3Q49B

Crystal structure of the tpr domain of chip complexed with hsp70-c peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
132
structure length
132
Chain Sequence
SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STIP1 homology and U box-containing protein 1
publication title Molecular Mechanism of the Negative Regulation of Smad1/5 Protein by Carboxyl Terminus of Hsc70-interacting Protein (CHIP).
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/chaperone
total genus 56
structure length 132
sequence length 132
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3q49B00
4YVOA 5CCMA 4UQYA 5JJ6A 4N2SA 3Q49B 2KCLA 1NA3A 4HOSA 3CEQA 3TG5A 3R9AB 2HO1A 4NQ0A 3ZHEA 2VSYA 4BWRA 2C2LA 3RO3A 5DIZA 2FBNA 2YQ8A 4I1AA 3QWWA 4GA0A 4ABNA 2PL2A 5G05C 2FI7A 3WXXA 3FFLA 3S7DA 1IHGA 3ZPJA 5G05J 4UQZA 3CK8A 1KT1A 4GYOA 5KJMA 3UUXA 2LSVA 1P5QA 4I2WA 2JLBA 4N39A 1B89A 2XPIA 2DBAA 3UQ3A 4AM9A 4RG6A 3CV0A 4H7XA 3PDNA 5EKQD 5ARFA 2IF4A 4KYOB 1W3BA 1FCHA 4JA9A 1QQEA 4I9CA 2GW1A 3URZA 3CKCA 2UY1B 1XNFA 2XGOA 4UI9C 4IN3B 2VGXB 5D0QD 3CK9A 4BTAA 4F3VA 3Q15A 4U07A 3RIBA 2NC9A 4WNDA 3S7FA 3CKBA 2MHKA 3S7BA 2PQRA 5FT9A 4EQFA 4BT8A 2XGMA 4J0UA 3U4TA 3KD7A 5KJLA 3SF4A 2VQ2A 3MV3B 2HYZA 3FWVA 1Y8MA 3ASGA 4WNEA 2YHCA 4J8FA 1ELRA 4Y6WA 2I6HA 2XGSA 2XEVA 3LPZA 5ARGA 3TGOA 4XIFA 3RJVA 2KCVA 3TG4A 4G2VA 4J8DA 2VGXA 4XI0A 4I17A 4G23A 2C0MA 4HOQA 4RG9A 4H7YA 3MA5A 2QFCA 3UPVA 4U04A 3N71A 5CHEE 3QWPA 3CVPA 3VTXA 3KAEA 4G1TA 4Y6CA 5JJ7A 3KS2A 4BTBA 1QZ2A 2E2EA 4GYWA 4N3AA 4YVQC 3LCAA 2LSUA 3CVQA 3QWVA 4KXKB 5G04C 3PE3A 1A17A 3RU0A 4GZ6A 4U0ZA 3ZHEB 4N5CA 3NF1A 5G04J 2KATA 2ONDA 2WQHA 4UI9J 4GPKA 4I9EA 3QDNA 3LY7A 3CVLA 4N3BA 3ULQA 3U3WA 4AY6A 5M72A 1HXIA 4I2ZA 5C1DA 2XCCA 4G26A 4HOUA 3LYAA 2KCKA 5A6CA 3CK7A 3IEGA 3LY8A 3Q47B 3ZGQA 5CCLA 4GCNA 3JYSA 2FEZA 2OOEA 4CGVA 4JL0A 3LY9A 4GZ5A 4G25A 1IYGA 5BNWA 2P58C 5JJTA 5KJNA 4APOA 1YA0A 1WAO1 3ASDA 3ZFWA 2UWJG 4UI9K 3ASHA 1KLXA 4J8EA 5FZRA 4U0SA 3K9IA 4W9RA 4A1SA 3BEEA 3S7JA 2HR2A 3PE4A 3SZ7A 5HQ8A 4GA2A 4CGWA 2VSNA 5FZQA 1ZBPA 5AYWD 1OUVA 2UY1A 3GZ2A 4GZ3A 4GA1A 3GZ1A 3EDTB 5DBKA 3FP3A 4LEUA 3AS8A 4O6FA 2PZIA 3VTYA 5FJYA 4ME2A 2WPVA 4N2QA 4UQXA 2IFUA 1ZU2A 3OXFA 1E96B 2KC7A 4YNDA 3MEKA 3AS5A 4NRHB 1HH8A 3QKYA 3GYZA 5FTPA 3AS4A 2BUGA 2Y4UA 3ASFA 5EX0A 1TJCA 2VGYA 3GW4A 4WNGA 3OXLA 5LCWC 4CDRA 1NZNA 2J9QA 2PQNA 5LCWJ 4AY5A 3ESKA 5KJKA 5BW8C 3Q5MA 1PC2A 3CVNA 3Q4AB 4N3CA 4WUYA 5FZSA 1WM5A 3OXGA 1KT0A 3MV2B 2R5SA 3E4BA 2C0LA 4JA7A 1ELWA 4JHRA 4WNFA 4HORA 2VYIA 3RO2A 2Y4TA 2L6JA 2FO7A 4HOTA 4G24A 3LKUA 2LNIA 4GYYA 5EX3A 3TAXA 2FF4A 3HYMB 5BT1A 2Q7FA 3ZN3A 4U0UA 3MKRA 2V5FA 5A7DB 4B94A 4KBQA 2AVPA 5D0OD 2XCBA 3QOUA 4BT9A 1HZ4A 3O48A 1NA0A 3RKVA 5HI7A 4AIFA 4XI9A 4GCOA
chains in the Genus database with same CATH superfamily
2P9PG 1TJFA 3Q49B 1N54A 1H2TC 4K0RA 3CEQA 4HRNA 2IU1A 4UWGA 4E85A 4I1MA 2IJGX 4IYPA 1Z3YA 2CFUA 2YQ8A 4I1AA 2FI7A 3UM3A 1N52A 1SA4A 3ZPJA 2DVWA 5G05J 4D10C 1YMPA 1D9SA 1XGWA 4L23A 3CR3A 3UUXA 2LSVA 3PUKA 3JQ0A 2JLBA 3I3NA 2R59A 1PAQA 2XQ0A 3LS8A 3G2VA 3HXCA 3FU6A 3OTNA 1O1SA 2Y0BG 4KYOB 3QAQA 5AIJA 5C2YA 1QQEA 3WG7E 2GW1A 2WQ6A 3CVVA 2EIME 4YDYA 1BI8B 2P9KG 2P9IG 3EHRA 5J08A 1XNFA 2XGOA 3AG4E 3LDZA 4HRLA 2J4DA 2OVFA 4PS3A 1OCRE 5FQ8A 1Y6IA 2QYJA 4F3VA 4LSZE 3G2UA 2CHXA 2V5QC 3ONLA 3RIBA 1IKND 5EYPF 4J8SA 3SNXA 2X6JA 3HXDA 1FVFA 4BT8A 4XKBA 4AEZC 2BKKB 3U4TA 4RQIA 5FQ6A 3J5PA 3FH7A 3HHMA 5KJLA 4DX2A 4UUCA 2IO3C 2HYZA 4PS8A 1Y8MA 1IHBA 4XX5A 3CHRA 4BFRA 2F37A 1OWNA 3F6QA 3CHSA 5CEDB 2I6HA 2XGSA 3UT7A 2KCVA 5LFAA 4Q94A 3L6AA 1VDYA 1K1AA 4HOQA 4JHJA 5BV1A 2F8YA 4JZYA 4LNGA 5D66A 3ZIMA 3UPVA 3FU0A 4ZHBA 5CHEE 5KBAA 5ENSD 2GROB 3VTXA 2OCCE 1G3NB 4Y6CA 3CHMA 1HG5A 2WMNA 4BTBA 4DUIA 5J90A 2IEJA 3IBEA 4LUNU 1KZOA 4HQDA 3LCAA 5ENPD 3CVQA 3TWSA 4U8HA 5G04C 3E37A 4B0ZA 3D9HA 4ANWA 3ZYMA 2EILE 4MKTA 4UI9J 3MX3A 3QDNA 4N3BA 2MYOA 3LVQE 3U3WA 4NIKA 5M72A 2V4HC 3FUFA 3L08A 3UX4A 4G26A 4GMLA 4HOUA 2WVIA 2WXMA 4CRWA 4AVXA 5ENRD 2QY7A 4CGVA 3APDA 4GTOA 3LY9A 5FIOA 4DX1A 4C0MA 3UM1A 4APOA 1D8EA 3ASDA 4UI9K 3ASHA 2GRNB 2DWZA 3HG0D 3V30A 4A1SA 3ZKJA 3PE4A 4UWLA 5G55A 4CGWA 5AQAA 5AYWD 4A3TA 4U8VD 5ENNA 4GZ3A 2L6BA 3P1UA 2X6IA 3EDTB 4XKCA 2GRMA 5DBKA 3PUJA 3AS8A 5BUZA 3T5XA 2PZIA 3JCKC 3T8MA 3UKRG 3NOGD 1O5MA 1LTXA 2CHWA 4DI3A 3OXFA 4JPSA 2VTBA 1E96B 2KC7A 3Q78A 3E33A 3VLDA 2J08A 3AS5A 3E32A 3AU4A 3FUEA 1QBQA 5T4YA 2BUGA 4JVSA 1TJCA 1NI1A 2VGYA 1AP7A 4CYMD 2HE0A 3OXLA 4CDRA 1Z5SC 2EIJE 4OYSA 1V55E 3TWTA 2H6GA 1E7VA 3ESKA 3LXUX 5BW8C 3UIPC 4CDMA 2J8SD 1EF1C 5AQBA 2V8SE 1NFIE 2H6IA 3Q7AA 2XRZA 4DI4A 2XZDG 1KT0A 3G2TA 4GTSA 3FTZA 1H0AA 3LEWA 2R5SA 4Q96A 2JABA 5EN5D 2ETBA 4PH4B 3FEYA 3KEAA 1S70B 4C0EA 3KEZA 4HORA 2Y4TA 4L9PA 4BSXA 1TNUA 2FO7A 5B3SE 1ELKA 4G24A 3TAXA 1OCCE 2AJAA 4BETA 5LOZA 1OWPA 1TN6A 5D0OD 4KZCA 2XCBA 4C9BB 4EZKA 3O48A 4A63B 4XI9A 3RAUA 4GCOA 3FTYA 3NBNB 4TXPA 2AW6A 3V31A 1V54E 4UQYA 4E6HA 2KCLA 1NA3A 5LP0A 2E0IA 3TG5A 5HS0A 2I1KA 3ZHEA 2FULA 2WXOA 4FLBA 1JWGA 2VSYA 3ESLA 4GZCA 4KVOA 3RO3A 3ABME 5DIZA 5B1AE 5T8IA 2Y1LE 2LUHA 4ABNA 2PL2A 4ILIA 1N4RA 1S64A 4EPZA 1TEZA 1U2VG 1IHGA 2BF0X 1UOHA 4UQZA 2AXUA 4CT0A 1MYOA 4V3IA 4GYOA 4HBDA 3B7SA 3LJNA 2LO6A 1JCQA 1B89A 2DBAA 5FQ4A 3MGBA 1UN9A 3JXIA 5E75A 4GTVA 2DZNA 2J07A 3CV0A 3PDNA 5EKQD 4B8AA 5ARFA 3Q75A 4MLPA 4U96D 2L9BA 1W3BA 4F6RD 4JA9A 3RK6A 1EDUA 2I1JA 3UM2A 1N9AA 4MBGA 3LVRE 3W9GA 4WAFA 4BX9A 4YDOA 2ETAA 2XZTG 3APCA 1N4QA 1RW2A 5AAOA 4IN3B 5ENTD 3CHQA 4ACKA 4GTQA 4L2LA 2H6FA 1H2UA 2ILRA 4GU5A 2B0OE 4U07A 3T9KA 3QB2A 1Q2ZA 2MHKA 1BLXB 3SY2A 2KXPC 4GPMA 3BQOA 2XGMA 5LX8A 2EQXA 3FU5A 3UXGA 3NAWA 1DCEA 2R05A 2RFMA 2P9SG 2VQ2A 1TNOA 4B93B 1X81A 2YHCA 4J8FA 1ELRA 3QJZA 3VLFA 4J8YA 3LPZA 5ARGA 3TGOA 3GZSA 4XEIG 4XIFA 3SD5A 3RJVA 4G2VA 4BY6A 2IO2C 1O1RA 3HXBA 1YYHA 2Y69E 2YNQA 1BU9A 4IULA 3TWQA 2QC9A 2QFCA 1IQRA 2VJ8A 3SO8A 2KZTB 1U3CA 3ONKA 3KS2A 5CEAA 4ANUA 3ZNGA 4K5CA 1PY1A 5EIDA 2X6FA 4YVQC 4XZ4A 2WXRA 2LSUA 4KZ0A 1JCRA 2MOWA 4KXKB 1OCOE 1H6PA 3PE3A 1K8KG 2OVBA 3ULYA 3W9FA 3ASOE 4GZ6A 4HNAD 4UWKA 2J49A 4RSYA 2X6KA 5G04J 1N0QA 4DX6D 2IOSA 2CHZA 3IV0A 2WQHA 3LY7A 1S0PA 3CVLA 1HE8A 3JUEA 3UMVA 3EU9A 4I2ZA 4JEHA 2PM6A 3QARA 2KCKA 3CK7A 3IEGA 3Q47B 1TN7A 3ZGQA 1MX2A 5CECB 3CLJA 3ZUVB 3RSEG 1N0RA 2OOEA 3PNTB 4GZ5A 4G25A 2P2CP 1IYGA 2KZTA 2P58C 5KJNA 4NACA 3ZFWA 2UWJG 1FT2A 4Q69A 1KLXA 4LCTA 4J8EA 1S63A 5AENA 4U0SA 2QZAA 4W9RA 4ATGA 2HR2A 3DSVA 4F1PA 4GA2A 4F1SA 1LF8A 3EHMA 2VSNA 1ZBPA 2R17C 2R2LA 3FUNA 3GZ2A 4HLLA 4GA1A 1NL4A 2IQCA 1RZ4A 2ZU6B 3R7QA 4LEUA 2WXKA 1WY6A 4XE0A 5FJYA 4ME2A 2WPVA 1K1BA 3ZXPA 4N5QA 3SFYA 1HO8A 3FEXA 4TXRA 3NZSA 3MEKA 4NRHB 3IHVA 4ANVA 3AS4A 4M7CA 2Y4UA 3ASFA 5EX0A 5KNGA 3GW4A 3FHEA 4I6JA 3CQGB 3ZRHA 2GGFA 2XRYA 2J9QA 1Z6TA 2PQNA 2RD0A 4JEUA 3R7RA 3CVYA 1OWOA 1PC2A 5KWDA 3CVNA 2WXNA 4L7TA 2RKKA 1UW4B 4ANXA 3HXEA 3I4RB 5FZSA 3OXGA 3EUVA 3MV2B 4JW1A 2EIKE 4JA7A 2GRLA 3FTXA 4WNFA 1DNPA 4Z68A 1E8WA 4AJWA 1HS6A 3J5QB 3DRAA 3AJIA 3PZ2A 3EHQA 4P29A 1SA5A 1U3DA 1IXVA 1JPLA 5EX3A 3RRNB 2FO1E 4ZFHA 2FF4A 5CRVA 3MKRA 4J6IA 3VLEA 1H6KA 3KSQA 1WG0A 1NA0A 5HI7A 4BESA 5H7PA 5ANLA 4RLYA 3TWUA 3O4ZA 5JJ6A 4N2SA 5T3RA 3PEVB 4GMJA 3B7BA 1DC2A 3SFZA 4FULA 3DWLG 2HO1A 4NURA 2L0IA 4EZLA 1TN8A 3SFXA 4HRMB 3C3QA 3SQVA 3EIJA 3MJWA 3TWWA 3P2BA 1KZPA 5ENOD 2FBNA 2F0YA 3QWWA 4GA0A 3QNKA 3PZ4A 3BUAA 3FFLA 3D9MA 3U9WA 3S7DA 1NP7A 2ZGDA 3DXKG 3UIOC 3FUHA 3CK8A 4I43A 4EBAA 4G11A 4DX5D 2BKGA 1P5QA 4APFA 4MS6A 3UQ3A 3AAAC 4AM9A 3TWVA 1MX4A 4FJZA 1EPUA 3CVXA 3UT8A 3QK0A 3L13A 4ACLA 1N95A 1MX6A 1FCHA 4PDXA 3SGHA 2ZXWE 3MCXA 3URZA 4HI8A 4WWOA 5HKPA 3CKCA 3HDXA 2UY1B 4A1GA 1A5EA 4UI9C 2VGXB 2GRQB 4B8CB 4FP7A 2KM4A 4LNBA 4LNUD 3ZVVA 4BTAA 3Q15A 3C5RA 3LJ3A 2NXPA 3R9MA 4WNDA 3S7FA 3CKBA 1FVHA 3S7BA 2H6HA 4UWFA 3CVWA 2PQRA 3BU8A 2YINA 4AP2A 3PH0C 1FPPA 4CEMA 1N4PA 2OEVA 5EYLA 3KSLA 3TWRA 2CG3A 1TNBA 3Q7FA 2X6HA 4HLEA 3PNLB 3L9TA 5HRYA 2R03A 1HU3A 4LRZA 4F53A 5A23A 4JC8A 4WNEA 2DIWA 2GRPB 2A5UA 2I2OA 2XS8A 4Y6WA 2DYRE 4PS7A 2A5EA 3CVUA 2P9NG 2XEVA 2LXMA 3FUMA 3TG4A 5KNHD 4J8DA 2VGXA 3X2QE 4H7YA 1QNFA 2WXGA 4U04A 4U95D 4FA6A 3IXEA 3HXFA 3CVPA 4G1TA 1OCZE 3TL5A 5JJ7A 3NB2A 3AU5A 2V0PA 2GRRB 1OWMA 1YCSB 1QZ2A 4TUMA 4EBAG 3FDHA 4N3AA 5AQ7A 3OAWA 4GZDA 3B7UX 3CSFA 2P9UG 3QWVA 1A17A 3EU5A 1JUQA 1E8YA 3UT4A 4PUCA 4N5CA 3EJNA 3D9LA 3E34A 4I9EA 4OVVA 4AY6A 5CRUA 1HXIA 3D9JA 3DPDA 4G8LA 4QQIA 4EZJA 3NQPA 5FQ7A 3HVEB 3LYAA 4M3OA 4GMRA 5A6CA 1SW6A 3LY8A 5CCLA 4GB9A 3JUIA 4GCNA 2FEZA 2WXFA 2XHEA 4JXTA 4URKA 3ML9A 3FUIA 3DSUA 3T5VA 5JJTA 4K5BA 1BD8A 1QYMA 1YA0A 3DSTA 1WAO1 1H6OA 4EHMA 3ULEG 4AXHA 3B7RL 4F7AA 1BPOA 4DX7D 1Z3XA 3K9IA 5EILA 3BEEA 3PS6A 3S7JA 5B1BE 2WXQA 1OY3D 5FZQA 3APFA 4ILGA 1OXJA 4FADA 2R02A 1E7UA 2YHEA 2QYUA 3DSSA 3CQCB 2BEDA 4KT6B 5CBNA 3FP3A 1UJJA 3MYVA 1OWLA 3UTMA 3BG1B 3CHPA 2OV8A 4N2QA 1HF8A 1ZU2A 3AG3E 3DSWA 3L22A 4CT4A 3HVEA 2HM8A 4YNDA 3IKOB 4WWPA 4CDNA 3D9NA 1N11A 3QKYA 5FTPA 3PREA 2IONA 4OAVB 3ISMC 2AXVA 3FTUA 2DCPA 2CG2A 2A4ZA 2J09A 3S2AA 1FT1A 1D8DA 5LCWC 1L5JA 4I1OB 3AG1E 3ZYKA 1NZNA 3JXJA 4O1OA 3SBSA 4O1PA 3ZEFA 3TXNA 3EIQC 3E30A 1H2VC 3Q4AB 2VGEA 4WUYA 3ABLE 4OAUC 2XS1A 1HX8A 2XPYA 2WQ7A 1UN8A 2XEHA 3E4BA 5AN8A 3PZ3A 2C0LA 4JHRA 5BV0A 3L16A 2VYIA 3Q9UC 1N4SA 1INZA 3RRUA 1MJ0A 3FH8A 2V4LA 4HOTA 3JQ1A 4MRUA 3LKUA 3BG0B 4JHKA 3HYMB 2Q7FA 3V79K 5A7DB 3C72A 2J4BA 4BEPA 4KBQA 3NZUA 4EECA 1LD8A 3FY4A 4L1BA 3QOUA 3UKUG 2MRIA 1TR4A 3T8KA 2XEEA 1JWFA 3QC1A 1ZB1A 4YVOA 4U7EB 5CCMA 1K3ZD 3DEPA 4O60A 1IQUA 5G2NA 4HOSA 3R9AB 3DSXA 3NOCD 4ILHB 5ITZF 5FWQA 5EDSA 4NQ0A 1SVXA 1DVPA 4BWRA 2C2LA 2WMOA 5G05C 4TRQA 5BXUA 3WXXA 2PNNA 3ASNE 5JHAA 3CSTA 2XPZA 1KT1A 5EIBE 3FTSA 4ATZD 5KJMA 4I2WA 4N39A 2XPIA 3DBSA 3PRZA 4RG6A 3U66A 4H7XA 2RG8A 3L82A 4C48B 2X38A 3D9KA 4JD2G 4A3VA 2IF4A 4DLOA 5FINA 3MZLB 1JCSA 5BPPA 5CMYA 4GTRA 1N94A 4I9CA 5AJDA 3FTWA 4FC8A 3FU3A 3I4GA 1SZAA 2AXZA 3UINC 3DXMG 3IHYA 5D0QD 4QFVA 5E76A 2WM9A 3D3MA 3PZ1A 3CK9A 1E8ZA 1UG3A 5AQ9A 4DK5A 5IY5E 2NC9A 2AWIA 5JA4D 1E90A 3TWXA 2ZGGA 3Q73A 3ABKE 4FHKA 3ZXSA 2VTBB 5FT9A 3D9PA 4EQFA 4HVBA 2I9CA 3CGHA 4J0UA 4FJYA 2WXJA 3KD7A 2LAHA 3FUDA 3V2XA 3I5PA 4RVBA 1TYQG 4JB8P 3UM0A 3SF4A 4TV3A 3MV3B 3FWVA 3FH5A 3FUJA 2X3MA 3B95A 3D9IA 4BSZB 4DLQA 3ASGA 3ML8A 2XENA 2KBXA 2PM7A 3FUKA 3SHFA 1KPSB 5AARA 2OEWA 2DYSE 4GTPA 2WXIA 2F8XK 5CMWA 4HFGA 4XI0A 3ZU7B 4I17A 4G23A 2C0MA 4YDWA 2ZIRA 4RG9A 3L17A 3MA5A 3CIAA 4FLHA 3PVLA 3N71A 3QWPA 4G8KA 4KVMA 4K5AB 3G2WA 5AJLA 4YDEA 3KAEA 2L0TB 2M63A 1HFAA 2DZOA 3ZYQA 5CERB 1WDYA 2E2EA 3PZDA 4GYWA 3D9OA 2IOLA 3ZW3A 3V2OA 4A55A 3FTVA 5ENQD 2VSXE 1MQSA 3Q9NC 3RU0A 3PEUB 4WWNA 4AOFA 2IY0C 4U0ZA 3ZHEB 3NF1A 3B7TA 2KATA 2ONDA 1SZ9A 2CFZA 2LAIA 4GPKA 4FU3A 3MKQB 4GTTA 1DCQA 3ULQA 3DEOA 1OT8A 5D2MC 1LD7A 4U63A 5C1DA 2XCCA 1HG2A 4HXIA 4BERA 1AWCB 4L2YA 1TNZA 5CBOA 4J7WA 3TJPA 5ANRA 3UI2A 3JYSA 4JL0A 4GTMA 4X8QA 5BNWA 2ETCA 4UWHA 5JMND 4OVUA 5JHBA 5FZRA 4I6EA 2Y3AA 4HI9A 4B89A 2BTDA 1E8XA 3SZ7A 3AG2E 4LERA 5HQ8A 2ZISA 3DPYA 2NYJA 1H19A 4CCAA 1OUVA 2UY1A 4AV7A 3U64A 1MHQA 3GZ1A 2NSZA 2RFAA 3TXMA 3MKQA 4HB5A 4O6FA 3SBTB 3VTYA 4GAAA 3G2SA 4LG6A 4U8YD 3ENEA 3SI5A 4UQXA 2IFUA 1X5BA 5BXOA 1MZCA 4HS2A 4K03A 3CHOA 4DRXE 1HH8A 3GYZA 3RRMB 1GW6A 1EYHA 2EINE 3C3RA 4WNGA 1O1TA 4R7LA 3C3OA 3FULA 4DPRA 5LCWJ 4AY5A 1SQMA 2LXLA 5KJKA 2B6CA 1TNYA 3Q5MA 2WXPA 3C98A 4N3CA 4CZ2D 4FHJA 2VSOE 3HRAA 1WM5A 4TXQA 2P9LG 1ELWA 3EHNA 3RO2A 2L6JA 4DJAA 4I6GA 2LNIA 3L54A 4GYYA 4KMOA 5BT1A 5KCMA 3ZN3A 4U0UA 2V5FA 4B94A 2AVPA 2JEKA 2WXHA 4BX8A 4BT9A 2WB2A 3HIZA 3B13A 1UJKA 1HZ4A 3Q79A 4TUUA 3RKVA 4AIFA 4IRUA 3ZYLA 2WXLA 1BI7B
chains in the Genus database with same CATH topology
4YVOA 5ANLA 2AW6A 5CCMA 5G2NA 1IQUA 4UQYA 4E6HA 3O4ZA 1TJFA 5JJ6A 4N2SA 3Q49B 2KCLA 5T3RA 1NA3A 3PEVB 5LP0A 1N54A 4GMJA 4HOSA 1H2TC 4K0RA 2E0IA 3CEQA 2IU1A 3SFZA 3R9AB 4FULA 3TG5A 4UWGA 2HO1A 4NURA 2L0IA 4E85A 4EZLA 2I1KA 4ILHB 4I1MA 5FWQA 5EDSA 4NQ0A 2IJGX 3ZHEA 2FULA 2WXOA 4FLBA 3EIJA 1DVPA 3MJWA 1JWGA 4IYPA 2VSYA 3ESLA 1Z3YA 3P2BA 4GZCA 4KVOA 4BWRA 2C2LA 2CFUA 3RO3A 5DIZA 2WMOA 2FBNA 5T8IA 2YQ8A 4I1AA 3QWWA 4GA0A 4ABNA 2PL2A 5G05C 4ILIA 3QNKA 4TRQA 2FI7A 3WXXA 4EPZA 1TEZA 3FFLA 3D9MA 3U9WA 3S7DA 1N52A 1IHGA 1NP7A 3ZPJA 2BF0X 5JHAA 5G05J 4UQZA 3CSTA 4D10C 2XPZA 2AXUA 4CT0A 3FUHA 3CK8A 1KT1A 4I43A 4V3IA 4GYOA 4EBAA 1XGWA 3FTSA 4G11A 4L23A 5KJMA 3B7SA 3CR3A 3UUXA 2LO6A 1P5QA 2LSVA 4I2WA 3PUKA 4APFA 3JQ0A 2JLBA 4N39A 3I3NA 1B89A 2XPIA 2DBAA 5FQ4A 2R59A 1PAQA 3MGBA 1UN9A 2XQ0A 4MS6A 3UQ3A 3LS8A 3G2VA 3DBSA 5E75A 4AM9A 3FU6A 3PRZA 4RG6A 3U66A 2J07A 3CV0A 4H7XA 4FJZA 2RG8A 3PDNA 1EPUA 2X38A 5EKQD 3OTNA 3D9KA 5ARFA 4B8AA 3CVXA 3UT8A 4A3VA 4MLPA 2IF4A 3QK0A 4DLOA 3MZLB 4KYOB 3L13A 5BPPA 2L9BA 4ACLA 3QAQA 1W3BA 5CMYA 1FCHA 5AIJA 4JA9A 4PDXA 5C2YA 3SGHA 1QQEA 3RK6A 4I9CA 3MCXA 2GW1A 2WQ6A 1EDUA 2I1JA 5AJDA 3URZA 3CVVA 4WWOA 3LVRE 3CKCA 3FTWA 4WAFA 4BX9A 3HDXA 4FC8A 3FU3A 5J08A 2UY1B 3APCA 3I4GA 1SZAA 1XNFA 2AXZA 2XGOA 4A1GA 3LDZA 4UI9C 4IN3B 2VGXB 4B8CB 4FP7A 2J4DA 2KM4A 2OVFA 3IHYA 4PS3A 5D0QD 4QFVA 5E76A 3CHQA 2WM9A 3D3MA 5FQ8A 1Y6IA 3CK9A 4ACKA 3ZVVA 4L2LA 4BTAA 1H2UA 3Q15A 4F3VA 2ILRA 3LJ3A 1E8ZA 2NXPA 4GU5A 1UG3A 3G2UA 2CHXA 4U07A 4DK5A 3ONLA 3RIBA 2NC9A 4WNDA 3QB2A 2AWIA 3S7FA 3CKBA 1FVHA 2MHKA 1E90A 4J8SA 4FHKA 3S7BA 4UWFA 3SNXA 3ZXSA 2PQRA 3CVWA 2VTBB 2YINA 5FT9A 4AP2A 3D9PA 4EQFA 2X6JA 4HVBA 3PH0C 4CEMA 2I9CA 1FVFA 4BT8A 4XKBA 4AEZC 2XGMA 3CGHA 5LX8A 4J0UA 2EQXA 4FJYA 2WXJA 3U4TA 3FU5A 3KD7A 2LAHA 2CG3A 5FQ6A 3FH7A 3HHMA 2X6HA 4HLEA 5KJLA 3PNLB 3FUDA 3I5PA 4RVBA 3SF4A 2VQ2A 4TV3A 1HU3A 3MV3B 4LRZA 2HYZA 3FH5A 3FWVA 3FUJA 2X3MA 4PS8A 1Y8MA 3D9IA 4F53A 5A23A 4JC8A 4DLQA 3ASGA 3ML8A 4WNEA 4XX5A 2YHCA 2DIWA 3CHRA 3CVYA 4BFRA 2A5UA 2I2OA 4J8FA 1ELRA 2PM7A 1OWNA 3QJZA 3FUKA 3VLFA 3CHSA 4Y6WA 3SHFA 4PS7A 2I6HA 2XGSA 3CVUA 2XEVA 3LPZA 5ARGA 3UT7A 3TGOA 3GZSA 4XIFA 3SD5A 3RJVA 2KCVA 5LFAA 3FUMA 4Q94A 3TG4A 3L6AA 4G2VA 4J8DA 4BY6A 2WXIA 2VGXA 1VDYA 5CMWA 4HFGA 4XI0A 4I17A 4G23A 2C0MA 2YNQA 4HOQA 4JHJA 4RG9A 4H7YA 4IULA 5BV1A 4JZYA 3L17A 1QNFA 2WXGA 3MA5A 3CIAA 2QFCA 4FLHA 3FU0A 3ZIMA 4U04A 3UPVA 3PVLA 3N71A 5CHEE 3QWPA 4FA6A 1IQRA 4KVMA 2VJ8A 3CVPA 3G2WA 3VTXA 5AJLA 2KZTB 3KAEA 2L0TB 4G1TA 1U3CA 2M63A 3TL5A 1HFAA 4Y6CA 5JJ7A 3ONKA 3CHMA 1HG5A 2WMNA 3KS2A 3AU5A 3ZYQA 4BTBA 5J90A 4ANUA 2V0PA 1OWMA 3IBEA 4LUNU 1QZ2A 2E2EA 3PZDA 4GYWA 4EBAG 1PY1A 3FDHA 4N3AA 2X6FA 3D9OA 2IOLA 3LCAA 3OAWA 4GZDA 4XZ4A 3B7UX 4YVQC 3CSFA 3ZW3A 4A55A 3FTVA 2WXRA 2LSUA 4KZ0A 3CVQA 3QWVA 2VSXE 2MOWA 4KXKB 4U8HA 5G04C 4B0ZA 3PE3A 1A17A 1JUQA 2OVBA 1MQSA 3RU0A 3PEUB 1E8YA 4ANWA 4WWNA 3UT4A 4AOFA 4PUCA 4GZ6A 4UWKA 3ZYMA 4U0ZA 2J49A 4RSYA 2X6KA 4N5CA 3EJNA 3NF1A 5G04J 3ZHEB 2IOSA 2CHZA 3B7TA 2KATA 3IV0A 3D9LA 2ONDA 1SZ9A 2CFZA 2WQHA 4MKTA 2LAIA 4UI9J 4GPKA 3MX3A 4FU3A 3MKQB 4I9EA 3QDNA 3LY7A 1S0PA 3CVLA 4N3BA 3ULQA 3LVQE 4OVVA 3U3WA 4AY6A 1HE8A 5M72A 1HXIA 4U63A 3FUFA 3D9JA 3DPDA 4I2ZA 4JEHA 3UMVA 3L08A 4EZJA 5C1DA 2XCCA 1HG2A 4HXIA 3UX4A 4G26A 3NQPA 5FQ7A 4GMLA 4HOUA 2PM6A 2WVIA 3HVEB 3LYAA 4L2YA 3QARA 2KCKA 4M3OA 5A6CA 2WXMA 4CRWA 3CK7A 3IEGA 3LY8A 3Q47B 3ZGQA 4AVXA 5CCLA 3CLJA 2QY7A 3TJPA 4GB9A 3JUIA 4GCNA 5ANRA 3JYSA 2FEZA 2OOEA 2WXFA 4CGVA 3APDA 2XHEA 4JL0A 3PNTB 4JXTA 3LY9A 4URKA 4GZ5A 3ML9A 4G25A 1IYGA 4C0MA 5BNWA 3FUIA 3T5VA 2KZTA 2P58C 5JJTA 5KJNA 4APOA 1YA0A 4UWHA 1WAO1 4OVUA 3ASDA 4NACA 3ZFWA 2UWJG 4UI9K 3ASHA 4AXHA 3B7RL 1KLXA 4LCTA 4Q69A 4J8EA 4F7AA 1BPOA 5JHBA 5FZRA 4I6EA 5AENA 1Z3XA 4U0SA 3K9IA 4W9RA 4A1SA 2Y3AA 3BEEA 3PS6A 2HR2A 3S7JA 4ATGA 4B89A 2BTDA 1E8XA 3PE4A 4LERA 3SZ7A 5HQ8A 4GA2A 4UWLA 2WXQA 4F1SA 5G55A 4CGWA 1LF8A 3EHMA 2VSNA 5FZQA 1ZBPA 3APFA 2R17C 4ILGA 1H19A 3FUNA 5AYWD 4FADA 4CCAA 1OUVA 4A3TA 2UY1A 3GZ2A 5ENNA 1E7UA 4AV7A 4GZ3A 4GA1A 3U64A 2YHEA 2IQCA 1MHQA 2X6IA 3P1UA 3GZ1A 3EDTB 2ZU6B 3CQCB 2NSZA 4KT6B 4XKCA 2GRMA 5DBKA 3FP3A 4LEUA 3R7QA 1UJJA 3PUJA 3TXMA 3AS8A 3MYVA 5BUZA 2WXKA 1WY6A 4XE0A 1OWLA 3MKQA 3T5XA 4O6FA 3BG1B 3SBTB 2PZIA 3CHPA 3JCKC 4GAAA 3G2SA 3VTYA 5FJYA 2OV8A 3T8MA 4ME2A 2WPVA 3ENEA 3SI5A 4N2QA 4UQXA 2IFUA 1HF8A 1ZU2A 1X5BA 2CHWA 4DI3A 3OXFA 3L22A 4JPSA 4HS2A 4CT4A 2VTBA 4K03A 1HO8A 1E96B 3FEXA 3HVEA 2HM8A 2KC7A 3IKOB 4WWPA 3CHOA 4YNDA 3NZSA 4CDNA 3MEKA 3VLDA 2J08A 3AS5A 4NRHB 1HH8A 3D9NA 3AU4A 3GYZA 3IHVA 1GW6A 3FUEA 3QKYA 5FTPA 3PREA 3RRMB 3AS4A 2IONA 4ANVA 2AXVA 3FTUA 1EYHA 2BUGA 5T4YA 2DCPA 2Y4UA 3ASFA 4JVSA 5EX0A 2CG2A 2A4ZA 2J09A 1TJCA 3S2AA 2VGYA 3FHEA 3GW4A 4WNGA 3OXLA 5LCWC 1L5JA 4I1OB 4R7LA 4CDRA 3ZYKA 4I6JA 3CQGB 3ZRHA 1NZNA 2GGFA 2XRYA 3SBSA 2J9QA 3FULA 1Z6TA 2PQNA 4OYSA 4DPRA 2RD0A 3ZEFA 3TXNA 5LCWJ 4AY5A 4JEUA 1SQMA 3ESKA 1E7VA 5KJKA 3LXUX 3EIQC 5BW8C 3R7RA 4CDMA 1OWOA 2WXPA 3Q5MA 1PC2A 3C98A 1H2VC 3CVNA 2WXNA 3Q4AB 4L7TA 4N3CA 4WUYA 1EF1C 4FHJA 1UW4B 2V8SE 1HX8A 4ANXA 2VSOE 2XRZA 3I4RB 2XPYA 5FZSA 1WM5A 4DI4A 3OXGA 2WQ7A 1KT0A 3G2TA 1UN8A 3MV2B 3FTZA 4JW1A 1H0AA 3LEWA 2R5SA 3E4BA 2C0LA 4JA7A 2GRLA 1ELWA 3FTXA 4JHRA 4Q96A 4WNFA 1DNPA 5BV0A 3L16A 3EHNA 4PH4B 3FEYA 1E8WA 4AJWA 4C0EA 3KEZA 2VYIA 1HS6A 4HORA 3RO2A 2Y4TA 4BSXA 1INZA 3RRUA 2L6JA 4DJAA 3FH8A 4P29A 2FO7A 1U3DA 2V4LA 4HOTA 3JQ1A 4MRUA 1ELKA 4G24A 3LKUA 4I6GA 1JPLA 2LNIA 3L54A 3BG0B 4GYYA 5EX3A 3RRNB 3TAXA 4JHKA 2FF4A 4KMOA 3HYMB 5BT1A 2Q7FA 5KCMA 3ZN3A 4U0UA 3MKRA 2V5FA 5A7DB 4B94A 5LOZA 2J4BA 4J6IA 3VLEA 1OWPA 4KBQA 1H6KA 2AVPA 2JEKA 2WXHA 3NZUA 5D0OD 4KZCA 4BX8A 4EECA 2XCBA 3FY4A 3QOUA 4L1BA 4BT9A 4C9BB 3HIZA 4EZKA 2WB2A 3B13A 1UJKA 1HZ4A 3O48A 4TUUA 1NA0A 2MRIA 3RKVA 5HI7A 4AIFA 4IRUA 4XI9A 1JWFA 3ZYLA 2WXLA 4GCOA 3FTYA 3QC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YVO A;  5CCM A;  4UQY A;  5JJ6 A;  4N2S A;  3Q49 B;  2KCL A;  1NA3 A;  4HOS A;  3CEQ A;  3TG5 A;  3R9A B;  2HO1 A;  4NQ0 A;  3ZHE A;  2VSY A;  4BWR A;  2C2L A;  3RO3 A;  5DIZ A;  2FBN A;  2YQ8 A;  4I1A A;  3QWW A;  4GA0 A;  4ABN A;  2PL2 A;  5G05 C;  2FI7 A;  3WXX A;  3FFL A;  3S7D A;  1IHG A;  3ZPJ A;  5G05 J;  4UQZ A;  3CK8 A;  1KT1 A;  4GYO A;  5KJM A;  3UUX A;  2LSV A;  1P5Q A;  4I2W A;  2JLB A;  4N39 A;  1B89 A;  2XPI A;  2DBA A;  3UQ3 A;  4AM9 A;  4RG6 A;  3CV0 A;  4H7X A;  3PDN A;  5EKQ D;  5ARF A;  2IF4 A;  4KYO B;  1W3B A;  1FCH A;  4JA9 A;  1QQE A;  4I9C A;  2GW1 A;  3URZ A;  3CKC A;  2UY1 B;  1XNF A;  2XGO A;  4UI9 C;  4IN3 B;  2VGX B;  5D0Q D;  3CK9 A;  4BTA A;  4F3V A;  3Q15 A;  4U07 A;  3RIB A;  2NC9 A;  4WND A;  3S7F A;  3CKB A;  2MHK A;  3S7B A;  2PQR A;  5FT9 A;  4EQF A;  4BT8 A;  2XGM A;  4J0U A;  3U4T A;  3KD7 A;  5KJL A;  3SF4 A;  2VQ2 A;  3MV3 B;  2HYZ A;  3FWV A;  1Y8M A;  3ASG A;  4WNE A;  2YHC A;  4J8F A;  1ELR A;  4Y6W A;  2I6H A;  2XGS A;  2XEV A;  3LPZ A;  5ARG A;  3TGO A;  4XIF A;  3RJV A;  2KCV A;  3TG4 A;  4G2V A;  4J8D A;  2VGX A;  4XI0 A;  4I17 A;  4G23 A;  2C0M A;  4HOQ A;  4RG9 A;  4H7Y A;  3MA5 A;  2QFC A;  3UPV A;  4U04 A;  3N71 A;  5CHE E;  3QWP A;  3CVP A;  3VTX A;  3KAE A;  4G1T A;  4Y6C A;  5JJ7 A;  3KS2 A;  4BTB A;  1QZ2 A;  2E2E A;  4GYW A;  4N3A A;  4YVQ C;  3LCA A;  2LSU A;  3CVQ A;  3QWV A;  4KXK B;  5G04 C;  3PE3 A;  1A17 A;  3RU0 A;  4GZ6 A;  4U0Z A;  3ZHE B;  4N5C A;  3NF1 A;  5G04 J;  2KAT A;  2OND A;  2WQH A;  4UI9 J;  4GPK A;  4I9E A;  3QDN A;  3LY7 A;  3CVL A;  4N3B A;  3ULQ A;  3U3W A;  4AY6 A;  5M72 A;  1HXI A;  4I2Z A;  5C1D A;  2XCC A;  4G26 A;  4HOU A;  3LYA A;  2KCK A;  5A6C A;  3CK7 A;  3IEG A;  3LY8 A;  3Q47 B;  3ZGQ A;  5CCL A;  4GCN A;  3JYS A;  2FEZ A;  2OOE A;  4CGV A;  4JL0 A;  3LY9 A;  4GZ5 A;  4G25 A;  1IYG A;  5BNW A;  2P58 C;  5JJT A;  5KJN A;  4APO A;  1YA0 A;  1WAO 1;  3ASD A;  3ZFW A;  2UWJ G;  4UI9 K;  3ASH A;  1KLX A;  4J8E A;  5FZR A;  4U0S A;  3K9I A;  4W9R A;  4A1S A;  3BEE A;  3S7J A;  2HR2 A;  3PE4 A;  3SZ7 A;  5HQ8 A;  4GA2 A;  4CGW A;  2VSN A;  5FZQ A;  1ZBP A;  5AYW D;  1OUV A;  2UY1 A;  3GZ2 A;  4GZ3 A;  4GA1 A;  3GZ1 A;  3EDT B;  5DBK A;  3FP3 A;  4LEU A;  3AS8 A;  4O6F A;  2PZI A;  3VTY A;  5FJY A;  4ME2 A;  2WPV A;  4N2Q A;  4UQX A;  2IFU A;  1ZU2 A;  3OXF A;  1E96 B;  2KC7 A;  4YND A;  3MEK A;  3AS5 A;  4NRH B;  1HH8 A;  3QKY A;  3GYZ A;  5FTP A;  3AS4 A;  2BUG A;  2Y4U A;  3ASF A;  5EX0 A;  1TJC A;  2VGY A;  3GW4 A;  4WNG A;  3OXL A;  5LCW C;  4CDR A;  1NZN A;  2J9Q A;  2PQN A;  5LCW J;  4AY5 A;  3ESK A;  5KJK A;  5BW8 C;  3Q5M A;  1PC2 A;  3CVN A;  3Q4A B;  4N3C A;  4WUY A;  5FZS A;  1WM5 A;  3OXG A;  1KT0 A;  3MV2 B;  2R5S A;  3E4B A;  2C0L A;  4JA7 A;  1ELW A;  4JHR A;  4WNF A;  4HOR A;  2VYI A;  3RO2 A;  2Y4T A;  2L6J A;  2FO7 A;  4HOT A;  4G24 A;  3LKU A;  2LNI A;  4GYY A;  5EX3 A;  3TAX A;  2FF4 A;  3HYM B;  5BT1 A;  2Q7F A;  3ZN3 A;  4U0U A;  3MKR A;  2V5F A;  5A7D B;  4B94 A;  4KBQ A;  2AVP A;  5D0O D;  2XCB A;  3QOU A;  4BT9 A;  1HZ4 A;  3O48 A;  1NA0 A;  3RKV A;  5HI7 A;  4AIF A;  4XI9 A;  4GCO A; 
#chains in the Genus database with same CATH topology
 2P9P G;  1TJF A;  3Q49 B;  1N54 A;  1H2T C;  4K0R A;  3CEQ A;  4HRN A;  2IU1 A;  4UWG A;  4E85 A;  4I1M A;  2IJG X;  4IYP A;  1Z3Y A;  2CFU A;  2YQ8 A;  4I1A A;  2FI7 A;  3UM3 A;  1N52 A;  1SA4 A;  3ZPJ A;  2DVW A;  5G05 J;  4D10 C;  1YMP A;  1D9S A;  1XGW A;  4L23 A;  3CR3 A;  3UUX A;  2LSV A;  3PUK A;  3JQ0 A;  2JLB A;  3I3N A;  2R59 A;  1PAQ A;  2XQ0 A;  3LS8 A;  3G2V A;  3HXC A;  3FU6 A;  3OTN A;  1O1S A;  2Y0B G;  4KYO B;  3QAQ A;  5AIJ A;  5C2Y A;  1QQE A;  3WG7 E;  2GW1 A;  2WQ6 A;  3CVV A;  2EIM E;  4YDY A;  1BI8 B;  2P9K G;  2P9I G;  3EHR A;  5J08 A;  1XNF A;  2XGO A;  3AG4 E;  3LDZ A;  4HRL A;  2J4D A;  2OVF A;  4PS3 A;  1OCR E;  5FQ8 A;  1Y6I A;  2QYJ A;  4F3V A;  4LSZ E;  3G2U A;  2CHX A;  2V5Q C;  3ONL A;  3RIB A;  1IKN D;  5EYP F;  4J8S A;  3SNX A;  2X6J A;  3HXD A;  1FVF A;  4BT8 A;  4XKB A;  4AEZ C;  2BKK B;  3U4T A;  4RQI A;  5FQ6 A;  3J5P A;  3FH7 A;  3HHM A;  5KJL A;  4DX2 A;  4UUC A;  2IO3 C;  2HYZ A;  4PS8 A;  1Y8M A;  1IHB A;  4XX5 A;  3CHR A;  4BFR A;  2F37 A;  1OWN A;  3F6Q A;  3CHS A;  5CED B;  2I6H A;  2XGS A;  3UT7 A;  2KCV A;  5LFA A;  4Q94 A;  3L6A A;  1VDY A;  1K1A A;  4HOQ A;  4JHJ A;  5BV1 A;  2F8Y A;  4JZY A;  4LNG A;  5D66 A;  3ZIM A;  3UPV A;  3FU0 A;  4ZHB A;  5CHE E;  5KBA A;  5ENS D;  2GRO B;  3VTX A;  2OCC E;  1G3N B;  4Y6C A;  3CHM A;  1HG5 A;  2WMN A;  4BTB A;  4DUI A;  5J90 A;  2IEJ A;  3IBE A;  4LUN U;  1KZO A;  4HQD A;  3LCA A;  5ENP D;  3CVQ A;  3TWS A;  4U8H A;  5G04 C;  3E37 A;  4B0Z A;  3D9H A;  4ANW A;  3ZYM A;  2EIL E;  4MKT A;  4UI9 J;  3MX3 A;  3QDN A;  4N3B A;  2MYO A;  3LVQ E;  3U3W A;  4NIK A;  5M72 A;  2V4H C;  3FUF A;  3L08 A;  3UX4 A;  4G26 A;  4GML A;  4HOU A;  2WVI A;  2WXM A;  4CRW A;  4AVX A;  5ENR D;  2QY7 A;  4CGV A;  3APD A;  4GTO A;  3LY9 A;  5FIO A;  4DX1 A;  4C0M A;  3UM1 A;  4APO A;  1D8E A;  3ASD A;  4UI9 K;  3ASH A;  2GRN B;  2DWZ A;  3HG0 D;  3V30 A;  4A1S A;  3ZKJ A;  3PE4 A;  4UWL A;  5G55 A;  4CGW A;  5AQA A;  5AYW D;  4A3T A;  4U8V D;  5ENN A;  4GZ3 A;  2L6B A;  3P1U A;  2X6I A;  3EDT B;  4XKC A;  2GRM A;  5DBK A;  3PUJ A;  3AS8 A;  5BUZ A;  3T5X A;  2PZI A;  3JCK C;  3T8M A;  3UKR G;  3NOG D;  1O5M A;  1LTX A;  2CHW A;  4DI3 A;  3OXF A;  4JPS A;  2VTB A;  1E96 B;  2KC7 A;  3Q78 A;  3E33 A;  3VLD A;  2J08 A;  3AS5 A;  3E32 A;  3AU4 A;  3FUE A;  1QBQ A;  5T4Y A;  2BUG A;  4JVS A;  1TJC A;  1NI1 A;  2VGY A;  1AP7 A;  4CYM D;  2HE0 A;  3OXL A;  4CDR A;  1Z5S C;  2EIJ E;  4OYS A;  1V55 E;  3TWT A;  2H6G A;  1E7V A;  3ESK A;  3LXU X;  5BW8 C;  3UIP C;  4CDM A;  2J8S D;  1EF1 C;  5AQB A;  2V8S E;  1NFI E;  2H6I A;  3Q7A A;  2XRZ A;  4DI4 A;  2XZD G;  1KT0 A;  3G2T A;  4GTS A;  3FTZ A;  1H0A A;  3LEW A;  2R5S A;  4Q96 A;  2JAB A;  5EN5 D;  2ETB A;  4PH4 B;  3FEY A;  3KEA A;  1S70 B;  4C0E A;  3KEZ A;  4HOR A;  2Y4T A;  4L9P A;  4BSX A;  1TNU A;  2FO7 A;  5B3S E;  1ELK A;  4G24 A;  3TAX A;  1OCC E;  2AJA A;  4BET A;  5LOZ A;  1OWP A;  1TN6 A;  5D0O D;  4KZC A;  2XCB A;  4C9B B;  4EZK A;  3O48 A;  4A63 B;  4XI9 A;  3RAU A;  4GCO A;  3FTY A;  3NBN B;  4TXP A;  2AW6 A;  3V31 A;  1V54 E;  4UQY A;  4E6H A;  2KCL A;  1NA3 A;  5LP0 A;  2E0I A;  3TG5 A;  5HS0 A;  2I1K A;  3ZHE A;  2FUL A;  2WXO A;  4FLB A;  1JWG A;  2VSY A;  3ESL A;  4GZC A;  4KVO A;  3RO3 A;  3ABM E;  5DIZ A;  5B1A E;  5T8I A;  2Y1L E;  2LUH A;  4ABN A;  2PL2 A;  4ILI A;  1N4R A;  1S64 A;  4EPZ A;  1TEZ A;  1U2V G;  1IHG A;  2BF0 X;  1UOH A;  4UQZ A;  2AXU A;  4CT0 A;  1MYO A;  4V3I A;  4GYO A;  4HBD A;  3B7S A;  3LJN A;  2LO6 A;  1JCQ A;  1B89 A;  2DBA A;  5FQ4 A;  3MGB A;  1UN9 A;  3JXI A;  5E75 A;  4GTV A;  2DZN A;  2J07 A;  3CV0 A;  3PDN A;  5EKQ D;  4B8A A;  5ARF A;  3Q75 A;  4MLP A;  4U96 D;  2L9B A;  1W3B A;  4F6R D;  4JA9 A;  3RK6 A;  1EDU A;  2I1J A;  3UM2 A;  1N9A A;  4MBG A;  3LVR E;  3W9G A;  4WAF A;  4BX9 A;  4YDO A;  2ETA A;  2XZT G;  3APC A;  1N4Q A;  1RW2 A;  5AAO A;  4IN3 B;  5ENT D;  3CHQ A;  4ACK A;  4GTQ A;  4L2L A;  2H6F A;  1H2U A;  2ILR A;  4GU5 A;  2B0O E;  4U07 A;  3T9K A;  3QB2 A;  1Q2Z A;  2MHK A;  1BLX B;  3SY2 A;  2KXP C;  4GPM A;  3BQO A;  2XGM A;  5LX8 A;  2EQX A;  3FU5 A;  3UXG A;  3NAW A;  1DCE A;  2R05 A;  2RFM A;  2P9S G;  2VQ2 A;  1TNO A;  4B93 B;  1X81 A;  2YHC A;  4J8F A;  1ELR A;  3QJZ A;  3VLF A;  4J8Y A;  3LPZ A;  5ARG A;  3TGO A;  3GZS A;  4XEI G;  4XIF A;  3SD5 A;  3RJV A;  4G2V A;  4BY6 A;  2IO2 C;  1O1R A;  3HXB A;  1YYH A;  2Y69 E;  2YNQ A;  1BU9 A;  4IUL A;  3TWQ A;  2QC9 A;  2QFC A;  1IQR A;  2VJ8 A;  3SO8 A;  2KZT B;  1U3C A;  3ONK A;  3KS2 A;  5CEA A;  4ANU A;  3ZNG A;  4K5C A;  1PY1 A;  5EID A;  2X6F A;  4YVQ C;  4XZ4 A;  2WXR A;  2LSU A;  4KZ0 A;  1JCR A;  2MOW A;  4KXK B;  1OCO E;  1H6P A;  3PE3 A;  1K8K G;  2OVB A;  3ULY A;  3W9F A;  3ASO E;  4GZ6 A;  4HNA D;  4UWK A;  2J49 A;  4RSY A;  2X6K A;  5G04 J;  1N0Q A;  4DX6 D;  2IOS A;  2CHZ A;  3IV0 A;  2WQH A;  3LY7 A;  1S0P A;  3CVL A;  1HE8 A;  3JUE A;  3UMV A;  3EU9 A;  4I2Z A;  4JEH A;  2PM6 A;  3QAR A;  2KCK A;  3CK7 A;  3IEG A;  3Q47 B;  1TN7 A;  3ZGQ A;  1MX2 A;  5CEC B;  3CLJ A;  3ZUV B;  3RSE G;  1N0R A;  2OOE A;  3PNT B;  4GZ5 A;  4G25 A;  2P2C P;  1IYG A;  2KZT A;  2P58 C;  5KJN A;  4NAC A;  3ZFW A;  2UWJ G;  1FT2 A;  4Q69 A;  1KLX A;  4LCT A;  4J8E A;  1S63 A;  5AEN A;  4U0S A;  2QZA A;  4W9R A;  4ATG A;  2HR2 A;  3DSV A;  4F1P A;  4GA2 A;  4F1S A;  1LF8 A;  3EHM A;  2VSN A;  1ZBP A;  2R17 C;  2R2L A;  3FUN A;  3GZ2 A;  4HLL A;  4GA1 A;  1NL4 A;  2IQC A;  1RZ4 A;  2ZU6 B;  3R7Q A;  4LEU A;  2WXK A;  1WY6 A;  4XE0 A;  5FJY A;  4ME2 A;  2WPV A;  1K1B A;  3ZXP A;  4N5Q A;  3SFY A;  1HO8 A;  3FEX A;  4TXR A;  3NZS A;  3MEK A;  4NRH B;  3IHV A;  4ANV A;  3AS4 A;  4M7C A;  2Y4U A;  3ASF A;  5EX0 A;  5KNG A;  3GW4 A;  3FHE A;  4I6J A;  3CQG B;  3ZRH A;  2GGF A;  2XRY A;  2J9Q A;  1Z6T A;  2PQN A;  2RD0 A;  4JEU A;  3R7R A;  3CVY A;  1OWO A;  1PC2 A;  5KWD A;  3CVN A;  2WXN A;  4L7T A;  2RKK A;  1UW4 B;  4ANX A;  3HXE A;  3I4R B;  5FZS A;  3OXG A;  3EUV A;  3MV2 B;  4JW1 A;  2EIK E;  4JA7 A;  2GRL A;  3FTX A;  4WNF A;  1DNP A;  4Z68 A;  1E8W A;  4AJW A;  1HS6 A;  3J5Q B;  3DRA A;  3AJI A;  3PZ2 A;  3EHQ A;  4P29 A;  1SA5 A;  1U3D A;  1IXV A;  1JPL A;  5EX3 A;  3RRN B;  2FO1 E;  4ZFH A;  2FF4 A;  5CRV A;  3MKR A;  4J6I A;  3VLE A;  1H6K A;  3KSQ A;  1WG0 A;  1NA0 A;  5HI7 A;  4BES A;  5H7P A;  5ANL A;  4RLY A;  3TWU A;  3O4Z A;  5JJ6 A;  4N2S A;  5T3R A;  3PEV B;  4GMJ A;  3B7B A;  1DC2 A;  3SFZ A;  4FUL A;  3DWL G;  2HO1 A;  4NUR A;  2L0I A;  4EZL A;  1TN8 A;  3SFX A;  4HRM B;  3C3Q A;  3SQV A;  3EIJ A;  3MJW A;  3TWW A;  3P2B A;  1KZP A;  5ENO D;  2FBN A;  2F0Y A;  3QWW A;  4GA0 A;  3QNK A;  3PZ4 A;  3BUA A;  3FFL A;  3D9M A;  3U9W A;  3S7D A;  1NP7 A;  2ZGD A;  3DXK G;  3UIO C;  3FUH A;  3CK8 A;  4I43 A;  4EBA A;  4G11 A;  4DX5 D;  2BKG A;  1P5Q A;  4APF A;  4MS6 A;  3UQ3 A;  3AAA C;  4AM9 A;  3TWV A;  1MX4 A;  4FJZ A;  1EPU A;  3CVX A;  3UT8 A;  3QK0 A;  3L13 A;  4ACL A;  1N95 A;  1MX6 A;  1FCH A;  4PDX A;  3SGH A;  2ZXW E;  3MCX A;  3URZ A;  4HI8 A;  4WWO A;  5HKP A;  3CKC A;  3HDX A;  2UY1 B;  4A1G A;  1A5E A;  4UI9 C;  2VGX B;  2GRQ B;  4B8C B;  4FP7 A;  2KM4 A;  4LNB A;  4LNU D;  3ZVV A;  4BTA A;  3Q15 A;  3C5R A;  3LJ3 A;  2NXP A;  3R9M A;  4WND A;  3S7F A;  3CKB A;  1FVH A;  3S7B A;  2H6H A;  4UWF A;  3CVW A;  2PQR A;  3BU8 A;  2YIN A;  4AP2 A;  3PH0 C;  1FPP A;  4CEM A;  1N4P A;  2OEV A;  5EYL A;  3KSL A;  3TWR A;  2CG3 A;  1TNB A;  3Q7F A;  2X6H A;  4HLE A;  3PNL B;  3L9T A;  5HRY A;  2R03 A;  1HU3 A;  4LRZ A;  4F53 A;  5A23 A;  4JC8 A;  4WNE A;  2DIW A;  2GRP B;  2A5U A;  2I2O A;  2XS8 A;  4Y6W A;  2DYR E;  4PS7 A;  2A5E A;  3CVU A;  2P9N G;  2XEV A;  2LXM A;  3FUM A;  3TG4 A;  5KNH D;  4J8D A;  2VGX A;  3X2Q E;  4H7Y A;  1QNF A;  2WXG A;  4U04 A;  4U95 D;  4FA6 A;  3IXE A;  3HXF A;  3CVP A;  4G1T A;  1OCZ E;  3TL5 A;  5JJ7 A;  3NB2 A;  3AU5 A;  2V0P A;  2GRR B;  1OWM A;  1YCS B;  1QZ2 A;  4TUM A;  4EBA G;  3FDH A;  4N3A A;  5AQ7 A;  3OAW A;  4GZD A;  3B7U X;  3CSF A;  2P9U G;  3QWV A;  1A17 A;  3EU5 A;  1JUQ A;  1E8Y A;  3UT4 A;  4PUC A;  4N5C A;  3EJN A;  3D9L A;  3E34 A;  4I9E A;  4OVV A;  4AY6 A;  5CRU A;  1HXI A;  3D9J A;  3DPD A;  4G8L A;  4QQI A;  4EZJ A;  3NQP A;  5FQ7 A;  3HVE B;  3LYA A;  4M3O A;  4GMR A;  5A6C A;  1SW6 A;  3LY8 A;  5CCL A;  4GB9 A;  3JUI A;  4GCN A;  2FEZ A;  2WXF A;  2XHE A;  4JXT A;  4URK A;  3ML9 A;  3FUI A;  3DSU A;  3T5V A;  5JJT A;  4K5B A;  1BD8 A;  1QYM A;  1YA0 A;  3DST A;  1WAO 1;  1H6O A;  4EHM A;  3ULE G;  4AXH A;  3B7R L;  4F7A A;  1BPO A;  4DX7 D;  1Z3X A;  3K9I A;  5EIL A;  3BEE A;  3PS6 A;  3S7J A;  5B1B E;  2WXQ A;  1OY3 D;  5FZQ A;  3APF A;  4ILG A;  1OXJ A;  4FAD A;  2R02 A;  1E7U A;  2YHE A;  2QYU A;  3DSS A;  3CQC B;  2BED A;  4KT6 B;  5CBN A;  3FP3 A;  1UJJ A;  3MYV A;  1OWL A;  3UTM A;  3BG1 B;  3CHP A;  2OV8 A;  4N2Q A;  1HF8 A;  1ZU2 A;  3AG3 E;  3DSW A;  3L22 A;  4CT4 A;  3HVE A;  2HM8 A;  4YND A;  3IKO B;  4WWP A;  4CDN A;  3D9N A;  1N11 A;  3QKY A;  5FTP A;  3PRE A;  2ION A;  4OAV B;  3ISM C;  2AXV A;  3FTU A;  2DCP A;  2CG2 A;  2A4Z A;  2J09 A;  3S2A A;  1FT1 A;  1D8D A;  5LCW C;  1L5J A;  4I1O B;  3AG1 E;  3ZYK A;  1NZN A;  3JXJ A;  4O1O A;  3SBS A;  4O1P A;  3ZEF A;  3TXN A;  3EIQ C;  3E30 A;  1H2V C;  3Q4A B;  2VGE A;  4WUY A;  3ABL E;  4OAU C;  2XS1 A;  1HX8 A;  2XPY A;  2WQ7 A;  1UN8 A;  2XEH A;  3E4B A;  5AN8 A;  3PZ3 A;  2C0L A;  4JHR A;  5BV0 A;  3L16 A;  2VYI A;  3Q9U C;  1N4S A;  1INZ A;  3RRU A;  1MJ0 A;  3FH8 A;  2V4L A;  4HOT A;  3JQ1 A;  4MRU A;  3LKU A;  3BG0 B;  4JHK A;  3HYM B;  2Q7F A;  3V79 K;  5A7D B;  3C72 A;  2J4B A;  4BEP A;  4KBQ A;  3NZU A;  4EEC A;  1LD8 A;  3FY4 A;  4L1B A;  3QOU A;  3UKU G;  2MRI A;  1TR4 A;  3T8K A;  2XEE A;  1JWF A;  3QC1 A;  1ZB1 A;  4YVO A;  4U7E B;  5CCM A;  1K3Z D;  3DEP A;  4O60 A;  1IQU A;  5G2N A;  4HOS A;  3R9A B;  3DSX A;  3NOC D;  4ILH B;  5ITZ F;  5FWQ A;  5EDS A;  4NQ0 A;  1SVX A;  1DVP A;  4BWR A;  2C2L A;  2WMO A;  5G05 C;  4TRQ A;  5BXU A;  3WXX A;  2PNN A;  3ASN E;  5JHA A;  3CST A;  2XPZ A;  1KT1 A;  5EIB E;  3FTS A;  4ATZ D;  5KJM A;  4I2W A;  4N39 A;  2XPI A;  3DBS A;  3PRZ A;  4RG6 A;  3U66 A;  4H7X A;  2RG8 A;  3L82 A;  4C48 B;  2X38 A;  3D9K A;  4JD2 G;  4A3V A;  2IF4 A;  4DLO A;  5FIN A;  3MZL B;  1JCS A;  5BPP A;  5CMY A;  4GTR A;  1N94 A;  4I9C A;  5AJD A;  3FTW A;  4FC8 A;  3FU3 A;  3I4G A;  1SZA A;  2AXZ A;  3UIN C;  3DXM G;  3IHY A;  5D0Q D;  4QFV A;  5E76 A;  2WM9 A;  3D3M A;  3PZ1 A;  3CK9 A;  1E8Z A;  1UG3 A;  5AQ9 A;  4DK5 A;  5IY5 E;  2NC9 A;  2AWI A;  5JA4 D;  1E90 A;  3TWX A;  2ZGG A;  3Q73 A;  3ABK E;  4FHK A;  3ZXS A;  2VTB B;  5FT9 A;  3D9P A;  4EQF A;  4HVB A;  2I9C A;  3CGH A;  4J0U A;  4FJY A;  2WXJ A;  3KD7 A;  2LAH A;  3FUD A;  3V2X A;  3I5P A;  4RVB A;  1TYQ G;  4JB8 P;  3UM0 A;  3SF4 A;  4TV3 A;  3MV3 B;  3FWV A;  3FH5 A;  3FUJ A;  2X3M A;  3B95 A;  3D9I A;  4BSZ B;  4DLQ A;  3ASG A;  3ML8 A;  2XEN A;  2KBX A;  2PM7 A;  3FUK A;  3SHF A;  1KPS B;  5AAR A;  2OEW A;  2DYS E;  4GTP A;  2WXI A;  2F8X K;  5CMW A;  4HFG A;  4XI0 A;  3ZU7 B;  4I17 A;  4G23 A;  2C0M A;  4YDW A;  2ZIR A;  4RG9 A;  3L17 A;  3MA5 A;  3CIA A;  4FLH A;  3PVL A;  3N71 A;  3QWP A;  4G8K A;  4KVM A;  4K5A B;  3G2W A;  5AJL A;  4YDE A;  3KAE A;  2L0T B;  2M63 A;  1HFA A;  2DZO A;  3ZYQ A;  5CER B;  1WDY A;  2E2E A;  3PZD A;  4GYW A;  3D9O A;  2IOL A;  3ZW3 A;  3V2O A;  4A55 A;  3FTV A;  5ENQ D;  2VSX E;  1MQS A;  3Q9N C;  3RU0 A;  3PEU B;  4WWN A;  4AOF A;  2IY0 C;  4U0Z A;  3ZHE B;  3NF1 A;  3B7T A;  2KAT A;  2OND A;  1SZ9 A;  2CFZ A;  2LAI A;  4GPK A;  4FU3 A;  3MKQ B;  4GTT A;  1DCQ A;  3ULQ A;  3DEO A;  1OT8 A;  5D2M C;  1LD7 A;  4U63 A;  5C1D A;  2XCC A;  1HG2 A;  4HXI A;  4BER A;  1AWC B;  4L2Y A;  1TNZ A;  5CBO A;  4J7W A;  3TJP A;  5ANR A;  3UI2 A;  3JYS A;  4JL0 A;  4GTM A;  4X8Q A;  5BNW A;  2ETC A;  4UWH A;  5JMN D;  4OVU A;  5JHB A;  5FZR A;  4I6E A;  2Y3A A;  4HI9 A;  4B89 A;  2BTD A;  1E8X A;  3SZ7 A;  3AG2 E;  4LER A;  5HQ8 A;  2ZIS A;  3DPY A;  2NYJ A;  1H19 A;  4CCA A;  1OUV A;  2UY1 A;  4AV7 A;  3U64 A;  1MHQ A;  3GZ1 A;  2NSZ A;  2RFA A;  3TXM A;  3MKQ A;  4HB5 A;  4O6F A;  3SBT B;  3VTY A;  4GAA A;  3G2S A;  4LG6 A;  4U8Y D;  3ENE A;  3SI5 A;  4UQX A;  2IFU A;  1X5B A;  5BXO A;  1MZC A;  4HS2 A;  4K03 A;  3CHO A;  4DRX E;  1HH8 A;  3GYZ A;  3RRM B;  1GW6 A;  1EYH A;  2EIN E;  3C3R A;  4WNG A;  1O1T A;  4R7L A;  3C3O A;  3FUL A;  4DPR A;  5LCW J;  4AY5 A;  1SQM A;  2LXL A;  5KJK A;  2B6C A;  1TNY A;  3Q5M A;  2WXP A;  3C98 A;  4N3C A;  4CZ2 D;  4FHJ A;  2VSO E;  3HRA A;  1WM5 A;  4TXQ A;  2P9L G;  1ELW A;  3EHN A;  3RO2 A;  2L6J A;  4DJA A;  4I6G A;  2LNI A;  3L54 A;  4GYY A;  4KMO A;  5BT1 A;  5KCM A;  3ZN3 A;  4U0U A;  2V5F A;  4B94 A;  2AVP A;  2JEK A;  2WXH A;  4BX8 A;  4BT9 A;  2WB2 A;  3HIZ A;  3B13 A;  1UJK A;  1HZ4 A;  3Q79 A;  4TUU A;  3RKV A;  4AIF A;  4IRU A;  3ZYL A;  2WXL A;  1BI7 B; 
#chains in the Genus database with same CATH homology
 4YVO A;  5ANL A;  2AW6 A;  5CCM A;  5G2N A;  1IQU A;  4UQY A;  4E6H A;  3O4Z A;  1TJF A;  5JJ6 A;  4N2S A;  3Q49 B;  2KCL A;  5T3R A;  1NA3 A;  3PEV B;  5LP0 A;  1N54 A;  4GMJ A;  4HOS A;  1H2T C;  4K0R A;  2E0I A;  3CEQ A;  2IU1 A;  3SFZ A;  3R9A B;  4FUL A;  3TG5 A;  4UWG A;  2HO1 A;  4NUR A;  2L0I A;  4E85 A;  4EZL A;  2I1K A;  4ILH B;  4I1M A;  5FWQ A;  5EDS A;  4NQ0 A;  2IJG X;  3ZHE A;  2FUL A;  2WXO A;  4FLB A;  3EIJ A;  1DVP A;  3MJW A;  1JWG A;  4IYP A;  2VSY A;  3ESL A;  1Z3Y A;  3P2B A;  4GZC A;  4KVO A;  4BWR A;  2C2L A;  2CFU A;  3RO3 A;  5DIZ A;  2WMO A;  2FBN A;  5T8I A;  2YQ8 A;  4I1A A;  3QWW A;  4GA0 A;  4ABN A;  2PL2 A;  5G05 C;  4ILI A;  3QNK A;  4TRQ A;  2FI7 A;  3WXX A;  4EPZ A;  1TEZ A;  3FFL A;  3D9M A;  3U9W A;  3S7D A;  1N52 A;  1IHG A;  1NP7 A;  3ZPJ A;  2BF0 X;  5JHA A;  5G05 J;  4UQZ A;  3CST A;  4D10 C;  2XPZ A;  2AXU A;  4CT0 A;  3FUH A;  3CK8 A;  1KT1 A;  4I43 A;  4V3I A;  4GYO A;  4EBA A;  1XGW A;  3FTS A;  4G11 A;  4L23 A;  5KJM A;  3B7S A;  3CR3 A;  3UUX A;  2LO6 A;  1P5Q A;  2LSV A;  4I2W A;  3PUK A;  4APF A;  3JQ0 A;  2JLB A;  4N39 A;  3I3N A;  1B89 A;  2XPI A;  2DBA A;  5FQ4 A;  2R59 A;  1PAQ A;  3MGB A;  1UN9 A;  2XQ0 A;  4MS6 A;  3UQ3 A;  3LS8 A;  3G2V A;  3DBS A;  5E75 A;  4AM9 A;  3FU6 A;  3PRZ A;  4RG6 A;  3U66 A;  2J07 A;  3CV0 A;  4H7X A;  4FJZ A;  2RG8 A;  3PDN A;  1EPU A;  2X38 A;  5EKQ D;  3OTN A;  3D9K A;  5ARF A;  4B8A A;  3CVX A;  3UT8 A;  4A3V A;  4MLP A;  2IF4 A;  3QK0 A;  4DLO A;  3MZL B;  4KYO B;  3L13 A;  5BPP A;  2L9B A;  4ACL A;  3QAQ A;  1W3B A;  5CMY A;  1FCH A;  5AIJ A;  4JA9 A;  4PDX A;  5C2Y A;  3SGH A;  1QQE A;  3RK6 A;  4I9C A;  3MCX A;  2GW1 A;  2WQ6 A;  1EDU A;  2I1J A;  5AJD A;  3URZ A;  3CVV A;  4WWO A;  3LVR E;  3CKC A;  3FTW A;  4WAF A;  4BX9 A;  3HDX A;  4FC8 A;  3FU3 A;  5J08 A;  2UY1 B;  3APC A;  3I4G A;  1SZA A;  1XNF A;  2AXZ A;  2XGO A;  4A1G A;  3LDZ A;  4UI9 C;  4IN3 B;  2VGX B;  4B8C B;  4FP7 A;  2J4D A;  2KM4 A;  2OVF A;  3IHY A;  4PS3 A;  5D0Q D;  4QFV A;  5E76 A;  3CHQ A;  2WM9 A;  3D3M A;  5FQ8 A;  1Y6I A;  3CK9 A;  4ACK A;  3ZVV A;  4L2L A;  4BTA A;  1H2U A;  3Q15 A;  4F3V A;  2ILR A;  3LJ3 A;  1E8Z A;  2NXP A;  4GU5 A;  1UG3 A;  3G2U A;  2CHX A;  4U07 A;  4DK5 A;  3ONL A;  3RIB A;  2NC9 A;  4WND A;  3QB2 A;  2AWI A;  3S7F A;  3CKB A;  1FVH A;  2MHK A;  1E90 A;  4J8S A;  4FHK A;  3S7B A;  4UWF A;  3SNX A;  3ZXS A;  2PQR A;  3CVW A;  2VTB B;  2YIN A;  5FT9 A;  4AP2 A;  3D9P A;  4EQF A;  2X6J A;  4HVB A;  3PH0 C;  4CEM A;  2I9C A;  1FVF A;  4BT8 A;  4XKB A;  4AEZ C;  2XGM A;  3CGH A;  5LX8 A;  4J0U A;  2EQX A;  4FJY A;  2WXJ A;  3U4T A;  3FU5 A;  3KD7 A;  2LAH A;  2CG3 A;  5FQ6 A;  3FH7 A;  3HHM A;  2X6H A;  4HLE A;  5KJL A;  3PNL B;  3FUD A;  3I5P A;  4RVB A;  3SF4 A;  2VQ2 A;  4TV3 A;  1HU3 A;  3MV3 B;  4LRZ A;  2HYZ A;  3FH5 A;  3FWV A;  3FUJ A;  2X3M A;  4PS8 A;  1Y8M A;  3D9I A;  4F53 A;  5A23 A;  4JC8 A;  4DLQ A;  3ASG A;  3ML8 A;  4WNE A;  4XX5 A;  2YHC A;  2DIW A;  3CHR A;  3CVY A;  4BFR A;  2A5U A;  2I2O A;  4J8F A;  1ELR A;  2PM7 A;  1OWN A;  3QJZ A;  3FUK A;  3VLF A;  3CHS A;  4Y6W A;  3SHF A;  4PS7 A;  2I6H A;  2XGS A;  3CVU A;  2XEV A;  3LPZ A;  5ARG A;  3UT7 A;  3TGO A;  3GZS A;  4XIF A;  3SD5 A;  3RJV A;  2KCV A;  5LFA A;  3FUM A;  4Q94 A;  3TG4 A;  3L6A A;  4G2V A;  4J8D A;  4BY6 A;  2WXI A;  2VGX A;  1VDY A;  5CMW A;  4HFG A;  4XI0 A;  4I17 A;  4G23 A;  2C0M A;  2YNQ A;  4HOQ A;  4JHJ A;  4RG9 A;  4H7Y A;  4IUL A;  5BV1 A;  4JZY A;  3L17 A;  1QNF A;  2WXG A;  3MA5 A;  3CIA A;  2QFC A;  4FLH A;  3FU0 A;  3ZIM A;  4U04 A;  3UPV A;  3PVL A;  3N71 A;  5CHE E;  3QWP A;  4FA6 A;  1IQR A;  4KVM A;  2VJ8 A;  3CVP A;  3G2W A;  3VTX A;  5AJL A;  2KZT B;  3KAE A;  2L0T B;  4G1T A;  1U3C A;  2M63 A;  3TL5 A;  1HFA A;  4Y6C A;  5JJ7 A;  3ONK A;  3CHM A;  1HG5 A;  2WMN A;  3KS2 A;  3AU5 A;  3ZYQ A;  4BTB A;  5J90 A;  4ANU A;  2V0P A;  1OWM A;  3IBE A;  4LUN U;  1QZ2 A;  2E2E A;  3PZD A;  4GYW A;  4EBA G;  1PY1 A;  3FDH A;  4N3A A;  2X6F A;  3D9O A;  2IOL A;  3LCA A;  3OAW A;  4GZD A;  4XZ4 A;  3B7U X;  4YVQ C;  3CSF A;  3ZW3 A;  4A55 A;  3FTV A;  2WXR A;  2LSU A;  4KZ0 A;  3CVQ A;  3QWV A;  2VSX E;  2MOW A;  4KXK B;  4U8H A;  5G04 C;  4B0Z A;  3PE3 A;  1A17 A;  1JUQ A;  2OVB A;  1MQS A;  3RU0 A;  3PEU B;  1E8Y A;  4ANW A;  4WWN A;  3UT4 A;  4AOF A;  4PUC A;  4GZ6 A;  4UWK A;  3ZYM A;  4U0Z A;  2J49 A;  4RSY A;  2X6K A;  4N5C A;  3EJN A;  3NF1 A;  5G04 J;  3ZHE B;  2IOS A;  2CHZ A;  3B7T A;  2KAT A;  3IV0 A;  3D9L A;  2OND A;  1SZ9 A;  2CFZ A;  2WQH A;  4MKT A;  2LAI A;  4UI9 J;  4GPK A;  3MX3 A;  4FU3 A;  3MKQ B;  4I9E A;  3QDN A;  3LY7 A;  1S0P A;  3CVL A;  4N3B A;  3ULQ A;  3LVQ E;  4OVV A;  3U3W A;  4AY6 A;  1HE8 A;  5M72 A;  1HXI A;  4U63 A;  3FUF A;  3D9J A;  3DPD A;  4I2Z A;  4JEH A;  3UMV A;  3L08 A;  4EZJ A;  5C1D A;  2XCC A;  1HG2 A;  4HXI A;  3UX4 A;  4G26 A;  3NQP A;  5FQ7 A;  4GML A;  4HOU A;  2PM6 A;  2WVI A;  3HVE B;  3LYA A;  4L2Y A;  3QAR A;  2KCK A;  4M3O A;  5A6C A;  2WXM A;  4CRW A;  3CK7 A;  3IEG A;  3LY8 A;  3Q47 B;  3ZGQ A;  4AVX A;  5CCL A;  3CLJ A;  2QY7 A;  3TJP A;  4GB9 A;  3JUI A;  4GCN A;  5ANR A;  3JYS A;  2FEZ A;  2OOE A;  2WXF A;  4CGV A;  3APD A;  2XHE A;  4JL0 A;  3PNT B;  4JXT A;  3LY9 A;  4URK A;  4GZ5 A;  3ML9 A;  4G25 A;  1IYG A;  4C0M A;  5BNW A;  3FUI A;  3T5V A;  2KZT A;  2P58 C;  5JJT A;  5KJN A;  4APO A;  1YA0 A;  4UWH A;  1WAO 1;  4OVU A;  3ASD A;  4NAC A;  3ZFW A;  2UWJ G;  4UI9 K;  3ASH A;  4AXH A;  3B7R L;  1KLX A;  4LCT A;  4Q69 A;  4J8E A;  4F7A A;  1BPO A;  5JHB A;  5FZR A;  4I6E A;  5AEN A;  1Z3X A;  4U0S A;  3K9I A;  4W9R A;  4A1S A;  2Y3A A;  3BEE A;  3PS6 A;  2HR2 A;  3S7J A;  4ATG A;  4B89 A;  2BTD A;  1E8X A;  3PE4 A;  4LER A;  3SZ7 A;  5HQ8 A;  4GA2 A;  4UWL A;  2WXQ A;  4F1S A;  5G55 A;  4CGW A;  1LF8 A;  3EHM A;  2VSN A;  5FZQ A;  1ZBP A;  3APF A;  2R17 C;  4ILG A;  1H19 A;  3FUN A;  5AYW D;  4FAD A;  4CCA A;  1OUV A;  4A3T A;  2UY1 A;  3GZ2 A;  5ENN A;  1E7U A;  4AV7 A;  4GZ3 A;  4GA1 A;  3U64 A;  2YHE A;  2IQC A;  1MHQ A;  2X6I A;  3P1U A;  3GZ1 A;  3EDT B;  2ZU6 B;  3CQC B;  2NSZ A;  4KT6 B;  4XKC A;  2GRM A;  5DBK A;  3FP3 A;  4LEU A;  3R7Q A;  1UJJ A;  3PUJ A;  3TXM A;  3AS8 A;  3MYV A;  5BUZ A;  2WXK A;  1WY6 A;  4XE0 A;  1OWL A;  3MKQ A;  3T5X A;  4O6F A;  3BG1 B;  3SBT B;  2PZI A;  3CHP A;  3JCK C;  4GAA A;  3G2S A;  3VTY A;  5FJY A;  2OV8 A;  3T8M A;  4ME2 A;  2WPV A;  3ENE A;  3SI5 A;  4N2Q A;  4UQX A;  2IFU A;  1HF8 A;  1ZU2 A;  1X5B A;  2CHW A;  4DI3 A;  3OXF A;  3L22 A;  4JPS A;  4HS2 A;  4CT4 A;  2VTB A;  4K03 A;  1HO8 A;  1E96 B;  3FEX A;  3HVE A;  2HM8 A;  2KC7 A;  3IKO B;  4WWP A;  3CHO A;  4YND A;  3NZS A;  4CDN A;  3MEK A;  3VLD A;  2J08 A;  3AS5 A;  4NRH B;  1HH8 A;  3D9N A;  3AU4 A;  3GYZ A;  3IHV A;  1GW6 A;  3FUE A;  3QKY A;  5FTP A;  3PRE A;  3RRM B;  3AS4 A;  2ION A;  4ANV A;  2AXV A;  3FTU A;  1EYH A;  2BUG A;  5T4Y A;  2DCP A;  2Y4U A;  3ASF A;  4JVS A;  5EX0 A;  2CG2 A;  2A4Z A;  2J09 A;  1TJC A;  3S2A A;  2VGY A;  3FHE A;  3GW4 A;  4WNG A;  3OXL A;  5LCW C;  1L5J A;  4I1O B;  4R7L A;  4CDR A;  3ZYK A;  4I6J A;  3CQG B;  3ZRH A;  1NZN A;  2GGF A;  2XRY A;  3SBS A;  2J9Q A;  3FUL A;  1Z6T A;  2PQN A;  4OYS A;  4DPR A;  2RD0 A;  3ZEF A;  3TXN A;  5LCW J;  4AY5 A;  4JEU A;  1SQM A;  3ESK A;  1E7V A;  5KJK A;  3LXU X;  3EIQ C;  5BW8 C;  3R7R A;  4CDM A;  1OWO A;  2WXP A;  3Q5M A;  1PC2 A;  3C98 A;  1H2V C;  3CVN A;  2WXN A;  3Q4A B;  4L7T A;  4N3C A;  4WUY A;  1EF1 C;  4FHJ A;  1UW4 B;  2V8S E;  1HX8 A;  4ANX A;  2VSO E;  2XRZ A;  3I4R B;  2XPY A;  5FZS A;  1WM5 A;  4DI4 A;  3OXG A;  2WQ7 A;  1KT0 A;  3G2T A;  1UN8 A;  3MV2 B;  3FTZ A;  4JW1 A;  1H0A A;  3LEW A;  2R5S A;  3E4B A;  2C0L A;  4JA7 A;  2GRL A;  1ELW A;  3FTX A;  4JHR A;  4Q96 A;  4WNF A;  1DNP A;  5BV0 A;  3L16 A;  3EHN A;  4PH4 B;  3FEY A;  1E8W A;  4AJW A;  4C0E A;  3KEZ A;  2VYI A;  1HS6 A;  4HOR A;  3RO2 A;  2Y4T A;  4BSX A;  1INZ A;  3RRU A;  2L6J A;  4DJA A;  3FH8 A;  4P29 A;  2FO7 A;  1U3D A;  2V4L A;  4HOT A;  3JQ1 A;  4MRU A;  1ELK A;  4G24 A;  3LKU A;  4I6G A;  1JPL A;  2LNI A;  3L54 A;  3BG0 B;  4GYY A;  5EX3 A;  3RRN B;  3TAX A;  4JHK A;  2FF4 A;  4KMO A;  3HYM B;  5BT1 A;  2Q7F A;  5KCM A;  3ZN3 A;  4U0U A;  3MKR A;  2V5F A;  5A7D B;  4B94 A;  5LOZ A;  2J4B A;  4J6I A;  3VLE A;  1OWP A;  4KBQ A;  1H6K A;  2AVP A;  2JEK A;  2WXH A;  3NZU A;  5D0O D;  4KZC A;  4BX8 A;  4EEC A;  2XCB A;  3FY4 A;  3QOU A;  4L1B A;  4BT9 A;  4C9B B;  3HIZ A;  4EZK A;  2WB2 A;  3B13 A;  1UJK A;  1HZ4 A;  3O48 A;  4TUU A;  1NA0 A;  2MRI A;  3RKV A;  5HI7 A;  4AIF A;  4IRU A;  4XI9 A;  1JWF A;  3ZYL A;  2WXL A;  4GCO A;  3FTY A;  3QC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...