3Q49B

Crystal structure of the tpr domain of chip complexed with hsp70-c peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
132
structure length
132
Chain Sequence
SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism of the Negative Regulation of Smad1/5 Protein by Carboxyl Terminus of Hsc70-interacting Protein (CHIP).
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/chaperone
molecule keywords STIP1 homology and U box-containing protein 1
total genus 56
structure length 132
sequence length 132
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3q49B00
2KATA 3FP3A 3ZPJA 3KD7A 1WAO1 4A1SA 1NA0A 4GA2A 5A7DB 4BTAA 5HQ8A 4N2SA 4ME2A 2KCKA 2VYIA 3LY8A 4KBQA 4G2VA 4N3AA 4YNDA 3CEQA 3CVPA 3EDTB 4WNDA 4JHRA 5EX0A 4CDRA 5JJTA 2Q7FA 3U3WA 1IYGA 1NA3A 4HOTA 3ZHEB 1IHGA 2L6JA 4I1AA 3ZGQA 2FEZA 2QFCA 1TJCA 3NF1A 2XGOA 3LCAA 3OXGA 1HZ4A 3MV2B 4Y6WA 3RO2A 5G04C 2VGXA 3URZA 1OUVA 3ZN3A 4J8DA 3QKYA 4U0ZA 5FJYA 2XGSA 3S7FA 4I17A 3ASDA 1HH8A 2KCLA 2XPIA 5G05J 5EX3A 4H7XA 5BW8C 3QWWA 2ONDA 4KYOB 4AIFA 3RO3A 2C0MA 4UQYA 4N3CA 3FFLA 3WXXA 2YHCA 2XCCA 4N3BA 1ZU2A 3GW4A 2WPVA 2PQRA 3CVQA 3LY7A 4HOUA 4JA7A 4UI9J 5DIZA 5JJ6A 4AM9A 4YVOA 3TG4A 3N71A 2UY1A 3AS4A 1A17A 1QQEA 4GA1A 4G24A 2R5SA 5G05C 3S7BA 1B89A 4GZ3A 4I9EA 3LYAA 4N39A 2VGXB 4N5CA 3RJVA 4XI9A 5FT9A 1W3BA 4G25A 1KLXA 1PC2A 3PE4A 3QWVA 4J8FA 4ABNA 3QDNA 4HOQA 4WUYA 4HORA 2OOEA 4J8EA 2Y4UA 3R9AB 3ASFA 4CGVA 3TAXA 5LCWJ 3UQ3A 3MEKA 4GA0A 3CVLA 3QOUA 3UPVA 2LSVA 3MV3B 1KT1A 1ELRA 2DBAA 5BNWA 3Q47B 2VSNA 2C2LA 2BUGA 3IEGA 3GZ2A 3Q15A 4GYOA 3GYZA 5EKQD 3Q49B 5HI7A 4GPKA 2PZIA 3MA5A 3PDNA 4I9CA 2E2EA 5ARFA 2GW1A 2FBNA 2PL2A 2VGYA 2XEVA 3FWVA 5A6CA 3OXLA 3KAEA 1XNFA 4B94A 1P5QA 4UI9C 5C1DA 2J9QA 3SZ7A 4AY6A 4WNFA 3K9IA 2PQNA 2P58C 3VTXA 4N2QA 4WNGA 2XCBA 2HO1A 4JA9A 5D0QD 3CK7A 2KCVA 3E4BA 4H7YA 2VSYA 4AY5A 4GZ6A 4U07A 4W9RA 3CKCA 1FCHA 4XIFA 5JJ7A 3BEEA 5CCLA 2AVPA 1YA0A 3ESKA 4APOA 3RIBA 2LSUA 5FTPA 4BT8A 4BT9A 1QZ2A 5LCWC 4BWRA 1NZNA 4GZ5A 1HXIA 4G1TA 4JL0A 4U04A 5FZSA 4CGWA 5KJNA 3AS8A 4I2ZA 2C0LA 4UQXA 3CV0A 3O48A 2HYZA 2XGMA 3GZ1A 3AS5A 3Q4AB 4G26A 4Y6CA 4GCOA 4U0SA 4U0UA 1WM5A 3QWPA 2NC9A 3LKUA 3ULQA 4O6FA 4YVQC 3RKVA 4EQFA 3ZFWA 4GYYA 4J0UA 2LNIA 5AYWD 2FF4A 1ELWA 5KJKA 5DBKA 4GYWA 4I2WA 1ZBPA 3LPZA 5KJLA 5G04J 3HYMB 2WQHA 5KJMA 5D0OD 1Y8MA 3CKBA 4NRHB 3CVNA 3TG5A 4HOSA 4GCNA 2IFUA 4G23A 3JYSA 3PE3A 2V5FA 3CK9A 3MKRA 2Y4TA 5BT1A 3TGOA 3KS2A 4UI9K 5FZRA 2JLBA 2MHKA 3OXFA 2HR2A 4NQ0A 4WNEA 3LY9A 4XI0A 4BTBA 4IN3B 2KC7A 1E96B 3CK8A 2FO7A 3ASHA 4RG6A 5ARGA 5FZQA 3RU0A 3S7JA 3U4TA 3ZHEA 5CCMA 2IF4A 5CHEE 3UUXA 2YQ8A 4LEUA 3VTYA 3S7DA 4UQZA 3SF4A 2VQ2A 4F3VA 5M72A 4KXKB 3Q5MA 1KT0A 3ASGA 2FI7A 2UWJG 2I6HA 4RG9A 2UY1B
chains in the Genus database with same CATH superfamily
2CFUA 3JQ1A 3T8KA 4NURA 4ME2A 4KBQA 2VGEA 3CVPA 3QARA 1IYGA 2WXMA 1OUVA 3ZXPA 5G05J 5BPPA 5BW8C 5CMWA 4UQYA 3WXXA 3UXGA 1UG3A 3GW4A 4UI9J 4AVXA 2XEEA 3ISMC 2LUHA 3KEZA 1HU3A 3APFA 5ENRD 3RJVA 3FEXA 2I1KA 1W3BA 1KLXA 3HVEA 2ETAA 4HORA 4CGVA 4BSZB 2LSVA 2OV8A 4GB9A 5T3RA 2C2LA 4I43A 4PUCA 5EKQD 3HDXA 2PL2A 3CHPA 3AG3E 4DPRA 3EIQC 3TWQA 1TNUA 4PDXA 2VSYA 4XIFA 3X2QE 5LCWC 3AAAC 4JL0A 3Q75A 3U9WA 2I2OA 5KJNA 3Q4AB 4DX6D 4G26A 3ULEG 5KNHD 1WM5A 3MYVA 4EQFA 3CVWA 4ATZD 4CDNA 4IYPA 3AU4A 1TN7A 1JCQA 2MHKA 3BU8A 5KBAA 4FJYA 3UUXA 2WB2A 3FUNA 4KXKB 2XS8A 1FPPA 3ASGA 3BUAA 2UY1B 3DEOA 4UWGA 1O1TA 2HE0A 4A1GA 2H6IA 3LEWA 3FUMA 4OAUC 1NA3A 3RRMB 4I1AA 3HXCA 3SD5A 1IHBA 5G04C 4J8DA 5FJYA 3S7FA 5ITZF 4KYOB 1N94A 3LY7A 3PRZA 3Q78A 2P9LG 3D9HA 4J8YA 3E34A 1B89A 3KSQA 2AJAA 3QAQA 4UWLA 4BETA 4HBDA 4OYSA 5CRUA 4TXRA 3SNXA 5LCWJ 1Z5SC 5KWDA 3MV3B 1KT1A 4U95D 3B95A 2NSZA 2V4LA 2IJGX 3JXIA 1JWFA 4GYOA 4GTSA 3NB2A 4J7WA 1BPOA 3SQVA 3OXLA 5CRVA 1HG5A 4HVBA 2IOLA 2AXUA 3G2WA 3V2OA 4FULA 3ENEA 2MRIA 3I4GA 2AXZA 1G3NB 4H7YA 3CKCA 2WXHA 3R7QA 4I2ZA 3ZW3A 4D10C 3CVXA 2NC9A 3DSWA 3RKVA 4KMOA 3ASNE 4HB5A 4FLBA 4J0UA 4JD2G 4I6JA 3PZ2A 2WQHA 1U3DA 4DI3A 3CK9A 3FU0A 4MLPA 2PNNA 2VSXE 3TWVA 5AN8A 5LX8A 1BI7B 1E8WA 3L82A 4K0RA 1N4QA 1OCRE 2CHXA 3B13A 3BG1B 3R9MA 5JJTA 3ZGQA 1TJCA 3LCAA 5AQAA 4RQIA 3G2SA 3B7RL 1Z3XA 1TN8A 3PH0C 2P9IG 4R7LA 4G8LA 1EPUA 3FFLA 3EHNA 4JW1A 1ZB1A 3W9FA 4GA1A 4I9EA 2XENA 4ABNA 2J4DA 3LXUX 5BV1A 4PS7A 3LJ3A 4UUCA 3GZ2A 2KM4A 2GRMA 4Q69A 4HLEA 3HXFA 4L23A 4C9BB 3C3OA 4NACA 2XCBA 4ZFHA 5CEAA 1TNOA 2ZGGA 2V8SE 3RIBA 3B7UX 1KZOA 4GZ5A 3HXBA 3NAWA 3TJPA 2C0LA 3GZ1A 4U0UA 1K3ZD 3LKUA 1OWLA 2BEDA 3T5XA 4GYWA 5KJLA 4BX8A 3CVNA 2IOSA 4NQ0A 4XI0A 3SFZA 2KC7A 3QNKA 4DJAA 2IF4A 3C72A 3EU9A 3CQGB 5EILA 3CSFA 2FI7A 4LNBA 3IHVA 3LY8A 2WXKA 1O1RA 2KXPC 2L0TB 3E37A 3SBSA 1V55E 3MZLB 4N3CA 2R03A 1DC2A 3UIOC 3V30A 3L6AA 5AQ9A 2OVBA 3FUHA 3HRAA 4G25A 2OOEA 4A55A 3FUIA 3TWTA 3QOUA 1SZAA 4FHKA 3HHMA 1OY3D 3AG1E 3CR3A 3MA5A 2E2EA 2FBNA 1OT8A 4XE0A 3VTXA 1LD7A 2JABA 4DX5D 3UT8A 4LCTA 3PUJA 4BEPA 2X6JA 2BKGA 4CGWA 1QNFA 5CMYA 2XGMA 3C3RA 3EJNA 5AYWD 3OTNA 5JA4D 3DRAA 4JEHA 4ANVA 3D9OA 3OAWA 2V5FA 3PREA 2RD0A 1OWPA 2A4ZA 3LY9A 4LNGA 4IN3B 4RG6A 2FO7A 3IHYA 1EYHA 3ZYKA 3HXDA 4JZYA 1AWCB 1H2VC 1YYHA 2WQ7A 3CHQA 4N2SA 3FH5A 1E90A 3AG2E 2H6FA 5ANRA 1BU9A 1LD8A 3EHRA 5CEDB 2XZTG 1HZ4A 2ZU6B 4GZCA 1OCCE 3JUEA 4GU5A 4N5QA 3LJNA 3L17A 4MRUA 4M3OA 4EHMA 2XCCA 3APDA 4BESA 2PQRA 4B89A 2BF0X 3AG4E 2M63A 4WUYA 1OCZE 3EHQA 4GTRA 5ENTD 3PDNA 4GZDA 3D9IA 3LDZA 3FTVA 3TWWA 4WNGA 4DUIA 1OWMA 4FC8A 2KCVA 1YCSB 3E4BA 4MS6A 2Y69E 4Q96A 3BQOA 4BWRA 1TN6A 2YNQA 1UJKA 4CT0A 3AJIA 1UN8A 3ZNGA 1ELWA 1DVPA 4DI4A 3DPYA 1SA4A 4G23A 3JYSA 5AAOA 3TGOA 4FADA 4BTBA 2NXPA 1MYOA 2X6KA 2WVIA 5ARGA 3RU0A 2WMNA 2DZOA 4AOFA 3CVVA 4RVBA 2J8SD 1N0RA 4FLHA 4WNDA 1SQMA 4U7EB 4HOTA 4CT4A 3DSVA 3B7TA 3FTSA 3QWWA 3ESLA 2WXGA 3FH7A 5AENA 2WPVA 3CVQA 5DIZA 1X5BA 1D8DA 4OAVB 5E75A 4N39A 1XGWA 4ANUA 2LXLA 4J8EA 3TAXA 2I1JA 2R2LA 5AIJA 3DPDA 3J5PA 2J49A 2GW1A 3DXKG 1XNFA 3FY4A 3E30A 4CZ2D 4WNFA 3ABME 3BG0B 3CK7A 2WXPA 1FCHA 4U96D 2H6HA 1Z3YA 4BT9A 3L54A 3ONLA 3EU5A 2EIME 5C2YA 4JVSA 3JUIA 3ZFWA 1JPLA 3NOGD 1ZBPA 4F1SA 2LXMA 1EDUA 3MKRA 1N9AA 3FTUA 1IQUA 5ANLA 4QQIA 4UWFA 2EQXA 5H7PA 1HG2A 2CG3A 2IO3C 4TUMA 2PM7A 5T4YA 3FULA 2KCKA 3TWUA 3CEQA 2WXFA 4IULA 2QZAA 1N52A 3FUKA 5AARA 2KBXA 3ASDA 4ACKA 2ETCA 4AIFA 3RO3A 5E76A 1BI8B 2YHCA 3DWLG 2YHEA 2GRQB 3ZRHA 5HKPA 3UT4A 1K8KG 3UIPC 3CQCB 3P2BA 2EILE 2ZGDA 1D8EA 3UM2A 2WXJA 1O5MA 4L2LA 4JB8P 5ARFA 5EN5D 2J9QA 3FTYA 4LERA 4JA9A 1JWGA 3Q7AA 4W9RA 1TJFA 4YDYA 3ESKA 3G2VA 1OWOA 5CBOA 4K5AB 4UQXA 3O48A 1RW2A 3AS5A 3ONKA 3VLDA 3D9JA 1UOHA 5G04J 1HFAA 2LO6A 3RSEG 3CKBA 2Y4TA 1Z6TA 3UKRG 4LUNU 4U63A 1U3CA 3UM3A 1N54A 3EUVA 4J6IA 4DLOA 3ZUVB 2KATA 3IBEA 3UINC 4GA2A 5EX0A 4OVVA 2DCPA 1U2VG 2GGFA 4LSZE 4FJZA 1HH8A 2XPIA 5EX3A 5IY5E 2ONDA 1O1SA 4ILHB 1ELKA 3S7DA 5JJ6A 2WXOA 4B93B 1QQEA 2QYUA 2V0PA 3S7BA 4JHJA 3QWVA 2XQ0A 1MQSA 3NZUA 4WWNA 3FHEA 3PUKA 2DYSE 3ZXSA 1WDYA 2VGYA 3CVYA 3FU3A 3FUEA 1Q2ZA 4AV7A 4F1PA 4N2QA 2AW6A 4ACLA 3FU5A 4P29A 1YA0A 1H0AA 3ABKE 1QZ2A 4HFGA 3R7RA 4KVMA 4EECA 3QB2A 5AQ7A 2F8YA 4B8AA 2P9KG 4TRQA 3Q7FA 4GYYA 2LNIA 4JHKA 1DNPA 3SGHA 1E8ZA 4AP2A 3TG5A 4CCAA 4KVOA 5FZRA 3OXFA 3CHSA 5CCLA 4HI9A 3U4TA 5CHEE 1SZ9A 3TWRA 5M72A 5D66A 4HS2A 3ZPJA 2ILRA 3CHMA 4YNDA 3L13A 2Y1LE 3EHMA 4G8KA 3ZIMA 2FEZA 4GMLA 4Y6WA 3MV2B 2E0IA 5FIOA 3Q79A 4OVUA 3D9MA 1N95A 5BXUA 5FQ6A 4JC8A 2UY1A 2R5SA 3W9GA 3DEPA 1N4SA 3QDNA 3U64A 3TWXA 3R9AB 4BFRA 3UQ3A 1D9SA 3D9KA 4L1BA 3CVLA 4I1MA 3Q47B 2X6HA 2BUGA 3ABLE 2FULA 3SBTB 4PH4B 3C5RA 2BKKB 4U8HA 2IO2C 2WXLA 2A5EA 4XKCA 4A3VA 4AJWA 5J08A 1IKND 4U04A 5FZSA 4EPZA 1H6OA 4KT6B 1H6PA 3AS8A 5A23A 3MKQA 1HE8A 2XS1A 3SHFA 2J4BA 4BERA 1S64A 3ULQA 3DBSA 4CEMA 2NYJA 5KJKA 3V79K 3LPZA 1N4RA 4GMJA 1N0QA 4NRHB 4DX1A 2BTDA 5C1DA 4FU3A 1TYQG 2GRPB 3ZHEA 3UT7A 4JXTA 1E7VA 4A63B 2GRNB 4MBGA 1WAO1 3PEUB 3DSSA 4G11A 4O1PA 2VYIA 2R05A 4G2VA 4CDRA 1LF8A 5JMND 3UTMA 1HX8A 2QFCA 4NIKA 2XGOA 2VGXA 3E33A 4I17A 2XPZA 4HXIA 5EYPF 2VTBB 5EIBE 3C98A 1JCSA 5BXOA 2YINA 4G24A 4HRNA 5G05C 5LOZA 2HM8A 2H6GA 4N5CA 4QFVA 5B1AE 1X81A 3CGHA 3PS6A 2Y4UA 5AQBA 4L2YA 5B3SE 4EBAG 5BNWA 1NL4A 3Q49B 1BD8A 1NI1A 2Y0BG 3FTZA 5A6CA 1WY6A 2WXQA 3LVQE 4UI9C 3SZ7A 2OEVA 4GPMA 1UN9A 3HIZA 2OEWA 4C48B 4EBAA 2IU1A 5JJ7A 4GZ6A 4O1OA 4URKA 2AVPA 2DIWA 5FTPA 2DWZA 4DX7D 2J08A 2RFMA 1E7UA 1TNZA 3TL5A 4ANXA 3LS8A 5LFAA 4AXHA 4O6FA 3AU5A 2FF4A 5FQ4A 5D0OD 3SO8A 1L5JA 4ATGA 4PS8A 4GMRA 1JCRA 1NP7A 5ENOD 2VJ8A 4L9PA 4LEUA 1QYMA 3VTYA 2OVFA 2L9BA 3ZU7B 4GTPA 1NA0A 3RRUA 1DCQA 1DCEA 4I1OB 2Q7FA 3U3WA 3RAUA 3ZHEB 2V4HC 2L6JA 3OXGA 1QBQA 3SY2A 3I3NA 1FVHA 2KCLA 3N71A 3AS4A 3Q73A 3NBNB 1TNYA 2P9PG 1Y6IA 1PC2A 3G2UA 1TEZA 3ASFA 2EIJE 4GAAA 4XKBA 3JXJA 2A5UA 5HI7A 4E85A 1YMPA 3K9IA 2XEHA 3ZYMA 3SFXA 1H2TC 4U07A 4DK5A 2MOWA 3PZ4A 4APOA 4LNUD 1IXVA 3UKUG 1NZNA 1HXIA 1MHQA 2DYRE 2WM9A 1FVFA 1HS6A 4Y6CA 4CYMD 4GCOA 3QWPA 3VLEA 4V3IA 3FTWA 1OWNA 3HYMB 3I4RB 2KZTA 1H6KA 2JLBA 2HR2A 2XRYA 3CK8A 4F7AA 2GRRB 2J07A 4I6EA 1KT0A 3ASOE 3D9PA 1H19A 4C0MA 5HQ8A 4GTQA 2LAHA 5KCMA 4GTTA 2CG2A 3UMVA 3FUDA 5CBNA 3NF1A 3ZYLA 4U0ZA 4UWKA 2PM6A 2MYOA 4H7XA 1S0PA 3T5VA 3FUJA 2RKKA 3IKOB 4N3BA 1ZU2A 4JA7A 1MZCA 5B1BE 3TG4A 3SI5A 3ULYA 4O60A 3D9LA 3GZSA 4L7TA 3MEKA 4C0EA 3MKQB 2FO1E 3CHOA 3V2XA 5J90A 4HQDA 4B94A 1P5QA 3P1UA 4AY6A 2L6BA 3HG0D 2HO1A 3Q9UC 5CECB 3QK0A 2IEJA 1TR4A 5FWQA 4HNAD 1INZA 3ML9A 5BUZA 4B0ZA 3FEYA 3WG7E 4KZ0A 1SW6A 4HOSA 3MCXA 2IFUA 1HF8A 3KS2A 1S63A 4I6GA 3NOCD 3S7JA 4YDOA 3S2AA 4KZCA 2VTBA 2CHZA 4K03A 5HRYA 3TXMA 3FUFA 4AEZC 1TNBA 4A1SA 2KZTB 4N3AA 3EDTB 2F37A 4X8QA 1IHGA 3QC1A 3PNTB 2XPYA 3ZN3A 4A3TA 2J09A 3L08A 1HO8A 4TUUA 3CVUA 4XEIG 2R02A 3TXNA 4HOUA 3PZ3A 2XZDG 5LP0A 1MX4A 3T9KA 2B0OE 2WMOA 3FTXA 4GZ3A 3I5PA 2EIKE 3L16A 3UPVA 1ELRA 4XZ4A 1OXJA 3L9TA 3GYZA 2WQ6A 4I9CA 2P58C 4B8CB 4HRLA 4GTVA 2ZIRA 2LSUA 2HYZA 2DVWA 4EZLA 4TXPA 4DRXE 1LTXA 2ETBA 5ENPD 4I2WA 3RK6A 2R17C 4GCNA 1N4PA 3V31A 5ENNA 5EIDA 4DX2A 3DSTA 4WWOA 4HI8A 5EYLA 3HXEA 4BY6A 2P9SG 2WXIA 2YQ8A 3UX4A 3IXEA 4F3VA 2AWIA 4Q94A 4APFA 1MX6A 2X3MA 3CIAA 4ILGA 3J5QB 2IONA 2Y3AA 5BV0A 3KEAA 3D9NA 2QY7A 2X6FA 4YVOA 3LYAA 5FT9A 3RRNB 3C3QA 3PE4A 4HOQA 4ILIA 3JCKC 3IEGA 3TWSA 1JUQA 1FT2A 2F0YA 3D3MA 5CERB 2XEVA 1VDYA 1OCOE 3KAEA 2V5QC 4CRWA 3UM0A 4J8SA 2GROB 3Q9NC 4RLYA 1S70B 1V54E 4AY5A 3PZ1A 4HLLA 1A5EA 4F6RD 4BT8A 4ZHBA 1N11A 3ZVVA 3CHRA 3CV0A 1NFIE 4K5CA 4WWPA 4U0SA 4FA6A 2L0IA 4YVQC 3UI2A 1KZPA 5DBKA 3SFYA 1EF1C 4JPSA 4JEUA 4F53A 1Y8MA 1MJ0A 2RFAA 3ASHA 4DLQA 3MJWA 3DSXA 5CCMA 4YDWA 5AJLA 3PZDA 5FQ7A 2P2CP 5FINA 5FQ8A 2OCCE 3SF4A 2LAIA 2I6HA 4RG9A 3FP3A 5ENQD 1IQRA 5KNGA 4JHRA 1GW6A 3JQ0A 3CSTA 3RO2A 3URZA 3QKYA 2XGSA 4FHJA 2C0MA 4YDEA 4AM9A 3VLFA 1PY1A 2WXNA 1FT1A 1A17A 2VSOE 1SA5A 3APCA 2F8XK 2VGXB 5G2NA 4J8FA 1AP7A 2AXVA 4TV3A 2QYJA 4GA0A 5AJDA 1KPSB 2VSNA 4LG6A 3DXMG 3Q15A 3EIJA 4E6HA 4BSXA 5EDSA 2ZXWE 2PQNA 2X38A 4K5BA 5HS0A 3ZKJA 3B7SA 2P9NG 4IRUA 4WAFA 5JHAA 2EINE 3NQPA 2JEKA 2P9UG 3CLJA 3PEVB 2RG8A 1BLXB 1H2UA 3F6QA 1UW4B 4UWHA 4BX9A 2X6IA 1PAQA 3PE3A 3DSUA 1E8XA 2IQCA 4WNEA 1E96B 5G55A 2R59A 3KSLA 5D2MC 1K1AA 4UQZA 3ML8A 3Q5MA 4ANWA 4M7CA 3E32A 2WXRA 2DZNA 4EZKA 4BTAA 3KD7A 2XHEA 5A7DB 3PVLA 3NZSA 3HVEB 4GTMA 1RZ4A 3PNLB 1MX2A 2I9CA 4PS3A 2B6CA 2CFZA 2XRZA 4XI9A 4MKTA 5T8IA 3ZEFA 3FU6A 4GTOA 1WG0A 4U8VD 3O4ZA 5JHBA 4FP7A 2DBAA 1E8YA 3L22A 3MX3A 3T8MA 4Z68A 4GPKA 2PZIA 5KJMA 3FWVA 4RSYA 4XX5A 3MGBA 2ZISA 3QJZA 3U66A 3FDHA 4LRZA 4HRMB 5D0QD 4CDMA 2IY0C 3BEEA 3LVRE 4G1TA 4EZJA 4U8YD 1K1BA 4TXQA 3UM1A 3IV0A 5BT1A 4UI9K 2QC9A 3FH8A 1SVXA 3G2TA 5FZQA 1UJJA 3B7BA 2GRLA 2VQ2A 5ENSD 3ZYQA 2UWJG 2CHWA
chains in the Genus database with same CATH topology
2CFUA 2WQ7A 3CHQA 4AEZC 3ZPJA 4N2SA 3FH5A 1E90A 3JQ1A 4A1SA 2ILRA 2KZTB 4NURA 3CHMA 5ANRA 4ME2A 4KBQA 4N3AA 4YNDA 3CVPA 3EDTB 3L13A 3EHMA 3QARA 1IYGA 1IHGA 3QC1A 2WXMA 3ZIMA 2FEZA 3PNTB 4GMLA 4Y6WA 1HZ4A 3MV2B 2E0IA 2XPYA 1OUVA 3ZN3A 2ZU6B 4OVUA 4GZCA 3D9MA 5G05J 4A3TA 5BPPA 4GU5A 2J09A 5BW8C 3L17A 5CMWA 4MRUA 3L08A 5FQ6A 1HO8A 4UQYA 3WXXA 4M3OA 4TUUA 3CVUA 2XCCA 3APDA 1UG3A 3GW4A 2PQRA 4JC8A 4UI9J 4HOUA 3TXNA 4AVXA 4B89A 5LP0A 2UY1A 3KEZA 2R5SA 1HU3A 3APFA 2BF0X 2WMOA 3FTXA 4GZ3A 3RJVA 3FEXA 2I1KA 1W3BA 1KLXA 3I5PA 3HVEA 3QDNA 2M63A 4WUYA 3U64A 4HORA 3R9AB 4BFRA 4CGVA 3UQ3A 3D9KA 4L1BA 3CVLA 3L16A 4I1MA 3UPVA 2LSVA 1ELRA 2OV8A 4GB9A 4XZ4A 3Q47B 5T3RA 2X6HA 2C2LA 4I43A 2BUGA 2FULA 3GYZA 4PUCA 5EKQD 2WQ6A 3SBTB 3PDNA 4GZDA 3HDXA 4I9CA 3D9IA 2PL2A 3CHPA 3LDZA 3FTVA 4PH4B 4DPRA 2P58C 3EIQC 4U8HA 4B8CB 4WNGA 1OWMA 4FC8A 2KCVA 2WXLA 3E4BA 2VSYA 4MS6A 4PDXA 4XIFA 4XKCA 4A3VA 4AJWA 5J08A 2LSUA 5LCWC 4Q96A 4BWRA 4JL0A 4U04A 5FZSA 3U9WA 4KT6B 2I2OA 3AS8A 4EPZA 5A23A 5KJNA 3MKQA 1HE8A 3Q4AB 2HYZA 4G26A 2YNQA 3SHFA 4EZLA 2J4BA 1UJKA 4CT0A 1WM5A 3ULQA 3DBSA 3MYVA 4CEMA 4EQFA 3CVWA 1UN8A 4CDNA 4IYPA 1ELWA 5KJKA 4I2WA 1DVPA 3RK6A 3LPZA 4DI4A 3AU4A 4GMJA 4NRHB 2R17C 2BTDA 4GCNA 4G23A 3JYSA 5C1DA 5ENNA 3TGOA 4FADA 2MHKA 4BTBA 2NXPA 4WWOA 2X6KA 4FU3A 2WVIA 5ARGA 3RU0A 3ZHEA 2WMNA 3UT7A 4JXTA 1E7VA 4BY6A 4FJYA 3UUXA 2WB2A 2WXIA 2YQ8A 3FUNA 3UX4A 4AOFA 4F3VA 2AWIA 4KXKB 4Q94A 3CVVA 3ASGA 4RVBA 2UY1B 4APFA 4UWGA 1WAO1 3PEUB 2X3MA 4G11A 4FLHA 4A1GA 2VYIA 4G2VA 4WNDA 3LEWA 4CDRA 3FUMA 1SQMA 1LF8A 3CIAA 1NA3A 4HOTA 3RRMB 4ILGA 4CT4A 4I1AA 1HX8A 3SD5A 2QFCA 2XGOA 2IONA 5G04C 2VGXA 3B7TA 2Y3AA 4J8DA 5FJYA 3FTSA 5BV0A 3S7FA 4I17A 2XPZA 3D9NA 3ESLA 2QY7A 3QWWA 4HXIA 4KYOB 2VTBB 2WXGA 3FH7A 5AENA 2WPVA 3CVQA 2X6FA 3LY7A 3PRZA 5DIZA 4YVOA 1X5BA 3C98A 2YINA 4G24A 5G05C 5LOZA 2HM8A 1B89A 4N5CA 4QFVA 3LYAA 4N39A 5E75A 3QAQA 4UWLA 5FT9A 3RRNB 1XGWA 3PE4A 4ANUA 4OYSA 3CGHA 3PS6A 4HOQA 4ILIA 4J8EA 2Y4UA 3SNXA 2I1JA 3TAXA 5LCWJ 4L2YA 4EBAG 3MV3B 1KT1A 2NSZA 5BNWA 2V4LA 3JCKC 2IJGX 3IEGA 1JWFA 3DPDA 1JUQA 4GYOA 2J49A 3D3MA 5AIJA 3Q49B 5FZRA 5A6CA 3FTZA 2GW1A 2XEVA 1BPOA 1VDYA 3OXLA 3KAEA 1HG5A 1WY6A 1XNFA 2WXQA 3LVQE 4HVBA 4UI9C 3FY4A 4CRWA 2IOLA 3SZ7A 4J8SA 4WNFA 2AXUA 3G2WA 1UN9A 3HIZA 3BG0B 3ENEA 4FULA 2MRIA 3I4GA 3CK7A 2AXZA 4EBAA 2IU1A 2WXPA 4H7YA 4AY5A 4GZ6A 5JJ7A 3CKCA 1FCHA 4URKA 2WXHA 1Z3YA 2AVPA 2DIWA 4BT9A 5FTPA 4BT8A 2J08A 3L54A 3R7QA 3ONLA 3ZVVA 1E7UA 4I2ZA 3ZW3A 3CHRA 3CV0A 4WWPA 3TL5A 4ANXA 4D10C 3LS8A 4U0SA 5C2YA 4FA6A 5LFAA 2L0IA 4JVSA 4AXHA 2NC9A 3CVXA 4O6FA 3JUIA 4YVQC 4KMOA 3RKVA 3AU5A 3ZFWA 4FLBA 4J0UA 2FF4A 4I6JA 1JPLA 5DBKA 5FQ4A 1ZBPA 1EF1C 4JPSA 2WQHA 4F1SA 4JEUA 5D0OD 4F53A 1EDUA 1Y8MA 1U3DA 4DI3A 3MKRA 3CK9A 1L5JA 3FTUA 3FU0A 1IQUA 4ATGA 5ANLA 4PS8A 3ASHA 4DLQA 3MJWA 1NP7A 4MLPA 2VJ8A 2VSXE 4UWFA 5AJLA 5CCMA 3PZDA 5FQ7A 4LEUA 2EQXA 5FQ8A 3VTYA 2OVFA 1HG2A 3SF4A 2CG3A 2LAIA 5LX8A 2L9BA 2I6HA 4RG9A 1E8WA 2PM7A 3FP3A 5T4YA 1IQRA 1NA0A 4K0RA 3RRUA 3FULA 2KCKA 2CHXA 3CEQA 2WXFA 3B13A 3BG1B 4JHRA 4I1OB 5JJTA 2Q7FA 3U3WA 4IULA 1GW6A 3ZHEB 2L6JA 3ZGQA 3OXGA 1N52A 1TJCA 3LCAA 3JQ0A 3CSTA 3RO2A 3FUKA 3URZA 3I3NA 3QKYA 2XGSA 3B7RL 3G2SA 1FVHA 1Z3XA 3ASDA 2KCLA 4FHJA 3PH0C 4R7LA 4ACKA 4AIFA 3RO3A 2C0MA 1EPUA 5E76A 3FFLA 2YHCA 3EHNA 4JW1A 4AM9A 3VLFA 2YHEA 1PY1A 2WXNA 3AS4A 1A17A 3N71A 2VSOE 4GA1A 3ZRHA 3APCA 4I9EA 3UT4A 2VGXB 1Y6IA 5G2NA 3CQCB 4ABNA 1PC2A 3G2UA 2J4DA 4J8FA 2AXVA 1TEZA 4TV3A 3P2BA 3ASFA 3LXUX 5BV1A 4GA0A 4PS7A 5AJDA 3LJ3A 4GAAA 4XKBA 2VSNA 2WXJA 3GZ2A 3Q15A 2KM4A 2A5UA 2GRMA 4Q69A 3EIJA 4L2LA 5HI7A 4HLEA 5ARFA 4E6HA 4E85A 4L23A 4BSXA 4C9BB 5EDSA 2J9QA 4NACA 3FTYA 3K9IA 2PQNA 4LERA 2X38A 2XCBA 1JWGA 4JA9A 3ZYMA 3B7SA 1H2TC 4U07A 4W9RA 4IRUA 4WAFA 1TJFA 1H2VC 4DK5A 2MOWA 2V8SE 3ESKA 3G2VA 4APOA 1OWOA 3RIBA 5JHAA 3B7UX 3NQPA 1NZNA 4GZ5A 1HXIA 1MHQA 2JEKA 3TJPA 2C0LA 4UQXA 3O48A 2WM9A 1FVFA 1HS6A 3GZ1A 3AS5A 3CLJA 4Y6CA 4GCOA 3ONKA 4U0UA 3PEVB 3QWPA 2RG8A 1H2UA 3D9JA 3LKUA 3VLDA 3VLEA 1OWLA 3T5XA 1UW4B 4V3IA 3FTWA 4GYWA 4UWHA 4BX9A 2X6IA 5KJLA 5G04J 1OWNA 1HFAA 3HYMB 1PAQA 2LO6A 3CKBA 3I4RB 3CVNA 2IOSA 4BX8A 2KZTA 3PE3A 1H6KA 1E8XA 2Y4TA 2IQCA 1Z6TA 2JLBA 4NQ0A 4WNEA 2HR2A 4XI0A 3SFZA 2XRYA 2KC7A 1E96B 3CK8A 3QNKA 5G55A 4F7AA 4DJAA 2IF4A 2R59A 4LUNU 2J07A 4I6EA 3CQGB 4U63A 1U3CA 4UQZA 3ML8A 3CSFA 3Q5MA 1N54A 1KT0A 4ANWA 2FI7A 3D9PA 2WXRA 1H19A 4J6IA 4DLOA 2KATA 4EZKA 4BTAA 3KD7A 3IBEA 2XHEA 4GA2A 5A7DB 4C0MA 3IHVA 5HQ8A 2LAHA 3LY8A 3PVLA 5KCMA 5EX0A 4OVVA 2WXKA 2L0TB 2CG2A 2DCPA 3NZSA 3FUDA 3UMVA 3HVEB 3NF1A 2GGFA 3SBSA 4U0ZA 3ZYLA 4FJZA 3PNLB 4UWKA 1HH8A 2PM6A 2XPIA 5EX3A 4H7XA 1S0PA 2I9CA 2ONDA 4PS3A 3MZLB 3T5VA 3FUJA 4N3CA 4ILHB 3IKOB 1ELKA 4N3BA 1ZU2A 3S7DA 2CFZA 4JA7A 5JJ6A 3TG4A 3L6AA 3SI5A 2WXOA 2OVBA 2XRZA 1QQEA 3FUHA 2V0PA 3S7BA 4JHJA 4XI9A 4G25A 3QWVA 4MKTA 3D9LA 5T8IA 3ZEFA 3GZSA 3FU6A 2OOEA 4L7TA 2XQ0A 1MQSA 3FUIA 3O4ZA 3MEKA 4A55A 3NZUA 4C0EA 5JHBA 3MKQB 3QOUA 4FP7A 1SZAA 2DBAA 4WWNA 1E8YA 3FHEA 3PUKA 3CHOA 3L22A 4FHKA 3HHMA 5J90A 3MX3A 3T8MA 4GPKA 2PZIA 3CR3A 3MA5A 3ZXSA 2E2EA 5KJMA 3FWVA 2FBNA 4RSYA 2VGYA 3CVYA 3FU3A 1P5QA 3FUEA 3P1UA 4B94A 4XX5A 4AV7A 4XE0A 3MGBA 4AY6A 3QJZA 3VTXA 3U66A 4N2QA 2AW6A 2HO1A 3FDHA 4LRZA 4ACLA 5D0QD 3FU5A 4CDMA 3QK0A 4P29A 3UT8A 4LCTA 3BEEA 5FWQA 1YA0A 3PUJA 1H0AA 3LVRE 2X6JA 1INZA 1QZ2A 4HFGA 3R7RA 4KVMA 4EECA 4CGWA 3QB2A 4G1TA 1QNFA 4EZJA 5CMYA 3ML9A 2XGMA 5BUZA 3EJNA 4B8AA 4B0ZA 4TRQA 3FEYA 4HS2A 4GYYA 4KZ0A 2LNIA 5AYWD 3OTNA 4JHKA 1DNPA 3SGHA 3IV0A 1E8ZA 4JEHA 4AP2A 3TG5A 4HOSA 3MCXA 2IFUA 4ANVA 3D9OA 1HF8A 2V5FA 3OAWA 4CCAA 5BT1A 3PREA 3KS2A 2RD0A 4KVOA 4UI9K 1OWPA 2A4ZA 3FH8A 3G2TA 3OXFA 3CHSA 3LY9A 4I6GA 4IN3B 5CCLA 4RG6A 2FO7A 3U4TA 3IHYA 1EYHA 5FZQA 3S7JA 5CHEE 3ZYKA 1SZ9A 1UJJA 3S2AA 4KZCA 2GRLA 2VTBA 2CHZA 2VQ2A 4JZYA 5M72A 4K03A 3ZYQA 3TXMA 3FUFA 2UWJG 2CHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KAT A;  3FP3 A;  3ZPJ A;  3KD7 A;  1WAO 1;  4A1S A;  1NA0 A;  4GA2 A;  5A7D B;  4BTA A;  5HQ8 A;  4N2S A;  4ME2 A;  2KCK A;  2VYI A;  3LY8 A;  4KBQ A;  4G2V A;  4N3A A;  4YND A;  3CEQ A;  3CVP A;  3EDT B;  4WND A;  4JHR A;  5EX0 A;  4CDR A;  5JJT A;  2Q7F A;  3U3W A;  1IYG A;  1NA3 A;  4HOT A;  3ZHE B;  1IHG A;  2L6J A;  4I1A A;  3ZGQ A;  2FEZ A;  2QFC A;  1TJC A;  3NF1 A;  2XGO A;  3LCA A;  3OXG A;  1HZ4 A;  3MV2 B;  4Y6W A;  3RO2 A;  5G04 C;  2VGX A;  3URZ A;  1OUV A;  3ZN3 A;  4J8D A;  3QKY A;  4U0Z A;  5FJY A;  2XGS A;  3S7F A;  4I17 A;  3ASD A;  1HH8 A;  2KCL A;  2XPI A;  5G05 J;  5EX3 A;  4H7X A;  5BW8 C;  3QWW A;  2OND A;  4KYO B;  4AIF A;  3RO3 A;  2C0M A;  4UQY A;  4N3C A;  3FFL A;  3WXX A;  2YHC A;  2XCC A;  4N3B A;  1ZU2 A;  3GW4 A;  2WPV A;  2PQR A;  3CVQ A;  3LY7 A;  4HOU A;  4JA7 A;  4UI9 J;  5DIZ A;  5JJ6 A;  4AM9 A;  4YVO A;  3TG4 A;  3N71 A;  2UY1 A;  3AS4 A;  1A17 A;  1QQE A;  4GA1 A;  4G24 A;  2R5S A;  5G05 C;  3S7B A;  1B89 A;  4GZ3 A;  4I9E A;  3LYA A;  4N39 A;  2VGX B;  4N5C A;  3RJV A;  4XI9 A;  5FT9 A;  1W3B A;  4G25 A;  1KLX A;  1PC2 A;  3PE4 A;  3QWV A;  4J8F A;  4ABN A;  3QDN A;  4HOQ A;  4WUY A;  4HOR A;  2OOE A;  4J8E A;  2Y4U A;  3R9A B;  3ASF A;  4CGV A;  3TAX A;  5LCW J;  3UQ3 A;  3MEK A;  4GA0 A;  3CVL A;  3QOU A;  3UPV A;  2LSV A;  3MV3 B;  1KT1 A;  1ELR A;  2DBA A;  5BNW A;  3Q47 B;  2VSN A;  2C2L A;  2BUG A;  3IEG A;  3GZ2 A;  3Q15 A;  4GYO A;  3GYZ A;  5EKQ D;  3Q49 B;  5HI7 A;  4GPK A;  2PZI A;  3MA5 A;  3PDN A;  4I9C A;  2E2E A;  5ARF A;  2GW1 A;  2FBN A;  2PL2 A;  2VGY A;  2XEV A;  3FWV A;  5A6C A;  3OXL A;  3KAE A;  1XNF A;  4B94 A;  1P5Q A;  4UI9 C;  5C1D A;  2J9Q A;  3SZ7 A;  4AY6 A;  4WNF A;  3K9I A;  2PQN A;  2P58 C;  3VTX A;  4N2Q A;  4WNG A;  2XCB A;  2HO1 A;  4JA9 A;  5D0Q D;  3CK7 A;  2KCV A;  3E4B A;  4H7Y A;  2VSY A;  4AY5 A;  4GZ6 A;  4U07 A;  4W9R A;  3CKC A;  1FCH A;  4XIF A;  5JJ7 A;  3BEE A;  5CCL A;  2AVP A;  1YA0 A;  3ESK A;  4APO A;  3RIB A;  2LSU A;  5FTP A;  4BT8 A;  4BT9 A;  1QZ2 A;  5LCW C;  4BWR A;  1NZN A;  4GZ5 A;  1HXI A;  4G1T A;  4JL0 A;  4U04 A;  5FZS A;  4CGW A;  5KJN A;  3AS8 A;  4I2Z A;  2C0L A;  4UQX A;  3CV0 A;  3O48 A;  2HYZ A;  2XGM A;  3GZ1 A;  3AS5 A;  3Q4A B;  4G26 A;  4Y6C A;  4GCO A;  4U0S A;  4U0U A;  1WM5 A;  3QWP A;  2NC9 A;  3LKU A;  3ULQ A;  4O6F A;  4YVQ C;  3RKV A;  4EQF A;  3ZFW A;  4GYY A;  4J0U A;  2LNI A;  5AYW D;  2FF4 A;  1ELW A;  5KJK A;  5DBK A;  4GYW A;  4I2W A;  1ZBP A;  3LPZ A;  5KJL A;  5G04 J;  3HYM B;  2WQH A;  5KJM A;  5D0O D;  1Y8M A;  3CKB A;  4NRH B;  3CVN A;  3TG5 A;  4HOS A;  4GCN A;  2IFU A;  4G23 A;  3JYS A;  3PE3 A;  2V5F A;  3CK9 A;  3MKR A;  2Y4T A;  5BT1 A;  3TGO A;  3KS2 A;  4UI9 K;  5FZR A;  2JLB A;  2MHK A;  3OXF A;  2HR2 A;  4NQ0 A;  4WNE A;  3LY9 A;  4XI0 A;  4BTB A;  4IN3 B;  2KC7 A;  1E96 B;  3CK8 A;  2FO7 A;  3ASH A;  4RG6 A;  5ARG A;  5FZQ A;  3RU0 A;  3S7J A;  3U4T A;  3ZHE A;  5CCM A;  2IF4 A;  5CHE E;  3UUX A;  2YQ8 A;  4LEU A;  3VTY A;  3S7D A;  4UQZ A;  3SF4 A;  2VQ2 A;  4F3V A;  5M72 A;  4KXK B;  3Q5M A;  1KT0 A;  3ASG A;  2FI7 A;  2UWJ G;  2I6H A;  4RG9 A;  2UY1 B; 
#chains in the Genus database with same CATH topology
 2CFU A;  3JQ1 A;  3T8K A;  4NUR A;  4ME2 A;  4KBQ A;  2VGE A;  3CVP A;  3QAR A;  1IYG A;  2WXM A;  1OUV A;  3ZXP A;  5G05 J;  5BPP A;  5BW8 C;  5CMW A;  4UQY A;  3WXX A;  3UXG A;  1UG3 A;  3GW4 A;  4UI9 J;  4AVX A;  2XEE A;  3ISM C;  2LUH A;  3KEZ A;  1HU3 A;  3APF A;  5ENR D;  3RJV A;  3FEX A;  2I1K A;  1W3B A;  1KLX A;  3HVE A;  2ETA A;  4HOR A;  4CGV A;  4BSZ B;  2LSV A;  2OV8 A;  4GB9 A;  5T3R A;  2C2L A;  4I43 A;  4PUC A;  5EKQ D;  3HDX A;  2PL2 A;  3CHP A;  3AG3 E;  4DPR A;  3EIQ C;  3TWQ A;  1TNU A;  4PDX A;  2VSY A;  4XIF A;  3X2Q E;  5LCW C;  3AAA C;  4JL0 A;  3Q75 A;  3U9W A;  2I2O A;  5KJN A;  3Q4A B;  4DX6 D;  4G26 A;  3ULE G;  5KNH D;  1WM5 A;  3MYV A;  4EQF A;  3CVW A;  4ATZ D;  4CDN A;  4IYP A;  3AU4 A;  1TN7 A;  1JCQ A;  2MHK A;  3BU8 A;  5KBA A;  4FJY A;  3UUX A;  2WB2 A;  3FUN A;  4KXK B;  2XS8 A;  1FPP A;  3ASG A;  3BUA A;  2UY1 B;  3DEO A;  4UWG A;  1O1T A;  2HE0 A;  4A1G A;  2H6I A;  3LEW A;  3FUM A;  4OAU C;  1NA3 A;  3RRM B;  4I1A A;  3HXC A;  3SD5 A;  1IHB A;  5G04 C;  4J8D A;  5FJY A;  3S7F A;  5ITZ F;  4KYO B;  1N94 A;  3LY7 A;  3PRZ A;  3Q78 A;  2P9L G;  3D9H A;  4J8Y A;  3E34 A;  1B89 A;  3KSQ A;  2AJA A;  3QAQ A;  4UWL A;  4BET A;  4HBD A;  4OYS A;  5CRU A;  4TXR A;  3SNX A;  5LCW J;  1Z5S C;  5KWD A;  3MV3 B;  1KT1 A;  4U95 D;  3B95 A;  2NSZ A;  2V4L A;  2IJG X;  3JXI A;  1JWF A;  4GYO A;  4GTS A;  3NB2 A;  4J7W A;  1BPO A;  3SQV A;  3OXL A;  5CRV A;  1HG5 A;  4HVB A;  2IOL A;  2AXU A;  3G2W A;  3V2O A;  4FUL A;  3ENE A;  2MRI A;  3I4G A;  2AXZ A;  1G3N B;  4H7Y A;  3CKC A;  2WXH A;  3R7Q A;  4I2Z A;  3ZW3 A;  4D10 C;  3CVX A;  2NC9 A;  3DSW A;  3RKV A;  4KMO A;  3ASN E;  4HB5 A;  4FLB A;  4J0U A;  4JD2 G;  4I6J A;  3PZ2 A;  2WQH A;  1U3D A;  4DI3 A;  3CK9 A;  3FU0 A;  4MLP A;  2PNN A;  2VSX E;  3TWV A;  5AN8 A;  5LX8 A;  1BI7 B;  1E8W A;  3L82 A;  4K0R A;  1N4Q A;  1OCR E;  2CHX A;  3B13 A;  3BG1 B;  3R9M A;  5JJT A;  3ZGQ A;  1TJC A;  3LCA A;  5AQA A;  4RQI A;  3G2S A;  3B7R L;  1Z3X A;  1TN8 A;  3PH0 C;  2P9I G;  4R7L A;  4G8L A;  1EPU A;  3FFL A;  3EHN A;  4JW1 A;  1ZB1 A;  3W9F A;  4GA1 A;  4I9E A;  2XEN A;  4ABN A;  2J4D A;  3LXU X;  5BV1 A;  4PS7 A;  3LJ3 A;  4UUC A;  3GZ2 A;  2KM4 A;  2GRM A;  4Q69 A;  4HLE A;  3HXF A;  4L23 A;  4C9B B;  3C3O A;  4NAC A;  2XCB A;  4ZFH A;  5CEA A;  1TNO A;  2ZGG A;  2V8S E;  3RIB A;  3B7U X;  1KZO A;  4GZ5 A;  3HXB A;  3NAW A;  3TJP A;  2C0L A;  3GZ1 A;  4U0U A;  1K3Z D;  3LKU A;  1OWL A;  2BED A;  3T5X A;  4GYW A;  5KJL A;  4BX8 A;  3CVN A;  2IOS A;  4NQ0 A;  4XI0 A;  3SFZ A;  2KC7 A;  3QNK A;  4DJA A;  2IF4 A;  3C72 A;  3EU9 A;  3CQG B;  5EIL A;  3CSF A;  2FI7 A;  4LNB A;  3IHV A;  3LY8 A;  2WXK A;  1O1R A;  2KXP C;  2L0T B;  3E37 A;  3SBS A;  1V55 E;  3MZL B;  4N3C A;  2R03 A;  1DC2 A;  3UIO C;  3V30 A;  3L6A A;  5AQ9 A;  2OVB A;  3FUH A;  3HRA A;  4G25 A;  2OOE A;  4A55 A;  3FUI A;  3TWT A;  3QOU A;  1SZA A;  4FHK A;  3HHM A;  1OY3 D;  3AG1 E;  3CR3 A;  3MA5 A;  2E2E A;  2FBN A;  1OT8 A;  4XE0 A;  3VTX A;  1LD7 A;  2JAB A;  4DX5 D;  3UT8 A;  4LCT A;  3PUJ A;  4BEP A;  2X6J A;  2BKG A;  4CGW A;  1QNF A;  5CMY A;  2XGM A;  3C3R A;  3EJN A;  5AYW D;  3OTN A;  5JA4 D;  3DRA A;  4JEH A;  4ANV A;  3D9O A;  3OAW A;  2V5F A;  3PRE A;  2RD0 A;  1OWP A;  2A4Z A;  3LY9 A;  4LNG A;  4IN3 B;  4RG6 A;  2FO7 A;  3IHY A;  1EYH A;  3ZYK A;  3HXD A;  4JZY A;  1AWC B;  1H2V C;  1YYH A;  2WQ7 A;  3CHQ A;  4N2S A;  3FH5 A;  1E90 A;  3AG2 E;  2H6F A;  5ANR A;  1BU9 A;  1LD8 A;  3EHR A;  5CED B;  2XZT G;  1HZ4 A;  2ZU6 B;  4GZC A;  1OCC E;  3JUE A;  4GU5 A;  4N5Q A;  3LJN A;  3L17 A;  4MRU A;  4M3O A;  4EHM A;  2XCC A;  3APD A;  4BES A;  2PQR A;  4B89 A;  2BF0 X;  3AG4 E;  2M63 A;  4WUY A;  1OCZ E;  3EHQ A;  4GTR A;  5ENT D;  3PDN A;  4GZD A;  3D9I A;  3LDZ A;  3FTV A;  3TWW A;  4WNG A;  4DUI A;  1OWM A;  4FC8 A;  2KCV A;  1YCS B;  3E4B A;  4MS6 A;  2Y69 E;  4Q96 A;  3BQO A;  4BWR A;  1TN6 A;  2YNQ A;  1UJK A;  4CT0 A;  3AJI A;  1UN8 A;  3ZNG A;  1ELW A;  1DVP A;  4DI4 A;  3DPY A;  1SA4 A;  4G23 A;  3JYS A;  5AAO A;  3TGO A;  4FAD A;  4BTB A;  2NXP A;  1MYO A;  2X6K A;  2WVI A;  5ARG A;  3RU0 A;  2WMN A;  2DZO A;  4AOF A;  3CVV A;  4RVB A;  2J8S D;  1N0R A;  4FLH A;  4WND A;  1SQM A;  4U7E B;  4HOT A;  4CT4 A;  3DSV A;  3B7T A;  3FTS A;  3QWW A;  3ESL A;  2WXG A;  3FH7 A;  5AEN A;  2WPV A;  3CVQ A;  5DIZ A;  1X5B A;  1D8D A;  4OAV B;  5E75 A;  4N39 A;  1XGW A;  4ANU A;  2LXL A;  4J8E A;  3TAX A;  2I1J A;  2R2L A;  5AIJ A;  3DPD A;  3J5P A;  2J49 A;  2GW1 A;  3DXK G;  1XNF A;  3FY4 A;  3E30 A;  4CZ2 D;  4WNF A;  3ABM E;  3BG0 B;  3CK7 A;  2WXP A;  1FCH A;  4U96 D;  2H6H A;  1Z3Y A;  4BT9 A;  3L54 A;  3ONL A;  3EU5 A;  2EIM E;  5C2Y A;  4JVS A;  3JUI A;  3ZFW A;  1JPL A;  3NOG D;  1ZBP A;  4F1S A;  2LXM A;  1EDU A;  3MKR A;  1N9A A;  3FTU A;  1IQU A;  5ANL A;  4QQI A;  4UWF A;  2EQX A;  5H7P A;  1HG2 A;  2CG3 A;  2IO3 C;  4TUM A;  2PM7 A;  5T4Y A;  3FUL A;  2KCK A;  3TWU A;  3CEQ A;  2WXF A;  4IUL A;  2QZA A;  1N52 A;  3FUK A;  5AAR A;  2KBX A;  3ASD A;  4ACK A;  2ETC A;  4AIF A;  3RO3 A;  5E76 A;  1BI8 B;  2YHC A;  3DWL G;  2YHE A;  2GRQ B;  3ZRH A;  5HKP A;  3UT4 A;  1K8K G;  3UIP C;  3CQC B;  3P2B A;  2EIL E;  2ZGD A;  1D8E A;  3UM2 A;  2WXJ A;  1O5M A;  4L2L A;  4JB8 P;  5ARF A;  5EN5 D;  2J9Q A;  3FTY A;  4LER A;  4JA9 A;  1JWG A;  3Q7A A;  4W9R A;  1TJF A;  4YDY A;  3ESK A;  3G2V A;  1OWO A;  5CBO A;  4K5A B;  4UQX A;  3O48 A;  1RW2 A;  3AS5 A;  3ONK A;  3VLD A;  3D9J A;  1UOH A;  5G04 J;  1HFA A;  2LO6 A;  3RSE G;  3CKB A;  2Y4T A;  1Z6T A;  3UKR G;  4LUN U;  4U63 A;  1U3C A;  3UM3 A;  1N54 A;  3EUV A;  4J6I A;  4DLO A;  3ZUV B;  2KAT A;  3IBE A;  3UIN C;  4GA2 A;  5EX0 A;  4OVV A;  2DCP A;  1U2V G;  2GGF A;  4LSZ E;  4FJZ A;  1HH8 A;  2XPI A;  5EX3 A;  5IY5 E;  2OND A;  1O1S A;  4ILH B;  1ELK A;  3S7D A;  5JJ6 A;  2WXO A;  4B93 B;  1QQE A;  2QYU A;  2V0P A;  3S7B A;  4JHJ A;  3QWV A;  2XQ0 A;  1MQS A;  3NZU A;  4WWN A;  3FHE A;  3PUK A;  2DYS E;  3ZXS A;  1WDY A;  2VGY A;  3CVY A;  3FU3 A;  3FUE A;  1Q2Z A;  4AV7 A;  4F1P A;  4N2Q A;  2AW6 A;  4ACL A;  3FU5 A;  4P29 A;  1YA0 A;  1H0A A;  3ABK E;  1QZ2 A;  4HFG A;  3R7R A;  4KVM A;  4EEC A;  3QB2 A;  5AQ7 A;  2F8Y A;  4B8A A;  2P9K G;  4TRQ A;  3Q7F A;  4GYY A;  2LNI A;  4JHK A;  1DNP A;  3SGH A;  1E8Z A;  4AP2 A;  3TG5 A;  4CCA A;  4KVO A;  5FZR A;  3OXF A;  3CHS A;  5CCL A;  4HI9 A;  3U4T A;  5CHE E;  1SZ9 A;  3TWR A;  5M72 A;  5D66 A;  4HS2 A;  3ZPJ A;  2ILR A;  3CHM A;  4YND A;  3L13 A;  2Y1L E;  3EHM A;  4G8K A;  3ZIM A;  2FEZ A;  4GML A;  4Y6W A;  3MV2 B;  2E0I A;  5FIO A;  3Q79 A;  4OVU A;  3D9M A;  1N95 A;  5BXU A;  5FQ6 A;  4JC8 A;  2UY1 A;  2R5S A;  3W9G A;  3DEP A;  1N4S A;  3QDN A;  3U64 A;  3TWX A;  3R9A B;  4BFR A;  3UQ3 A;  1D9S A;  3D9K A;  4L1B A;  3CVL A;  4I1M A;  3Q47 B;  2X6H A;  2BUG A;  3ABL E;  2FUL A;  3SBT B;  4PH4 B;  3C5R A;  2BKK B;  4U8H A;  2IO2 C;  2WXL A;  2A5E A;  4XKC A;  4A3V A;  4AJW A;  5J08 A;  1IKN D;  4U04 A;  5FZS A;  4EPZ A;  1H6O A;  4KT6 B;  1H6P A;  3AS8 A;  5A23 A;  3MKQ A;  1HE8 A;  2XS1 A;  3SHF A;  2J4B A;  4BER A;  1S64 A;  3ULQ A;  3DBS A;  4CEM A;  2NYJ A;  5KJK A;  3V79 K;  3LPZ A;  1N4R A;  4GMJ A;  1N0Q A;  4NRH B;  4DX1 A;  2BTD A;  5C1D A;  4FU3 A;  1TYQ G;  2GRP B;  3ZHE A;  3UT7 A;  4JXT A;  1E7V A;  4A63 B;  2GRN B;  4MBG A;  1WAO 1;  3PEU B;  3DSS A;  4G11 A;  4O1P A;  2VYI A;  2R05 A;  4G2V A;  4CDR A;  1LF8 A;  5JMN D;  3UTM A;  1HX8 A;  2QFC A;  4NIK A;  2XGO A;  2VGX A;  3E33 A;  4I17 A;  2XPZ A;  4HXI A;  5EYP F;  2VTB B;  5EIB E;  3C98 A;  1JCS A;  5BXO A;  2YIN A;  4G24 A;  4HRN A;  5G05 C;  5LOZ A;  2HM8 A;  2H6G A;  4N5C A;  4QFV A;  5B1A E;  1X81 A;  3CGH A;  3PS6 A;  2Y4U A;  5AQB A;  4L2Y A;  5B3S E;  4EBA G;  5BNW A;  1NL4 A;  3Q49 B;  1BD8 A;  1NI1 A;  2Y0B G;  3FTZ A;  5A6C A;  1WY6 A;  2WXQ A;  3LVQ E;  4UI9 C;  3SZ7 A;  2OEV A;  4GPM A;  1UN9 A;  3HIZ A;  2OEW A;  4C48 B;  4EBA A;  2IU1 A;  5JJ7 A;  4GZ6 A;  4O1O A;  4URK A;  2AVP A;  2DIW A;  5FTP A;  2DWZ A;  4DX7 D;  2J08 A;  2RFM A;  1E7U A;  1TNZ A;  3TL5 A;  4ANX A;  3LS8 A;  5LFA A;  4AXH A;  4O6F A;  3AU5 A;  2FF4 A;  5FQ4 A;  5D0O D;  3SO8 A;  1L5J A;  4ATG A;  4PS8 A;  4GMR A;  1JCR A;  1NP7 A;  5ENO D;  2VJ8 A;  4L9P A;  4LEU A;  1QYM A;  3VTY A;  2OVF A;  2L9B A;  3ZU7 B;  4GTP A;  1NA0 A;  3RRU A;  1DCQ A;  1DCE A;  4I1O B;  2Q7F A;  3U3W A;  3RAU A;  3ZHE B;  2V4H C;  2L6J A;  3OXG A;  1QBQ A;  3SY2 A;  3I3N A;  1FVH A;  2KCL A;  3N71 A;  3AS4 A;  3Q73 A;  3NBN B;  1TNY A;  2P9P G;  1Y6I A;  1PC2 A;  3G2U A;  1TEZ A;  3ASF A;  2EIJ E;  4GAA A;  4XKB A;  3JXJ A;  2A5U A;  5HI7 A;  4E85 A;  1YMP A;  3K9I A;  2XEH A;  3ZYM A;  3SFX A;  1H2T C;  4U07 A;  4DK5 A;  2MOW A;  3PZ4 A;  4APO A;  4LNU D;  1IXV A;  3UKU G;  1NZN A;  1HXI A;  1MHQ A;  2DYR E;  2WM9 A;  1FVF A;  1HS6 A;  4Y6C A;  4CYM D;  4GCO A;  3QWP A;  3VLE A;  4V3I A;  3FTW A;  1OWN A;  3HYM B;  3I4R B;  2KZT A;  1H6K A;  2JLB A;  2HR2 A;  2XRY A;  3CK8 A;  4F7A A;  2GRR B;  2J07 A;  4I6E A;  1KT0 A;  3ASO E;  3D9P A;  1H19 A;  4C0M A;  5HQ8 A;  4GTQ A;  2LAH A;  5KCM A;  4GTT A;  2CG2 A;  3UMV A;  3FUD A;  5CBN A;  3NF1 A;  3ZYL A;  4U0Z A;  4UWK A;  2PM6 A;  2MYO A;  4H7X A;  1S0P A;  3T5V A;  3FUJ A;  2RKK A;  3IKO B;  4N3B A;  1ZU2 A;  4JA7 A;  1MZC A;  5B1B E;  3TG4 A;  3SI5 A;  3ULY A;  4O60 A;  3D9L A;  3GZS A;  4L7T A;  3MEK A;  4C0E A;  3MKQ B;  2FO1 E;  3CHO A;  3V2X A;  5J90 A;  4HQD A;  4B94 A;  1P5Q A;  3P1U A;  4AY6 A;  2L6B A;  3HG0 D;  2HO1 A;  3Q9U C;  5CEC B;  3QK0 A;  2IEJ A;  1TR4 A;  5FWQ A;  4HNA D;  1INZ A;  3ML9 A;  5BUZ A;  4B0Z A;  3FEY A;  3WG7 E;  4KZ0 A;  1SW6 A;  4HOS A;  3MCX A;  2IFU A;  1HF8 A;  3KS2 A;  1S63 A;  4I6G A;  3NOC D;  3S7J A;  4YDO A;  3S2A A;  4KZC A;  2VTB A;  2CHZ A;  4K03 A;  5HRY A;  3TXM A;  3FUF A;  4AEZ C;  1TNB A;  4A1S A;  2KZT B;  4N3A A;  3EDT B;  2F37 A;  4X8Q A;  1IHG A;  3QC1 A;  3PNT B;  2XPY A;  3ZN3 A;  4A3T A;  2J09 A;  3L08 A;  1HO8 A;  4TUU A;  3CVU A;  4XEI G;  2R02 A;  3TXN A;  4HOU A;  3PZ3 A;  2XZD G;  5LP0 A;  1MX4 A;  3T9K A;  2B0O E;  2WMO A;  3FTX A;  4GZ3 A;  3I5P A;  2EIK E;  3L16 A;  3UPV A;  1ELR A;  4XZ4 A;  1OXJ A;  3L9T A;  3GYZ A;  2WQ6 A;  4I9C A;  2P58 C;  4B8C B;  4HRL A;  4GTV A;  2ZIR A;  2LSU A;  2HYZ A;  2DVW A;  4EZL A;  4TXP A;  4DRX E;  1LTX A;  2ETB A;  5ENP D;  4I2W A;  3RK6 A;  2R17 C;  4GCN A;  1N4P A;  3V31 A;  5ENN A;  5EID A;  4DX2 A;  3DST A;  4WWO A;  4HI8 A;  5EYL A;  3HXE A;  4BY6 A;  2P9S G;  2WXI A;  2YQ8 A;  3UX4 A;  3IXE A;  4F3V A;  2AWI A;  4Q94 A;  4APF A;  1MX6 A;  2X3M A;  3CIA A;  4ILG A;  3J5Q B;  2ION A;  2Y3A A;  5BV0 A;  3KEA A;  3D9N A;  2QY7 A;  2X6F A;  4YVO A;  3LYA A;  5FT9 A;  3RRN B;  3C3Q A;  3PE4 A;  4HOQ A;  4ILI A;  3JCK C;  3IEG A;  3TWS A;  1JUQ A;  1FT2 A;  2F0Y A;  3D3M A;  5CER B;  2XEV A;  1VDY A;  1OCO E;  3KAE A;  2V5Q C;  4CRW A;  3UM0 A;  4J8S A;  2GRO B;  3Q9N C;  4RLY A;  1S70 B;  1V54 E;  4AY5 A;  3PZ1 A;  4HLL A;  1A5E A;  4F6R D;  4BT8 A;  4ZHB A;  1N11 A;  3ZVV A;  3CHR A;  3CV0 A;  1NFI E;  4K5C A;  4WWP A;  4U0S A;  4FA6 A;  2L0I A;  4YVQ C;  3UI2 A;  1KZP A;  5DBK A;  3SFY A;  1EF1 C;  4JPS A;  4JEU A;  4F53 A;  1Y8M A;  1MJ0 A;  2RFA A;  3ASH A;  4DLQ A;  3MJW A;  3DSX A;  5CCM A;  4YDW A;  5AJL A;  3PZD A;  5FQ7 A;  2P2C P;  5FIN A;  5FQ8 A;  2OCC E;  3SF4 A;  2LAI A;  2I6H A;  4RG9 A;  3FP3 A;  5ENQ D;  1IQR A;  5KNG A;  4JHR A;  1GW6 A;  3JQ0 A;  3CST A;  3RO2 A;  3URZ A;  3QKY A;  2XGS A;  4FHJ A;  2C0M A;  4YDE A;  4AM9 A;  3VLF A;  1PY1 A;  2WXN A;  1FT1 A;  1A17 A;  2VSO E;  1SA5 A;  3APC A;  2F8X K;  2VGX B;  5G2N A;  4J8F A;  1AP7 A;  2AXV A;  4TV3 A;  2QYJ A;  4GA0 A;  5AJD A;  1KPS B;  2VSN A;  4LG6 A;  3DXM G;  3Q15 A;  3EIJ A;  4E6H A;  4BSX A;  5EDS A;  2ZXW E;  2PQN A;  2X38 A;  4K5B A;  5HS0 A;  3ZKJ A;  3B7S A;  2P9N G;  4IRU A;  4WAF A;  5JHA A;  2EIN E;  3NQP A;  2JEK A;  2P9U G;  3CLJ A;  3PEV B;  2RG8 A;  1BLX B;  1H2U A;  3F6Q A;  1UW4 B;  4UWH A;  4BX9 A;  2X6I A;  1PAQ A;  3PE3 A;  3DSU A;  1E8X A;  2IQC A;  4WNE A;  1E96 B;  5G55 A;  2R59 A;  3KSL A;  5D2M C;  1K1A A;  4UQZ A;  3ML8 A;  3Q5M A;  4ANW A;  4M7C A;  3E32 A;  2WXR A;  2DZN A;  4EZK A;  4BTA A;  3KD7 A;  2XHE A;  5A7D B;  3PVL A;  3NZS A;  3HVE B;  4GTM A;  1RZ4 A;  3PNL B;  1MX2 A;  2I9C A;  4PS3 A;  2B6C A;  2CFZ A;  2XRZ A;  4XI9 A;  4MKT A;  5T8I A;  3ZEF A;  3FU6 A;  4GTO A;  1WG0 A;  4U8V D;  3O4Z A;  5JHB A;  4FP7 A;  2DBA A;  1E8Y A;  3L22 A;  3MX3 A;  3T8M A;  4Z68 A;  4GPK A;  2PZI A;  5KJM A;  3FWV A;  4RSY A;  4XX5 A;  3MGB A;  2ZIS A;  3QJZ A;  3U66 A;  3FDH A;  4LRZ A;  4HRM B;  5D0Q D;  4CDM A;  2IY0 C;  3BEE A;  3LVR E;  4G1T A;  4EZJ A;  4U8Y D;  1K1B A;  4TXQ A;  3UM1 A;  3IV0 A;  5BT1 A;  4UI9 K;  2QC9 A;  3FH8 A;  1SVX A;  3G2T A;  5FZQ A;  1UJJ A;  3B7B A;  2GRL A;  2VQ2 A;  5ENS D;  3ZYQ A;  2UWJ G;  2CHW A; 
#chains in the Genus database with same CATH homology
 2CFU A;  2WQ7 A;  3CHQ A;  4AEZ C;  3ZPJ A;  4N2S A;  3FH5 A;  1E90 A;  3JQ1 A;  4A1S A;  2ILR A;  2KZT B;  4NUR A;  3CHM A;  5ANR A;  4ME2 A;  4KBQ A;  4N3A A;  4YND A;  3CVP A;  3EDT B;  3L13 A;  3EHM A;  3QAR A;  1IYG A;  1IHG A;  3QC1 A;  2WXM A;  3ZIM A;  2FEZ A;  3PNT B;  4GML A;  4Y6W A;  1HZ4 A;  3MV2 B;  2E0I A;  2XPY A;  1OUV A;  3ZN3 A;  2ZU6 B;  4OVU A;  4GZC A;  3D9M A;  5G05 J;  4A3T A;  5BPP A;  4GU5 A;  2J09 A;  5BW8 C;  3L17 A;  5CMW A;  4MRU A;  3L08 A;  5FQ6 A;  1HO8 A;  4UQY A;  3WXX A;  4M3O A;  4TUU A;  3CVU A;  2XCC A;  3APD A;  1UG3 A;  3GW4 A;  2PQR A;  4JC8 A;  4UI9 J;  4HOU A;  3TXN A;  4AVX A;  4B89 A;  5LP0 A;  2UY1 A;  3KEZ A;  2R5S A;  1HU3 A;  3APF A;  2BF0 X;  2WMO A;  3FTX A;  4GZ3 A;  3RJV A;  3FEX A;  2I1K A;  1W3B A;  1KLX A;  3I5P A;  3HVE A;  3QDN A;  2M63 A;  4WUY A;  3U64 A;  4HOR A;  3R9A B;  4BFR A;  4CGV A;  3UQ3 A;  3D9K A;  4L1B A;  3CVL A;  3L16 A;  4I1M A;  3UPV A;  2LSV A;  1ELR A;  2OV8 A;  4GB9 A;  4XZ4 A;  3Q47 B;  5T3R A;  2X6H A;  2C2L A;  4I43 A;  2BUG A;  2FUL A;  3GYZ A;  4PUC A;  5EKQ D;  2WQ6 A;  3SBT B;  3PDN A;  4GZD A;  3HDX A;  4I9C A;  3D9I A;  2PL2 A;  3CHP A;  3LDZ A;  3FTV A;  4PH4 B;  4DPR A;  2P58 C;  3EIQ C;  4U8H A;  4B8C B;  4WNG A;  1OWM A;  4FC8 A;  2KCV A;  2WXL A;  3E4B A;  2VSY A;  4MS6 A;  4PDX A;  4XIF A;  4XKC A;  4A3V A;  4AJW A;  5J08 A;  2LSU A;  5LCW C;  4Q96 A;  4BWR A;  4JL0 A;  4U04 A;  5FZS A;  3U9W A;  4KT6 B;  2I2O A;  3AS8 A;  4EPZ A;  5A23 A;  5KJN A;  3MKQ A;  1HE8 A;  3Q4A B;  2HYZ A;  4G26 A;  2YNQ A;  3SHF A;  4EZL A;  2J4B A;  1UJK A;  4CT0 A;  1WM5 A;  3ULQ A;  3DBS A;  3MYV A;  4CEM A;  4EQF A;  3CVW A;  1UN8 A;  4CDN A;  4IYP A;  1ELW A;  5KJK A;  4I2W A;  1DVP A;  3RK6 A;  3LPZ A;  4DI4 A;  3AU4 A;  4GMJ A;  4NRH B;  2R17 C;  2BTD A;  4GCN A;  4G23 A;  3JYS A;  5C1D A;  5ENN A;  3TGO A;  4FAD A;  2MHK A;  4BTB A;  2NXP A;  4WWO A;  2X6K A;  4FU3 A;  2WVI A;  5ARG A;  3RU0 A;  3ZHE A;  2WMN A;  3UT7 A;  4JXT A;  1E7V A;  4BY6 A;  4FJY A;  3UUX A;  2WB2 A;  2WXI A;  2YQ8 A;  3FUN A;  3UX4 A;  4AOF A;  4F3V A;  2AWI A;  4KXK B;  4Q94 A;  3CVV A;  3ASG A;  4RVB A;  2UY1 B;  4APF A;  4UWG A;  1WAO 1;  3PEU B;  2X3M A;  4G11 A;  4FLH A;  4A1G A;  2VYI A;  4G2V A;  4WND A;  3LEW A;  4CDR A;  3FUM A;  1SQM A;  1LF8 A;  3CIA A;  1NA3 A;  4HOT A;  3RRM B;  4ILG A;  4CT4 A;  4I1A A;  1HX8 A;  3SD5 A;  2QFC A;  2XGO A;  2ION A;  5G04 C;  2VGX A;  3B7T A;  2Y3A A;  4J8D A;  5FJY A;  3FTS A;  5BV0 A;  3S7F A;  4I17 A;  2XPZ A;  3D9N A;  3ESL A;  2QY7 A;  3QWW A;  4HXI A;  4KYO B;  2VTB B;  2WXG A;  3FH7 A;  5AEN A;  2WPV A;  3CVQ A;  2X6F A;  3LY7 A;  3PRZ A;  5DIZ A;  4YVO A;  1X5B A;  3C98 A;  2YIN A;  4G24 A;  5G05 C;  5LOZ A;  2HM8 A;  1B89 A;  4N5C A;  4QFV A;  3LYA A;  4N39 A;  5E75 A;  3QAQ A;  4UWL A;  5FT9 A;  3RRN B;  1XGW A;  3PE4 A;  4ANU A;  4OYS A;  3CGH A;  3PS6 A;  4HOQ A;  4ILI A;  4J8E A;  2Y4U A;  3SNX A;  2I1J A;  3TAX A;  5LCW J;  4L2Y A;  4EBA G;  3MV3 B;  1KT1 A;  2NSZ A;  5BNW A;  2V4L A;  3JCK C;  2IJG X;  3IEG A;  1JWF A;  3DPD A;  1JUQ A;  4GYO A;  2J49 A;  3D3M A;  5AIJ A;  3Q49 B;  5FZR A;  5A6C A;  3FTZ A;  2GW1 A;  2XEV A;  1BPO A;  1VDY A;  3OXL A;  3KAE A;  1HG5 A;  1WY6 A;  1XNF A;  2WXQ A;  3LVQ E;  4HVB A;  4UI9 C;  3FY4 A;  4CRW A;  2IOL A;  3SZ7 A;  4J8S A;  4WNF A;  2AXU A;  3G2W A;  1UN9 A;  3HIZ A;  3BG0 B;  3ENE A;  4FUL A;  2MRI A;  3I4G A;  3CK7 A;  2AXZ A;  4EBA A;  2IU1 A;  2WXP A;  4H7Y A;  4AY5 A;  4GZ6 A;  5JJ7 A;  3CKC A;  1FCH A;  4URK A;  2WXH A;  1Z3Y A;  2AVP A;  2DIW A;  4BT9 A;  5FTP A;  4BT8 A;  2J08 A;  3L54 A;  3R7Q A;  3ONL A;  3ZVV A;  1E7U A;  4I2Z A;  3ZW3 A;  3CHR A;  3CV0 A;  4WWP A;  3TL5 A;  4ANX A;  4D10 C;  3LS8 A;  4U0S A;  5C2Y A;  4FA6 A;  5LFA A;  2L0I A;  4JVS A;  4AXH A;  2NC9 A;  3CVX A;  4O6F A;  3JUI A;  4YVQ C;  4KMO A;  3RKV A;  3AU5 A;  3ZFW A;  4FLB A;  4J0U A;  2FF4 A;  4I6J A;  1JPL A;  5DBK A;  5FQ4 A;  1ZBP A;  1EF1 C;  4JPS A;  2WQH A;  4F1S A;  4JEU A;  5D0O D;  4F53 A;  1EDU A;  1Y8M A;  1U3D A;  4DI3 A;  3MKR A;  3CK9 A;  1L5J A;  3FTU A;  3FU0 A;  1IQU A;  4ATG A;  5ANL A;  4PS8 A;  3ASH A;  4DLQ A;  3MJW A;  1NP7 A;  4MLP A;  2VJ8 A;  2VSX E;  4UWF A;  5AJL A;  5CCM A;  3PZD A;  5FQ7 A;  4LEU A;  2EQX A;  5FQ8 A;  3VTY A;  2OVF A;  1HG2 A;  3SF4 A;  2CG3 A;  2LAI A;  5LX8 A;  2L9B A;  2I6H A;  4RG9 A;  1E8W A;  2PM7 A;  3FP3 A;  5T4Y A;  1IQR A;  1NA0 A;  4K0R A;  3RRU A;  3FUL A;  2KCK A;  2CHX A;  3CEQ A;  2WXF A;  3B13 A;  3BG1 B;  4JHR A;  4I1O B;  5JJT A;  2Q7F A;  3U3W A;  4IUL A;  1GW6 A;  3ZHE B;  2L6J A;  3ZGQ A;  3OXG A;  1N52 A;  1TJC A;  3LCA A;  3JQ0 A;  3CST A;  3RO2 A;  3FUK A;  3URZ A;  3I3N A;  3QKY A;  2XGS A;  3B7R L;  3G2S A;  1FVH A;  1Z3X A;  3ASD A;  2KCL A;  4FHJ A;  3PH0 C;  4R7L A;  4ACK A;  4AIF A;  3RO3 A;  2C0M A;  1EPU A;  5E76 A;  3FFL A;  2YHC A;  3EHN A;  4JW1 A;  4AM9 A;  3VLF A;  2YHE A;  1PY1 A;  2WXN A;  3AS4 A;  1A17 A;  3N71 A;  2VSO E;  4GA1 A;  3ZRH A;  3APC A;  4I9E A;  3UT4 A;  2VGX B;  1Y6I A;  5G2N A;  3CQC B;  4ABN A;  1PC2 A;  3G2U A;  2J4D A;  4J8F A;  2AXV A;  1TEZ A;  4TV3 A;  3P2B A;  3ASF A;  3LXU X;  5BV1 A;  4GA0 A;  4PS7 A;  5AJD A;  3LJ3 A;  4GAA A;  4XKB A;  2VSN A;  2WXJ A;  3GZ2 A;  3Q15 A;  2KM4 A;  2A5U A;  2GRM A;  4Q69 A;  3EIJ A;  4L2L A;  5HI7 A;  4HLE A;  5ARF A;  4E6H A;  4E85 A;  4L23 A;  4BSX A;  4C9B B;  5EDS A;  2J9Q A;  4NAC A;  3FTY A;  3K9I A;  2PQN A;  4LER A;  2X38 A;  2XCB A;  1JWG A;  4JA9 A;  3ZYM A;  3B7S A;  1H2T C;  4U07 A;  4W9R A;  4IRU A;  4WAF A;  1TJF A;  1H2V C;  4DK5 A;  2MOW A;  2V8S E;  3ESK A;  3G2V A;  4APO A;  1OWO A;  3RIB A;  5JHA A;  3B7U X;  3NQP A;  1NZN A;  4GZ5 A;  1HXI A;  1MHQ A;  2JEK A;  3TJP A;  2C0L A;  4UQX A;  3O48 A;  2WM9 A;  1FVF A;  1HS6 A;  3GZ1 A;  3AS5 A;  3CLJ A;  4Y6C A;  4GCO A;  3ONK A;  4U0U A;  3PEV B;  3QWP A;  2RG8 A;  1H2U A;  3D9J A;  3LKU A;  3VLD A;  3VLE A;  1OWL A;  3T5X A;  1UW4 B;  4V3I A;  3FTW A;  4GYW A;  4UWH A;  4BX9 A;  2X6I A;  5KJL A;  5G04 J;  1OWN A;  1HFA A;  3HYM B;  1PAQ A;  2LO6 A;  3CKB A;  3I4R B;  3CVN A;  2IOS A;  4BX8 A;  2KZT A;  3PE3 A;  1H6K A;  1E8X A;  2Y4T A;  2IQC A;  1Z6T A;  2JLB A;  4NQ0 A;  4WNE A;  2HR2 A;  4XI0 A;  3SFZ A;  2XRY A;  2KC7 A;  1E96 B;  3CK8 A;  3QNK A;  5G55 A;  4F7A A;  4DJA A;  2IF4 A;  2R59 A;  4LUN U;  2J07 A;  4I6E A;  3CQG B;  4U63 A;  1U3C A;  4UQZ A;  3ML8 A;  3CSF A;  3Q5M A;  1N54 A;  1KT0 A;  4ANW A;  2FI7 A;  3D9P A;  2WXR A;  1H19 A;  4J6I A;  4DLO A;  2KAT A;  4EZK A;  4BTA A;  3KD7 A;  3IBE A;  2XHE A;  4GA2 A;  5A7D B;  4C0M A;  3IHV A;  5HQ8 A;  2LAH A;  3LY8 A;  3PVL A;  5KCM A;  5EX0 A;  4OVV A;  2WXK A;  2L0T B;  2CG2 A;  2DCP A;  3NZS A;  3FUD A;  3UMV A;  3HVE B;  3NF1 A;  2GGF A;  3SBS A;  4U0Z A;  3ZYL A;  4FJZ A;  3PNL B;  4UWK A;  1HH8 A;  2PM6 A;  2XPI A;  5EX3 A;  4H7X A;  1S0P A;  2I9C A;  2OND A;  4PS3 A;  3MZL B;  3T5V A;  3FUJ A;  4N3C A;  4ILH B;  3IKO B;  1ELK A;  4N3B A;  1ZU2 A;  3S7D A;  2CFZ A;  4JA7 A;  5JJ6 A;  3TG4 A;  3L6A A;  3SI5 A;  2WXO A;  2OVB A;  2XRZ A;  1QQE A;  3FUH A;  2V0P A;  3S7B A;  4JHJ A;  4XI9 A;  4G25 A;  3QWV A;  4MKT A;  3D9L A;  5T8I A;  3ZEF A;  3GZS A;  3FU6 A;  2OOE A;  4L7T A;  2XQ0 A;  1MQS A;  3FUI A;  3O4Z A;  3MEK A;  4A55 A;  3NZU A;  4C0E A;  5JHB A;  3MKQ B;  3QOU A;  4FP7 A;  1SZA A;  2DBA A;  4WWN A;  1E8Y A;  3FHE A;  3PUK A;  3CHO A;  3L22 A;  4FHK A;  3HHM A;  5J90 A;  3MX3 A;  3T8M A;  4GPK A;  2PZI A;  3CR3 A;  3MA5 A;  3ZXS A;  2E2E A;  5KJM A;  3FWV A;  2FBN A;  4RSY A;  2VGY A;  3CVY A;  3FU3 A;  1P5Q A;  3FUE A;  3P1U A;  4B94 A;  4XX5 A;  4AV7 A;  4XE0 A;  3MGB A;  4AY6 A;  3QJZ A;  3VTX A;  3U66 A;  4N2Q A;  2AW6 A;  2HO1 A;  3FDH A;  4LRZ A;  4ACL A;  5D0Q D;  3FU5 A;  4CDM A;  3QK0 A;  4P29 A;  3UT8 A;  4LCT A;  3BEE A;  5FWQ A;  1YA0 A;  3PUJ A;  1H0A A;  3LVR E;  2X6J A;  1INZ A;  1QZ2 A;  4HFG A;  3R7R A;  4KVM A;  4EEC A;  4CGW A;  3QB2 A;  4G1T A;  1QNF A;  4EZJ A;  5CMY A;  3ML9 A;  2XGM A;  5BUZ A;  3EJN A;  4B8A A;  4B0Z A;  4TRQ A;  3FEY A;  4HS2 A;  4GYY A;  4KZ0 A;  2LNI A;  5AYW D;  3OTN A;  4JHK A;  1DNP A;  3SGH A;  3IV0 A;  1E8Z A;  4JEH A;  4AP2 A;  3TG5 A;  4HOS A;  3MCX A;  2IFU A;  4ANV A;  3D9O A;  1HF8 A;  2V5F A;  3OAW A;  4CCA A;  5BT1 A;  3PRE A;  3KS2 A;  2RD0 A;  4KVO A;  4UI9 K;  1OWP A;  2A4Z A;  3FH8 A;  3G2T A;  3OXF A;  3CHS A;  3LY9 A;  4I6G A;  4IN3 B;  5CCL A;  4RG6 A;  2FO7 A;  3U4T A;  3IHY A;  1EYH A;  5FZQ A;  3S7J A;  5CHE E;  3ZYK A;  1SZ9 A;  1UJJ A;  3S2A A;  4KZC A;  2GRL A;  2VTB A;  2CHZ A;  2VQ2 A;  4JZY A;  5M72 A;  4K03 A;  3ZYQ A;  3TXM A;  3FUF A;  2UWJ G;  2CHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...