YA 1Q0WB 3J9CA 3M3JA 2VRRB 1YN4A 2MQJA 3IXSA 1F77A 3NG0A 1L2NA 2QC8A 3DVGX 4PS7A 1L7YA 4DWFA 1VLBA 1YJ1A 4HCNB 2R2OA 3TEYA 2LRWA 4IOIE 1K8RB 2QJLA 3V61A 4ANUA 4E71A 1ZDVA 1L6VA 4M01A 1V80A 4A3PA 4RF0A 3WAMA 1K51A 4N6EB 4DHZE 3VHTC 5C2TB 3ZTDA 3BVMA 4BFRA 2PLPA 3BY4B 2L0FA 1TKGA 1DGJA 2LHDA 1YQ4B 4AJYB 2M19A 2PKOA 2D5GA 3DCGA 1JWAD 1E10A 4HPPA 2BW2A 2D11A 3ZYYX 4GB9A 2EKEC 4ZYNA 3QARA 2PMVA 1STEA 2R61A 1N63A 3W2DA 2C7HA 2Y3AA 1NYRA 1FRRA 4HWIB 2LGYA 3T3NA 2WXJA 2WXNA 3ML9A 5AUIA 4ICVA 3KUCB 3B2GA 2BT6A 3ML8A 1J7BA 4WWNA 1IYFA 3RNAC 4GN1A 1FM0D 1L0XB 2K8BA 4WJNA 3RFZB 3EGRA 1Q10A 2IGGA 3ZO5B 3UF8A 4LTUA 2MJEA 1TGZB 3IAS1 3KYDD 4KKIA 2KDFB 2WGSA 2LVPA 3ZDMC 2RDGA 2N1VA 4LDTD 1YMHE 4P16A 3UI3A 1OQRA 1WX7A 3ZNGC 5D94A 2KWVB 4FBJB 2BB5A 2KC2A 3ZNZB 4ZRQA 3MC0B 4YWGG 3SFEB 2PTLA 3IVFA 4WJQA 5AUKA 2OJRA 2KDIA 4E3CA 5G55A 4MELA 3ZGZA 4YTMB 1TTNA 2K1FA 4EKUA 1SIJA 4HDQA 5AZHA 2BS4B 2IO2B 3Q3MC 2KMAA 1WGDA 1TZOA 3R8BA 3ZVVA 1JRPA 4XWWA 1QF6A 2L05A 1LQBA 2OOBB 3W1SA 3NVYA 4KGTA 2GBRA 3EC8A 4WQMA 4OVZA 3VTVA 3KWLA 1LM8B 4Q2JA 4J6IA 3V62A 1JMLA 4N58A 2KJ6A 3TJPA 2YEPB 3UGBB 3MHZA 2WXGA 4N9F4 1XLPA 4HJKA 2DBYA 2V3PA 4XX5A 1CQVA 2ZZPB 1LXDA 2N7EA 2HTME 4P7IA 3B1LX 4MH0E 3ENEA 2RGFA 4BOZB 1XCQL 2Z8LA 2QEJC 2ZPNA 3NY5A 4A55A 2NBVB 5CHVC 2BS3B 2ZCBA 1XT9B 1WZ0A 4LJOB 2KN5A 4C7YA 1CZPA 3BYYB 4A3OA 2KDBA 4PK1A 3KUZA 1GPXA 2GBMA 1GB1A 4FHJA 3N20C 3RI7C 3AE4B 3HHMA 1G6JA 3AE3B 1EF5A 4UDUC 1M4VA 1DYQA 1Q1OA 1C4CA 3VQIA 4NJCA 1HTQA 2JUOA 2NBWB 2N0SB 1KTKA 3X0WA 2WX0A 2MHJA 2K22A 2NBUA 4I6NB 3RCZA 5DCNA 1BT0A 1WYWB 4XYCA 1WR1A 2KFKA 1ZOYB 2WU5B 2NPTA 1RYJA 1UD7A 3P4SB 4W9FA 4GSWA 2M1MA 1L4ZB 2JXXA 4HVBA 3VVWB 4HPLB 3O65B 3B0AA 4K1RB 1RAXA 3WALA 1E0ZA 3BINA 4CHKA 2IDYA 2M17A 4HKQA 1YX5B 3HM6X 2MBEA 4WH4A 1E9MA 2JF5A 3TBLD 2VH2A 3IFWB 2K6DB 2Y5PA 1VRAB 3W1YA 3AI5A 2NMQA 1V5OA 2BVCA 4HK2A 3NZSA 2BKFA 3UIOB 2V4LA 2BBCA 2K6QA 1YIWA 1ROEA 3I5JC 2WYQA 3Q14C 1WF9A 2NCNA 3ZXRA 1J7AA 1ACCA 5HHDG 2FUHB 2EKIA 1MPEA 1SE3A 3AE8B 2UU7A 3CIRB 2IJ0A 3EFUA 4BAXA 1PUTA 1JWBD 3RNGC 1WX9A 1WGHA 2DENB 3VR9B 2JRIB 3LDZE 2MCNB 2D07B 1VR9A 2JWZA 2IO0B 2K8CA 3DHHC 4WAFA 2ASQA 2TSSA 2J0MA 3U7DA 1VZ7A 1A5RA 5CHFA 3TEWA 3SHQA 1HEZE 2FBWB 3U8ZA 2GBNA 3UINB 1S3SG 1NVID 3H7SA 4B0MA 3ONSA 2L83A 2L8JA 1KRHA 2YEPF 4DDGD 3HM3A 3FC4A 3EFCA 2JYEA 4YT0B 2K3UA 4M0WB 2O6VA 4NQLB 1CJEA 2RR9A 3PSEB 2I1JA 4WJOA 1FXTB 2JQRB 2LWPA 2LI5A 2CHZA 5IOIA 3RZWC 1WX8A 1KJTA 4KKJA 3L54A 4MH8A 3C0RB 4B0EA 1MHHE 2BYVE 3TEZA 2IY1B 2KNBA 2BTEA 2FCNA 4PYUA 2IPKD 3AEFB 4HROA 1GUAB 3JW0X 1MI0A 2V4IB 4R3DA 4LNOA 3ZW3A 2LUEA 3K9PB 2MWSB 2O2VB 2I38A 1EUVB 3OWEB 2KXJA 3AEBB 4JQWC 3MFGA 3PVLA 4LDTB 1C4AA 4MGKE 1UUPA 1PGXA 2ZVOA 3R66C 1I4XA 2INPE 3SU8X 3DBRI 1T0YA 3N1YC 2REXA 1P3QU 3RT3B 1A70A 1I4QA 1WIAA 2RMMA 2N7DA 3PT2B 1JROA 4FJVB 3LJ3A 3N3KB 3MJ5A 2GRIA 5J17A 4F1SA 3NUHB 2N4FA 4K3CA 5IAAC 3ZKJC 1WM3A 3ZJTA 1B9RA 3RUIB 4TV3A 4ZRPA 2WHIA 5IN7A 5EE0A 2C9WB 1TJEA 1I7HA 2WP9B 4HEA1 2V9HA 3TCAA 3P63A 1KF6B 1YNTE 4GDKB 1XD3B 3DOWA 1C79A 3A33B 2W54A 2NTSA 2LMCA 1L6UA 2BB6A 3D32A 2LVOA 2ZW0A 2CJNA 2ZVNA 3P4PB 1S1QB 5TR5A 3A9JB 5JXVA 1PQSA 3GB1A 2D3CA 4ZHPA 4NJ7A 1QOGA 1VDVA 1J8CA 3Q8BA 2XNAC 3KVFB 2BYFA 4PYZA 4W9DA 3GZNB 3HRDD 1I4RA 3PHWB 2C60A 3HVZA 2C5LC 4JPSA 4K7UA 3QAQA 4TQ0A 3PZ8A 4KGSA 3V6EB 5FR6A 2WNMA 1KOTA 2AWTA 2INCC 5C1ZA 3AE1B 2KO3A 3NRZA 4TQ1A 2RPVA 4LNNA 3DBSA 1OTRB 4JWSC 4JE3B 3NVZA 2I2YA 1YOVB 3RNCC 2L32A 2DLBA 3I3TB 2KANA 1UF0A 4LK0M 3DBHB 4B95A 3PS6A 1ZGUB 5D3IB 1I42A 2AQ3B 2EMSA 3MTNB 3ECIA 3WAOA 3VAWA 2G45B 3MC8A 1FO4A 3AEEB 4GDLB 2QIEB 3RNEC 4FADA 5G5HA 5I4DA 1YQ3B 2JU6X 4REZA 4FJYA 3QK0A 2DYOA 3AE2B 5BYRA 1WH3A 1XLOA 5FR3A 1ET9A 2J42A 2WDQB 1XXGA 4IC7B 1P0RA 2BS2B 3H8HA 4W9HA 2BF8B 1BMLC 1Z5SB 4IM3A 2KDMA 3ABVB 5DPTA 1E7UA 3OJ4B 3SR6A 2MSED 2DAJA 1WI0A 2G9HD 1TYGB 1UH6A 4KZ0A 4L1BA 2WXFA 4L2YA 2KQ4X 2A4ZA 4XC2A 1SE9A 1WMHA 3HIZA 4MM3A 4ICUA 2DZMA 3ZLZA 3Q8FA 3M63B 1V1OA 1TKYA 1EU3A 1R7SA 1BXTA 1D5ZC 1WE7A 3Q3FA 2ZJDA 5D7GA 1KFYB 3ALBA 5TSSA 1QKZA 1IP9A 2XEWA 4K81A 1WXAA 4IM2A 2MBHA 1EWYC 1VCBA 2PW9A 3LB8C 1GC7A 2KWCA 4EUTA 5L95C 3AU4A 3BK1A 3U7ZA 4CQNA 1FPYA 2LGSA 1SF0A 1P1AA 3EHVA 2KDEB 1WWTA 2KKCA 2WXOA 1ESFA 3P4QB 1U4AA 4K3BA 3VTWA 1GOZA 4DK5A 2BWES 4OZBA 3L10B 1MHXA 2GBJA 1JW9D 3V60A 1Q5WB 2IYDB 4ZDVA 4DHJB 5HG2A 3IG3A 3Q3NC 3W1SC 4W9GA 1WYGA 3VUXA 1T3QA 3LYYA 3FILB 3IBEA 3DWMA 1WXMA 1AW7A 2H89B 5J18A 1TS4A 3Q8CA 4KSLC 1V2YA 2QILA 1V8CA 2K25A 4W9LA 4XZ4A 1RM6C 2DYBA 4MM3B 4O1NA 5DPRA 4TKNA 2RDBC 1V81A 5LLIA 4NPNA 1P7EA 3UQBA 1RWSA 2LUMA 2X8XX 2K39A 2JX5A 4WWMA 4G50A 3AE5B 2KK8A 3W5UB 3RNBC 2LZ6A 1VJKA 4EZJA 2L3ZA 4GXBA 4KIKA 3A9KB 1QQRA 4MEMA 1YN5A 3M62B 1TY2A 2E3TA 3L08A 4S17A 5JH5C 3QJZA 2WXIA 1N61A 3QCAA 2CKHB 5IKCM 1L4DB 1ZKHA 3NS1A 2W9NA 4KV2A 4LLGM 2KLCA 3AXCA 2BKRB 4RGTA 2KJHB 5IO9A 2MEKA 4OVVA 1TY0A 3VUYA 1ZDXA 3QX1A 1UGMA 4QAYA 2JSVX 3AU5A 4JLCA 4AS1A 2G3QB 1K50A 1ZXHA 1T0QC 2UWQA 2DZIA 1WE6A 4JWUC 2FIFA 2LASA 3BWUD 4FHKA 4XDCA 2MP2A 3MHSD 2FE8A 2CU1A 3ZNID 1WJNA 1OQYA 3U52E 2ONQA 1AWDA 1E8XA 2ZEQA 3N1XC 1HQRD 3H1UA 2KLGA 5EE1A 5AZGA 1GJZA 3ZNHB 2C7MB 1MG8A 3AEDB 4AP4C 3AV8A 4F7ZA 5FKAC 1T5XD 4MSMB 3DVNV 1AYFA 3A9JA 4G11A 1R4NI 3DBRB 1GNUA 5C3JB 1WXSA 4EFOA 5CTRC 4C80A 1M94A 1QZEA 3TL5A 2L1AA 1YX6B 4XDDA 3NHEB 3ZJVA 4DXGA 5CHWA 1SXTA 3BZDB 2LGDA 2DHZA 4HCPB 3Q3JA 4MGIE 1C9FA 2J0JA 4II3B 1YN3A 2L76A 1J7CA 4GOCA 2OJWA 4BBNC 1H4RA 3AH7A 5G5GA 4RFBA 3U2SC 2NPTB 4I6PA 2WQYB 2V3SA 3PZ7A 4AWJA 2PIAA 2IY0B 2CJOA 4NAWB 2CR5A 1XCTL 1TS2A 1SBBB 2HTHA 4MJSB 4BKTA 3TIXA 1L5PA 1WR6E 1LO5D 2K8HA 4EEWA 4DQOC 4AJWA 1QILA 1JWMD 2G4DB 2MP2B 4HXDA 1ZUD2 4EE2A 2K9XA 5JHBA 4US9A 2WXMA 3N9YC 2LXAA 2QMTA 5BO4B 1TIFA 2ON8A 3QA8A 1WM2A 2EMTA 1NBFC 1SE4A 3WA0A 3VDZA 2Z0DB 2W3SA 2J0KA 4MSQB 4FN2A 2FUG1 1FIQA 3GZNI 3L4PA 3PRPB 1CK1A 2KMMA 1VD2A 4E74A 1SSNA 2Q5WD 4ZRKA 4FJZA 2KACA 1N60A 1TZ1A 3APDA 3C19A 3URYA 4RMAA 4ACFA 3BIID 4CO7A 2GI9A 2FCQA 1ISNA 3PLVA 1L0VB 1X1MA 5KHOA 5BMHA 1D5XC 2MX2A 2Y5CA 1H8CA 3JYUA 2AYOB 1YJIA 4IW0A 1RFKA 2NR2A 1UGJA 4AOFA 4KVGB 1KM7A 3ZQ4A 4M0WA 2LEKA 1NENB 1E5WA 1FFVA 3AE9B 3AMZA 1WSPA 2D3AA 5E6JA 3RNFC 3WANA 5BMGA 2JPHA 3KH0A 4OZCA 2O6VD 2Z0EB 1V97A 3E56A 4B6WA 3AEGB 4WWPA 3P4RB 1UZXB 3BK2A 4NZLB 1C4PA 3AM9A 1E8WA 3DVNU 2KVZA 2N9LA 2JRHA 2J53A 2ZNVB 1MFWA 1IBXA 2JVCA 4YSZB 4RF1A 5IA7A 4KX6B 4YSXB 3N32A 5DPSA 1B1ZA 4USAA 2D2QA 3IHPC 1TBEA 4FXCA 4ZRJA 1UBQA 3RMKC 4A20A 2KX3A 1N62A 2QDFA 2BPSA 2Z59B 4DXAB 2M0XA 1P7FA 4BBNF 4URKA 2B76B 1ENFA 3EECA 1PYWD 3B08A 1I35A 4WAAA 2KTFA 2FCSA 4BKGA 5CX3A 2AL6A 1GC6A 2DZJA 4LNFA 3RYTA 1I4GA 3H7PB 3A4SC 1SEBD 3PO0A 2GB1A 3E9SA 2DYMA 1PDXA 4ZHOA 4RM8A 1SIFA 1GG3A 4DXFA 3NZ3A 1V9JA 1FNWA 3VFKA 2G1EA 4KDIC 2L52A 1WGGA 2Y5BB 1FRDA 1SJED 3O13A 3VUWA 4EZLA 4C00A 4ANVA 3GE8C 3K9OB 1EO6A 2LD9A 4N59A 3S2AA 1XF5L 3DPDA 4MDKE 1FCLA 4A9AA 3L16A 1F52A 2KAJA 4A8XC 1F1HA 3Q8EA 1HE8A 3VRAB 1JWUD 3N30A 3KYCD 5HKHA 1QOFA 2KFJA 2WXPA 2UYZB 4W9IA 4JIOU 4RM9A 3BVGA 3Q69A 3A4RA 3H7PA 3QQ8B 4MT5A 4KZCA 2OEDA 3SDLC 1FCCC 4DHZB 1UWXA 1I4PA 4PS8A 1NI3A 1FD6A 2KT7A 4PS3A 3R7QA 2EELA 1XLNA 1KLGD 3AB5A 3MJWA 4J3OD 4GIVA 2KX0A 1LFDA 1WGKA 4KDLB 2A5UA 4NJ6A 2IZVB 2KQ7A 3DBLB 5BYSA 3EA6A 3PV1A 3Q8AA 4ZOHC 2FIDA 2DNFA 4IUMB 1CMXB 2PE9A 3M95A 2MBQA 3ZRFA 3ZXVA 1F9JA 3TMPB 2INDC 3HK0A 1DOYA 4RGOS 4G0NB 2WS3B 2BQQA 4I6LB 4ZRIA 1D6EC 4TUUA 2KWUB 2WXHA 5BMIA 2B3AA 5JHAA 1VZ6A 2W55A 2X38A 2YLMA 3AECB 1DOXA 2RPQA 3FKYA 1RLFA 2M0AA 4GU2A 2NVUI 2YVCA 3AE7B 4BKSA 3CSFA 4RCOA 2AQ2B 2W82A 1VZ8A 4WJPA 1OEYJ 1ZPSA 2W3RA 4F8CB 1D4BA 1IBXB 2DAFA 2E6XA 2JWUA 2V0GA 4RH6A 4TMAB 2D3GA 2IO1B 2PVGC 3OAWA 5IP4D 4LNKA 4CYEA 1KLVA 4YL8A 4C7ZA 2CHWA 3B9JA 1ZXIA 1WRIA 2VZKB 1NI2A 4BKSD 4HDOA 2AQ1B 2ZNVC 1SE2A 1N5XA 2N9EB 3DHIC 3SFDB 3W9CB 5GXGB 1DOIA 3NOBA 5EE9A 5EDSA 3Q3OC 3Q2AC 3P1MA 1C3TA 3QWZB 3RZFA 2INNE 5T8IA 3ZIMA 2SEBD 4S0RA 5JZEB 3MP9A 5H8YE 2OHFA 3UIPB 4HJGE 1V5TA 1K52A 4NNJB 2CU3A 4RNAA 1TS3A 1XEEA 1E8YA 5J2RA 4M00A 3BYTB 2AX5A 1WXVA 1MVKA 1XQQA 1KLUD 1QOAA 4OVUA 2KQSA 4FULA 3EUB2 1UWMA 1NYQA 3HVDA 4XGAB 1WJ6A 2LGXA 5FK9C 3AN1A 5GMVA 1D5MC 2HDEA 4ITKA 3NVVA 3ETRA 3GS2A 1E7VA 2GBKA 3P42A 2D3BA 1UBIA 2WLBA 5EE3A 4YXDB 2WXQA 5MPOA 2O6VB 4HPMB 2H88B 4KGRA 3N1ZC 4AUQC 1WZ3A 2CS4A 2LVQA 3W5VB 1QLBB 1JALA 4RGMA 4BOSC 5E6PA 2DX5B 2N7JA 1SB3C 2BYEA 1TKEA 4DDID 4GLSC 1N6ZA 3KLSX 3ZUNA 3R7RA 3TSSA 4P6VF 4MGZE 4NAWA 4H2AA 2V3NA 2JZPA 2FAZA 4LNIA 2LJ5A 1JQ4A 4NQKE 2N9XA 4M02A 3DHGC 1MJDA 4GGQA 2PEAA 4C56C 4IKGA 4MJSA 1YQBA 1RRBA 3FAHA 5D6JB 4P1BC 2FNJB 3OLMD 4YSYB 2KHWB 4JX1C 2ZPYA 2IGHA 2VH1A 3APFA 4HKZE 5H92C 1F2RI 3DDCB 1V6EA 4IG7B 3B2FA 2J4XA 3I63C 2KVRA 2DZKA 1JWSD 1HZ6A 1JRUA 4A90A 3VH4B 3AULA 1J19A 5D2MB 3IT6B 3NS8A 1QT9A 2MW5A 1L0YB 4GMVA 2J7QB 2WU2B 2GOWA 2LFIA 4BVUC 2KTRB 2WWZA 1C77A 3FILA 2IO3B 4IM0A 1I4HA 4XWTA 2SAKA 2WXLA 1E7PB 3KUDB 4EOYA 4ZYSA 3ZDTA 1WGRA 3R2IA 3PZDA 1Z2MA 5HI1A 1C78A 1V1PB 2L0TA 1IGDA 2L00B 2MJDA 2MBOA 2ICIA 4ANXA 3H6NA 3V6CB 3GOEA 2HD5B 4K7WA 1FXAA 3VTUA 4D2KA 3IAM1 1WJ4A 4W9CA 2NS5A 2R2QA 4GDLA 2ACZB 2PPHA 4OHJA 2MBBB 3R3MA 2M56B 2WX1A 1EM7A 2DWQA 2I1KA 3T9LA 2N9KA 1FNVA 3KW5B 3DVGY 2C7NB 1T0RC 3CMMB 1IPGA 4ARIA 3PTFC 4HRSA 3TUOA 4C4VB 1ZE3D 1UELA 5AEKB 1V1PA 3A9KA 2NTTA 4IWOA 2XK5B 1ZW7A 2XBBC 2MRPA 1JCKB 1WXQA 4B9KA 2KTRA 3CSTA 2KC1A 4MACA 3PGEA 1C1YB 2K0PA 2BYTA 3H9DA 3RULA 3VRBB 3LXFA 4ARCA 3SEBA 4P1CC 1LGRA 1GAQB 2D10A 4KIKB 4ASWC 4US8A 3NZUA 3GP7A 1WY8A 3PREA 2KZRA 4HLEA 1R4MI 2XN9C 1FFUA 1AN8A 1OEYA 2WXRA 2KYWA 3RD2A 4OW0A 1V86A 3DBLI 2RD0A 1SJHD 2GMIC 1GB4A 4G3XB 1D3ZA 1IUEA 3U4EG 2LRUA 2KD0A 1R4MB 3WAPA 2N1WA 2CHXA 4FA6A 1P98A 3IT4B 3PRZA 4GDKA 3I57A 4LCDE 4DBGA 1HZ5A 3PRMB 1F2RC 4NY0A 4X57B 3A1QA 3OJ3A 3U30A 3V3XA 3T8MA 2MH7A 1OFFA 4M8MA 1E90A 4JGHB 2JYTA 4W9EA 1MG4A 1E8ZA 4XE0A 2LJIA 4AQ7A 2PVOD 2IBIB 1AARA 2IGDA 2KOXA 3WCQA 4JL9A 2KMCA 5LXHA 1FEHA 2PJHA 5LXIB 3JSVB 3DBHI 3I9V1 2QSDA 3NJTA 3PLUA 5LNK1 2KJRA 4NAMA 3R2TA 1IGCA 1P9DU 1SGHA 3SD5A 4ANWA 1R4NB 1EU4A 5BYQA 2LHEA 3QIJA 1FXIA 3KWVA 2AEHA 2VZKD 4MGYE 1NDDA 3P2BA 4L23A 1T0SC 3QHTA 1K53A 1WMHB 3APCA 2LXCA 3DWGC 3L17A 2O2VA 2ZW1A 3L0WB 3X23A 5C23A 3VH3B 2BGFA 3PPAA 2MJ3A 3ZTCA 1PFDA 4WWOA 4LJPB 1Y8RC 2KN4A 2FCMA 3VXWA 3WIMA 4WQOB 2KFKB 1EWCA 1XO3A 1N5WA 1J0GA 2MLBA 5E6OA 2QCZA 3NVWA
chains in the Genus database with same CATH topology
1T0RC 3DHIC 3RNFC 3RNGC 4P1BC 3RNCC 3I63C 1T0QC 3RNBC 3Q3OC 3N20C 3DHHC 3Q2AC 3RI7C 4P1CC 3I5JC 3Q14C 3RN9C 3GE3C 3DHGC 3RNAC 3N1ZC 2INCC 3Q3MC 3RMKC 1T0SC 3Q3NC 3RNEC 2INDC 2RDBC 3N1XC 3GE8C 3N1YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0R C;  3DHI C;  3RNF C;  3RNG C;  4P1B C;  3RNC C;  3I63 C;  1T0Q C;  3RNB C;  3Q3O C;  3N20 C;  3DHH C;  3Q2A C;  3RI7 C;  4P1C C;  3I5J C;  3Q14 C;  3RN9 C;  3GE3 C;  3DHG C;  3RNA C;  3N1Z C;  2INC C;  3Q3M C;  3RMK C;  1T0S C;  3Q3N C;  3RNE C;  2IND C;  2RDB C;  3N1X C;  3GE8 C;  3N1Y C; 
#chains in the Genus database with same CATH topology
 4M8N A;  1RFA A;  1Y56 A;  4DHJ D;  4PT5 A;  1WJU A;  2HJ8 A;  2V1Y A;  2HE7 A;  2JZZ A;  4TSS A;  3T3O A;  2RDH A;  3GE3 C;  5KHQ A;  3DQV A;  3CWI A;  2KWD A;  1T6B X;  1WRD B;  2WDT B;  2BWF A;  1OQQ A;  1UNS A;  4IWP A;  4C4V A;  3QC8 B;  3AE6 B;  1ET6 A;  1NEK B;  2ZCC A;  4BZA A;  2MA9 B;  2JXT A;  2M4N A;  1HXY D;  2WDR B;  4EZK A;  1C76 A;  2J52 A;  3CF6 E;  1XLQ A;  3OG5 A;  1YJJ A;  1WFY A;  4OZA A;  4YTN B;  2AL3 A;  3MC9 A;  1TS5 A;  1E6E B;  3BVZ A;  5AZF A;  4RGN A;  1WGY A;  4W9K A;  4K7S A;  5L83 A;  3HUI A;  1TT5 B;  3A1Q B;  1V49 A;  2RSU A;  3RN9 C;  1HTO A;  1FMA D;  1KH0 A;  2K5P A;  5E6N A;  5G2N A;  1EF1 A;  1ZP0 B;  2PE6 B;  4IWQ A;  5D3D A;  1PGA A;  3JVZ X;  3RPF C;  5DPW A;  2JY6 A;  4II2 B;  2G4S A;  2M8S A;  1YD8 U;  5HFY A;  2L7R A;  2QHO A;  2JZ3 B;  1PGB A;  1FNU A;  3AEA B;  3ZRC A;  3VR8 B;  3Q6B A;  2N9P C;  3L13 A;  1QOB A;  4WIP A;  4YTP B;  2JT4 B;  1OGW A;  1BUI C;  4W9J A;  4IDI A;  3V05 A;  4WUR A;  3TEX A;  1F0Z A;  1HA5 A;  4FLH A;  3JSV A;  2XK5 A;  3KQ4 A;  3PHX B;  3UQA A;  2LGI A;  4KSK C;  3ZJU A;  2GLS A;  2HJ1 A;  4A6Q A;  2WDV B;  2WXK A;  3C8Y A;  1Q0W B;  3J9C A;  3M3J A;  2VRR B;  1YN4 A;  2MQJ A;  3IXS A;  1F77 A;  3NG0 A;  1L2N A;  2QC8 A;  3DVG X;  4PS7 A;  1L7Y A;  4DWF A;  1VLB A;  1YJ1 A;  4HCN B;  2R2O A;  3TEY A;  2LRW A;  4IOI E;  1K8R B;  2QJL A;  3V61 A;  4ANU A;  4E71 A;  1ZDV A;  1L6V A;  4M01 A;  1V80 A;  4A3P A;  4RF0 A;  3WAM A;  1K51 A;  4N6E B;  4DHZ E;  3VHT C;  5C2T B;  3ZTD A;  3BVM A;  4BFR A;  2PLP A;  3BY4 B;  2L0F A;  1TKG A;  1DGJ A;  2LHD A;  1YQ4 B;  4AJY B;  2M19 A;  2PKO A;  2D5G A;  3DCG A;  1JWA D;  1E10 A;  4HPP A;  2BW2 A;  2D11 A;  3ZYY X;  4GB9 A;  2EKE C;  4ZYN A;  3QAR A;  2PMV A;  1STE A;  2R61 A;  1N63 A;  3W2D A;  2C7H A;  2Y3A A;  1NYR A;  1FRR A;  4HWI B;  2LGY A;  3T3N A;  2WXJ A;  2WXN A;  3ML9 A;  5AUI A;  4ICV A;  3KUC B;  3B2G A;  2BT6 A;  3ML8 A;  1J7B A;  4WWN A;  1IYF A;  3RNA C;  4GN1 A;  1FM0 D;  1L0X B;  2K8B A;  4WJN A;  3RFZ B;  3EGR A;  1Q10 A;  2IGG A;  3ZO5 B;  3UF8 A;  4LTU A;  2MJE A;  1TGZ B;  3IAS 1;  3KYD D;  4KKI A;  2KDF B;  2WGS A;  2LVP A;  3ZDM C;  2RDG A;  2N1V A;  4LDT D;  1YMH E;  4P16 A;  3UI3 A;  1OQR A;  1WX7 A;  3ZNG C;  5D94 A;  2KWV B;  4FBJ B;  2BB5 A;  2KC2 A;  3ZNZ B;  4ZRQ A;  3MC0 B;  4YWG G;  3SFE B;  2PTL A;  3IVF A;  4WJQ A;  5AUK A;  2OJR A;  2KDI A;  4E3C A;  5G55 A;  4MEL A;  3ZGZ A;  4YTM B;  1TTN A;  2K1F A;  4EKU A;  1SIJ A;  4HDQ A;  5AZH A;  2BS4 B;  2IO2 B;  3Q3M C;  2KMA A;  1WGD A;  1TZO A;  3R8B A;  3ZVV A;  1JRP A;  4XWW A;  1QF6 A;  2L05 A;  1LQB A;  2OOB B;  3W1S A;  3NVY A;  4KGT A;  2GBR A;  3EC8 A;  4WQM A;  4OVZ A;  3VTV A;  3KWL A;  1LM8 B;  4Q2J A;  4J6I A;  3V62 A;  1JML A;  4N58 A;  2KJ6 A;  3TJP A;  2YEP B;  3UGB B;  3MHZ A;  2WXG A;  4N9F 4;  1XLP A;  4HJK A;  2DBY A;  2V3P A;  4XX5 A;  1CQV A;  2ZZP B;  1LXD A;  2N7E A;  2HTM E;  4P7I A;  3B1L X;  4MH0 E;  3ENE A;  2RGF A;  4BOZ B;  1XCQ L;  2Z8L A;  2QEJ C;  2ZPN A;  3NY5 A;  4A55 A;  2NBV B;  5CHV C;  2BS3 B;  2ZCB A;  1XT9 B;  1WZ0 A;  4LJO B;  2KN5 A;  4C7Y A;  1CZP A;  3BYY B;  4A3O A;  2KDB A;  4PK1 A;  3KUZ A;  1GPX A;  2GBM A;  1GB1 A;  4FHJ A;  3N20 C;  3RI7 C;  3AE4 B;  3HHM A;  1G6J A;  3AE3 B;  1EF5 A;  4UDU C;  1M4V A;  1DYQ A;  1Q1O A;  1C4C A;  3VQI A;  4NJC A;  1HTQ A;  2JUO A;  2NBW B;  2N0S B;  1KTK A;  3X0W A;  2WX0 A;  2MHJ A;  2K22 A;  2NBU A;  4I6N B;  3RCZ A;  5DCN A;  1BT0 A;  1WYW B;  4XYC A;  1WR1 A;  2KFK A;  1ZOY B;  2WU5 B;  2NPT A;  1RYJ A;  1UD7 A;  3P4S B;  4W9F A;  4GSW A;  2M1M A;  1L4Z B;  2JXX A;  4HVB A;  3VVW B;  4HPL B;  3O65 B;  3B0A A;  4K1R B;  1RAX A;  3WAL A;  1E0Z A;  3BIN A;  4CHK A;  2IDY A;  2M17 A;  4HKQ A;  1YX5 B;  3HM6 X;  2MBE A;  4WH4 A;  1E9M A;  2JF5 A;  3TBL D;  2VH2 A;  3IFW B;  2K6D B;  2Y5P A;  1VRA B;  3W1Y A;  3AI5 A;  2NMQ A;  1V5O A;  2BVC A;  4HK2 A;  3NZS A;  2BKF A;  3UIO B;  2V4L A;  2BBC A;  2K6Q A;  1YIW A;  1ROE A;  3I5J C;  2WYQ A;  3Q14 C;  1WF9 A;  2NCN A;  3ZXR A;  1J7A A;  1ACC A;  5HHD G;  2FUH B;  2EKI A;  1MPE A;  1SE3 A;  3AE8 B;  2UU7 A;  3CIR B;  2IJ0 A;  3EFU A;  4BAX A;  1PUT A;  1JWB D;  3RNG C;  1WX9 A;  1WGH A;  2DEN B;  3VR9 B;  2JRI B;  3LDZ E;  2MCN B;  2D07 B;  1VR9 A;  2JWZ A;  2IO0 B;  2K8C A;  3DHH C;  4WAF A;  2ASQ A;  2TSS A;  2J0M A;  3U7D A;  1VZ7 A;  1A5R A;  5CHF A;  3TEW A;  3SHQ A;  1HEZ E;  2FBW B;  3U8Z A;  2GBN A;  3UIN B;  1S3S G;  1NVI D;  3H7S A;  4B0M A;  3ONS A;  2L83 A;  2L8J A;  1KRH A;  2YEP F;  4DDG D;  3HM3 A;  3FC4 A;  3EFC A;  2JYE A;  4YT0 B;  2K3U A;  4M0W B;  2O6V A;  4NQL B;  1CJE A;  2RR9 A;  3PSE B;  2I1J A;  4WJO A;  1FXT B;  2JQR B;  2LWP A;  2LI5 A;  2CHZ A;  5IOI A;  3RZW C;  1WX8 A;  1KJT A;  4KKJ A;  3L54 A;  4MH8 A;  3C0R B;  4B0E A;  1MHH E;  2BYV E;  3TEZ A;  2IY1 B;  2KNB A;  2BTE A;  2FCN A;  4PYU A;  2IPK D;  3AEF B;  4HRO A;  1GUA B;  3JW0 X;  1MI0 A;  2V4I B;  4R3D A;  4LNO A;  3ZW3 A;  2LUE A;  3K9P B;  2MWS B;  2O2V B;  2I38 A;  1EUV B;  3OWE B;  2KXJ A;  3AEB B;  4JQW C;  3MFG A;  3PVL A;  4LDT B;  1C4A A;  4MGK E;  1UUP A;  1PGX A;  2ZVO A;  3R66 C;  1I4X A;  2INP E;  3SU8 X;  3DBR I;  1T0Y A;  3N1Y C;  2REX A;  1P3Q U;  3RT3 B;  1A70 A;  1I4Q A;  1WIA A;  2RMM A;  2N7D A;  3PT2 B;  1JRO A;  4FJV B;  3LJ3 A;  3N3K B;  3MJ5 A;  2GRI A;  5J17 A;  4F1S A;  3NUH B;  2N4F A;  4K3C A;  5IAA C;  3ZKJ C;  1WM3 A;  3ZJT A;  1B9R A;  3RUI B;  4TV3 A;  4ZRP A;  2WHI A;  5IN7 A;  5EE0 A;  2C9W B;  1TJE A;  1I7H A;  2WP9 B;  4HEA 1;  2V9H A;  3TCA A;  3P63 A;  1KF6 B;  1YNT E;  4GDK B;  1XD3 B;  3DOW A;  1C79 A;  3A33 B;  2W54 A;  2NTS A;  2LMC A;  1L6U A;  2BB6 A;  3D32 A;  2LVO A;  2ZW0 A;  2CJN A;  2ZVN A;  3P4P B;  1S1Q B;  5TR5 A;  3A9J B;  5JXV A;  1PQS A;  3GB1 A;  2D3C A;  4ZHP A;  4NJ7 A;  1QOG A;  1VDV A;  1J8C A;  3Q8B A;  2XNA C;  3KVF B;  2BYF A;  4PYZ A;  4W9D A;  3GZN B;  3HRD D;  1I4R A;  3PHW B;  2C60 A;  3HVZ A;  2C5L C;  4JPS A;  4K7U A;  3QAQ A;  4TQ0 A;  3PZ8 A;  4KGS A;  3V6E B;  5FR6 A;  2WNM A;  1KOT A;  2AWT A;  2INC C;  5C1Z A;  3AE1 B;  2KO3 A;  3NRZ A;  4TQ1 A;  2RPV A;  4LNN A;  3DBS A;  1OTR B;  4JWS C;  4JE3 B;  3NVZ A;  2I2Y A;  1YOV B;  3RNC C;  2L32 A;  2DLB A;  3I3T B;  2KAN A;  1UF0 A;  4LK0 M;  3DBH B;  4B95 A;  3PS6 A;  1ZGU B;  5D3I B;  1I42 A;  2AQ3 B;  2EMS A;  3MTN B;  3ECI A;  3WAO A;  3VAW A;  2G45 B;  3MC8 A;  1FO4 A;  3AEE B;  4GDL B;  2QIE B;  3RNE C;  4FAD A;  5G5H A;  5I4D A;  1YQ3 B;  2JU6 X;  4REZ A;  4FJY A;  3QK0 A;  2DYO A;  3AE2 B;  5BYR A;  1WH3 A;  1XLO A;  5FR3 A;  1ET9 A;  2J42 A;  2WDQ B;  1XXG A;  4IC7 B;  1P0R A;  2BS2 B;  3H8H A;  4W9H A;  2BF8 B;  1BML C;  1Z5S B;  4IM3 A;  2KDM A;  3ABV B;  5DPT A;  1E7U A;  3OJ4 B;  3SR6 A;  2MSE D;  2DAJ A;  1WI0 A;  2G9H D;  1TYG B;  1UH6 A;  4KZ0 A;  4L1B A;  2WXF A;  4L2Y A;  2KQ4 X;  2A4Z A;  4XC2 A;  1SE9 A;  1WMH A;  3HIZ A;  4MM3 A;  4ICU A;  2DZM A;  3ZLZ A;  3Q8F A;  3M63 B;  1V1O A;  1TKY A;  1EU3 A;  1R7S A;  1BXT A;  1D5Z C;  1WE7 A;  3Q3F A;  2ZJD A;  5D7G A;  1KFY B;  3ALB A;  5TSS A;  1QKZ A;  1IP9 A;  2XEW A;  4K81 A;  1WXA A;  4IM2 A;  2MBH A;  1EWY C;  1VCB A;  2PW9 A;  3LB8 C;  1GC7 A;  2KWC A;  4EUT A;  5L95 C;  3AU4 A;  3BK1 A;  3U7Z A;  4CQN A;  1FPY A;  2LGS A;  1SF0 A;  1P1A A;  3EHV A;  2KDE B;  1WWT A;  2KKC A;  2WXO A;  1ESF A;  3P4Q B;  1U4A A;  4K3B A;  3VTW A;  1GOZ A;  4DK5 A;  2BWE S;  4OZB A;  3L10 B;  1MHX A;  2GBJ A;  1JW9 D;  3V60 A;  1Q5W B;  2IYD B;  4ZDV A;  4DHJ B;  5HG2 A;  3IG3 A;  3Q3N C;  3W1S C;  4W9G A;  1WYG A;  3VUX A;  1T3Q A;  3LYY A;  3FIL B;  3IBE A;  3DWM A;  1WXM A;  1AW7 A;  2H89 B;  5J18 A;  1TS4 A;  3Q8C A;  4KSL C;  1V2Y A;  2QIL A;  1V8C A;  2K25 A;  4W9L A;  4XZ4 A;  1RM6 C;  2DYB A;  4MM3 B;  4O1N A;  5DPR A;  4TKN A;  2RDB C;  1V81 A;  5LLI A;  4NPN A;  1P7E A;  3UQB A;  1RWS A;  2LUM A;  2X8X X;  2K39 A;  2JX5 A;  4WWM A;  4G50 A;  3AE5 B;  2KK8 A;  3W5U B;  3RNB C;  2LZ6 A;  1VJK A;  4EZJ A;  2L3Z A;  4GXB A;  4KIK A;  3A9K B;  1QQR A;  4MEM A;  1YN5 A;  3M62 B;  1TY2 A;  2E3T A;  3L08 A;  4S17 A;  5JH5 C;  3QJZ A;  2WXI A;  1N61 A;  3QCA A;  2CKH B;  5IKC M;  1L4D B;  1ZKH A;  3NS1 A;  2W9N A;  4KV2 A;  4LLG M;  2KLC A;  3AXC A;  2BKR B;  4RGT A;  2KJH B;  5IO9 A;  2MEK A;  4OVV A;  1TY0 A;  3VUY A;  1ZDX A;  3QX1 A;  1UGM A;  4QAY A;  2JSV X;  3AU5 A;  4JLC A;  4AS1 A;  2G3Q B;  1K50 A;  1ZXH A;  1T0Q C;  2UWQ A;  2DZI A;  1WE6 A;  4JWU C;  2FIF A;  2LAS A;  3BWU D;  4FHK A;  4XDC A;  2MP2 A;  3MHS D;  2FE8 A;  2CU1 A;  3ZNI D;  1WJN A;  1OQY A;  3U52 E;  2ONQ A;  1AWD A;  1E8X A;  2ZEQ A;  3N1X C;  1HQR D;  3H1U A;  2KLG A;  5EE1 A;  5AZG A;  1GJZ A;  3ZNH B;  2C7M B;  1MG8 A;  3AED B;  4AP4 C;  3AV8 A;  4F7Z A;  5FKA C;  1T5X D;  4MSM B;  3DVN V;  1AYF A;  3A9J A;  4G11 A;  1R4N I;  3DBR B;  1GNU A;  5C3J B;  1WXS A;  4EFO A;  5CTR C;  4C80 A;  1M94 A;  1QZE A;  3TL5 A;  2L1A A;  1YX6 B;  4XDD A;  3NHE B;  3ZJV A;  4DXG A;  5CHW A;  1SXT A;  3BZD B;  2LGD A;  2DHZ A;  4HCP B;  3Q3J A;  4MGI E;  1C9F A;  2J0J A;  4II3 B;  1YN3 A;  2L76 A;  1J7C A;  4GOC A;  2OJW A;  4BBN C;  1H4R A;  3AH7 A;  5G5G A;  4RFB A;  3U2S C;  2NPT B;  4I6P A;  2WQY B;  2V3S A;  3PZ7 A;  4AWJ A;  2PIA A;  2IY0 B;  2CJO A;  4NAW B;  2CR5 A;  1XCT L;  1TS2 A;  1SBB B;  2HTH A;  4MJS B;  4BKT A;  3TIX A;  1L5P A;  1WR6 E;  1LO5 D;  2K8H A;  4EEW A;  4DQO C;  4AJW A;  1QIL A;  1JWM D;  2G4D B;  2MP2 B;  4HXD A;  1ZUD 2;  4EE2 A;  2K9X A;  5JHB A;  4US9 A;  2WXM A;  3N9Y C;  2LXA A;  2QMT A;  5BO4 B;  1TIF A;  2ON8 A;  3QA8 A;  1WM2 A;  2EMT A;  1NBF C;  1SE4 A;  3WA0 A;  3VDZ A;  2Z0D B;  2W3S A;  2J0K A;  4MSQ B;  4FN2 A;  2FUG 1;  1FIQ A;  3GZN I;  3L4P A;  3PRP B;  1CK1 A;  2KMM A;  1VD2 A;  4E74 A;  1SSN A;  2Q5W D;  4ZRK A;  4FJZ A;  2KAC A;  1N60 A;  1TZ1 A;  3APD A;  3C19 A;  3URY A;  4RMA A;  4ACF A;  3BII D;  4CO7 A;  2GI9 A;  2FCQ A;  1ISN A;  3PLV A;  1L0V B;  1X1M A;  5KHO A;  5BMH A;  1D5X C;  2MX2 A;  2Y5C A;  1H8C A;  3JYU A;  2AYO B;  1YJI A;  4IW0 A;  1RFK A;  2NR2 A;  1UGJ A;  4AOF A;  4KVG B;  1KM7 A;  3ZQ4 A;  4M0W A;  2LEK A;  1NEN B;  1E5W A;  1FFV A;  3AE9 B;  3AMZ A;  1WSP A;  2D3A A;  5E6J A;  3RNF C;  3WAN A;  5BMG A;  2JPH A;  3KH0 A;  4OZC A;  2O6V D;  2Z0E B;  1V97 A;  3E56 A;  4B6W A;  3AEG B;  4WWP A;  3P4R B;  1UZX B;  3BK2 A;  4NZL B;  1C4P A;  3AM9 A;  1E8W A;  3DVN U;  2KVZ A;  2N9L A;  2JRH A;  2J53 A;  2ZNV B;  1MFW A;  1IBX A;  2JVC A;  4YSZ B;  4RF1 A;  5IA7 A;  4KX6 B;  4YSX B;  3N32 A;  5DPS A;  1B1Z A;  4USA A;  2D2Q A;  3IHP C;  1TBE A;  4FXC A;  4ZRJ A;  1UBQ A;  3RMK C;  4A20 A;  2KX3 A;  1N62 A;  2QDF A;  2BPS A;  2Z59 B;  4DXA B;  2M0X A;  1P7F A;  4BBN F;  4URK A;  2B76 B;  1ENF A;  3EEC A;  1PYW D;  3B08 A;  1I35 A;  4WAA A;  2KTF A;  2FCS A;  4BKG A;  5CX3 A;  2AL6 A;  1GC6 A;  2DZJ A;  4LNF A;  3RYT A;  1I4G A;  3H7P B;  3A4S C;  1SEB D;  3PO0 A;  2GB1 A;  3E9S A;  2DYM A;  1PDX A;  4ZHO A;  4RM8 A;  1SIF A;  1GG3 A;  4DXF A;  3NZ3 A;  1V9J A;  1FNW A;  3VFK A;  2G1E A;  4KDI C;  2L52 A;  1WGG A;  2Y5B B;  1FRD A;  1SJE D;  3O13 A;  3VUW A;  4EZL A;  4C00 A;  4ANV A;  3GE8 C;  3K9O B;  1EO6 A;  2LD9 A;  4N59 A;  3S2A A;  1XF5 L;  3DPD A;  4MDK E;  1FCL A;  4A9A A;  3L16 A;  1F52 A;  2KAJ A;  4A8X C;  1F1H A;  3Q8E A;  1HE8 A;  3VRA B;  1JWU D;  3N30 A;  3KYC D;  5HKH A;  1QOF A;  2KFJ A;  2WXP A;  2UYZ B;  4W9I A;  4JIO U;  4RM9 A;  3BVG A;  3Q69 A;  3A4R A;  3H7P A;  3QQ8 B;  4MT5 A;  4KZC A;  2OED A;  3SDL C;  1FCC C;  4DHZ B;  1UWX A;  1I4P A;  4PS8 A;  1NI3 A;  1FD6 A;  2KT7 A;  4PS3 A;  3R7Q A;  2EEL A;  1XLN A;  1KLG D;  3AB5 A;  3MJW A;  4J3O D;  4GIV A;  2KX0 A;  1LFD A;  1WGK A;  4KDL B;  2A5U A;  4NJ6 A;  2IZV B;  2KQ7 A;  3DBL B;  5BYS A;  3EA6 A;  3PV1 A;  3Q8A A;  4ZOH C;  2FID A;  2DNF A;  4IUM B;  1CMX B;  2PE9 A;  3M95 A;  2MBQ A;  3ZRF A;  3ZXV A;  1F9J A;  3TMP B;  2IND C;  3HK0 A;  1DOY A;  4RGO S;  4G0N B;  2WS3 B;  2BQQ A;  4I6L B;  4ZRI A;  1D6E C;  4TUU A;  2KWU B;  2WXH A;  5BMI A;  2B3A A;  5JHA A;  1VZ6 A;  2W55 A;  2X38 A;  2YLM A;  3AEC B;  1DOX A;  2RPQ A;  3FKY A;  1RLF A;  2M0A A;  4GU2 A;  2NVU I;  2YVC A;  3AE7 B;  4BKS A;  3CSF A;  4RCO A;  2AQ2 B;  2W82 A;  1VZ8 A;  4WJP A;  1OEY J;  1ZPS A;  2W3R A;  4F8C B;  1D4B A;  1IBX B;  2DAF A;  2E6X A;  2JWU A;  2V0G A;  4RH6 A;  4TMA B;  2D3G A;  2IO1 B;  2PVG C;  3OAW A;  5IP4 D;  4LNK A;  4CYE A;  1KLV A;  4YL8 A;  4C7Z A;  2CHW A;  3B9J A;  1ZXI A;  1WRI A;  2VZK B;  1NI2 A;  4BKS D;  4HDO A;  2AQ1 B;  2ZNV C;  1SE2 A;  1N5X A;  2N9E B;  3DHI C;  3SFD B;  3W9C B;  5GXG B;  1DOI A;  3NOB A;  5EE9 A;  5EDS A;  3Q3O C;  3Q2A C;  3P1M A;  1C3T A;  3QWZ B;  3RZF A;  2INN E;  5T8I A;  3ZIM A;  2SEB D;  4S0R A;  5JZE B;  3MP9 A;  5H8Y E;  2OHF A;  3UIP B;  4HJG E;  1V5T A;  1K52 A;  4NNJ B;  2CU3 A;  4RNA A;  1TS3 A;  1XEE A;  1E8Y A;  5J2R A;  4M00 A;  3BYT B;  2AX5 A;  1WXV A;  1MVK A;  1XQQ A;  1KLU D;  1QOA A;  4OVU A;  2KQS A;  4FUL A;  3EUB 2;  1UWM A;  1NYQ A;  3HVD A;  4XGA B;  1WJ6 A;  2LGX A;  5FK9 C;  3AN1 A;  5GMV A;  1D5M C;  2HDE A;  4ITK A;  3NVV A;  3ETR A;  3GS2 A;  1E7V A;  2GBK A;  3P42 A;  2D3B A;  1UBI A;  2WLB A;  5EE3 A;  4YXD B;  2WXQ A;  5MPO A;  2O6V B;  4HPM B;  2H88 B;  4KGR A;  3N1Z C;  4AUQ C;  1WZ3 A;  2CS4 A;  2LVQ A;  3W5V B;  1QLB B;  1JAL A;  4RGM A;  4BOS C;  5E6P A;  2DX5 B;  2N7J A;  1SB3 C;  2BYE A;  1TKE A;  4DDI D;  4GLS C;  1N6Z A;  3KLS X;  3ZUN A;  3R7R A;  3TSS A;  4P6V F;  4MGZ E;  4NAW A;  4H2A A;  2V3N A;  2JZP A;  2FAZ A;  4LNI A;  2LJ5 A;  1JQ4 A;  4NQK E;  2N9X A;  4M02 A;  3DHG C;  1MJD A;  4GGQ A;  2PEA A;  4C56 C;  4IKG A;  4MJS A;  1YQB A;  1RRB A;  3FAH A;  5D6J B;  4P1B C;  2FNJ B;  3OLM D;  4YSY B;  2KHW B;  4JX1 C;  2ZPY A;  2IGH A;  2VH1 A;  3APF A;  4HKZ E;  5H92 C;  1F2R I;  3DDC B;  1V6E A;  4IG7 B;  3B2F A;  2J4X A;  3I63 C;  2KVR A;  2DZK A;  1JWS D;  1HZ6 A;  1JRU A;  4A90 A;  3VH4 B;  3AUL A;  1J19 A;  5D2M B;  3IT6 B;  3NS8 A;  1QT9 A;  2MW5 A;  1L0Y B;  4GMV A;  2J7Q B;  2WU2 B;  2GOW A;  2LFI A;  4BVU C;  2KTR B;  2WWZ A;  1C77 A;  3FIL A;  2IO3 B;  4IM0 A;  1I4H A;  4XWT A;  2SAK A;  2WXL A;  1E7P B;  3KUD B;  4EOY A;  4ZYS A;  3ZDT A;  1WGR A;  3R2I A;  3PZD A;  1Z2M A;  5HI1 A;  1C78 A;  1V1P B;  2L0T A;  1IGD A;  2L00 B;  2MJD A;  2MBO A;  2ICI A;  4ANX A;  3H6N A;  3V6C B;  3GOE A;  2HD5 B;  4K7W A;  1FXA A;  3VTU A;  4D2K A;  3IAM 1;  1WJ4 A;  4W9C A;  2NS5 A;  2R2Q A;  4GDL A;  2ACZ B;  2PPH A;  4OHJ A;  2MBB B;  3R3M A;  2M56 B;  2WX1 A;  1EM7 A;  2DWQ A;  2I1K A;  3T9L A;  2N9K A;  1FNV A;  3KW5 B;  3DVG Y;  2C7N B;  1T0R C;  3CMM B;  1IPG A;  4ARI A;  3PTF C;  4HRS A;  3TUO A;  4C4V B;  1ZE3 D;  1UEL A;  5AEK B;  1V1P A;  3A9K A;  2NTT A;  4IWO A;  2XK5 B;  1ZW7 A;  2XBB C;  2MRP A;  1JCK B;  1WXQ A;  4B9K A;  2KTR A;  3CST A;  2KC1 A;  4MAC A;  3PGE A;  1C1Y B;  2K0P A;  2BYT A;  3H9D A;  3RUL A;  3VRB B;  3LXF A;  4ARC A;  3SEB A;  4P1C C;  1LGR A;  1GAQ B;  2D10 A;  4KIK B;  4ASW C;  4US8 A;  3NZU A;  3GP7 A;  1WY8 A;  3PRE A;  2KZR A;  4HLE A;  1R4M I;  2XN9 C;  1FFU A;  1AN8 A;  1OEY A;  2WXR A;  2KYW A;  3RD2 A;  4OW0 A;  1V86 A;  3DBL I;  2RD0 A;  1SJH D;  2GMI C;  1GB4 A;  4G3X B;  1D3Z A;  1IUE A;  3U4E G;  2LRU A;  2KD0 A;  1R4M B;  3WAP A;  2N1W A;  2CHX A;  4FA6 A;  1P98 A;  3IT4 B;  3PRZ A;  4GDK A;  3I57 A;  4LCD E;  4DBG A;  1HZ5 A;  3PRM B;  1F2R C;  4NY0 A;  4X57 B;  3A1Q A;  3OJ3 A;  3U30 A;  3V3X A;  3T8M A;  2MH7 A;  1OFF A;  4M8M A;  1E90 A;  4JGH B;  2JYT A;  4W9E A;  1MG4 A;  1E8Z A;  4XE0 A;  2LJI A;  4AQ7 A;  2PVO D;  2IBI B;  1AAR A;  2IGD A;  2KOX A;  3WCQ A;  4JL9 A;  2KMC A;  5LXH A;  1FEH A;  2PJH A;  5LXI B;  3JSV B;  3DBH I;  3I9V 1;  2QSD A;  3NJT A;  3PLU A;  5LNK 1;  2KJR A;  4NAM A;  3R2T A;  1IGC A;  1P9D U;  1SGH A;  3SD5 A;  4ANW A;  1R4N B;  1EU4 A;  5BYQ A;  2LHE A;  3QIJ A;  1FXI A;  3KWV A;  2AEH A;  2VZK D;  4MGY E;  1NDD A;  3P2B A;  4L23 A;  1T0S C;  3QHT A;  1K53 A;  1WMH B;  3APC A;  2LXC A;  3DWG C;  3L17 A;  2O2V A;  2ZW1 A;  3L0W B;  3X23 A;  5C23 A;  3VH3 B;  2BGF A;  3PPA A;  2MJ3 A;  3ZTC A;  1PFD A;  4WWO A;  4LJP B;  1Y8R C;  2KN4 A;  2FCM A;  3VXW A;  3WIM A;  4WQO B;  2KFK B;  1EWC A;  1XO3 A;  1N5W A;  1J0G A;  2MLB A;  5E6O A;  2QCZ A;  3NVW A; 
#chains in the Genus database with same CATH homology
 1T0R C;  3DHI C;  3RNF C;  3RNG C;  4P1B C;  3RNC C;  3I63 C;  1T0Q C;  3RNB C;  3Q3O C;  3N20 C;  3DHH C;  3Q2A C;  3RI7 C;  4P1C C;  3I5J C;  3Q14 C;  3RN9 C;  3GE3 C;  3DHG C;  3RNA C;  3N1Z C;  2INC C;  3Q3M C;  3RMK C;  1T0S C;  3Q3N C;  3RNE C;  2IND C;  2RDB C;  3N1X C;  3GE8 C;  3N1Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...