3Q49B

Crystal structure of the tpr domain of chip complexed with hsp70-c peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
132
structure length
132
Chain Sequence
b'SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STIP1 homology and U box-containing protein 1
publication title Molecular Mechanism of the Negative Regulation of Smad1/5 Protein by Carboxyl Terminus of Hsc70-interacting Protein (CHIP).
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/chaperone
total genus 56
structure length 132
sequence length 132
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3q49B00
3QKYA 2XGMA 4UI9J 1E96B 4WNFA 3ESKA 5LCWC 2KCVA 3S7JA 3GYZA 2FEZA 5FTPA 4BT9A 4APOA 3PDNA 3MV2B 4N3AA 2BUGA 3AS5A 2E2EA 2P58C 3TG4A 5JJ6A 1NZNA 2IFUA 3ASFA 2YQ8A 4KYOB 4G23A 4I9CA 1IHGA 1ELWA 3Q49B 5FJYA 3CK7A 4J8DA 2HR2A 3ASHA 3IEGA 3AS8A 4I2WA 2XGSA 2LSUA 3QWPA 3CVLA 3PE3A 4NQ0A 1YA0A 4N3CA 5D0QD 4WUYA 4CDRA 4UI9C 4J8EA 2FF4A 5BW8C 3CK8A 4XI9A 4UQXA 4HOQA 5KJLA 4JA9A 3HYMB 1NA0A 4U07A 4HORA 5KJNA 1QQEA 3Q47B 5FZQA 1HZ4A 4WNDA 2ONDA 1OUVA 5FZSA 2VGXA 3Q5MA 4YNDA 5JJ7A 3RO2A 2GW1A 4I1AA 1WAO1 2PZIA 3Q15A 2FI7A 3FFLA 4W9RA 3TG5A 3RKVA 1HH8A 2R5SA 5DBKA 3U4TA 4HOUA 3KS2A 4GYYA 4HOTA 4ME2A 4ABNA 5EKQD 5G04C 2J9QA 4KBQA 4N3BA 2MHKA 5EX0A 3S7FA 2DBAA 3CK9A 2JLBA 2V5FA 2LSVA 4GYOA 3MEKA 4XI0A 2KC7A 4GPKA 2IF4A 3UPVA 3WXXA 5HI7A 3RU0A 4O6FA 3K9IA 3VTYA 2XPIA 2Q7FA 4JHRA 5C1DA 4LEUA 4GA1A 2PQRA 5EX3A 1PC2A 2YHCA 2UWJG 1QZ2A 5AYWD 3BEEA 3UUXA 4I9EA 4GZ5A 2UY1A 2XGOA 5G04J 5FT9A 3NF1A 3LCAA 5G05J 3LPZA 3LYAA 2VSNA 3LY9A 5BT1A 3N71A 4AIFA 4J8FA 2KCLA 3CVQA 1P5QA 4U0ZA 2HYZA 4EQFA 3MA5A 1HXIA 3TAXA 4KXKB 1TJCA 1KT1A 2XEVA 4G25A 5JJTA 3SF4A 1WM5A 2VSYA 4BT8A 5A7DB 3ZFWA 3E4BA 3CKCA 5KJMA 3RO3A 2Y4UA 3EDTB 3AS4A 2C0MA 4GCNA 3OXFA 2VQ2A 3ASGA 2VYIA 1KT0A 4IN3B 4JL0A 4U04A 5ARGA 1IYGA 4G24A 3Q4AB 5ARFA 3CV0A 5CCLA 2Y4TA 4U0UA 3MV3B 3RJVA 2PQNA 4WNGA 3QOUA 3CEQA 5CHEE 4WNEA 2FO7A 5DIZA 1FCHA 4B94A 3ASDA 5BNWA 1ZBPA 4HOSA 5G05C 5M72A 2L6JA 4AY5A 4J0UA 2FBNA 2I6HA 1W3BA 2UY1B 2KATA 4G1TA 1ELRA 3PE4A 4YVQC 4GZ3A 3CVPA 2WQHA 4N5CA 4H7XA 3ZHEA 4GA0A 3TGOA 4G26A 3ZGQA 4NRHB 4YVOA 4UI9K 4GA2A 3VTXA 4CGWA 5CCMA 3KD7A 1B89A 2KCKA 3QDNA 3GZ1A 2VGYA 4AY6A 4UQZA 2C2LA 2C0LA 4Y6WA 5D0OD 5A6CA 4G2VA 2VGXB 2XCCA 3CKBA 3SZ7A 4BWRA 4I17A 3R9AB 3ZN3A 3URZA 3S7BA 2PL2A 3MKRA 2OOEA 5HQ8A 5LCWJ 4I2ZA 2LNIA 3FP3A 4Y6CA 3RIBA 3FWVA 3LY8A 3CVNA 3OXGA 3ZPJA 3GZ2A 3U3WA 4UQYA 4N2QA 4GCOA 4N2SA 1A17A 5KJKA 3LKUA 3QWWA 2HO1A 3O48A 1KLXA 4H7YA 4BTAA 4CGVA 3JYSA 4GYWA 4F3VA 2NC9A 4RG6A 3KAEA 3QWVA 3LY7A 4RG9A 4U0SA 4XIFA 3S7DA 4JA7A 4N39A 1ZU2A 2AVPA 4GZ6A 3ZHEB 1XNFA 2XCBA 3GW4A 4BTBA 2QFCA 1Y8MA 3ULQA 2WPVA 4AM9A 1NA3A 3UQ3A 5FZRA 3OXLA 4A1SA
chains in the Genus database with same CATH superfamily
1UJJA 2ZISA 3QKYA 3UM1A 1S64A 2XGMA 2LXMA 2AJAA 2WQ7A 3F6QA 4BSZB 1E8XA 3S7JA 3L54A 3CHRA 1HFAA 3B95A 2KZTB 2WVIA 3I4RB 4BT9A 4URKA 2EINE 4LCTA 3VLFA 5IY5E 1RW2A 1KZOA 4WAFA 2E2EA 5T8IA 3UM0A 1O1TA 2IFUA 3ASFA 3RRUA 4ILHB 4JW1A 4G23A 5CEDB 3Q49B 3HXEA 4HNAD 4GTQA 2HR2A 1TNOA 1WDYA 4K03A 2XGSA 3I5PA 3QWPA 3CVLA 2DYRE 2I1KA 3DPYA 3J5QB 3DSVA 2KXPC 4JEUA 4NQ0A 4AP2A 1OY3D 5AARA 4A55A 2I1JA 3FULA 5D0QD 4WUYA 4F6RD 3ENEA 2R17C 4J8EA 3CQCB 4BY6A 5EILA 4GZCA 5BV0A 3LVRE 5KJLA 1H6PA 4JA9A 2QYJA 4HORA 2RKKA 4L1BA 2MYOA 2WXHA 3Q47B 4WNDA 3PEUB 2ONDA 2M63A 4J8SA 1OUVA 2HM8A 4U95D 4BX9A 4YNDA 2CFZA 4UWGA 3Q15A 4PH4B 2FI7A 3D9HA 2NSZA 3FHEA 2R5SA 2DYSE 4ACKA 1HG2A 2P9KG 4HOUA 3EU9A 4GYYA 4CDNA 3DWLG 4JZYA 3ZUVB 2VJ8A 4KBQA 3CVYA 1NL4A 3G2VA 4FU3A 4BEPA 3EHMA 3UXGA 5AIJA 2J4BA 1OWOA 2V5FA 4GYOA 2X6FA 3ZNGA 2IF4A 4GAAA 2MRIA 4G8LA 4GU5A 1N0QA 3QARA 5B1BE 1TN6A 4LEUA 3G2SA 2PQRA 4FLHA 3ZU7B 4WWNA 5EX3A 1QZ2A 5AYWD 1N54A 3FTSA 1HE8A 4Q69A 2DIWA 2LO6A 2WXLA 5G04J 3CVUA 3LCAA 2WMNA 3TWVA 3B7BA 3N71A 4CEMA 4AIFA 4J8FA 1FVFA 4ACLA 4EQFA 2AW6A 4KXKB 3UKUG 4G25A 3SFYA 2A4ZA 3RSEG 3CVVA 3SF4A 1WM5A 1IHBA 4CCAA 3C3QA 1JPLA 3ULYA 3HVEB 3ZFWA 4B8CB 4IULA 5KJMA 3MZLB 3L16A 4BSXA 3FTUA 4GPMA 3DEPA 4UWKA 3SFXA 5LX8A 3D9LA 3JXIA 3AAAC 3DSSA 3EHRA 5ARGA 4FJYA 3EU5A 1TN8A 3BU8A 5FIOA 3ESLA 4DJAA 4AV7A 2ILRA 4HRNA 3D9NA 3EIJA 4G8KA 2DZOA 3CV0A 5CCLA 2Y4TA 4U0UA 4FLBA 4WWOA 3MV3B 4JC8A 2RD0A 3MGBA 3HXBA 3KSLA 2J49A 4DRXE 4HOSA 1N9AA 5M72A 2I6HA 1W3BA 2ZIRA 2IONA 4G1TA 3APCA 4A63B 3T8MA 2V8SE 4OAUC 1V55E 4MKTA 4DX6D 2WXMA 3ONKA 4GZ3A 3CVPA 2WQHA 1SVXA 2R02A 3E37A 4IYPA 1MX6A 2R2LA 1BU9A 4TUUA 5LOZA 3FEXA 3DXMG 3E30A 3BG0B 4OVVA 1DCEA 3MKQA 5BPPA 2ZGDA 1ELKA 3L82A 4A3VA 3GZ1A 4AY6A 4UQZA 4TRQA 5EIDA 2GGFA 3FUNA 1OCRE 3APFA 5D0OD 4CDMA 2PM6A 2VTBB 4I17A 3MKRA 4LUNU 3CHQA 4Q96A 3UTMA 5AQAA 5FQ6A 3UT8A 1NI1A 4Y6CA 3RIBA 1YMPA 1E7VA 4FC8A 3FWVA 3LY8A 1N4PA 2I9CA 3SI5A 3ZPJA 3GZ2A 3C72A 3DPDA 4ZHBA 4U8HA 1H6KA 3L13A 3LKUA 3E33A 4DLQA 2A5UA 5B3SE 1N4RA 2X3MA 2XS1A 4AVXA 3FU3A 2FO1E 1Y6IA 5ENQD 3ZIMA 4I1MA 2NC9A 4RG9A 3KEZA 4Q94A 2WXPA 3KSQA 4JA7A 1HS6A 3ZKJA 3ZHEB 4EECA 1XNFA 4TXQA 1Y8MA 1S63A 4YDEA 3P1UA 1S0PA 1E8YA 3CHOA 4AM9A 5CECB 4BETA 1BPOA 3G2WA 3ASOE 2BKKB 1LD7A 3FUJA 2RFAA 1E96B 4LRZA 4RQIA 4WNFA 1E90A 4L9PA 1D9SA 2R05A 2AXUA 3GYZA 3UM3A 3T5XA 1H19A 3FUMA 3IXEA 2XZDG 4APOA 1XGWA 4N3AA 3DXKG 2BUGA 4I6EA 3ZYKA 3PUJA 3TG4A 4R7LA 4DPRA 4XKBA 4GTMA 3D3MA 3AJIA 2YQ8A 4I6JA 4GMLA 2ZU6B 3D9MA 2F8YA 5HS0A 2RG8A 4J8DA 3IEGA 1O5MA 1S70B 3CHPA 4EPZA 3IBEA 4YDOA 4EBAA 2H6GA 4TXPA 4N3CA 5ENSD 5AJDA 2EIKE 1G3NB 4HLLA 4DX1A 2F37A 3SBSA 2XPYA 1TNYA 3CK8A 4DX7D 3I4GA 3SGHA 3CGHA 3HYMB 3ML8A 1UN9A 4U07A 3ZYMA 3UT4A 3ASNE 3Q5MA 4EHMA 3Q7AA 5JJ7A 5EYLA 2GW1A 3TXMA 4MBGA 3AG4E 2EIJE 1TNBA 3UINC 5C2YA 4TUMA 1EPUA 3PZ4A 1DC2A 4BESA 2A5EA 5AENA 3FTXA 2WXRA 2IO3C 5BXUA 3KS2A 3NBNB 4V3IA 5LP0A 4ABNA 3TL5A 1N52A 3IHVA 2XRZA 3I3NA 5CBNA 2DWZA 3TWUA 3S7FA 2DBAA 2JLBA 4GTTA 4DX2A 3PZ1A 2LSVA 3MEKA 2L0IA 3PZDA 4XI0A 2KC7A 4GPKA 3TJPA 3HHMA 4CT4A 1KPSB 1OCZE 5HI7A 1BD8A 4QQIA 4FHKA 2V4LA 3K9IA 5ENOD 3VTYA 3Q75A 4JHRA 4KMOA 5C1DA 3J5PA 2LXLA 4GA1A 4K5CA 1NFIE 2L0TB 3HXCA 2IY0C 4BERA 4K0RA 4I9EA 3D9OA 2WXQA 5H7PA 3SNXA 1UJKA 3Q78A 3DRAA 5G05J 3LY9A 5BT1A 3PREA 4GTVA 2ETBA 2Y1LE 4JD2G 2XENA 1Z5SC 3CVQA 4B93B 5AQ7A 1MX2A 1BI8B 1TJCA 2BKGA 4I1OB 4HRMB 5B1AE 2J08A 5CBOA 3UMVA 3B13A 3JUIA 3L08A 3FU5A 3UT7A 3EDTB 4KZ0A 1TNZA 3P2BA 3OXFA 2VQ2A 3ASGA 4IN3B 3ZXSA 4U04A 3TWXA 1IYGA 3FU6A 2H6HA 4G24A 4JHJA 1K1AA 4JVSA 1JCSA 3RJVA 2LAIA 3SQVA 4KVMA 2FO7A 1KZPA 1AWCB 5BNWA 3RK6A 5BV1A 4K5BA 5G05C 3KEAA 2L6JA 2JEKA 5T3RA 3QK0A 5FQ7A 1ELRA 3PVLA 4JEHA 1L5JA 2X6IA 3ISMC 4M7CA 4YVQC 4CT0A 4N5CA 1MHQA 3C3OA 1UN8A 4F1PA 3UIOC 3E34A 4GA0A 3TGOA 1HG5A 4NIKA 3TWQA 3LXUX 3ZGQA 4NRHB 4YVOA 3UI2A 3BUAA 3VTXA 1X5BA 1X81A 3APDA 5T4YA 3FUFA 1JUQA 2BTDA 5CCMA 3JUEA 3SY2A 4L2LA 5EDSA 5ITZF 1MZCA 1B89A 2KCKA 4GTSA 3V79K 2J09A 3DSTA 5FQ4A 4PUCA 3RRMB 2LUHA 3CQGB 5BXOA 5A6CA 2VGXB 2XCCA 4BWRA 3ZN3A 2JABA 4PS8A 2OV8A 4HI8A 3D9PA 2OOEA 5LCWJ 2LNIA 1OWMA 4KVOA 2XS8A 3LS8A 2P9PG 5E75A 3LEWA 4GZDA 3U3WA 4GB9A 3QAQA 3CSFA 4N2QA 5EYPF 4AJWA 3QWWA 2CG3A 2IJGX 4U7EB 1N0RA 4CGVA 4GYWA 3FUIA 2P9UG 4RG6A 3Q7FA 1HO8A 5JHBA 2GRMA 3LY7A 1WY6A 2E0IA 4UWFA 3ZYLA 3PNTB 2AVPA 4GZ6A 1OXJA 3LJ3A 3GW4A 4BTBA 3U9WA 5KNGA 3JXJA 4TXRA 2VSOE 4Z68A 1BLXB 3L9TA 4F7AA 3QNKA 2V5QC 4HB5A 3R9MA 4XX5A 3MKQB 4UI9J 4GTRA 1Q2ZA 3AG1E 3EHNA 3ESKA 5LCWC 4U8YD 1QYMA 3IHYA 3R7RA 1LD8A 2VGEA 1HX8A 2WXJA 3HIZA 1TEZA 2F0YA 3T8KA 2MOWA 1D8EA 2CG2A 5ENRD 3T9KA 5J08A 4C0MA 3MV2B 1O1SA 5AAOA 3V2XA 2DCPA 1SW6A 4CYMD 5CRVA 3V2OA 2P58C 2QY7A 1N4QA 5JJ6A 1NZNA 2WXGA 1QBQA 2CHXA 5FJYA 3CHSA 1TJFA 3ASHA 1SZAA 3AS8A 3NB2A 2LSUA 2EIME 1YCSB 3RAUA 4HQDA 3CHMA 2AXZA 4AEZC 1OCOE 1YA0A 2QZAA 2IO2C 2V4HC 4A1GA 1U3CA 2Y0BG 1TN7A 2IU1A 4HXIA 4CDRA 4QFVA 2CHZA 4UI9C 5AQ9A 4DUIA 4JPSA 4UWHA 2DVWA 1N95A 4UQXA 4HOQA 4GMRA 4NURA 4ANWA 1NA0A 1QQEA 5FZQA 2ZGGA 3E32A 4FHJA 2P2CP 3JCKC 2PZIA 3FFLA 4FJZA 4U96D 3TG5A 2X6HA 1HH8A 4HLEA 5JMND 1RZ4A 1Z6TA 2L9BA 2YINA 5J90A 2CFUA 4HOTA 1H2VC 4ME2A 4ZFHA 4KZCA 2J9QA 5D66A 4N3BA 1K1BA 4EZJA 3R7QA 3G2UA 3OAWA 3O4ZA 3QB2A 3CK9A 3AG2E 4X8QA 4DX5D 3NQPA 2J07A 1BI7B 5ENNA 4MS6A 1AP7A 4O6FA 4HVBA 1TYQG 3FY4A 2XPIA 2Q7FA 3Q9UC 3CR3A 4UWLA 4ANXA 2NYJA 3CSTA 3FTWA 4O1OA 3MJWA 1K3ZD 4AOFA 2NXPA 4DI3A 2BF0X 4XE0A 4IRUA 5D2MC 3BEEA 4CRWA 3HXFA 2UY1A 3W9FA 1U2VG 1JCQA 5FT9A 3NF1A 3LPZA 3ZEFA 2VSNA 4K5AB 3JQ1A 4RLYA 2L6BA 1OT8A 3PS6A 1LF8A 3RRNB 2WMOA 2KCLA 2J8SD 1P5QA 4U0ZA 2HYZA 4LNUD 4OAVB 2Y3AA 2IOSA 3MCXA 2OEVA 2XEVA 4I43A 1H0AA 3PUKA 5JJTA 5G2NA 1V54E 2LAHA 4BT8A 3X2QE 3E4BA 4LNGA 3CKCA 3T5VA 3UX4A 3RO3A 2H6FA 4LNBA 1DCQA 1IXVA 2Y4UA 5E76A 2IOLA 5EIBE 2C0MA 4LERA 4FULA 4GCNA 2VYIA 1KT0A 4JXTA 4FADA 4XZ4A 3ZW3A 4A3TA 3D9IA 2QC9A 4LG6A 2CHWA 4O60A 2X6JA 3CEQA 5CHEE 3C3RA 4WNEA 2AWIA 1FCHA 2KM4A 3FTYA 4C48B 1Z3YA 1PY1A 3LDZA 3ABKE 4AY5A 4EZLA 1SQMA 2KATA 5AQBA 1LTXA 3PE4A 2F8XK 4JB8P 1MJ0A 2FULA 1N11A 1YYHA 3AU4A 4PDXA 3Q73A 3MX3A 4H7XA 2P9LG 4NACA 3TXNA 3VLDA 3U64A 4G26A 1TR4A 5CMYA 3EIQC 4L2YA 3LJNA 4UI9K 4FA6A 1OCCE 3ABLE 4CGWA 3L17A 1N94A 4YDWA 4O1PA 4G11A 1SA4A 3QDNA 3Q79A 2PM7A 2VGYA 2OCCE 1OWNA 2C2LA 2C0LA 4Y6WA 2V0PA 2R03A 3CKBA 2GROB 3HXDA 3URZA 2KZTA 5ENPD 4GTPA 2DZNA 3NZSA 3GZSA 1UG3A 5HQ8A 3FDHA 4I2ZA 3TWRA 2R59A 3FP3A 4U63A 3TWTA 2AXVA 3PRZA 5KBAA 1ZB1A 3ML9A 4UQYA 4GCOA 4N2SA 4N5QA 1EYHA 2WXIA 2HO1A 3NAWA 5JHAA 1GW6A 3FTZA 1D8DA 4TV3A 5FQ8A 4BTAA 3JYSA 4F3VA 1UW4B 5CMWA 1OWLA 4U0SA 3S2AA 3FUHA 3S7DA 3ULEG 4KT6B 4N39A 4OYSA 3HDXA 2WQ6A 1ZU2A 3NOGD 5JA4D 3QC1A 3SFZA 2XCBA 1UOHA 2RFMA 2QFCA 2P9IG 2X38A 4APFA 2WPVA 3ZXPA 1NA3A 1DVPA 3IV0A 4DK5A 4HBDA 5EN5D 3CLJA 3OXLA 4A1SA 1E8ZA 4ATGA 3SD5A 4ANVA 3D9JA 2KCVA 5KWDA 2FEZA 1H2UA 2XQ0A 2EILE 4E85A 5FTPA 4ILGA 3PDNA 3TWSA 5AN8A 3TWWA 3PZ2A 3AS5A 3EUVA 3B7SA 5FINA 4P29A 5ENTD 2OVFA 4KYOB 2I2OA 5CRUA 4I9CA 4XEIG 1IHGA 1ELWA 3L22A 2XZTG 3CK7A 3NOCD 2EQXA 4I6GA 4J7WA 4I2WA 5HRYA 1EDUA 4AXHA 3PE3A 2BEDA 3MYVA 4B89A 3DSUA 1JWGA 3AG3E 2FF4A 4UUCA 5BW8C 3ZYQA 4ILIA 2WXKA 4XI9A 2GRLA 4L23A 4M3OA 2YHEA 4U8VD 5KJNA 1IQRA 5KCMA 3BQOA 2PNNA 5FZSA 3OTNA 2VGXA 4D10C 5CEAA 1MYOA 3RO2A 2J4DA 4I1AA 1WAO1 3U66A 3EJNA 4W9RA 4BX8A 4LSZE 3RKVA 1INZA 3Q9NC 3NZUA 1FT1A 5FWQA 1WG0A 5DBKA 3U4TA 3ABME 3JQ0A 3HVEA 3FEYA 1U3DA 1NP7A 5EKQD 5G04C 4PS7A 2XEEA 5A23A 5KNHD 5ANLA 3WG7E 3B7RL 2MHKA 5EX0A 2WXFA 1MQSA 4BFRA 4EZKA 3ONLA 2XHEA 4E6HA 2GRQB 4B0ZA 1HF8A 3UPVA 3G2TA 3WXXA 1FPPA 3RU0A 3FH5A 1E8WA 1H2TC 2XEHA 4C0EA 2WB2A 4EBAG 2XRYA 5HKPA 1Z3XA 1QNFA 5CERB 1IKND 3B7UX 2KBXA 1PC2A 4L7TA 2YHCA 2UWJG 3EHQA 3UUXA 4GZ5A 3C5RA 2Y69E 2XGOA 4YDYA 3LYAA 3HRAA 4ANUA 1PAQA 5BUZA 3UKRG 3MA5A 1HXIA 3TAXA 1KT1A 1E7UA 4RSYA 2WXOA 5AJLA 1O1RA 2HE0A 2VSYA 4J6IA 2XPZA 5A7DB 2GRNB 3AS4A 3QJZA 1FT2A 2VTBA 3VLEA 4JL0A 1N4SA 2VSXE 4DLOA 3IKOB 3Q4AB 1TNUA 3SBTB 5ANRA 5ARFA 3FU0A 2IEJA 3SO8A 1A5EA 3ZRHA 2OEWA 2PQNA 1VDYA 4MRUA 4JHKA 4WNGA 4J8YA 3PNLB 3QOUA 3V31A 2OVBA 4PS3A 5DIZA 4B94A 3ASDA 1DNPA 3ZVVA 1ZBPA 2IQCA 3D9KA 3AU5A 1EF1C 3PH0C 4J0UA 2FBNA 2UY1B 3FH7A 2ETAA 4F53A 3FUEA 4RVBA 4OVUA 1IQUA 3FUDA 3C98A 3PEVB 1HU3A 1K8KG 3ZHEA 2B6CA 4C9BB 4GA2A 2QYUA 3W9GA 3DSWA 1MX4A 2ZXWE 4XKCA 3KD7A 3DSXA 4ATZD 1JWFA 3PZ3A 2GRRB 4F1SA 5LFAA 4B8AA 4GMJA 4FP7A 2GRPB 1SZ9A 4G2VA 3SZ7A 3R9AB 3UM2A 3S7BA 2PL2A 4MLPA 2P9SG 2WM9A 4DI4A 4GTOA 2ETCA 3DBSA 3CVNA 3OXGA 2B0OE 3FH8A 3BG1B 3L6AA 4HI9A 4HFGA 3LVQE 1A17A 1FVHA 3UIPC 2H6IA 5KJKA 1SA5A 3O48A 5G55A 1KLXA 4H7YA 4HRLA 4HS2A 3KAEA 2P9NG 3QWVA 4WWPA 2YNQA 2X6KA 3CVXA 4XIFA 3FTVA 3V30A 3CIAA 3B7TA 1JCRA 2WXNA 3ULQA 4CZ2D 3HG0D 3SHFA 1H6OA 3DEOA 3UQ3A 5FZRA 1OWPA 3CVWA 1HZ4A 3FUKA
chains in the Genus database with same CATH topology
1UJJA 1E8ZA 4ATGA 3QKYA 3SD5A 3FUJA 4ANVA 2XGMA 4UI9J 3D9JA 1E96B 4LRZA 4WNFA 1E90A 3EHNA 3ESKA 5LCWC 2KCVA 2WQ7A 1E8XA 2AXUA 3S7JA 3IHYA 3GYZA 3L54A 2FEZA 1H2UA 2XQ0A 3CHRA 1HFAA 1H19A 3T5XA 3FUMA 3R7RA 2KZTB 4E85A 1HX8A 2WXJA 5FTPA 2WVIA 3I4RB 3HIZA 4BT9A 1TEZA 4URKA 4APOA 4ILGA 2MOWA 2CG2A 5J08A 3PDNA 4LCTA 3VLFA 1XGWA 4C0MA 3MV2B 4N3AA 2BUGA 2DCPA 3AS5A 4WAFA 2E2EA 4I6EA 3B7SA 3ZYKA 3PUJA 2P58C 2QY7A 3TG4A 4P29A 5T8IA 4R7LA 5JJ6A 4DPRA 1NZNA 4XKBA 2IFUA 2OVFA 3D3MA 3ASFA 3RRUA 2YQ8A 4I6JA 4ILHB 4GMLA 2WXGA 4KYOB 2I2OA 4JW1A 2ZU6B 4G23A 3D9MA 4I9CA 1IHGA 1ELWA 2RG8A 2CHXA 3Q49B 3L22A 5FJYA 3CK7A 3CHSA 1TJFA 4J8DA 2HR2A 3ASHA 3IEGA 2EQXA 4I6GA 1SZAA 3AS8A 4K03A 2XGSA 3I5PA 4I2WA 2LSUA 3QWPA 3CVLA 2I1KA 4EPZA 1EDUA 3CHPA 4AXHA 4JEUA 3CHMA 3PE3A 4NQ0A 2AXZA 3IBEA 4EBAA 4AEZC 1YA0A 4AP2A 4N3CA 4A55A 3MYVA 4B89A 2I1JA 3FULA 5AJDA 4A1GA 1U3CA 1JWGA 5D0QD 4WUYA 2IU1A 4HXIA 4CDRA 4QFVA 3ENEA 2CHZA 4UI9C 2R17C 4J8EA 2FF4A 3CQCB 5BW8C 4JPSA 4UWHA 3SBSA 2XPYA 3CK8A 3ZYQA 4BY6A 4ILIA 4A1SA 2WXKA 3I4GA 4GZCA 4UQXA 4XI9A 5BV0A 4HOQA 3LVRE 5KJLA 2GRLA 4JA9A 3CGHA 3HYMB 3ML8A 4L23A 3SGHA 1UN9A 4M3OA 2YHEA 4NURA 4ANWA 1NA0A 4U07A 4HORA 5KJNA 1IQRA 3ZYMA 4L1BA 1QQEA 2WXHA 3Q47B 5FZQA 4WNDA 5KCMA 3PEUB 2ONDA 3UT4A 2M63A 4J8SA 1OUVA 2HM8A 5FZSA 3OTNA 4BX9A 2VGXA 3Q5MA 4D10C 4FHJA 4YNDA 2CFZA 5JJ7A 4UWGA 3RO2A 2GW1A 2J4DA 3TXMA 4I1AA 3JCKC 1WAO1 2PZIA 3Q15A 4PH4B 2FI7A 3FFLA 3U66A 4FJZA 2NSZA 3EJNA 4W9RA 5C2YA 1EPUA 3TG5A 4BX8A 2X6HA 3RKVA 1HH8A 3FHEA 4HLEA 1INZA 3NZUA 2R5SA 5FWQA 5DBKA 5AENA 3MKQB 4ACKA 1Z6TA 3FTXA 2WXRA 3U4TA 1HG2A 3JQ0A 3HVEA 2L9BA 2YINA 3FEYA 5J90A 4HOUA 3KS2A 2CFUA 4GYYA 4V3IA 4HOTA 1H2VC 1U3DA 4CDNA 5LP0A 4ME2A 4ABNA 1NP7A 3TL5A 1N52A 4JZYA 3IHVA 5EKQD 4KZCA 2XRZA 5G04C 2J9QA 4PS7A 2VJ8A 4KBQA 4N3BA 3I3NA 5A23A 4EZJA 3R7QA 3CVYA 5ANLA 3B7RL 2MHKA 5EX0A 3G2UA 3OAWA 3G2VA 4FU3A 3O4ZA 3QB2A 3S7FA 2DBAA 3CK9A 2JLBA 2WXFA 3EHMA 1MQSA 4BFRA 4EZKA 5AIJA 2J4BA 1OWOA 2LSVA 2V5FA 4GYOA 3MEKA 2L0IA 3PZDA 3ONLA 4XI0A 2KC7A 2XHEA 2X6FA 3NQPA 4GPKA 3TJPA 4E6HA 4B0ZA 2J07A 1HF8A 2IF4A 3HHMA 3UPVA 3G2TA 4CT4A 5ENNA 4GAAA 3WXXA 4MS6A 5HI7A 3RU0A 4FHKA 2V4LA 2MRIA 3FH5A 4GU5A 4O6FA 4HVBA 1E8WA 3K9IA 3FY4A 1H2TC 3QARA 3VTYA 2XPIA 2Q7FA 4JHRA 4KMOA 4C0EA 5C1DA 2WB2A 4LEUA 3CR3A 4EBAG 2XRYA 1Z3XA 4UWLA 4ANXA 1QNFA 3G2SA 4GA1A 2PQRA 4FLHA 3CSTA 2L0TB 3FTWA 3B7UX 3MJWA 4WWNA 5EX3A 4AOFA 1PC2A 2NXPA 4L7TA 4DI3A 2YHCA 2BF0X 2UWJG 1QZ2A 4XE0A 5AYWD 4IRUA 4CRWA 3BEEA 3UUXA 4K0RA 4I9EA 3D9OA 1N54A 3FTSA 1HE8A 2UY1A 2DIWA 2WXQA 4GZ5A 3SNXA 4Q69A 2LO6A 2WXLA 2XGOA 1UJKA 5G04J 5FT9A 3NF1A 3CVUA 3LCAA 2WMNA 3LPZA 5G05J 3ZEFA 3LYAA 2VSNA 4ANUA 3JQ1A 3LY9A 5BT1A 3PS6A 3N71A 1LF8A 3PREA 4CEMA 4AIFA 4J8FA 3RRNB 1PAQA 2WMOA 1FVFA 2KCLA 3CVQA 1P5QA 4U0ZA 2HYZA 4ACLA 5BUZA 4EQFA 2AW6A 2Y3AA 1HXIA 3MA5A 4KXKB 3TAXA 2IOSA 1TJCA 1KT1A 1E7UA 3MCXA 4RSYA 2XEVA 2WXOA 4G25A 4I1OB 4I43A 1H0AA 3PUKA 5JJTA 2A4ZA 5AJLA 2J08A 5G2NA 3CVVA 3SF4A 1WM5A 3UMVA 2VSYA 3B13A 4CCAA 4J6IA 1JPLA 2LAHA 3JUIA 4BT8A 2XPZA 3HVEB 5A7DB 3ZFWA 3E4BA 3L08A 4B8CB 3CKCA 4IULA 3UX4A 5KJMA 3RO3A 3T5VA 3FU5A 2Y4UA 3MZLB 5E76A 2IOLA 3EDTB 3L16A 3UT7A 4BSXA 3FTUA 4KZ0A 3AS4A 2C0MA 3P2BA 4UWKA 4LERA 3QJZA 4FULA 4GCNA 5LX8A 2VTBA 3D9LA 3OXFA 2VQ2A 3ASGA 3VLEA 2VYIA 1KT0A 4IN3B 4JXTA 3ZXSA 4FADA 4JL0A 4XZ4A 4U04A 5ARGA 3ZW3A 4FJYA 2VSXE 4DLOA 3IKOB 4A3TA 3FU6A 1IYGA 3D9IA 3ESLA 4G24A 4DJAA 3Q4AB 4AV7A 3SBTB 2ILRA 5ANRA 3D9NA 3EIJA 4JHJA 5ARFA 2CHWA 3CV0A 5CCLA 3FU0A 2Y4TA 4JVSA 4U0UA 3ZRHA 4FLBA 4WWOA 3MV3B 2LAIA 2RD0A 2PQNA 1VDYA 4JC8A 4JHKA 4MRUA 2X6JA 4WNGA 3RJVA 3PNLB 3QOUA 4KVMA 3MGBA 3CEQA 2OVBA 5CHEE 4WNEA 2AWIA 2FO7A 4PS3A 5DIZA 1FCHA 4B94A 3ASDA 5BNWA 1DNPA 3RK6A 3ZVVA 2J49A 2KM4A 1ZBPA 3FTYA 4HOSA 5BV1A 1Z3YA 2IQCA 5G05C 1PY1A 3D9KA 3LDZA 5M72A 2L6JA 2JEKA 3AU5A 1EF1C 5T3RA 3PH0C 4AY5A 4J0UA 4EZLA 3QK0A 1SQMA 2FBNA 2I6HA 1W3BA 5FQ7A 2UY1B 2KATA 2IONA 4G1TA 3FH7A 1ELRA 3APCA 3PVLA 3T8MA 4JEHA 1L5JA 4F53A 2V8SE 3FUEA 3PE4A 2X6IA 4MKTA 4RVBA 2WXMA 4OVUA 4YVQC 2FULA 4CT0A 1IQUA 3ONKA 3CVPA 1MHQA 2WQHA 1UN8A 4GZ3A 4N5CA 3FUDA 3AU4A 4PDXA 3C98A 3PEVB 3MX3A 4H7XA 1HU3A 3ZHEA 4NACA 3TXNA 4IYPA 3VLDA 4GA0A 3TGOA 3U64A 1HG5A 4G26A 3LXUX 3ZGQA 5CMYA 3EIQC 4L2YA 4C9BB 4NRHB 4YVOA 4UI9K 4GA2A 3VTXA 4TUUA 1X5BA 4FA6A 5LOZA 3APDA 5T4YA 3FUFA 1JUQA 2BTDA 4CGWA 5CCMA 3FEXA 3L17A 4XKCA 3BG0B 4OVVA 3KD7A 3MKQA 4G11A 1JWFA 5BPPA 4L2LA 5EDSA 1B89A 2KCKA 4F1SA 3QDNA 5LFAA 1ELKA 2J09A 4B8AA 2PM7A 4A3VA 3GZ1A 2VGYA 4GMJA 4AY6A 4UQZA 1OWNA 2C2LA 4FP7A 2C0LA 4TRQA 5FQ4A 4PUCA 2GGFA 3RRMB 3FUNA 4Y6WA 2V0PA 1SZ9A 3APFA 3CQGB 5D0OD 2PM6A 2VGXB 4G2VA 4CDMA 2XCCA 5A6CA 2VTBB 3CKBA 3SZ7A 4BWRA 4I17A 3R9AB 3ZN3A 3URZA 2KZTA 3S7BA 2PL2A 3MKRA 3NZSA 4PS8A 2OV8A 4LUNU 3CHQA 4MLPA 3GZSA 1UG3A 4Q96A 3D9PA 2OOEA 5HQ8A 3FDHA 5LCWJ 5FQ6A 4I2ZA 2LNIA 1OWMA 2WM9A 2R59A 3FP3A 4KVOA 3UT8A 4Y6CA 4DI4A 3RIBA 4U63A 3LS8A 1E7VA 5E75A 4FC8A 3LEWA 3FWVA 3DBSA 3LY8A 2AXVA 3CVNA 3OXGA 4GZDA 2I9CA 3PRZA 3FH8A 3SI5A 3ZPJA 3GZ2A 3DPDA 3BG1B 3U3WA 3ML9A 4U8HA 4GB9A 4UQYA 3QAQA 3L6AA 4HFGA 3CSFA 3LVQE 4N2QA 4GCOA 4N2SA 1H6KA 1A17A 1FVHA 3L13A 1EYHA 5KJKA 3LKUA 3QWWA 4AJWA 2WXIA 4DLQA 2HO1A 2A5UA 2CG3A 3O48A 5G55A 2IJGX 1GW6A 1KLXA 5JHAA 2X3MA 3FTZA 4TV3A 4H7YA 3FU3A 5FQ8A 4AVXA 1Y6IA 4BTAA 4CGVA 3JYSA 4GYWA 3ZIMA 3FUIA 4HS2A 4F3VA 4I1MA 2NC9A 1UW4B 4RG6A 3KAEA 5CMWA 3QWVA 1HO8A 4WWPA 5JHBA 1OWLA 2GRMA 2YNQA 1WY6A 3LY7A 2X6KA 4RG9A 2E0IA 3KEZA 4U0SA 4XIFA 3CVXA 4Q94A 4UWFA 3FUHA 2WXPA 3S7DA 4JA7A 3S2AA 1HS6A 4KT6B 4N39A 3PNTB 3HDXA 4OYSA 3ZYLA 3FTVA 2WQ6A 1ZU2A 3CIAA 3QC1A 2AVPA 4GZ6A 3ZHEB 4EECA 3SFZA 1XNFA 3B7TA 2XCBA 2WXNA 3LJ3A 3GW4A 2QFCA 4BTBA 3U9WA 1Y8MA 2X38A 3ULQA 3P1UA 4APFA 1S0PA 1E8YA 2WPVA 3CHOA 4AM9A 1NA3A 1DVPA 2VSOE 3SHFA 3IV0A 4DK5A 1BPOA 4F7AA 3G2WA 3QNKA 3UQ3A 5FZRA 1OWPA 3CVWA 4XX5A 3CLJA 3OXLA 1HZ4A 3FUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QKY A;  2XGM A;  4UI9 J;  1E96 B;  4WNF A;  3ESK A;  5LCW C;  2KCV A;  3S7J A;  3GYZ A;  2FEZ A;  5FTP A;  4BT9 A;  4APO A;  3PDN A;  3MV2 B;  4N3A A;  2BUG A;  3AS5 A;  2E2E A;  2P58 C;  3TG4 A;  5JJ6 A;  1NZN A;  2IFU A;  3ASF A;  2YQ8 A;  4KYO B;  4G23 A;  4I9C A;  1IHG A;  1ELW A;  3Q49 B;  5FJY A;  3CK7 A;  4J8D A;  2HR2 A;  3ASH A;  3IEG A;  3AS8 A;  4I2W A;  2XGS A;  2LSU A;  3QWP A;  3CVL A;  3PE3 A;  4NQ0 A;  1YA0 A;  4N3C A;  5D0Q D;  4WUY A;  4CDR A;  4UI9 C;  4J8E A;  2FF4 A;  5BW8 C;  3CK8 A;  4XI9 A;  4UQX A;  4HOQ A;  5KJL A;  4JA9 A;  3HYM B;  1NA0 A;  4U07 A;  4HOR A;  5KJN A;  1QQE A;  3Q47 B;  5FZQ A;  1HZ4 A;  4WND A;  2OND A;  1OUV A;  5FZS A;  2VGX A;  3Q5M A;  4YND A;  5JJ7 A;  3RO2 A;  2GW1 A;  4I1A A;  1WAO 1;  2PZI A;  3Q15 A;  2FI7 A;  3FFL A;  4W9R A;  3TG5 A;  3RKV A;  1HH8 A;  2R5S A;  5DBK A;  3U4T A;  4HOU A;  3KS2 A;  4GYY A;  4HOT A;  4ME2 A;  4ABN A;  5EKQ D;  5G04 C;  2J9Q A;  4KBQ A;  4N3B A;  2MHK A;  5EX0 A;  3S7F A;  2DBA A;  3CK9 A;  2JLB A;  2V5F A;  2LSV A;  4GYO A;  3MEK A;  4XI0 A;  2KC7 A;  4GPK A;  2IF4 A;  3UPV A;  3WXX A;  5HI7 A;  3RU0 A;  4O6F A;  3K9I A;  3VTY A;  2XPI A;  2Q7F A;  4JHR A;  5C1D A;  4LEU A;  4GA1 A;  2PQR A;  5EX3 A;  1PC2 A;  2YHC A;  2UWJ G;  1QZ2 A;  5AYW D;  3BEE A;  3UUX A;  4I9E A;  4GZ5 A;  2UY1 A;  2XGO A;  5G04 J;  5FT9 A;  3NF1 A;  3LCA A;  5G05 J;  3LPZ A;  3LYA A;  2VSN A;  3LY9 A;  5BT1 A;  3N71 A;  4AIF A;  4J8F A;  2KCL A;  3CVQ A;  1P5Q A;  4U0Z A;  2HYZ A;  4EQF A;  3MA5 A;  1HXI A;  3TAX A;  4KXK B;  1TJC A;  1KT1 A;  2XEV A;  4G25 A;  5JJT A;  3SF4 A;  1WM5 A;  2VSY A;  4BT8 A;  5A7D B;  3ZFW A;  3E4B A;  3CKC A;  5KJM A;  3RO3 A;  2Y4U A;  3EDT B;  3AS4 A;  2C0M A;  4GCN A;  3OXF A;  2VQ2 A;  3ASG A;  2VYI A;  1KT0 A;  4IN3 B;  4JL0 A;  4U04 A;  5ARG A;  1IYG A;  4G24 A;  3Q4A B;  5ARF A;  3CV0 A;  5CCL A;  2Y4T A;  4U0U A;  3MV3 B;  3RJV A;  2PQN A;  4WNG A;  3QOU A;  3CEQ A;  5CHE E;  4WNE A;  2FO7 A;  5DIZ A;  1FCH A;  4B94 A;  3ASD A;  5BNW A;  1ZBP A;  4HOS A;  5G05 C;  5M72 A;  2L6J A;  4AY5 A;  4J0U A;  2FBN A;  2I6H A;  1W3B A;  2UY1 B;  2KAT A;  4G1T A;  1ELR A;  3PE4 A;  4YVQ C;  4GZ3 A;  3CVP A;  2WQH A;  4N5C A;  4H7X A;  3ZHE A;  4GA0 A;  3TGO A;  4G26 A;  3ZGQ A;  4NRH B;  4YVO A;  4UI9 K;  4GA2 A;  3VTX A;  4CGW A;  5CCM A;  3KD7 A;  1B89 A;  2KCK A;  3QDN A;  3GZ1 A;  2VGY A;  4AY6 A;  4UQZ A;  2C2L A;  2C0L A;  4Y6W A;  5D0O D;  5A6C A;  4G2V A;  2VGX B;  2XCC A;  3CKB A;  3SZ7 A;  4BWR A;  4I17 A;  3R9A B;  3ZN3 A;  3URZ A;  3S7B A;  2PL2 A;  3MKR A;  2OOE A;  5HQ8 A;  5LCW J;  4I2Z A;  2LNI A;  3FP3 A;  4Y6C A;  3RIB A;  3FWV A;  3LY8 A;  3CVN A;  3OXG A;  3ZPJ A;  3GZ2 A;  3U3W A;  4UQY A;  4N2Q A;  4GCO A;  4N2S A;  1A17 A;  5KJK A;  3LKU A;  3QWW A;  2HO1 A;  3O48 A;  1KLX A;  4H7Y A;  4BTA A;  4CGV A;  3JYS A;  4GYW A;  4F3V A;  2NC9 A;  4RG6 A;  3KAE A;  3QWV A;  3LY7 A;  4RG9 A;  4U0S A;  4XIF A;  3S7D A;  4JA7 A;  4N39 A;  1ZU2 A;  2AVP A;  4GZ6 A;  3ZHE B;  1XNF A;  2XCB A;  3GW4 A;  4BTB A;  2QFC A;  1Y8M A;  3ULQ A;  2WPV A;  4AM9 A;  1NA3 A;  3UQ3 A;  5FZR A;  3OXL A;  4A1S A; 
#chains in the Genus database with same CATH topology
 1UJJ A;  2ZIS A;  3QKY A;  3UM1 A;  1S64 A;  2XGM A;  2LXM A;  2AJA A;  2WQ7 A;  3F6Q A;  4BSZ B;  1E8X A;  3S7J A;  3L54 A;  3CHR A;  1HFA A;  3B95 A;  2KZT B;  2WVI A;  3I4R B;  4BT9 A;  4URK A;  2EIN E;  4LCT A;  3VLF A;  5IY5 E;  1RW2 A;  1KZO A;  4WAF A;  2E2E A;  5T8I A;  3UM0 A;  1O1T A;  2IFU A;  3ASF A;  3RRU A;  4ILH B;  4JW1 A;  4G23 A;  5CED B;  3Q49 B;  3HXE A;  4HNA D;  4GTQ A;  2HR2 A;  1TNO A;  1WDY A;  4K03 A;  2XGS A;  3I5P A;  3QWP A;  3CVL A;  2DYR E;  2I1K A;  3DPY A;  3J5Q B;  3DSV A;  2KXP C;  4JEU A;  4NQ0 A;  4AP2 A;  1OY3 D;  5AAR A;  4A55 A;  2I1J A;  3FUL A;  5D0Q D;  4WUY A;  4F6R D;  3ENE A;  2R17 C;  4J8E A;  3CQC B;  4BY6 A;  5EIL A;  4GZC A;  5BV0 A;  3LVR E;  5KJL A;  1H6P A;  4JA9 A;  2QYJ A;  4HOR A;  2RKK A;  4L1B A;  2MYO A;  2WXH A;  3Q47 B;  4WND A;  3PEU B;  2OND A;  2M63 A;  4J8S A;  1OUV A;  2HM8 A;  4U95 D;  4BX9 A;  4YND A;  2CFZ A;  4UWG A;  3Q15 A;  4PH4 B;  2FI7 A;  3D9H A;  2NSZ A;  3FHE A;  2R5S A;  2DYS E;  4ACK A;  1HG2 A;  2P9K G;  4HOU A;  3EU9 A;  4GYY A;  4CDN A;  3DWL G;  4JZY A;  3ZUV B;  2VJ8 A;  4KBQ A;  3CVY A;  1NL4 A;  3G2V A;  4FU3 A;  4BEP A;  3EHM A;  3UXG A;  5AIJ A;  2J4B A;  1OWO A;  2V5F A;  4GYO A;  2X6F A;  3ZNG A;  2IF4 A;  4GAA A;  2MRI A;  4G8L A;  4GU5 A;  1N0Q A;  3QAR A;  5B1B E;  1TN6 A;  4LEU A;  3G2S A;  2PQR A;  4FLH A;  3ZU7 B;  4WWN A;  5EX3 A;  1QZ2 A;  5AYW D;  1N54 A;  3FTS A;  1HE8 A;  4Q69 A;  2DIW A;  2LO6 A;  2WXL A;  5G04 J;  3CVU A;  3LCA A;  2WMN A;  3TWV A;  3B7B A;  3N71 A;  4CEM A;  4AIF A;  4J8F A;  1FVF A;  4ACL A;  4EQF A;  2AW6 A;  4KXK B;  3UKU G;  4G25 A;  3SFY A;  2A4Z A;  3RSE G;  3CVV A;  3SF4 A;  1WM5 A;  1IHB A;  4CCA A;  3C3Q A;  1JPL A;  3ULY A;  3HVE B;  3ZFW A;  4B8C B;  4IUL A;  5KJM A;  3MZL B;  3L16 A;  4BSX A;  3FTU A;  4GPM A;  3DEP A;  4UWK A;  3SFX A;  5LX8 A;  3D9L A;  3JXI A;  3AAA C;  3DSS A;  3EHR A;  5ARG A;  4FJY A;  3EU5 A;  1TN8 A;  3BU8 A;  5FIO A;  3ESL A;  4DJA A;  4AV7 A;  2ILR A;  4HRN A;  3D9N A;  3EIJ A;  4G8K A;  2DZO A;  3CV0 A;  5CCL A;  2Y4T A;  4U0U A;  4FLB A;  4WWO A;  3MV3 B;  4JC8 A;  2RD0 A;  3MGB A;  3HXB A;  3KSL A;  2J49 A;  4DRX E;  4HOS A;  1N9A A;  5M72 A;  2I6H A;  1W3B A;  2ZIR A;  2ION A;  4G1T A;  3APC A;  4A63 B;  3T8M A;  2V8S E;  4OAU C;  1V55 E;  4MKT A;  4DX6 D;  2WXM A;  3ONK A;  4GZ3 A;  3CVP A;  2WQH A;  1SVX A;  2R02 A;  3E37 A;  4IYP A;  1MX6 A;  2R2L A;  1BU9 A;  4TUU A;  5LOZ A;  3FEX A;  3DXM G;  3E30 A;  3BG0 B;  4OVV A;  1DCE A;  3MKQ A;  5BPP A;  2ZGD A;  1ELK A;  3L82 A;  4A3V A;  3GZ1 A;  4AY6 A;  4UQZ A;  4TRQ A;  5EID A;  2GGF A;  3FUN A;  1OCR E;  3APF A;  5D0O D;  4CDM A;  2PM6 A;  2VTB B;  4I17 A;  3MKR A;  4LUN U;  3CHQ A;  4Q96 A;  3UTM A;  5AQA A;  5FQ6 A;  3UT8 A;  1NI1 A;  4Y6C A;  3RIB A;  1YMP A;  1E7V A;  4FC8 A;  3FWV A;  3LY8 A;  1N4P A;  2I9C A;  3SI5 A;  3ZPJ A;  3GZ2 A;  3C72 A;  3DPD A;  4ZHB A;  4U8H A;  1H6K A;  3L13 A;  3LKU A;  3E33 A;  4DLQ A;  2A5U A;  5B3S E;  1N4R A;  2X3M A;  2XS1 A;  4AVX A;  3FU3 A;  2FO1 E;  1Y6I A;  5ENQ D;  3ZIM A;  4I1M A;  2NC9 A;  4RG9 A;  3KEZ A;  4Q94 A;  2WXP A;  3KSQ A;  4JA7 A;  1HS6 A;  3ZKJ A;  3ZHE B;  4EEC A;  1XNF A;  4TXQ A;  1Y8M A;  1S63 A;  4YDE A;  3P1U A;  1S0P A;  1E8Y A;  3CHO A;  4AM9 A;  5CEC B;  4BET A;  1BPO A;  3G2W A;  3ASO E;  2BKK B;  1LD7 A;  3FUJ A;  2RFA A;  1E96 B;  4LRZ A;  4RQI A;  4WNF A;  1E90 A;  4L9P A;  1D9S A;  2R05 A;  2AXU A;  3GYZ A;  3UM3 A;  3T5X A;  1H19 A;  3FUM A;  3IXE A;  2XZD G;  4APO A;  1XGW A;  4N3A A;  3DXK G;  2BUG A;  4I6E A;  3ZYK A;  3PUJ A;  3TG4 A;  4R7L A;  4DPR A;  4XKB A;  4GTM A;  3D3M A;  3AJI A;  2YQ8 A;  4I6J A;  4GML A;  2ZU6 B;  3D9M A;  2F8Y A;  5HS0 A;  2RG8 A;  4J8D A;  3IEG A;  1O5M A;  1S70 B;  3CHP A;  4EPZ A;  3IBE A;  4YDO A;  4EBA A;  2H6G A;  4TXP A;  4N3C A;  5ENS D;  5AJD A;  2EIK E;  1G3N B;  4HLL A;  4DX1 A;  2F37 A;  3SBS A;  2XPY A;  1TNY A;  3CK8 A;  4DX7 D;  3I4G A;  3SGH A;  3CGH A;  3HYM B;  3ML8 A;  1UN9 A;  4U07 A;  3ZYM A;  3UT4 A;  3ASN E;  3Q5M A;  4EHM A;  3Q7A A;  5JJ7 A;  5EYL A;  2GW1 A;  3TXM A;  4MBG A;  3AG4 E;  2EIJ E;  1TNB A;  3UIN C;  5C2Y A;  4TUM A;  1EPU A;  3PZ4 A;  1DC2 A;  4BES A;  2A5E A;  5AEN A;  3FTX A;  2WXR A;  2IO3 C;  5BXU A;  3KS2 A;  3NBN B;  4V3I A;  5LP0 A;  4ABN A;  3TL5 A;  1N52 A;  3IHV A;  2XRZ A;  3I3N A;  5CBN A;  2DWZ A;  3TWU A;  3S7F A;  2DBA A;  2JLB A;  4GTT A;  4DX2 A;  3PZ1 A;  2LSV A;  3MEK A;  2L0I A;  3PZD A;  4XI0 A;  2KC7 A;  4GPK A;  3TJP A;  3HHM A;  4CT4 A;  1KPS B;  1OCZ E;  5HI7 A;  1BD8 A;  4QQI A;  4FHK A;  2V4L A;  3K9I A;  5ENO D;  3VTY A;  3Q75 A;  4JHR A;  4KMO A;  5C1D A;  3J5P A;  2LXL A;  4GA1 A;  4K5C A;  1NFI E;  2L0T B;  3HXC A;  2IY0 C;  4BER A;  4K0R A;  4I9E A;  3D9O A;  2WXQ A;  5H7P A;  3SNX A;  1UJK A;  3Q78 A;  3DRA A;  5G05 J;  3LY9 A;  5BT1 A;  3PRE A;  4GTV A;  2ETB A;  2Y1L E;  4JD2 G;  2XEN A;  1Z5S C;  3CVQ A;  4B93 B;  5AQ7 A;  1MX2 A;  1BI8 B;  1TJC A;  2BKG A;  4I1O B;  4HRM B;  5B1A E;  2J08 A;  5CBO A;  3UMV A;  3B13 A;  3JUI A;  3L08 A;  3FU5 A;  3UT7 A;  3EDT B;  4KZ0 A;  1TNZ A;  3P2B A;  3OXF A;  2VQ2 A;  3ASG A;  4IN3 B;  3ZXS A;  4U04 A;  3TWX A;  1IYG A;  3FU6 A;  2H6H A;  4G24 A;  4JHJ A;  1K1A A;  4JVS A;  1JCS A;  3RJV A;  2LAI A;  3SQV A;  4KVM A;  2FO7 A;  1KZP A;  1AWC B;  5BNW A;  3RK6 A;  5BV1 A;  4K5B A;  5G05 C;  3KEA A;  2L6J A;  2JEK A;  5T3R A;  3QK0 A;  5FQ7 A;  1ELR A;  3PVL A;  4JEH A;  1L5J A;  2X6I A;  3ISM C;  4M7C A;  4YVQ C;  4CT0 A;  4N5C A;  1MHQ A;  3C3O A;  1UN8 A;  4F1P A;  3UIO C;  3E34 A;  4GA0 A;  3TGO A;  1HG5 A;  4NIK A;  3TWQ A;  3LXU X;  3ZGQ A;  4NRH B;  4YVO A;  3UI2 A;  3BUA A;  3VTX A;  1X5B A;  1X81 A;  3APD A;  5T4Y A;  3FUF A;  1JUQ A;  2BTD A;  5CCM A;  3JUE A;  3SY2 A;  4L2L A;  5EDS A;  5ITZ F;  1MZC A;  1B89 A;  2KCK A;  4GTS A;  3V79 K;  2J09 A;  3DST A;  5FQ4 A;  4PUC A;  3RRM B;  2LUH A;  3CQG B;  5BXO A;  5A6C A;  2VGX B;  2XCC A;  4BWR A;  3ZN3 A;  2JAB A;  4PS8 A;  2OV8 A;  4HI8 A;  3D9P A;  2OOE A;  5LCW J;  2LNI A;  1OWM A;  4KVO A;  2XS8 A;  3LS8 A;  2P9P G;  5E75 A;  3LEW A;  4GZD A;  3U3W A;  4GB9 A;  3QAQ A;  3CSF A;  4N2Q A;  5EYP F;  4AJW A;  3QWW A;  2CG3 A;  2IJG X;  4U7E B;  1N0R A;  4CGV A;  4GYW A;  3FUI A;  2P9U G;  4RG6 A;  3Q7F A;  1HO8 A;  5JHB A;  2GRM A;  3LY7 A;  1WY6 A;  2E0I A;  4UWF A;  3ZYL A;  3PNT B;  2AVP A;  4GZ6 A;  1OXJ A;  3LJ3 A;  3GW4 A;  4BTB A;  3U9W A;  5KNG A;  3JXJ A;  4TXR A;  2VSO E;  4Z68 A;  1BLX B;  3L9T A;  4F7A A;  3QNK A;  2V5Q C;  4HB5 A;  3R9M A;  4XX5 A;  3MKQ B;  4UI9 J;  4GTR A;  1Q2Z A;  3AG1 E;  3EHN A;  3ESK A;  5LCW C;  4U8Y D;  1QYM A;  3IHY A;  3R7R A;  1LD8 A;  2VGE A;  1HX8 A;  2WXJ A;  3HIZ A;  1TEZ A;  2F0Y A;  3T8K A;  2MOW A;  1D8E A;  2CG2 A;  5ENR D;  3T9K A;  5J08 A;  4C0M A;  3MV2 B;  1O1S A;  5AAO A;  3V2X A;  2DCP A;  1SW6 A;  4CYM D;  5CRV A;  3V2O A;  2P58 C;  2QY7 A;  1N4Q A;  5JJ6 A;  1NZN A;  2WXG A;  1QBQ A;  2CHX A;  5FJY A;  3CHS A;  1TJF A;  3ASH A;  1SZA A;  3AS8 A;  3NB2 A;  2LSU A;  2EIM E;  1YCS B;  3RAU A;  4HQD A;  3CHM A;  2AXZ A;  4AEZ C;  1OCO E;  1YA0 A;  2QZA A;  2IO2 C;  2V4H C;  4A1G A;  1U3C A;  2Y0B G;  1TN7 A;  2IU1 A;  4HXI A;  4CDR A;  4QFV A;  2CHZ A;  4UI9 C;  5AQ9 A;  4DUI A;  4JPS A;  4UWH A;  2DVW A;  1N95 A;  4UQX A;  4HOQ A;  4GMR A;  4NUR A;  4ANW A;  1NA0 A;  1QQE A;  5FZQ A;  2ZGG A;  3E32 A;  4FHJ A;  2P2C P;  3JCK C;  2PZI A;  3FFL A;  4FJZ A;  4U96 D;  3TG5 A;  2X6H A;  1HH8 A;  4HLE A;  5JMN D;  1RZ4 A;  1Z6T A;  2L9B A;  2YIN A;  5J90 A;  2CFU A;  4HOT A;  1H2V C;  4ME2 A;  4ZFH A;  4KZC A;  2J9Q A;  5D66 A;  4N3B A;  1K1B A;  4EZJ A;  3R7Q A;  3G2U A;  3OAW A;  3O4Z A;  3QB2 A;  3CK9 A;  3AG2 E;  4X8Q A;  4DX5 D;  3NQP A;  2J07 A;  1BI7 B;  5ENN A;  4MS6 A;  1AP7 A;  4O6F A;  4HVB A;  1TYQ G;  3FY4 A;  2XPI A;  2Q7F A;  3Q9U C;  3CR3 A;  4UWL A;  4ANX A;  2NYJ A;  3CST A;  3FTW A;  4O1O A;  3MJW A;  1K3Z D;  4AOF A;  2NXP A;  4DI3 A;  2BF0 X;  4XE0 A;  4IRU A;  5D2M C;  3BEE A;  4CRW A;  3HXF A;  2UY1 A;  3W9F A;  1U2V G;  1JCQ A;  5FT9 A;  3NF1 A;  3LPZ A;  3ZEF A;  2VSN A;  4K5A B;  3JQ1 A;  4RLY A;  2L6B A;  1OT8 A;  3PS6 A;  1LF8 A;  3RRN B;  2WMO A;  2KCL A;  2J8S D;  1P5Q A;  4U0Z A;  2HYZ A;  4LNU D;  4OAV B;  2Y3A A;  2IOS A;  3MCX A;  2OEV A;  2XEV A;  4I43 A;  1H0A A;  3PUK A;  5JJT A;  5G2N A;  1V54 E;  2LAH A;  4BT8 A;  3X2Q E;  3E4B A;  4LNG A;  3CKC A;  3T5V A;  3UX4 A;  3RO3 A;  2H6F A;  4LNB A;  1DCQ A;  1IXV A;  2Y4U A;  5E76 A;  2IOL A;  5EIB E;  2C0M A;  4LER A;  4FUL A;  4GCN A;  2VYI A;  1KT0 A;  4JXT A;  4FAD A;  4XZ4 A;  3ZW3 A;  4A3T A;  3D9I A;  2QC9 A;  4LG6 A;  2CHW A;  4O60 A;  2X6J A;  3CEQ A;  5CHE E;  3C3R A;  4WNE A;  2AWI A;  1FCH A;  2KM4 A;  3FTY A;  4C48 B;  1Z3Y A;  1PY1 A;  3LDZ A;  3ABK E;  4AY5 A;  4EZL A;  1SQM A;  2KAT A;  5AQB A;  1LTX A;  3PE4 A;  2F8X K;  4JB8 P;  1MJ0 A;  2FUL A;  1N11 A;  1YYH A;  3AU4 A;  4PDX A;  3Q73 A;  3MX3 A;  4H7X A;  2P9L G;  4NAC A;  3TXN A;  3VLD A;  3U64 A;  4G26 A;  1TR4 A;  5CMY A;  3EIQ C;  4L2Y A;  3LJN A;  4UI9 K;  4FA6 A;  1OCC E;  3ABL E;  4CGW A;  3L17 A;  1N94 A;  4YDW A;  4O1P A;  4G11 A;  1SA4 A;  3QDN A;  3Q79 A;  2PM7 A;  2VGY A;  2OCC E;  1OWN A;  2C2L A;  2C0L A;  4Y6W A;  2V0P A;  2R03 A;  3CKB A;  2GRO B;  3HXD A;  3URZ A;  2KZT A;  5ENP D;  4GTP A;  2DZN A;  3NZS A;  3GZS A;  1UG3 A;  5HQ8 A;  3FDH A;  4I2Z A;  3TWR A;  2R59 A;  3FP3 A;  4U63 A;  3TWT A;  2AXV A;  3PRZ A;  5KBA A;  1ZB1 A;  3ML9 A;  4UQY A;  4GCO A;  4N2S A;  4N5Q A;  1EYH A;  2WXI A;  2HO1 A;  3NAW A;  5JHA A;  1GW6 A;  3FTZ A;  1D8D A;  4TV3 A;  5FQ8 A;  4BTA A;  3JYS A;  4F3V A;  1UW4 B;  5CMW A;  1OWL A;  4U0S A;  3S2A A;  3FUH A;  3S7D A;  3ULE G;  4KT6 B;  4N39 A;  4OYS A;  3HDX A;  2WQ6 A;  1ZU2 A;  3NOG D;  5JA4 D;  3QC1 A;  3SFZ A;  2XCB A;  1UOH A;  2RFM A;  2QFC A;  2P9I G;  2X38 A;  4APF A;  2WPV A;  3ZXP A;  1NA3 A;  1DVP A;  3IV0 A;  4DK5 A;  4HBD A;  5EN5 D;  3CLJ A;  3OXL A;  4A1S A;  1E8Z A;  4ATG A;  3SD5 A;  4ANV A;  3D9J A;  2KCV A;  5KWD A;  2FEZ A;  1H2U A;  2XQ0 A;  2EIL E;  4E85 A;  5FTP A;  4ILG A;  3PDN A;  3TWS A;  5AN8 A;  3TWW A;  3PZ2 A;  3AS5 A;  3EUV A;  3B7S A;  5FIN A;  4P29 A;  5ENT D;  2OVF A;  4KYO B;  2I2O A;  5CRU A;  4I9C A;  4XEI G;  1IHG A;  1ELW A;  3L22 A;  2XZT G;  3CK7 A;  3NOC D;  2EQX A;  4I6G A;  4J7W A;  4I2W A;  5HRY A;  1EDU A;  4AXH A;  3PE3 A;  2BED A;  3MYV A;  4B89 A;  3DSU A;  1JWG A;  3AG3 E;  2FF4 A;  4UUC A;  5BW8 C;  3ZYQ A;  4ILI A;  2WXK A;  4XI9 A;  2GRL A;  4L23 A;  4M3O A;  2YHE A;  4U8V D;  5KJN A;  1IQR A;  5KCM A;  3BQO A;  2PNN A;  5FZS A;  3OTN A;  2VGX A;  4D10 C;  5CEA A;  1MYO A;  3RO2 A;  2J4D A;  4I1A A;  1WAO 1;  3U66 A;  3EJN A;  4W9R A;  4BX8 A;  4LSZ E;  3RKV A;  1INZ A;  3Q9N C;  3NZU A;  1FT1 A;  5FWQ A;  1WG0 A;  5DBK A;  3U4T A;  3ABM E;  3JQ0 A;  3HVE A;  3FEY A;  1U3D A;  1NP7 A;  5EKQ D;  5G04 C;  4PS7 A;  2XEE A;  5A23 A;  5KNH D;  5ANL A;  3WG7 E;  3B7R L;  2MHK A;  5EX0 A;  2WXF A;  1MQS A;  4BFR A;  4EZK A;  3ONL A;  2XHE A;  4E6H A;  2GRQ B;  4B0Z A;  1HF8 A;  3UPV A;  3G2T A;  3WXX A;  1FPP A;  3RU0 A;  3FH5 A;  1E8W A;  1H2T C;  2XEH A;  4C0E A;  2WB2 A;  4EBA G;  2XRY A;  5HKP A;  1Z3X A;  1QNF A;  5CER B;  1IKN D;  3B7U X;  2KBX A;  1PC2 A;  4L7T A;  2YHC A;  2UWJ G;  3EHQ A;  3UUX A;  4GZ5 A;  3C5R A;  2Y69 E;  2XGO A;  4YDY A;  3LYA A;  3HRA A;  4ANU A;  1PAQ A;  5BUZ A;  3UKR G;  3MA5 A;  1HXI A;  3TAX A;  1KT1 A;  1E7U A;  4RSY A;  2WXO A;  5AJL A;  1O1R A;  2HE0 A;  2VSY A;  4J6I A;  2XPZ A;  5A7D B;  2GRN B;  3AS4 A;  3QJZ A;  1FT2 A;  2VTB A;  3VLE A;  4JL0 A;  1N4S A;  2VSX E;  4DLO A;  3IKO B;  3Q4A B;  1TNU A;  3SBT B;  5ANR A;  5ARF A;  3FU0 A;  2IEJ A;  3SO8 A;  1A5E A;  3ZRH A;  2OEW A;  2PQN A;  1VDY A;  4MRU A;  4JHK A;  4WNG A;  4J8Y A;  3PNL B;  3QOU A;  3V31 A;  2OVB A;  4PS3 A;  5DIZ A;  4B94 A;  3ASD A;  1DNP A;  3ZVV A;  1ZBP A;  2IQC A;  3D9K A;  3AU5 A;  1EF1 C;  3PH0 C;  4J0U A;  2FBN A;  2UY1 B;  3FH7 A;  2ETA A;  4F53 A;  3FUE A;  4RVB A;  4OVU A;  1IQU A;  3FUD A;  3C98 A;  3PEV B;  1HU3 A;  1K8K G;  3ZHE A;  2B6C A;  4C9B B;  4GA2 A;  2QYU A;  3W9G A;  3DSW A;  1MX4 A;  2ZXW E;  4XKC A;  3KD7 A;  3DSX A;  4ATZ D;  1JWF A;  3PZ3 A;  2GRR B;  4F1S A;  5LFA A;  4B8A A;  4GMJ A;  4FP7 A;  2GRP B;  1SZ9 A;  4G2V A;  3SZ7 A;  3R9A B;  3UM2 A;  3S7B A;  2PL2 A;  4MLP A;  2P9S G;  2WM9 A;  4DI4 A;  4GTO A;  2ETC A;  3DBS A;  3CVN A;  3OXG A;  2B0O E;  3FH8 A;  3BG1 B;  3L6A A;  4HI9 A;  4HFG A;  3LVQ E;  1A17 A;  1FVH A;  3UIP C;  2H6I A;  5KJK A;  1SA5 A;  3O48 A;  5G55 A;  1KLX A;  4H7Y A;  4HRL A;  4HS2 A;  3KAE A;  2P9N G;  3QWV A;  4WWP A;  2YNQ A;  2X6K A;  3CVX A;  4XIF A;  3FTV A;  3V30 A;  3CIA A;  3B7T A;  1JCR A;  2WXN A;  3ULQ A;  4CZ2 D;  3HG0 D;  3SHF A;  1H6O A;  3DEO A;  3UQ3 A;  5FZR A;  1OWP A;  3CVW A;  1HZ4 A;  3FUK A; 
#chains in the Genus database with same CATH homology
 1UJJ A;  1E8Z A;  4ATG A;  3QKY A;  3SD5 A;  3FUJ A;  4ANV A;  2XGM A;  4UI9 J;  3D9J A;  1E96 B;  4LRZ A;  4WNF A;  1E90 A;  3EHN A;  3ESK A;  5LCW C;  2KCV A;  2WQ7 A;  1E8X A;  2AXU A;  3S7J A;  3IHY A;  3GYZ A;  3L54 A;  2FEZ A;  1H2U A;  2XQ0 A;  3CHR A;  1HFA A;  1H19 A;  3T5X A;  3FUM A;  3R7R A;  2KZT B;  4E85 A;  1HX8 A;  2WXJ A;  5FTP A;  2WVI A;  3I4R B;  3HIZ A;  4BT9 A;  1TEZ A;  4URK A;  4APO A;  4ILG A;  2MOW A;  2CG2 A;  5J08 A;  3PDN A;  4LCT A;  3VLF A;  1XGW A;  4C0M A;  3MV2 B;  4N3A A;  2BUG A;  2DCP A;  3AS5 A;  4WAF A;  2E2E A;  4I6E A;  3B7S A;  3ZYK A;  3PUJ A;  2P58 C;  2QY7 A;  3TG4 A;  4P29 A;  5T8I A;  4R7L A;  5JJ6 A;  4DPR A;  1NZN A;  4XKB A;  2IFU A;  2OVF A;  3D3M A;  3ASF A;  3RRU A;  2YQ8 A;  4I6J A;  4ILH B;  4GML A;  2WXG A;  4KYO B;  2I2O A;  4JW1 A;  2ZU6 B;  4G23 A;  3D9M A;  4I9C A;  1IHG A;  1ELW A;  2RG8 A;  2CHX A;  3Q49 B;  3L22 A;  5FJY A;  3CK7 A;  3CHS A;  1TJF A;  4J8D A;  2HR2 A;  3ASH A;  3IEG A;  2EQX A;  4I6G A;  1SZA A;  3AS8 A;  4K03 A;  2XGS A;  3I5P A;  4I2W A;  2LSU A;  3QWP A;  3CVL A;  2I1K A;  4EPZ A;  1EDU A;  3CHP A;  4AXH A;  4JEU A;  3CHM A;  3PE3 A;  4NQ0 A;  2AXZ A;  3IBE A;  4EBA A;  4AEZ C;  1YA0 A;  4AP2 A;  4N3C A;  4A55 A;  3MYV A;  4B89 A;  2I1J A;  3FUL A;  5AJD A;  4A1G A;  1U3C A;  1JWG A;  5D0Q D;  4WUY A;  2IU1 A;  4HXI A;  4CDR A;  4QFV A;  3ENE A;  2CHZ A;  4UI9 C;  2R17 C;  4J8E A;  2FF4 A;  3CQC B;  5BW8 C;  4JPS A;  4UWH A;  3SBS A;  2XPY A;  3CK8 A;  3ZYQ A;  4BY6 A;  4ILI A;  4A1S A;  2WXK A;  3I4G A;  4GZC A;  4UQX A;  4XI9 A;  5BV0 A;  4HOQ A;  3LVR E;  5KJL A;  2GRL A;  4JA9 A;  3CGH A;  3HYM B;  3ML8 A;  4L23 A;  3SGH A;  1UN9 A;  4M3O A;  2YHE A;  4NUR A;  4ANW A;  1NA0 A;  4U07 A;  4HOR A;  5KJN A;  1IQR A;  3ZYM A;  4L1B A;  1QQE A;  2WXH A;  3Q47 B;  5FZQ A;  4WND A;  5KCM A;  3PEU B;  2OND A;  3UT4 A;  2M63 A;  4J8S A;  1OUV A;  2HM8 A;  5FZS A;  3OTN A;  4BX9 A;  2VGX A;  3Q5M A;  4D10 C;  4FHJ A;  4YND A;  2CFZ A;  5JJ7 A;  4UWG A;  3RO2 A;  2GW1 A;  2J4D A;  3TXM A;  4I1A A;  3JCK C;  1WAO 1;  2PZI A;  3Q15 A;  4PH4 B;  2FI7 A;  3FFL A;  3U66 A;  4FJZ A;  2NSZ A;  3EJN A;  4W9R A;  5C2Y A;  1EPU A;  3TG5 A;  4BX8 A;  2X6H A;  3RKV A;  1HH8 A;  3FHE A;  4HLE A;  1INZ A;  3NZU A;  2R5S A;  5FWQ A;  5DBK A;  5AEN A;  3MKQ B;  4ACK A;  1Z6T A;  3FTX A;  2WXR A;  3U4T A;  1HG2 A;  3JQ0 A;  3HVE A;  2L9B A;  2YIN A;  3FEY A;  5J90 A;  4HOU A;  3KS2 A;  2CFU A;  4GYY A;  4V3I A;  4HOT A;  1H2V C;  1U3D A;  4CDN A;  5LP0 A;  4ME2 A;  4ABN A;  1NP7 A;  3TL5 A;  1N52 A;  4JZY A;  3IHV A;  5EKQ D;  4KZC A;  2XRZ A;  5G04 C;  2J9Q A;  4PS7 A;  2VJ8 A;  4KBQ A;  4N3B A;  3I3N A;  5A23 A;  4EZJ A;  3R7Q A;  3CVY A;  5ANL A;  3B7R L;  2MHK A;  5EX0 A;  3G2U A;  3OAW A;  3G2V A;  4FU3 A;  3O4Z A;  3QB2 A;  3S7F A;  2DBA A;  3CK9 A;  2JLB A;  2WXF A;  3EHM A;  1MQS A;  4BFR A;  4EZK A;  5AIJ A;  2J4B A;  1OWO A;  2LSV A;  2V5F A;  4GYO A;  3MEK A;  2L0I A;  3PZD A;  3ONL A;  4XI0 A;  2KC7 A;  2XHE A;  2X6F A;  3NQP A;  4GPK A;  3TJP A;  4E6H A;  4B0Z A;  2J07 A;  1HF8 A;  2IF4 A;  3HHM A;  3UPV A;  3G2T A;  4CT4 A;  5ENN A;  4GAA A;  3WXX A;  4MS6 A;  5HI7 A;  3RU0 A;  4FHK A;  2V4L A;  2MRI A;  3FH5 A;  4GU5 A;  4O6F A;  4HVB A;  1E8W A;  3K9I A;  3FY4 A;  1H2T C;  3QAR A;  3VTY A;  2XPI A;  2Q7F A;  4JHR A;  4KMO A;  4C0E A;  5C1D A;  2WB2 A;  4LEU A;  3CR3 A;  4EBA G;  2XRY A;  1Z3X A;  4UWL A;  4ANX A;  1QNF A;  3G2S A;  4GA1 A;  2PQR A;  4FLH A;  3CST A;  2L0T B;  3FTW A;  3B7U X;  3MJW A;  4WWN A;  5EX3 A;  4AOF A;  1PC2 A;  2NXP A;  4L7T A;  4DI3 A;  2YHC A;  2BF0 X;  2UWJ G;  1QZ2 A;  4XE0 A;  5AYW D;  4IRU A;  4CRW A;  3BEE A;  3UUX A;  4K0R A;  4I9E A;  3D9O A;  1N54 A;  3FTS A;  1HE8 A;  2UY1 A;  2DIW A;  2WXQ A;  4GZ5 A;  3SNX A;  4Q69 A;  2LO6 A;  2WXL A;  2XGO A;  1UJK A;  5G04 J;  5FT9 A;  3NF1 A;  3CVU A;  3LCA A;  2WMN A;  3LPZ A;  5G05 J;  3ZEF A;  3LYA A;  2VSN A;  4ANU A;  3JQ1 A;  3LY9 A;  5BT1 A;  3PS6 A;  3N71 A;  1LF8 A;  3PRE A;  4CEM A;  4AIF A;  4J8F A;  3RRN B;  1PAQ A;  2WMO A;  1FVF A;  2KCL A;  3CVQ A;  1P5Q A;  4U0Z A;  2HYZ A;  4ACL A;  5BUZ A;  4EQF A;  2AW6 A;  2Y3A A;  1HXI A;  3MA5 A;  4KXK B;  3TAX A;  2IOS A;  1TJC A;  1KT1 A;  1E7U A;  3MCX A;  4RSY A;  2XEV A;  2WXO A;  4G25 A;  4I1O B;  4I43 A;  1H0A A;  3PUK A;  5JJT A;  2A4Z A;  5AJL A;  2J08 A;  5G2N A;  3CVV A;  3SF4 A;  1WM5 A;  3UMV A;  2VSY A;  3B13 A;  4CCA A;  4J6I A;  1JPL A;  2LAH A;  3JUI A;  4BT8 A;  2XPZ A;  3HVE B;  5A7D B;  3ZFW A;  3E4B A;  3L08 A;  4B8C B;  3CKC A;  4IUL A;  3UX4 A;  5KJM A;  3RO3 A;  3T5V A;  3FU5 A;  2Y4U A;  3MZL B;  5E76 A;  2IOL A;  3EDT B;  3L16 A;  3UT7 A;  4BSX A;  3FTU A;  4KZ0 A;  3AS4 A;  2C0M A;  3P2B A;  4UWK A;  4LER A;  3QJZ A;  4FUL A;  4GCN A;  5LX8 A;  2VTB A;  3D9L A;  3OXF A;  2VQ2 A;  3ASG A;  3VLE A;  2VYI A;  1KT0 A;  4IN3 B;  4JXT A;  3ZXS A;  4FAD A;  4JL0 A;  4XZ4 A;  4U04 A;  5ARG A;  3ZW3 A;  4FJY A;  2VSX E;  4DLO A;  3IKO B;  4A3T A;  3FU6 A;  1IYG A;  3D9I A;  3ESL A;  4G24 A;  4DJA A;  3Q4A B;  4AV7 A;  3SBT B;  2ILR A;  5ANR A;  3D9N A;  3EIJ A;  4JHJ A;  5ARF A;  2CHW A;  3CV0 A;  5CCL A;  3FU0 A;  2Y4T A;  4JVS A;  4U0U A;  3ZRH A;  4FLB A;  4WWO A;  3MV3 B;  2LAI A;  2RD0 A;  2PQN A;  1VDY A;  4JC8 A;  4JHK A;  4MRU A;  2X6J A;  4WNG A;  3RJV A;  3PNL B;  3QOU A;  4KVM A;  3MGB A;  3CEQ A;  2OVB A;  5CHE E;  4WNE A;  2AWI A;  2FO7 A;  4PS3 A;  5DIZ A;  1FCH A;  4B94 A;  3ASD A;  5BNW A;  1DNP A;  3RK6 A;  3ZVV A;  2J49 A;  2KM4 A;  1ZBP A;  3FTY A;  4HOS A;  5BV1 A;  1Z3Y A;  2IQC A;  5G05 C;  1PY1 A;  3D9K A;  3LDZ A;  5M72 A;  2L6J A;  2JEK A;  3AU5 A;  1EF1 C;  5T3R A;  3PH0 C;  4AY5 A;  4J0U A;  4EZL A;  3QK0 A;  1SQM A;  2FBN A;  2I6H A;  1W3B A;  5FQ7 A;  2UY1 B;  2KAT A;  2ION A;  4G1T A;  3FH7 A;  1ELR A;  3APC A;  3PVL A;  3T8M A;  4JEH A;  1L5J A;  4F53 A;  2V8S E;  3FUE A;  3PE4 A;  2X6I A;  4MKT A;  4RVB A;  2WXM A;  4OVU A;  4YVQ C;  2FUL A;  4CT0 A;  1IQU A;  3ONK A;  3CVP A;  1MHQ A;  2WQH A;  1UN8 A;  4GZ3 A;  4N5C A;  3FUD A;  3AU4 A;  4PDX A;  3C98 A;  3PEV B;  3MX3 A;  4H7X A;  1HU3 A;  3ZHE A;  4NAC A;  3TXN A;  4IYP A;  3VLD A;  4GA0 A;  3TGO A;  3U64 A;  1HG5 A;  4G26 A;  3LXU X;  3ZGQ A;  5CMY A;  3EIQ C;  4L2Y A;  4C9B B;  4NRH B;  4YVO A;  4UI9 K;  4GA2 A;  3VTX A;  4TUU A;  1X5B A;  4FA6 A;  5LOZ A;  3APD A;  5T4Y A;  3FUF A;  1JUQ A;  2BTD A;  4CGW A;  5CCM A;  3FEX A;  3L17 A;  4XKC A;  3BG0 B;  4OVV A;  3KD7 A;  3MKQ A;  4G11 A;  1JWF A;  5BPP A;  4L2L A;  5EDS A;  1B89 A;  2KCK A;  4F1S A;  3QDN A;  5LFA A;  1ELK A;  2J09 A;  4B8A A;  2PM7 A;  4A3V A;  3GZ1 A;  2VGY A;  4GMJ A;  4AY6 A;  4UQZ A;  1OWN A;  2C2L A;  4FP7 A;  2C0L A;  4TRQ A;  5FQ4 A;  4PUC A;  2GGF A;  3RRM B;  3FUN A;  4Y6W A;  2V0P A;  1SZ9 A;  3APF A;  3CQG B;  5D0O D;  2PM6 A;  2VGX B;  4G2V A;  4CDM A;  2XCC A;  5A6C A;  2VTB B;  3CKB A;  3SZ7 A;  4BWR A;  4I17 A;  3R9A B;  3ZN3 A;  3URZ A;  2KZT A;  3S7B A;  2PL2 A;  3MKR A;  3NZS A;  4PS8 A;  2OV8 A;  4LUN U;  3CHQ A;  4MLP A;  3GZS A;  1UG3 A;  4Q96 A;  3D9P A;  2OOE A;  5HQ8 A;  3FDH A;  5LCW J;  5FQ6 A;  4I2Z A;  2LNI A;  1OWM A;  2WM9 A;  2R59 A;  3FP3 A;  4KVO A;  3UT8 A;  4Y6C A;  4DI4 A;  3RIB A;  4U63 A;  3LS8 A;  1E7V A;  5E75 A;  4FC8 A;  3LEW A;  3FWV A;  3DBS A;  3LY8 A;  2AXV A;  3CVN A;  3OXG A;  4GZD A;  2I9C A;  3PRZ A;  3FH8 A;  3SI5 A;  3ZPJ A;  3GZ2 A;  3DPD A;  3BG1 B;  3U3W A;  3ML9 A;  4U8H A;  4GB9 A;  4UQY A;  3QAQ A;  3L6A A;  4HFG A;  3CSF A;  3LVQ E;  4N2Q A;  4GCO A;  4N2S A;  1H6K A;  1A17 A;  1FVH A;  3L13 A;  1EYH A;  5KJK A;  3LKU A;  3QWW A;  4AJW A;  2WXI A;  4DLQ A;  2HO1 A;  2A5U A;  2CG3 A;  3O48 A;  5G55 A;  2IJG X;  1GW6 A;  1KLX A;  5JHA A;  2X3M A;  3FTZ A;  4TV3 A;  4H7Y A;  3FU3 A;  5FQ8 A;  4AVX A;  1Y6I A;  4BTA A;  4CGV A;  3JYS A;  4GYW A;  3ZIM A;  3FUI A;  4HS2 A;  4F3V A;  4I1M A;  2NC9 A;  1UW4 B;  4RG6 A;  3KAE A;  5CMW A;  3QWV A;  1HO8 A;  4WWP A;  5JHB A;  1OWL A;  2GRM A;  2YNQ A;  1WY6 A;  3LY7 A;  2X6K A;  4RG9 A;  2E0I A;  3KEZ A;  4U0S A;  4XIF A;  3CVX A;  4Q94 A;  4UWF A;  3FUH A;  2WXP A;  3S7D A;  4JA7 A;  3S2A A;  1HS6 A;  4KT6 B;  4N39 A;  3PNT B;  3HDX A;  4OYS A;  3ZYL A;  3FTV A;  2WQ6 A;  1ZU2 A;  3CIA A;  3QC1 A;  2AVP A;  4GZ6 A;  3ZHE B;  4EEC A;  3SFZ A;  1XNF A;  3B7T A;  2XCB A;  2WXN A;  3LJ3 A;  3GW4 A;  2QFC A;  4BTB A;  3U9W A;  1Y8M A;  2X38 A;  3ULQ A;  3P1U A;  4APF A;  1S0P A;  1E8Y A;  2WPV A;  3CHO A;  4AM9 A;  1NA3 A;  1DVP A;  2VSO E;  3SHF A;  3IV0 A;  4DK5 A;  1BPO A;  4F7A A;  3G2W A;  3QNK A;  3UQ3 A;  5FZR A;  1OWP A;  3CVW A;  4XX5 A;  3CLJ A;  3OXL A;  1HZ4 A;  3FUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...