3Q3NC

Toluene 4 monooxygenase hd complex with p-nitrophenol
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3q3nC00
3DHHC 3N1XC 3GE3C 3RNGC 3Q3MC 1T0SC 3Q3NC 3N1YC 3RNCC 3GE8C 3I5JC 1T0QC 3RNEC 1T0RC 3Q2AC 3Q14C 2RDBC 3RMKC 4P1BC 3RNAC 3N1ZC 3Q3OC 3N20C 3RNFC 3DHIC 2INDC 3RNBC 3DHGC 3RN9C 4P1CC 2INCC 3RI7C 3I63C
chains in the Genus database with same CATH superfamily
2J52A 2A4ZA 1WF9A 5LLIA 3X23A 2MX2A 5IOIA 2K22A 5L95C 4B9KA 2OOBB 1T0YA 4WJPA 4ARIA 3Q8EA 3MP9A 1N6ZA 5EE9A 1U4AA 2L8JA 4FHKA 5J17A 2DYBA 3CMMB 4GMVA 2INDC 4W9HA 3PRZA 3ZUNA 4US9A 4R3DA 3IT6B 4IKGA 2L0FA 1DYQA 3KWLA 3AH7A 1M94A 3Q8CA 1P0RA 1D4BA 3ZW3A 2PMVA 2MBBB 2NBWB 2WXMA 3HIZA 4RGTA 2CHXA 3Q2AC 1RM6C 4FJVB 3RMKC 3UGBB 2RD0A 1UD7A 3R3MA 5BYQA 2K3UA 4HPMB 1R7SA 2C7NB 2RPQA 4DHJD 4JGHB 3EFUA 5JZEB 2N9PC 2JPHA 2CJNA 2DZKA 4B0EA 4RCOA 2GRIA 4A55A 3GE8C 2LUMA 3I5JC 4JQWC 2R2QA 1I35A 1SE2A 1YJJA 3NZ3A 3HM6X 4WWOA 3AEDB 1OQRA 4B6WA 1FCLA 1WYGA 1EF1A 4HPPA 3KWVA 3PGEA 3KYDD 2H89B 3UINB 3AE7B 3ZNID 1FCCC 3CWIA 2G3QB 2DBYA 4A20A 2WXOA 1T6BX 3NHEB 1VR9A 3DBLI 4A90A 1WE6A 4LNOA 3LDZE 3VTVA 3DPDA 1N62A 3ZDTA 1D5MC 2BKFA 1MG8A 1GB1A 2LJ5A 3NZSA 2PEAA 3PRMB 3OG5A 2FCNA 2JU6X 1LM8B 2Z8LA 3R2IA 3FILB 5CTRC 3Q3JA 4IWPA 3W5VB 4LJOB 1GJZA 4E74A 3APCA 4MELA 3APFA 2UYZB 2KKCA 2NS5A 2LD9A 2HTHA 4RFBA 1WXSA 2IO2B 4NY0A 5HKHA 3A33B 5KHOA 3OWEB 1WH3A 2I2YA 2KDBA 2N9LA 2NBUA 1IGDA 1RYJA 2HTME 2J0MA 2XK5B 2E3TA 3AEGB 3AMZA 3L13A 4L23A 2GB1A 3HK0A 1FFUA 4DXAB 3I9V1 1FXIA 5IO9A 3V6CB 2K1FA 4M8MA 3WAOA 4X57B 2N1WA 3ZTCA 1GG3A 2W82A 1ZP0B 2BGFA 4FJZA 4FHJA 4YTPB 3ZXVA 2Y5BB 1MJDA 3EECA 1F52A 2BW2A 4G11A 1QQRA 1UUPA 1SBBB 2LFIA 2CHZA 2C5LC 2K8HA 1L6VA 3ZNGC 3GS2A 3X0WA 3ZJVA 3BVGA 3IHPC 2VH1A 4I6PA 2WU2B 4FULA 2WXGA 4II3B 2CS4A 2KXJA 1P98A 3SU8X 3QX1A 1WGHA 2WHIA 1J19A 3QJZA 3HVDA 5C23A 4PT5A 3AE6B 3PZ7A 5DCNA 4AP4C 5HG2A 4C00A 2L52A 1FFVA 3V62A 2OJRA 3WCQA 2K8BA 3EC8A 2LHDA 3EFCA 4LNKA 1SSNA 1WZ3A 3I63C 1KM7A 2G1EA 4WIPA 3MJ5A 1WXQA 5T8IA 1KLGD 1QOAA 1V86A 1J8CA 1K53A 2ZCBA 5FR3A 1UNSA 1BMLC 1HEZE 2PVGC 4USAA 2RSUA 2MBQA 4DBGA 4URKA 2MW5A 4WAAA 4NAWB 4K7SA 1TKEA 3GB1A 2O2VB 2RR9A 3PZ8A 4JLCA 4AS1A 2NPTA 1V49A 4KKJA 3NVWA 4II2B 1L2NA 1WR1A 1NYQA 2KWUB 2KVRA 2J42A 2ZPYA 1K8RB 3VDZA 2TSSA 1IP9A 2CKHB 4HPLB 2PIAA 3IBEA 3DVGX 4YWGG 3T9LA 4EZLA 4IWQA 3BVZA 1E6EB 2BYFA 1Q10A 1MG4A 4EFOA 3GP7A 3RNCC 2WX0A 4L1BA 5AZHA 2QMTA 2H88B 3H7PA 1UGJA 3IAS1 3L16A 2AYOB 2M0AA 2BTEA 1Z2MA 2INCC 4BKTA 2MCNB 4W9KA 2KLGA 3BK1A 3NRZA 1KFYB 3ABVB 2BB5A 2ZJDA 2GBMA 4GSWA 4OZBA 1N5WA 2K5PA 3W1YA 2C60A 2IPKD 2JXXA 2CR5A 2ZNVC 3R8BA 3M62B 4N59A 4EE2A 2EMTA 1YNTE 1WMHA 4XDDA 4C7ZA 2LMCA 1X1MA 1L0VB 2WXNA 1JROA 3RCZA 3GZNI 3AV8A 3TJPA 3APDA 1E90A 4IM0A 5CHWA 4BKSD 2KLCA 3H8HA 2WDQB 2MBHA 1C4AA 3K9OB 4S17A 4WJNA 4RF1A 3RNFC 1ZOYB 2UU7A 2WDTB 3VR9B 4ZDVA 2KQ7A 1NYRA 1WGDA 4DWFA 2FCQA 1FRRA 3HVZA 4K81A 2DZJA 3P2BA 2BYEA 1KTKA 4A8XC 2YLMA 4RM8A 2JF5A 1YQBA 2KN4A 5CHFA 3A4SC 2KWDA 4MEMA 5H8YE 2WXLA 5MPOA 5EE3A 3N30A 4PYZA 1SE4A 1XD3B 1N61A 2BF8B 1YMHE 2BWFA 2WXRA 1R4MB 4M0WA 3W1SA 3TEYA 1VCBA 5BMHA 2MLBA 5CX3A 2IBIB 5I4DA 4HKZE 3NUHB 2KX3A 3ZLZA 1ZKHA 2QSDA 1E7PB 4F7ZA 1TY0A 3P4PB 3FC4A 2L7RA 3W2DA 1B1ZA 3QARA 4KSKC 1FO4A 5AZFA 2ACZB 4JWUC 1DOXA 2LZ6A 2KQ4X 3TCAA 4P6VF 1T0RC 2L3ZA 1I4HA 1QZEA 4GU2A 1I4QA 2DYMA 3I3TB 1YJIA 3UF8A 2ONQA 5BO4B 2JX5A 2KFJA 4EKUA 3RNBC 4KZ0A 1R4NB 1UH6A 1XT9B 2LGYA 2KC1A 2LHEA 2DHZA 1WGGA 2NTSA 3H1UA 2K6DB 3QAQA 4EOYA 2J4XA 3ZRFA 1TZOA 2D07B 4S0RA 2PE6B 3B0AA 2LEKA 4WAFA 1FEHA 1ROEA 3OJ4B 1I4XA 4RH6A 1KOTA 2FIDA 1C78A 1E8WA 2LGIA 4MSMB 2V0GA 4GGQA 5AUKA 1SJHD 2M56B 5D3IB 3N1XC 4MM3A 4ACFA 1E0ZA 1UELA 2MWSB 2CJOA 3URYA 1T0QC 2VZKB 3DOWA 1C9FA 1SE3A 3ZNHB 4E3CA 1RRBA 4NQKE 3C8YA 2JWUA 3U2SC 2N9EB 3DBLB 1V9JA 1HTOA 3DVNU 4UDUC 4HWIB 2WX1A 4IM2A 2FNJB 4RMAA 4RGMA 3MFGA 2K39A 4MGYE 5BMGA 4XE0A 4XDCA 1F2RI 1UBQA 3MJWA 1VZ8A 3V60A 3CF6E 2JUOA 1QF6A 2W9NA 3ZDMC 1WRIA 2MBEA 2FIFA 1HA5A 2DZIA 2M19A 5G2NA 3H7SA 3QIJA 4EZJA 4C7YA 4IW0A 1V5TA 4TV3A 3BINA 4AJWA 3AE1B 1PYWD 1V1PA 5D2MB 2QJLA 1PQSA 1AWDA 1WGRA 1JWSD 4MGKE 1PGXA 1F0ZA 3VH4B 2PTLA 2JZPA 5FKAC 3VHTC 3DBHI 3P4QB 5E6JA 1EO6A 4IUMB 3NG0A 3ML8A 5L83A 3N3KB 5IP4D 1PDXA 1V6EA 1C77A 2JWZA 2ON8A 4MGZE 1E8XA 2HJ8A 3BVMA 3ZGZA 4C56C 2E6XA 1MPEA 5G55A 2KO3A 4DQOC 3H9DA 1T0SC 2GOWA 3Q3NC 1R4MI 1FMAD 1KRHA 3BK2A 3L54A 3OJ3A 2XBBC 1YN5A 2WQYB 4JPSA 2REXA 1RLFA 3IXSA 4P16A 2K0PA 3RN9C 3TEXA 1MHXA 2JY6A 3ZQ4A 1WYWB 4EZKA 1Q5WB 3AB5A 3QC8B 2Q5WD 5LXIB 1D3ZA 2V9HA 3SFEB 3VVWB 2LXCA 2I38A 4WWNA 4TSSA 1ENFA 3LB8C 4ZRPA 1NVID 3DBHB 4K7WA 1P9DU 4IG7B 4OVZA 2G4SA 5AEKB 2N7EA 1LFDA 3ML9A 1ZGUB 1ZE3D 4ZRQA 2QEJC 2R61A 3NS1A 4ICVA 2UWQA 2KJHB 4FN2A 5HFYA 3GOEA 3PSEB 4ANWA 4KV2A 1D5ZC 3NJTA 2C9WB 4KKIA 1L7YA 3RFZB 4PS3A 5D3DA 4A3PA 3W1SC 2M8SA 3SHQA 3P63A 3ECIA 2ICIA 4ANUA 1WJUA 4HXDA 3AE4B 1D5XC 2INNE 2PLPA 4JL9A 1L0YB 1RFAA 2JZZA 5EE0A 3ZVVA 1HQRD 4MT5A 1VZ6A 2DNFA 4XX5A 1C4CA 2DAFA 2BVCA 3B2GA 4CO7A 3R7QA 1OTRB 5AZGA 4WWPA 1ET6A 1RFKA 1GUAB 3A1QB 2KJ6A 3T3OA 1UWMA 1XXGA 1AYFA 2MJDA 2PPHA 3EHVA 1FD6A 4NAMA 4BOZB 3IFWB 2QC8A 3AE3B 2WGSA 4PYUA 3RUIB 1VRAB 1R4NI 3RNAC 3ZNZB 1IPGA 2BT6A 3U30A 4BBNC 1IBXB 3RYTA 4L2YA 2AX5A 3SFDB 2KTFA 2NCNA 1LO5D 2L1AA 1B9RA 3PLVA 2JSVX 1SIFA 1TIFA 2WS3B 1TKGA 2QHOA 3PREA 4FJYA 4DK5A 2V4LA 4MM3B 4DXGA 4W9IA 3ONSA 1WMHB 2KMAA 2KANA 2KQSA 2MP2A 1T3QA 4IC7B 3QCAA 4F1SA 3P4SB 1ZPSA 2KX0A 2KHWB 1YOVB 4NQLB 3IVFA 1SIJA 3TBLD 1TYGB 5BMIA 2Z59B 2MQJA 2L32A 2N7JA 4MSQB 3AE5B 2PJHA 4BBNF 3SD5A 1QILA 1V1OA 2RPVA 3WIMA 2IO3B 2DZMA 4IM3A 3NY5A 4DXFA 1F1HA 2KNBA 2NMQA 1E10A 2LVOA 5EE1A 2PVOD 1PFDA 2NR2A 2WU5B 3IT4B 2IGHA 5EDSA 1WX9A 1HTQA 3VR8B 2SAKA 2N9XA 2N0SB 5D7GA 2DENB 2O6VD 4ASWC 2PKOA 3V61A 3TSSA 1FNWA 3VUXA 3DHGC 1GAQB 2KACA 1YQ3B 2W54A 3A1QA 1RWSA 3S2AA 1JMLA 3M63B 4LNIA 3GZNB 3VFKA 2JZ3B 3NVYA 3B2FA 2VH2A 2D10A 2MH7A 3VQIA 3WAPA 1CMXB 4O1NA 1GNUA 3JW0X 3L4PA 3ETRA 3BYTB 1V1PB 2FUHB 2L0TA 3KLSX 2V3NA 3PVLA 2D11A 1HZ6A 4BFRA 1XEEA 2MBOA 1WXAA 4M8NA 3N1ZC 2WDVB 2JYEA 2MEKA 1XCTL 2O6VA 3U8ZA 3W9CB 4F8CB 3T3NA 2BS2B 2VRRB 3KUCB 4JE3B 5E6NA 4PK1A 3AEFB 3AULA 3E56A 3W5UB 4AUQC 1SF0A 4WURA 4MH0E 2V3SA 5AUIA 3AN1A 2L00B 2JYTA 1SB3C 4HDQA 1E8YA 2WXPA 1T5XD 4N58A 5JHBA 3HHMA 1FXAA 3RNEC 1H8CA 5DPTA 1F9JA 1WR6E 2NBVB 1JRPA 2YVCA 4WJQA 2N4FA 2V3PA 1UZXB 1WZ0A 1WGKA 4YTMB 1OEYA 4K3CA 1L5PA 4DHZB 1FM0D 4XC2A 3CSTA 4W9EA 4LK0M 2GLSA 3DCGA 4NPNA 2L05A 2GBRA 5FK9C 3RZFA 4HROA 2LGDA 2Z0DB 3KVFB 3Q6BA 1TGZB 1ZDXA 1JW9D 4ARCA 3AECB 4RF0A 2X38A 4OW0A 4W9JA 2LRWA 2IY1B 4KSLC 3A9JB 1LXDA 4KZCA 5TR5A 4OZCA 3ZRCA 2INPE 4ZRKA 3DHHC 1AW7A 1WXMA 4OVUA 2D3CA 3QHTA 2WLBA 1N60A 4CHKA 1J7BA 2A5UA 2W3RA 3A9KA 2KDIA 3MC8A 2KC2A 2BKRB 1L4ZB 1SXTA 2EMSA 1TS3A 4Q2JA 3QA8A 1OQYA 1UF0A 4IDIA 4M00A 2KTRA 4NNJB 1KLVA 3MHSD 2QILA 2WYQA 2RDBC 1ET9A 3WANA 2BWES 3ZJTA 3PRPB 1EF5A 1V97A 4BVUC 4K7UA 3VAWA 3ALBA 3L08A 2XK5A 1FIQA 4ZHPA 3OLMD 4MGIE 5JH5C 1KH0A 4ZYSA 1YD8U 4FXCA 4TQ0A 3LYYA 1ZW7A 4US8A 1P3QU 3BIID 4HJKA 1VJKA 2W55A 1RAXA 2X8XX 2J0KA 2KJRA 3B08A 3UI3A 1WGYA 1Y56A 1YQ4B 3VH3B 1P7EA 4OVVA 4KIKB 2IDYA 4TKNA 3ZJUA 2ZCCA 4W9LA 3U7DA 3Q69A 4D2KA 5BYRA 3DBSA 2AWTA 5FR6A 1XLPA 2KMCA 4HJGE 3KW5B 1OFFA 3RD2A 3AEBB 3V3XA 2WXJA 4LCDE 2XN9C 3Q8BA 2DX5B 1S3SG 2KT7A 3UQAA 1J0GA 2N1VA 2BQQA 4G3XB 5J18A 3M95A 2BPSA 1HZ5A 1MHHE 3RNGC 2KFKA 1OEYJ 4LJPB 2K9XA 1VD2A 2IY0B 3D32A 2CU1A 1ISNA 3SR6A 3MTNB 4GXBA 3NVVA 4XGAB 2IO0B 4A3OA 4GLSC 1JQ4A 3PTFC 1OGWA 4HLEA 2HDEA 4LDTD 1XO3A 2EELA 5JXVA 4XWWA 3DBRB 2RDHA 3NVZA 3ZO5B 1P1AA 4W9GA 5J2RA 4CQNA 1NENB 4FBJB 3N9YC 3TEWA 4ANVA 1F2RC 3ENEA 4JX1C 4LNFA 3DVGY 5BYSA 3H7PB 2FBWB 2MP2B 2LUEA 4HCPB 4GDLB 2DWQA 1YIWA 4A6QA 3B9JA 5D6JB 3RT3B 2ZZPB 3L17A 1Q0WB 3KH0A 1UWXA 4YT0B 1DGJA 2M4NA 1Q1OA 3T8MA 2WXIA 3IG3A 3TUOA 1YN4A 2MJEA 3IAM1 2WXHA 3Q3OC 1HE8A 3A4RA 3ZXRA 3EA6A 2IO1B 4GOCA 3PS6A 1UGMA 2HJ1A 3JSVA 1J7AA 5CHVC 2IGGA 4ANXA 1JWBD 1IBXA 2HE7A 4FLHA 4WQMA 1AARA 4KX6B 4RGOS 2ZEQA 1WWTA 3CIRB 2IJ0A 3PO0A 3P1MA 1I42A 1TS4A 4W9CA 3RPFC 1GOZA 2D3AA 2BS3B 3E9SA 5GXGB 3QWZB 1A70A 1XCQL 1WJNA 2QCZA 3N1YC 4DDGD 3PHWB 2AEHA 4P7IA 4ITKA 2FCSA 2EKEC 3HM3A 5C2TB 1I4PA 2LGSA 4LTUA 4M01A 4G50A 1QT9A 2FE8A 1YX6B 5TSSA 3QQ8B 1YN3A 1G6JA 3AEEB 2N9KA 2OEDA 3K9PB 4KGTA 4QAYA 3R2TA 5G5GA 1XF5L 3WALA 3PHXB 1CJEA 2O6VB 4OHJA 3R7RA 4P1CC 1NI2A 1JALA 4NJCA 2MA9B 2LVQA 4RGNA 2V4IB 2ZVOA 1ZXHA 3VRAB 1WIAA 4NAWA 2K8CA 2JT4B 1E8ZA 2VZKD 3PLUA 1TBEA 2GBNA 3BZDB 2DAJA 2B76B 2G9HD 3FAHA 3Q3FA 3PPAA 4K3BA 1LGRA 2WXKA 1STEA 4HRSA 3SEBA 4MJSB 2B3AA 1GC7A 3M3JA 1TS2A 2IYDB 2KWVB 1YX5B 3ZIMA 1JWMD 1OQQA 1EUVB 3UIPB 1QLBB 2D2QA 2OJWA 1BXTA 2SEBD 2KTRB 2ZPNA 3FKYA 4MH8A 1Z5SB 3TIXA 3PZDA 1SEBD 1TJEA 2JVCA 4JIOU 1QKZA 2KFKB 3GE3C 1QOBA 3BY4B 1NEKB 4ZRIA 2AQ3B 3Q8AA 2L76A 1VDVA 1CZPA 2MRPA 4NZLB 2Y5PA 1J7CA 4TQ1A 1AN8A 4REZA 2Z0EB 2V1YA 1WM3A 2N7DA 2ZW1A 3DHIC 4IOIE 2MSED 4GDKB 4BOSC 3ZKJC 2W3SA 1JRUA 1BUIC 2CU3A 3V05A 3QK0A 4W9DA 2GBKA 2J0JA 2KDMA 4YTNB 5LXHA 2LRUA 2XNAC 1EM7A 3AEAB 3PV1A 3MC0B 4YSYB 3P4RB 4RM9A 1JWUD 2KZRA 2IZVB 3AE2B 3RULA 3WA0A 5IN7A 1ESFA 2KWCA 3TMPB 1IGCA 1PUTA 4BKSA 1M4VA 4BKGA 3BYYB 1VLBA 3DWGC 4A9AA 4WWMA 1WJ4A 5JHAA 1LQBA 5E6PA 1SJED 1TY2A 4LDTB 2NVUI 2RGFA 4J6IA 4OZAA 4FADA 1TTNA 1P7FA 1NDDA 1C4PA 2KOXA 1WM2A 2NPTB 1EU3A 1YJ1A 1WE7A 1K50A 3VUYA 1MFWA 3Q8FA 2RMMA 2WXQA 3KYCD 2M1MA 2FAZA 1PGAA 1EWCA 3L10B 2KDEB 4GB9A 5E6OA 1C1YB 2KVZA 2K25A 4TUUA 2D3BA 3MC9A 1I4RA 1CQVA 2MJ3A 3TL5A 1WSPA 5DPRA 5D94A 4KVGB 2CHWA 4TMAB 4C4VA 1ACCA 3RI7C 2M17A 2JRIB 5GMVA 3U4EG 4ZHOA 3EUB2 4WQOB 2Y3AA 5IAAC 4AJYB 1N5XA 3AE9B 5IA7A 1CK1A 3Q14C 4W9FA 1V8CA 3NS8A 1VZ7A 1N63A 3UIOB 4JWSC 1WX7A 2QIEB 2K6QA 3Q3MC 1ZDVA 2GMIC 2L83A 1EU4A 3U52E 5IKCM 1TKYA 3AE8B 1H4RA 5DPSA 3DVNV 5LNK1 2ZVNA 4KDIC 1JWAD 2KAJA 2LI5A 4WH4A 1GC6A 3TEZA 4KIKA 4HK2A 4AQ7A 1EWYC 1D6EC 2GI9A 2YEPB 4H2AA 4P1BC 1XQQA 3NOBA 1A5RA 3JSVB 3AI5A 3VTWA 2C7MB 4HVBA 3KUZA 4BAXA 1ZUD2 1L6UA 1DOYA 1K52A 3AXCA 4M0WB 4XWTA 4E71A 5DPWA 3CSFA 2LXAA 2KMMA 1C79A 2KK8A 1BT0A 4HCNB 3A9JA 4WJOA 1Y8RC 1C3TA 1TS5A 2ASQA 3WAMA 2I1KA 4N6EB 2ZW0A 1UBIA 2LJIA 4PS8A 1WY8A 2R2OA 1FNVA 4GDLA 4YSXB 4DHJB 4IWOA 1XLQA 1C76A 3HRDD 3VUWA 4LLGM 1KJTA 3VRBB 2AQ2B 3DQVA 3FILA 2G4DB 2LWPA 3J9CA 2Y5CA 3A9KB 2KYWA 1ZXIA 2C7HA 2KN5A 2AL6A 1WFYA 1MI0A 2WP9B 2LVPA 5HI1A 1GB4A 3PT2B 3BWUD 2MHJA 4ZOHC 3UQBA 5C3JB 4C80A 2BYTA 1DOIA 3B1LX 3VXWA 1WJ6A 1F77A 2LASA 2JRHA 3KQ4A 4B95A 2PE9A 2WWZA 1FNUA 4GN1A 3OAWA 3U7ZA 1FPYA 1I7HA 4ICUA 3VTUA 4YXDB 5KHQA 1WX8A 2J7QB 3JVZX 5C1ZA 3AU4A 3SDLC 1E7UA 3ZTDA 2O2VA 2I1JA 2OHFA 4MJSA 1E5WA 1KF6B 5H92C 2D3GA 2WNMA 1TZ1A 3NZUA 4NJ7A 4HKQA 2HD5B 2BYVE 1FXTB 4KGSA 4FA6A 4MDKE 2DYOA 1S1QB 3EGRA 2QDFA 3O13A 4YSZB 1K51A 5HHDG 4DHZE 3N20C 1WI0A 2BBCA 3DWMA 4CYEA 2YEPF 2BB6A 2PW9A 2KDFB 4J3OD 1IUEA 2WDRB 4K1RB 3C19A 2WXFA 1V81A 4ZRJA 2RDGA 4M02A 2IGDA 1KLUD 1XLOA 4KDLB 4XZ4A 3N32A 3KUDB 3ZYYX 4I6NB 4AWJA 2D5GA 1MVKA 4B0MA 2G45B 1FRDA 3L0WB 1XLNA 2XEWA 3C0RB 5G5HA 2NTTA 4GIVA 2J53A 2JXTA 2FCMA 4RNAA 3AM9A 4PS7A 2LGXA 2AL3A 3O65B 3RZWC 4G0NB 1V5OA 1I4GA 2DLBA 1E7VA 1WRDB 4AOFA 1TT5B 3DBRI 1SE9A 2M0XA 1NBFC 3R66C 4GDKA 4DDID 1L0XB 1SGHA 4ZYNA 2AQ1B 3AU5A 4BZAA 3V6EB 1IYFA 2ZNVB 3LJ3A 1L4DB 1E9MA 1V80A 4HEA1 1NI3A 1HXYD 2KD0A 3HUIA 4NJ6A 1QOFA 1GPXA 4MACA 3H6NA 4I6LB 2JQRB 4HDOA 4KGRA 3JYUA 4YL8A 2FUG1 3I57A 4XYCA 2BS4B 1V2YA 1PGBA 1QOGA 4EEWA 4C4VB 3P42A 3MHZA 3DDCB 2GBJA 1JCKB 1WXVA 4LNNA 4EUTA 2EKIA 4N9F4 3LXFA
chains in the Genus database with same CATH topology
3DHHC 3N1XC 3GE3C 3RNGC 3Q3MC 1T0SC 3Q3NC 3N1YC 3RNCC 3GE8C 3I5JC 1T0QC 3RNEC 1T0RC 3Q2AC 3Q14C 2RDBC 3RMKC 4P1BC 3RNAC 3N1ZC 3Q3OC 3N20C 3RNFC 3DHIC 2INDC 3RNBC 3DHGC 3RN9C 4P1CC 2INCC 3RI7C 3I63C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHH C;  3N1X C;  3GE3 C;  3RNG C;  3Q3M C;  1T0S C;  3Q3N C;  3N1Y C;  3RNC C;  3GE8 C;  3I5J C;  1T0Q C;  3RNE C;  1T0R C;  3Q2A C;  3Q14 C;  2RDB C;  3RMK C;  4P1B C;  3RNA C;  3N1Z C;  3Q3O C;  3N20 C;  3RNF C;  3DHI C;  2IND C;  3RNB C;  3DHG C;  3RN9 C;  4P1C C;  2INC C;  3RI7 C;  3I63 C; 
#chains in the Genus database with same CATH topology
 2J52 A;  2A4Z A;  1WF9 A;  5LLI A;  3X23 A;  2MX2 A;  5IOI A;  2K22 A;  5L95 C;  4B9K A;  2OOB B;  1T0Y A;  4WJP A;  4ARI A;  3Q8E A;  3MP9 A;  1N6Z A;  5EE9 A;  1U4A A;  2L8J A;  4FHK A;  5J17 A;  2DYB A;  3CMM B;  4GMV A;  2IND C;  4W9H A;  3PRZ A;  3ZUN A;  4US9 A;  4R3D A;  3IT6 B;  4IKG A;  2L0F A;  1DYQ A;  3KWL A;  3AH7 A;  1M94 A;  3Q8C A;  1P0R A;  1D4B A;  3ZW3 A;  2PMV A;  2MBB B;  2NBW B;  2WXM A;  3HIZ A;  4RGT A;  2CHX A;  3Q2A C;  1RM6 C;  4FJV B;  3RMK C;  3UGB B;  2RD0 A;  1UD7 A;  3R3M A;  5BYQ A;  2K3U A;  4HPM B;  1R7S A;  2C7N B;  2RPQ A;  4DHJ D;  4JGH B;  3EFU A;  5JZE B;  2N9P C;  2JPH A;  2CJN A;  2DZK A;  4B0E A;  4RCO A;  2GRI A;  4A55 A;  3GE8 C;  2LUM A;  3I5J C;  4JQW C;  2R2Q A;  1I35 A;  1SE2 A;  1YJJ A;  3NZ3 A;  3HM6 X;  4WWO A;  3AED B;  1OQR A;  4B6W A;  1FCL A;  1WYG A;  1EF1 A;  4HPP A;  3KWV A;  3PGE A;  3KYD D;  2H89 B;  3UIN B;  3AE7 B;  3ZNI D;  1FCC C;  3CWI A;  2G3Q B;  2DBY A;  4A20 A;  2WXO A;  1T6B X;  3NHE B;  1VR9 A;  3DBL I;  4A90 A;  1WE6 A;  4LNO A;  3LDZ E;  3VTV A;  3DPD A;  1N62 A;  3ZDT A;  1D5M C;  2BKF A;  1MG8 A;  1GB1 A;  2LJ5 A;  3NZS A;  2PEA A;  3PRM B;  3OG5 A;  2FCN A;  2JU6 X;  1LM8 B;  2Z8L A;  3R2I A;  3FIL B;  5CTR C;  3Q3J A;  4IWP A;  3W5V B;  4LJO B;  1GJZ A;  4E74 A;  3APC A;  4MEL A;  3APF A;  2UYZ B;  2KKC A;  2NS5 A;  2LD9 A;  2HTH A;  4RFB A;  1WXS A;  2IO2 B;  4NY0 A;  5HKH A;  3A33 B;  5KHO A;  3OWE B;  1WH3 A;  2I2Y A;  2KDB A;  2N9L A;  2NBU A;  1IGD A;  1RYJ A;  2HTM E;  2J0M A;  2XK5 B;  2E3T A;  3AEG B;  3AMZ A;  3L13 A;  4L23 A;  2GB1 A;  3HK0 A;  1FFU A;  4DXA B;  3I9V 1;  1FXI A;  5IO9 A;  3V6C B;  2K1F A;  4M8M A;  3WAO A;  4X57 B;  2N1W A;  3ZTC A;  1GG3 A;  2W82 A;  1ZP0 B;  2BGF A;  4FJZ A;  4FHJ A;  4YTP B;  3ZXV A;  2Y5B B;  1MJD A;  3EEC A;  1F52 A;  2BW2 A;  4G11 A;  1QQR A;  1UUP A;  1SBB B;  2LFI A;  2CHZ A;  2C5L C;  2K8H A;  1L6V A;  3ZNG C;  3GS2 A;  3X0W A;  3ZJV A;  3BVG A;  3IHP C;  2VH1 A;  4I6P A;  2WU2 B;  4FUL A;  2WXG A;  4II3 B;  2CS4 A;  2KXJ A;  1P98 A;  3SU8 X;  3QX1 A;  1WGH A;  2WHI A;  1J19 A;  3QJZ A;  3HVD A;  5C23 A;  4PT5 A;  3AE6 B;  3PZ7 A;  5DCN A;  4AP4 C;  5HG2 A;  4C00 A;  2L52 A;  1FFV A;  3V62 A;  2OJR A;  3WCQ A;  2K8B A;  3EC8 A;  2LHD A;  3EFC A;  4LNK A;  1SSN A;  1WZ3 A;  3I63 C;  1KM7 A;  2G1E A;  4WIP A;  3MJ5 A;  1WXQ A;  5T8I A;  1KLG D;  1QOA A;  1V86 A;  1J8C A;  1K53 A;  2ZCB A;  5FR3 A;  1UNS A;  1BML C;  1HEZ E;  2PVG C;  4USA A;  2RSU A;  2MBQ A;  4DBG A;  4URK A;  2MW5 A;  4WAA A;  4NAW B;  4K7S A;  1TKE A;  3GB1 A;  2O2V B;  2RR9 A;  3PZ8 A;  4JLC A;  4AS1 A;  2NPT A;  1V49 A;  4KKJ A;  3NVW A;  4II2 B;  1L2N A;  1WR1 A;  1NYQ A;  2KWU B;  2KVR A;  2J42 A;  2ZPY A;  1K8R B;  3VDZ A;  2TSS A;  1IP9 A;  2CKH B;  4HPL B;  2PIA A;  3IBE A;  3DVG X;  4YWG G;  3T9L A;  4EZL A;  4IWQ A;  3BVZ A;  1E6E B;  2BYF A;  1Q10 A;  1MG4 A;  4EFO A;  3GP7 A;  3RNC C;  2WX0 A;  4L1B A;  5AZH A;  2QMT A;  2H88 B;  3H7P A;  1UGJ A;  3IAS 1;  3L16 A;  2AYO B;  2M0A A;  2BTE A;  1Z2M A;  2INC C;  4BKT A;  2MCN B;  4W9K A;  2KLG A;  3BK1 A;  3NRZ A;  1KFY B;  3ABV B;  2BB5 A;  2ZJD A;  2GBM A;  4GSW A;  4OZB A;  1N5W A;  2K5P A;  3W1Y A;  2C60 A;  2IPK D;  2JXX A;  2CR5 A;  2ZNV C;  3R8B A;  3M62 B;  4N59 A;  4EE2 A;  2EMT A;  1YNT E;  1WMH A;  4XDD A;  4C7Z A;  2LMC A;  1X1M A;  1L0V B;  2WXN A;  1JRO A;  3RCZ A;  3GZN I;  3AV8 A;  3TJP A;  3APD A;  1E90 A;  4IM0 A;  5CHW A;  4BKS D;  2KLC A;  3H8H A;  2WDQ B;  2MBH A;  1C4A A;  3K9O B;  4S17 A;  4WJN A;  4RF1 A;  3RNF C;  1ZOY B;  2UU7 A;  2WDT B;  3VR9 B;  4ZDV A;  2KQ7 A;  1NYR A;  1WGD A;  4DWF A;  2FCQ A;  1FRR A;  3HVZ A;  4K81 A;  2DZJ A;  3P2B A;  2BYE A;  1KTK A;  4A8X C;  2YLM A;  4RM8 A;  2JF5 A;  1YQB A;  2KN4 A;  5CHF A;  3A4S C;  2KWD A;  4MEM A;  5H8Y E;  2WXL A;  5MPO A;  5EE3 A;  3N30 A;  4PYZ A;  1SE4 A;  1XD3 B;  1N61 A;  2BF8 B;  1YMH E;  2BWF A;  2WXR A;  1R4M B;  4M0W A;  3W1S A;  3TEY A;  1VCB A;  5BMH A;  2MLB A;  5CX3 A;  2IBI B;  5I4D A;  4HKZ E;  3NUH B;  2KX3 A;  3ZLZ A;  1ZKH A;  2QSD A;  1E7P B;  4F7Z A;  1TY0 A;  3P4P B;  3FC4 A;  2L7R A;  3W2D A;  1B1Z A;  3QAR A;  4KSK C;  1FO4 A;  5AZF A;  2ACZ B;  4JWU C;  1DOX A;  2LZ6 A;  2KQ4 X;  3TCA A;  4P6V F;  1T0R C;  2L3Z A;  1I4H A;  1QZE A;  4GU2 A;  1I4Q A;  2DYM A;  3I3T B;  1YJI A;  3UF8 A;  2ONQ A;  5BO4 B;  2JX5 A;  2KFJ A;  4EKU A;  3RNB C;  4KZ0 A;  1R4N B;  1UH6 A;  1XT9 B;  2LGY A;  2KC1 A;  2LHE A;  2DHZ A;  1WGG A;  2NTS A;  3H1U A;  2K6D B;  3QAQ A;  4EOY A;  2J4X A;  3ZRF A;  1TZO A;  2D07 B;  4S0R A;  2PE6 B;  3B0A A;  2LEK A;  4WAF A;  1FEH A;  1ROE A;  3OJ4 B;  1I4X A;  4RH6 A;  1KOT A;  2FID A;  1C78 A;  1E8W A;  2LGI A;  4MSM B;  2V0G A;  4GGQ A;  5AUK A;  1SJH D;  2M56 B;  5D3I B;  3N1X C;  4MM3 A;  4ACF A;  1E0Z A;  1UEL A;  2MWS B;  2CJO A;  3URY A;  1T0Q C;  2VZK B;  3DOW A;  1C9F A;  1SE3 A;  3ZNH B;  4E3C A;  1RRB A;  4NQK E;  3C8Y A;  2JWU A;  3U2S C;  2N9E B;  3DBL B;  1V9J A;  1HTO A;  3DVN U;  4UDU C;  4HWI B;  2WX1 A;  4IM2 A;  2FNJ B;  4RMA A;  4RGM A;  3MFG A;  2K39 A;  4MGY E;  5BMG A;  4XE0 A;  4XDC A;  1F2R I;  1UBQ A;  3MJW A;  1VZ8 A;  3V60 A;  3CF6 E;  2JUO A;  1QF6 A;  2W9N A;  3ZDM C;  1WRI A;  2MBE A;  2FIF A;  1HA5 A;  2DZI A;  2M19 A;  5G2N A;  3H7S A;  3QIJ A;  4EZJ A;  4C7Y A;  4IW0 A;  1V5T A;  4TV3 A;  3BIN A;  4AJW A;  3AE1 B;  1PYW D;  1V1P A;  5D2M B;  2QJL A;  1PQS A;  1AWD A;  1WGR A;  1JWS D;  4MGK E;  1PGX A;  1F0Z A;  3VH4 B;  2PTL A;  2JZP A;  5FKA C;  3VHT C;  3DBH I;  3P4Q B;  5E6J A;  1EO6 A;  4IUM B;  3NG0 A;  3ML8 A;  5L83 A;  3N3K B;  5IP4 D;  1PDX A;  1V6E A;  1C77 A;  2JWZ A;  2ON8 A;  4MGZ E;  1E8X A;  2HJ8 A;  3BVM A;  3ZGZ A;  4C56 C;  2E6X A;  1MPE A;  5G55 A;  2KO3 A;  4DQO C;  3H9D A;  1T0S C;  2GOW A;  3Q3N C;  1R4M I;  1FMA D;  1KRH A;  3BK2 A;  3L54 A;  3OJ3 A;  2XBB C;  1YN5 A;  2WQY B;  4JPS A;  2REX A;  1RLF A;  3IXS A;  4P16 A;  2K0P A;  3RN9 C;  3TEX A;  1MHX A;  2JY6 A;  3ZQ4 A;  1WYW B;  4EZK A;  1Q5W B;  3AB5 A;  3QC8 B;  2Q5W D;  5LXI B;  1D3Z A;  2V9H A;  3SFE B;  3VVW B;  2LXC A;  2I38 A;  4WWN A;  4TSS A;  1ENF A;  3LB8 C;  4ZRP A;  1NVI D;  3DBH B;  4K7W A;  1P9D U;  4IG7 B;  4OVZ A;  2G4S A;  5AEK B;  2N7E A;  1LFD A;  3ML9 A;  1ZGU B;  1ZE3 D;  4ZRQ A;  2QEJ C;  2R61 A;  3NS1 A;  4ICV A;  2UWQ A;  2KJH B;  4FN2 A;  5HFY A;  3GOE A;  3PSE B;  4ANW A;  4KV2 A;  1D5Z C;  3NJT A;  2C9W B;  4KKI A;  1L7Y A;  3RFZ B;  4PS3 A;  5D3D A;  4A3P A;  3W1S C;  2M8S A;  3SHQ A;  3P63 A;  3ECI A;  2ICI A;  4ANU A;  1WJU A;  4HXD A;  3AE4 B;  1D5X C;  2INN E;  2PLP A;  4JL9 A;  1L0Y B;  1RFA A;  2JZZ A;  5EE0 A;  3ZVV A;  1HQR D;  4MT5 A;  1VZ6 A;  2DNF A;  4XX5 A;  1C4C A;  2DAF A;  2BVC A;  3B2G A;  4CO7 A;  3R7Q A;  1OTR B;  5AZG A;  4WWP A;  1ET6 A;  1RFK A;  1GUA B;  3A1Q B;  2KJ6 A;  3T3O A;  1UWM A;  1XXG A;  1AYF A;  2MJD A;  2PPH A;  3EHV A;  1FD6 A;  4NAM A;  4BOZ B;  3IFW B;  2QC8 A;  3AE3 B;  2WGS A;  4PYU A;  3RUI B;  1VRA B;  1R4N I;  3RNA C;  3ZNZ B;  1IPG A;  2BT6 A;  3U30 A;  4BBN C;  1IBX B;  3RYT A;  4L2Y A;  2AX5 A;  3SFD B;  2KTF A;  2NCN A;  1LO5 D;  2L1A A;  1B9R A;  3PLV A;  2JSV X;  1SIF A;  1TIF A;  2WS3 B;  1TKG A;  2QHO A;  3PRE A;  4FJY A;  4DK5 A;  2V4L A;  4MM3 B;  4DXG A;  4W9I A;  3ONS A;  1WMH B;  2KMA A;  2KAN A;  2KQS A;  2MP2 A;  1T3Q A;  4IC7 B;  3QCA A;  4F1S A;  3P4S B;  1ZPS A;  2KX0 A;  2KHW B;  1YOV B;  4NQL B;  3IVF A;  1SIJ A;  3TBL D;  1TYG B;  5BMI A;  2Z59 B;  2MQJ A;  2L32 A;  2N7J A;  4MSQ B;  3AE5 B;  2PJH A;  4BBN F;  3SD5 A;  1QIL A;  1V1O A;  2RPV A;  3WIM A;  2IO3 B;  2DZM A;  4IM3 A;  3NY5 A;  4DXF A;  1F1H A;  2KNB A;  2NMQ A;  1E10 A;  2LVO A;  5EE1 A;  2PVO D;  1PFD A;  2NR2 A;  2WU5 B;  3IT4 B;  2IGH A;  5EDS A;  1WX9 A;  1HTQ A;  3VR8 B;  2SAK A;  2N9X A;  2N0S B;  5D7G A;  2DEN B;  2O6V D;  4ASW C;  2PKO A;  3V61 A;  3TSS A;  1FNW A;  3VUX A;  3DHG C;  1GAQ B;  2KAC A;  1YQ3 B;  2W54 A;  3A1Q A;  1RWS A;  3S2A A;  1JML A;  3M63 B;  4LNI A;  3GZN B;  3VFK A;  2JZ3 B;  3NVY A;  3B2F A;  2VH2 A;  2D10 A;  2MH7 A;  3VQI A;  3WAP A;  1CMX B;  4O1N A;  1GNU A;  3JW0 X;  3L4P A;  3ETR A;  3BYT B;  1V1P B;  2FUH B;  2L0T A;  3KLS X;  2V3N A;  3PVL A;  2D11 A;  1HZ6 A;  4BFR A;  1XEE A;  2MBO A;  1WXA A;  4M8N A;  3N1Z C;  2WDV B;  2JYE A;  2MEK A;  1XCT L;  2O6V A;  3U8Z A;  3W9C B;  4F8C B;  3T3N A;  2BS2 B;  2VRR B;  3KUC B;  4JE3 B;  5E6N A;  4PK1 A;  3AEF B;  3AUL A;  3E56 A;  3W5U B;  4AUQ C;  1SF0 A;  4WUR A;  4MH0 E;  2V3S A;  5AUI A;  3AN1 A;  2L00 B;  2JYT A;  1SB3 C;  4HDQ A;  1E8Y A;  2WXP A;  1T5X D;  4N58 A;  5JHB A;  3HHM A;  1FXA A;  3RNE C;  1H8C A;  5DPT A;  1F9J A;  1WR6 E;  2NBV B;  1JRP A;  2YVC A;  4WJQ A;  2N4F A;  2V3P A;  1UZX B;  1WZ0 A;  1WGK A;  4YTM B;  1OEY A;  4K3C A;  1L5P A;  4DHZ B;  1FM0 D;  4XC2 A;  3CST A;  4W9E A;  4LK0 M;  2GLS A;  3DCG A;  4NPN A;  2L05 A;  2GBR A;  5FK9 C;  3RZF A;  4HRO A;  2LGD A;  2Z0D B;  3KVF B;  3Q6B A;  1TGZ B;  1ZDX A;  1JW9 D;  4ARC A;  3AEC B;  4RF0 A;  2X38 A;  4OW0 A;  4W9J A;  2LRW A;  2IY1 B;  4KSL C;  3A9J B;  1LXD A;  4KZC A;  5TR5 A;  4OZC A;  3ZRC A;  2INP E;  4ZRK A;  3DHH C;  1AW7 A;  1WXM A;  4OVU A;  2D3C A;  3QHT A;  2WLB A;  1N60 A;  4CHK A;  1J7B A;  2A5U A;  2W3R A;  3A9K A;  2KDI A;  3MC8 A;  2KC2 A;  2BKR B;  1L4Z B;  1SXT A;  2EMS A;  1TS3 A;  4Q2J A;  3QA8 A;  1OQY A;  1UF0 A;  4IDI A;  4M00 A;  2KTR A;  4NNJ B;  1KLV A;  3MHS D;  2QIL A;  2WYQ A;  2RDB C;  1ET9 A;  3WAN A;  2BWE S;  3ZJT A;  3PRP B;  1EF5 A;  1V97 A;  4BVU C;  4K7U A;  3VAW A;  3ALB A;  3L08 A;  2XK5 A;  1FIQ A;  4ZHP A;  3OLM D;  4MGI E;  5JH5 C;  1KH0 A;  4ZYS A;  1YD8 U;  4FXC A;  4TQ0 A;  3LYY A;  1ZW7 A;  4US8 A;  1P3Q U;  3BII D;  4HJK A;  1VJK A;  2W55 A;  1RAX A;  2X8X X;  2J0K A;  2KJR A;  3B08 A;  3UI3 A;  1WGY A;  1Y56 A;  1YQ4 B;  3VH3 B;  1P7E A;  4OVV A;  4KIK B;  2IDY A;  4TKN A;  3ZJU A;  2ZCC A;  4W9L A;  3U7D A;  3Q69 A;  4D2K A;  5BYR A;  3DBS A;  2AWT A;  5FR6 A;  1XLP A;  2KMC A;  4HJG E;  3KW5 B;  1OFF A;  3RD2 A;  3AEB B;  3V3X A;  2WXJ A;  4LCD E;  2XN9 C;  3Q8B A;  2DX5 B;  1S3S G;  2KT7 A;  3UQA A;  1J0G A;  2N1V A;  2BQQ A;  4G3X B;  5J18 A;  3M95 A;  2BPS A;  1HZ5 A;  1MHH E;  3RNG C;  2KFK A;  1OEY J;  4LJP B;  2K9X A;  1VD2 A;  2IY0 B;  3D32 A;  2CU1 A;  1ISN A;  3SR6 A;  3MTN B;  4GXB A;  3NVV A;  4XGA B;  2IO0 B;  4A3O A;  4GLS C;  1JQ4 A;  3PTF C;  1OGW A;  4HLE A;  2HDE A;  4LDT D;  1XO3 A;  2EEL A;  5JXV A;  4XWW A;  3DBR B;  2RDH A;  3NVZ A;  3ZO5 B;  1P1A A;  4W9G A;  5J2R A;  4CQN A;  1NEN B;  4FBJ B;  3N9Y C;  3TEW A;  4ANV A;  1F2R C;  3ENE A;  4JX1 C;  4LNF A;  3DVG Y;  5BYS A;  3H7P B;  2FBW B;  2MP2 B;  2LUE A;  4HCP B;  4GDL B;  2DWQ A;  1YIW A;  4A6Q A;  3B9J A;  5D6J B;  3RT3 B;  2ZZP B;  3L17 A;  1Q0W B;  3KH0 A;  1UWX A;  4YT0 B;  1DGJ A;  2M4N A;  1Q1O A;  3T8M A;  2WXI A;  3IG3 A;  3TUO A;  1YN4 A;  2MJE A;  3IAM 1;  2WXH A;  3Q3O C;  1HE8 A;  3A4R A;  3ZXR A;  3EA6 A;  2IO1 B;  4GOC A;  3PS6 A;  1UGM A;  2HJ1 A;  3JSV A;  1J7A A;  5CHV C;  2IGG A;  4ANX A;  1JWB D;  1IBX A;  2HE7 A;  4FLH A;  4WQM A;  1AAR A;  4KX6 B;  4RGO S;  2ZEQ A;  1WWT A;  3CIR B;  2IJ0 A;  3PO0 A;  3P1M A;  1I42 A;  1TS4 A;  4W9C A;  3RPF C;  1GOZ A;  2D3A A;  2BS3 B;  3E9S A;  5GXG B;  3QWZ B;  1A70 A;  1XCQ L;  1WJN A;  2QCZ A;  3N1Y C;  4DDG D;  3PHW B;  2AEH A;  4P7I A;  4ITK A;  2FCS A;  2EKE C;  3HM3 A;  5C2T B;  1I4P A;  2LGS A;  4LTU A;  4M01 A;  4G50 A;  1QT9 A;  2FE8 A;  1YX6 B;  5TSS A;  3QQ8 B;  1YN3 A;  1G6J A;  3AEE B;  2N9K A;  2OED A;  3K9P B;  4KGT A;  4QAY A;  3R2T A;  5G5G A;  1XF5 L;  3WAL A;  3PHX B;  1CJE A;  2O6V B;  4OHJ A;  3R7R A;  4P1C C;  1NI2 A;  1JAL A;  4NJC A;  2MA9 B;  2LVQ A;  4RGN A;  2V4I B;  2ZVO A;  1ZXH A;  3VRA B;  1WIA A;  4NAW A;  2K8C A;  2JT4 B;  1E8Z A;  2VZK D;  3PLU A;  1TBE A;  2GBN A;  3BZD B;  2DAJ A;  2B76 B;  2G9H D;  3FAH A;  3Q3F A;  3PPA A;  4K3B A;  1LGR A;  2WXK A;  1STE A;  4HRS A;  3SEB A;  4MJS B;  2B3A A;  1GC7 A;  3M3J A;  1TS2 A;  2IYD B;  2KWV B;  1YX5 B;  3ZIM A;  1JWM D;  1OQQ A;  1EUV B;  3UIP B;  1QLB B;  2D2Q A;  2OJW A;  1BXT A;  2SEB D;  2KTR B;  2ZPN A;  3FKY A;  4MH8 A;  1Z5S B;  3TIX A;  3PZD A;  1SEB D;  1TJE A;  2JVC A;  4JIO U;  1QKZ A;  2KFK B;  3GE3 C;  1QOB A;  3BY4 B;  1NEK B;  4ZRI A;  2AQ3 B;  3Q8A A;  2L76 A;  1VDV A;  1CZP A;  2MRP A;  4NZL B;  2Y5P A;  1J7C A;  4TQ1 A;  1AN8 A;  4REZ A;  2Z0E B;  2V1Y A;  1WM3 A;  2N7D A;  2ZW1 A;  3DHI C;  4IOI E;  2MSE D;  4GDK B;  4BOS C;  3ZKJ C;  2W3S A;  1JRU A;  1BUI C;  2CU3 A;  3V05 A;  3QK0 A;  4W9D A;  2GBK A;  2J0J A;  2KDM A;  4YTN B;  5LXH A;  2LRU A;  2XNA C;  1EM7 A;  3AEA B;  3PV1 A;  3MC0 B;  4YSY B;  3P4R B;  4RM9 A;  1JWU D;  2KZR A;  2IZV B;  3AE2 B;  3RUL A;  3WA0 A;  5IN7 A;  1ESF A;  2KWC A;  3TMP B;  1IGC A;  1PUT A;  4BKS A;  1M4V A;  4BKG A;  3BYY B;  1VLB A;  3DWG C;  4A9A A;  4WWM A;  1WJ4 A;  5JHA A;  1LQB A;  5E6P A;  1SJE D;  1TY2 A;  4LDT B;  2NVU I;  2RGF A;  4J6I A;  4OZA A;  4FAD A;  1TTN A;  1P7F A;  1NDD A;  1C4P A;  2KOX A;  1WM2 A;  2NPT B;  1EU3 A;  1YJ1 A;  1WE7 A;  1K50 A;  3VUY A;  1MFW A;  3Q8F A;  2RMM A;  2WXQ A;  3KYC D;  2M1M A;  2FAZ A;  1PGA A;  1EWC A;  3L10 B;  2KDE B;  4GB9 A;  5E6O A;  1C1Y B;  2KVZ A;  2K25 A;  4TUU A;  2D3B A;  3MC9 A;  1I4R A;  1CQV A;  2MJ3 A;  3TL5 A;  1WSP A;  5DPR A;  5D94 A;  4KVG B;  2CHW A;  4TMA B;  4C4V A;  1ACC A;  3RI7 C;  2M17 A;  2JRI B;  5GMV A;  3U4E G;  4ZHO A;  3EUB 2;  4WQO B;  2Y3A A;  5IAA C;  4AJY B;  1N5X A;  3AE9 B;  5IA7 A;  1CK1 A;  3Q14 C;  4W9F A;  1V8C A;  3NS8 A;  1VZ7 A;  1N63 A;  3UIO B;  4JWS C;  1WX7 A;  2QIE B;  2K6Q A;  3Q3M C;  1ZDV A;  2GMI C;  2L83 A;  1EU4 A;  3U52 E;  5IKC M;  1TKY A;  3AE8 B;  1H4R A;  5DPS A;  3DVN V;  5LNK 1;  2ZVN A;  4KDI C;  1JWA D;  2KAJ A;  2LI5 A;  4WH4 A;  1GC6 A;  3TEZ A;  4KIK A;  4HK2 A;  4AQ7 A;  1EWY C;  1D6E C;  2GI9 A;  2YEP B;  4H2A A;  4P1B C;  1XQQ A;  3NOB A;  1A5R A;  3JSV B;  3AI5 A;  3VTW A;  2C7M B;  4HVB A;  3KUZ A;  4BAX A;  1ZUD 2;  1L6U A;  1DOY A;  1K52 A;  3AXC A;  4M0W B;  4XWT A;  4E71 A;  5DPW A;  3CSF A;  2LXA A;  2KMM A;  1C79 A;  2KK8 A;  1BT0 A;  4HCN B;  3A9J A;  4WJO A;  1Y8R C;  1C3T A;  1TS5 A;  2ASQ A;  3WAM A;  2I1K A;  4N6E B;  2ZW0 A;  1UBI A;  2LJI A;  4PS8 A;  1WY8 A;  2R2O A;  1FNV A;  4GDL A;  4YSX B;  4DHJ B;  4IWO A;  1XLQ A;  1C76 A;  3HRD D;  3VUW A;  4LLG M;  1KJT A;  3VRB B;  2AQ2 B;  3DQV A;  3FIL A;  2G4D B;  2LWP A;  3J9C A;  2Y5C A;  3A9K B;  2KYW A;  1ZXI A;  2C7H A;  2KN5 A;  2AL6 A;  1WFY A;  1MI0 A;  2WP9 B;  2LVP A;  5HI1 A;  1GB4 A;  3PT2 B;  3BWU D;  2MHJ A;  4ZOH C;  3UQB A;  5C3J B;  4C80 A;  2BYT A;  1DOI A;  3B1L X;  3VXW A;  1WJ6 A;  1F77 A;  2LAS A;  2JRH A;  3KQ4 A;  4B95 A;  2PE9 A;  2WWZ A;  1FNU A;  4GN1 A;  3OAW A;  3U7Z A;  1FPY A;  1I7H A;  4ICU A;  3VTU A;  4YXD B;  5KHQ A;  1WX8 A;  2J7Q B;  3JVZ X;  5C1Z A;  3AU4 A;  3SDL C;  1E7U A;  3ZTD A;  2O2V A;  2I1J A;  2OHF A;  4MJS A;  1E5W A;  1KF6 B;  5H92 C;  2D3G A;  2WNM A;  1TZ1 A;  3NZU A;  4NJ7 A;  4HKQ A;  2HD5 B;  2BYV E;  1FXT B;  4KGS A;  4FA6 A;  4MDK E;  2DYO A;  1S1Q B;  3EGR A;  2QDF A;  3O13 A;  4YSZ B;  1K51 A;  5HHD G;  4DHZ E;  3N20 C;  1WI0 A;  2BBC A;  3DWM A;  4CYE A;  2YEP F;  2BB6 A;  2PW9 A;  2KDF B;  4J3O D;  1IUE A;  2WDR B;  4K1R B;  3C19 A;  2WXF A;  1V81 A;  4ZRJ A;  2RDG A;  4M02 A;  2IGD A;  1KLU D;  1XLO A;  4KDL B;  4XZ4 A;  3N32 A;  3KUD B;  3ZYY X;  4I6N B;  4AWJ A;  2D5G A;  1MVK A;  4B0M A;  2G45 B;  1FRD A;  3L0W B;  1XLN A;  2XEW A;  3C0R B;  5G5H A;  2NTT A;  4GIV A;  2J53 A;  2JXT A;  2FCM A;  4RNA A;  3AM9 A;  4PS7 A;  2LGX A;  2AL3 A;  3O65 B;  3RZW C;  4G0N B;  1V5O A;  1I4G A;  2DLB A;  1E7V A;  1WRD B;  4AOF A;  1TT5 B;  3DBR I;  1SE9 A;  2M0X A;  1NBF C;  3R66 C;  4GDK A;  4DDI D;  1L0X B;  1SGH A;  4ZYN A;  2AQ1 B;  3AU5 A;  4BZA A;  3V6E B;  1IYF A;  2ZNV B;  3LJ3 A;  1L4D B;  1E9M A;  1V80 A;  4HEA 1;  1NI3 A;  1HXY D;  2KD0 A;  3HUI A;  4NJ6 A;  1QOF A;  1GPX A;  4MAC A;  3H6N A;  4I6L B;  2JQR B;  4HDO A;  4KGR A;  3JYU A;  4YL8 A;  2FUG 1;  3I57 A;  4XYC A;  2BS4 B;  1V2Y A;  1PGB A;  1QOG A;  4EEW A;  4C4V B;  3P42 A;  3MHZ A;  3DDC B;  2GBJ A;  1JCK B;  1WXV A;  4LNN A;  4EUT A;  2EKI A;  4N9F 4;  3LXF A; 
#chains in the Genus database with same CATH homology
 3DHH C;  3N1X C;  3GE3 C;  3RNG C;  3Q3M C;  1T0S C;  3Q3N C;  3N1Y C;  3RNC C;  3GE8 C;  3I5J C;  1T0Q C;  3RNE C;  1T0R C;  3Q2A C;  3Q14 C;  2RDB C;  3RMK C;  4P1B C;  3RNA C;  3N1Z C;  3Q3O C;  3N20 C;  3RNF C;  3DHI C;  2IND C;  3RNB C;  3DHG C;  3RN9 C;  4P1C C;  2INC C;  3RI7 C;  3I63 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...