3Q4AB

Crystal structure of the tpr domain of chip complexed with phosphorylated smad1 peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
132
structure length
132
Chain Sequence
b'SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STIP1 homology and U box-containing protein 1
publication title Molecular Mechanism of the Negative Regulation of Smad1/5 Protein by Carboxyl Terminus of Hsc70-interacting Protein (CHIP).
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/transcription
total genus 54
structure length 132
sequence length 132
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3q4aB00
2HR2A 2VGXA 4B94A 4WNGA 2UWJG 2XGSA 3LKUA 4J0UA 2HO1A 4F3VA 4N2SA 5A6CA 2UY1A 5DIZA 5JJ6A 4ME2A 3MV3B 4J8DA 2IFUA 1P5QA 4I9CA 2KATA 5DBKA 1PC2A 3ASFA 1NA3A 4BWRA 1YA0A 3CK8A 2PQNA 3RJVA 5FZRA 4XI9A 3KAEA 2VYIA 3K9IA 4GYYA 1QQEA 3OXFA 3RIBA 3SF4A 4UQZA 3CVPA 1KLXA 2BUGA 3CVLA 4JA9A 4G23A 3ULQA 2LSUA 4HORA 4G2VA 3KD7A 3NF1A 3RO2A 3ZHEB 4EQFA 3CEQA 3CKCA 5KJNA 1ZU2A 1ZBPA 4UI9C 2KCVA 1A17A 2LSVA 2J9QA 5LCWC 3AS4A 2P58C 4U04A 5G04J 3CVNA 2E2EA 2Y4UA 4BT9A 1ELRA 3LCAA 3TG5A 4Y6WA 5C1DA 3MKRA 3S7FA 4ABNA 4RG6A 3TGOA 4WNEA 5KJKA 4HOSA 4N3AA 1IYGA 3AS8A 4CDRA 5D0QD 3ASHA 3QWVA 4JHRA 2NC9A 4H7XA 4G25A 3Q49B 4W9RA 2XCBA 2C0LA 4KBQA 4GZ6A 3PDNA 2KC7A 2DBAA 1B89A 4YNDA 2GW1A 2VGXB 3S7DA 5FZSA 4LEUA 2VGYA 3JYSA 5FT9A 3CV0A 3FWVA 3LY9A 4XI0A 4HOUA 2YHCA 2JLBA 3ASGA 5EKQD 4J8FA 2ONDA 3Q4AB 4G24A 4AY5A 4Y6CA 4U0ZA 2V5FA 5KJMA 4KYOB 4O6FA 2XEVA 4WNDA 4UQYA 3VTYA 3EDTB 4GA0A 4HOTA 5M72A 2PL2A 2C0MA 4I2WA 3ASDA 2VSNA 5G04C 3CKBA 3PE3A 3GW4A 2FO7A 3VTXA 1Y8MA 3GZ2A 2WQHA 4CGVA 2OOEA 3QKYA 4BTAA 3TAXA 3PE4A 1E96B 5FJYA 2PQRA 3ZN3A 3AS5A 4G26A 4G1TA 4GZ5A 1NZNA 5G05J 3U3WA 3FFLA 3CK7A 2FEZA 2KCKA 3R9AB 4BTBA 5CCMA 3ZHEA 3U4TA 1ELWA 1IHGA 2XGOA 4JA7A 3OXGA 2FBNA 3S7BA 1KT0A 2WPVA 2R5SA 1KT1A 3BEEA 4U07A 3UUXA 4GCOA 3S7JA 4A1SA 3HYMB 3MV2B 5HQ8A 4I1AA 2C2LA 4N5CA 4WUYA 4YVQC 4APOA 4UI9K 3MA5A 2XGMA 1WM5A 4GCNA 5A7DB 5AYWD 4UI9J 4H7YA 3N71A 4U0SA 3LY7A 4J8EA 3TG4A 4KXKB 4YVOA 5EX3A 5BNWA 3WXXA 4GZ3A 4N3BA 2UY1B 5HI7A 3ZFWA 4BT8A 3RU0A 3E4BA 4AIFA 3RO3A 4NQ0A 1HXIA 3LPZA 2VSYA 3RKVA 3O48A 5G05C 4I2ZA 2AVPA 4N3CA 2IF4A 2Y4TA 3QOUA 2HYZA 2L6JA 1QZ2A 5ARGA 2PZIA 5BT1A 5CHEE 5JJ7A 4UQXA 3IEGA 4GA1A 4N2QA 3KS2A 5CCLA 3LYAA 1FCHA 4GYWA 3ZPJA 5D0OD 5ARFA 2FI7A 3FP3A 4I17A 3ZGQA 1OUVA 3Q47B 1NA0A 4N39A 5FTPA 4RG9A 3UPVA 3URZA 5JJTA 4GA2A 3CVQA 2YQ8A 1XNFA 5EX0A 4GYOA 2MHKA 2QFCA 3UQ3A 4CGWA 3GYZA 4U0UA 4XIFA 4AY6A 4I9EA 2Q7FA 5FZQA 4JL0A 5KJLA 3LY8A 3ESKA 4AM9A 5LCWJ 1WAO1 5BW8C 2VQ2A 1HZ4A 3QWWA 1HH8A 1W3BA 3Q15A 4WNFA 4NRHB 3CK9A 2I6HA 2KCLA 2FF4A 3QDNA 3OXLA 2XCCA 2XPIA 4GPKA 2LNIA 3QWPA 4HOQA 4IN3B 3GZ1A 3Q5MA 3MEKA 3SZ7A 1TJCA
chains in the Genus database with same CATH superfamily
4HXIA 3UT4A 2VJ8A 3DBSA 3FTUA 4FJYA 1BI8B 2ETAA 1AP7A 2BKKB 2BTDA 2OV8A 4ME2A 4I9CA 3QNKA 1KZPA 1MJ0A 2EIME 3RJVA 4K5CA 3IHYA 4GYYA 3RIBA 3EIJA 1OCOE 3T5VA 2IJGX 5ENOD 4JA9A 3L6AA 3ULQA 2MYOA 3TWTA 2GRNB 3ZXSA 2AWIA 2LSUA 2DIWA 4HORA 1JCSA 4LG6A 4HS2A 3RO2A 2P9SG 3UT7A 1ZU2A 5EN5D 1N0RA 2LSVA 1NI1A 4TUUA 3HXEA 3MKQA 5LCWC 2XEEA 3AS4A 2GRMA 3PZ4A 4BT9A 5BPPA 4Y6WA 2X6KA 4LCTA 4Q96A 4DI4A 3S7FA 4RG6A 3TGOA 1SA5A 2IY0C 1TEZA 2I1JA 3AS8A 1FVHA 4CDRA 3JQ0A 5BV0A 2OCCE 1DC2A 3PS6A 2RFAA 2BKGA 3ASHA 4R7LA 4V3IA 2F8XK 4G25A 4YDOA 3QAQA 2DCPA 2J4DA 4HLLA 3CHPA 4J6IA 4MLPA 3CHQA 3LJ3A 3CIAA 5D2MC 4FULA 5E75A 1O1TA 4GZ6A 3CQGB 3PDNA 2FULA 3AJIA 3D9LA 4YNDA 2GW1A 2V4HC 3S7DA 3HVEB 4GMJA 5FZSA 3SGHA 5FT9A 3CV0A 3DPDA 3APCA 3QC1A 3UMVA 2YHCA 3DSWA 4AXHA 5EKQD 2ONDA 3IBEA 2LO6A 3NZSA 4U0ZA 4GB9A 3SFXA 1QYMA 4D10C 2XEVA 3C5RA 4UQYA 2AXZA 2WVIA 4GA0A 3NAWA 2KBXA 1NL4A 1TYQG 3NQPA 1HO8A 3L9TA 3LVRE 3UX4A 4I2WA 3ASDA 3CKBA 4LSZE 2XQ0A 4CRWA 3UINC 3TWVA 3FH5A 3DSSA 4EZJA 4CGVA 4EZKA 3MZLB 5CRVA 3NB2A 5ANRA 3C72A 3CR3A 2IO2C 3EU5A 2X6IA 4X8QA 4GZ5A 1NZNA 4LNBA 5G05J 2DVWA 3UM1A 3AG4E 3CK7A 4JHKA 4WWOA 1RZ4A 5CCMA 4FA6A 2J49A 3APDA 4ANVA 2XGOA 3V31A 3D9IA 1KT0A 5G2NA 3MX3A 3UUXA 4WWNA 2JABA 1Z3YA 1Z3XA 4DX7D 2LUHA 2WXOA 4JHJA 2YHEA 4N5CA 3EU9A 4WUYA 4M3OA 3FU0A 1WM5A 4GCNA 3IV0A 4UI9J 3ZVVA 3N71A 3ESLA 4BSXA 5KCMA 2XENA 3FTXA 5ENQD 4C0EA 4YVOA 4C9BB 4GZ3A 5FQ8A 2J4BA 3DEPA 1UJJA 4NURA 5HI7A 3Q7AA 3OTNA 3PEUB 1WY6A 3RU0A 2Y69E 1KZOA 4CDNA 3IXEA 4U96D 5AENA 3V30A 2VSYA 3RKVA 1DCQA 3O48A 4CZ2D 5A23A 4C0MA 1AWCB 3G2TA 4I2ZA 4ANUA 1OWOA 3GZSA 1G3NB 4GTOA 3C3QA 1BI7B 4B0ZA 2Y4TA 4OVUA 1EF1C 2RG8A 4XEIG 4A1GA 3NZUA 3AAAC 2OVFA 4FADA 3DSXA 4KZCA 4RVBA 2CHWA 5AJLA 5CCLA 1IQRA 3EUVA 2VSOE 3OAWA 5ENTD 1MQSA 4BESA 4IULA 3CHMA 3P1UA 3Q78A 3KEZA 3HRAA 4K03A 2PM6A 5CBOA 3Q47B 2OVBA 3B95A 4G8KA 2RKKA 4HRLA 1XNFA 3ZU7B 3ONKA 5EX0A 5T4YA 2QFCA 3L08A 3UQ3A 4CGWA 3TWRA 3JUIA 3CHOA 2ZGGA 2WXRA 2QC9A 2Q7FA 4ANXA 5FZQA 3ZYLA 5KJLA 4EECA 3NBNB 1N4RA 4AM9A 3CVYA 1MX4A 5BW8C 3ZIMA 1HZ4A 3APFA 5T8IA 1E8XA 3CK9A 2KCLA 2ZGDA 4JVSA 3DRAA 4LNUD 2WQ6A 1OWPA 3SY2A 2QY7A 5AARA 1UOHA 4TXPA 4GMRA 4CYMD 4BY6A 3PRZA 3ZEFA 5CMWA 2VGXA 3BG0B 4WNGA 2XGSA 3LKUA 3Q9UC 2HO1A 5IY5E 4F3VA 1HU3A 1U2VG 5A6CA 3QK0A 4EBAA 1DVPA 3SFYA 1Y6IA 4BWRA 2HE0A 2WXNA 3CK8A 2PQNA 2JEKA 2DZNA 4KVOA 2VYIA 3E32A 4XX5A 3FUNA 2LXMA 2P2CP 3CVPA 1KLXA 1OY3D 5LX8A 5AIJA 1JPLA 1H6PA 4ZFHA 4TRQA 5EIBE 1TNBA 3ZHEB 3FUIA 4XKBA 3CEQA 2A5EA 3MJWA 1OWLA 3CKCA 4E85A 1TR4A 1UG3A 1IKND 4C48B 2J9QA 2ZXWE 3B7BA 4KVMA 5KBAA 4O1OA 4PS3A 1SZ9A 4U04A 5G04J 1GW6A 4FC8A 4HRNA 3FUJA 2MOWA 1E8YA 2WM9A 2WXJA 3MKRA 2PNNA 5D66A 3G2VA 4ABNA 4WNEA 3PZ3A 5KJKA 4PS7A 1ZB1A 4N3AA 1IYGA 1TN7A 3HDXA 3QWVA 4KMOA 4JHRA 4U7EB 2V5QC 1D9SA 3HXDA 1N54A 2OEVA 3ZYQA 3Q49B 3KSQA 2GROB 4W9RA 1MX6A 2XCBA 2IQCA 4L23A 2EIJE 4KBQA 1OCRE 1TNYA 3SBSA 4WAFA 3JYSA 5AQ7A 2Y3AA 2Y1LE 4XI0A 1PY1A 4UWGA 2AJAA 4A3VA 3FUMA 2JLBA 2IEJA 3ASGA 2IOLA 4MBGA 1SA4A 2V5FA 1HG5A 5KJMA 3QARA 3VTYA 2WXQA 3QJZA 4BFRA 3UM2A 4HOTA 1TNOA 3PREA 5M72A 2PL2A 3UIPC 3ZNGA 5CRUA 4CCAA 3EHMA 2FO7A 3TWSA 3GZ2A 4BEPA 2WQHA 3DSTA 4GTMA 2V0PA 4PDXA 1JCQA 2L9BA 3TAXA 3PE4A 3TWXA 3HIZA 2PQRA 3AS5A 4G8LA 3G2UA 2IU1A 2WXFA 3J5PA 2XPYA 2DYSE 3S2AA 3U3WA 1BU9A 2M63A 2GRLA 1HE8A 3ULYA 3ZHEA 2XRYA 2H6GA 2NYJA 5JHAA 1X5BA 3S7BA 1KPSB 1WDYA 1E7UA 2GRPB 1HX8A 3DEOA 4PH4B 2R2LA 4AP2A 2WQ7A 1U3CA 3CHRA 1K8KG 5HQ8A 1L5JA 2WMNA 4YVQC 3MA5A 3DXKG 3CVWA 4GAAA 3CSTA 3FTSA 4UWKA 2P9UG 4GTSA 2H6HA 1X81A 3T5XA 4J8EA 2CFUA 3FUEA 4GTPA 4KXKB 3UIOC 3MGBA 3G2SA 2P9NG 5BNWA 3WXXA 3HXCA 4N3BA 3IKOB 3TJPA 3B13A 3PNTB 2UY1B 2L6BA 3UM3A 3FEXA 3BQOA 3E34A 3Q79A 4NQ0A 4MRUA 3HXFA 3LPZA 4HB5A 4DX2A 3ZRHA 4AEZC 3FTYA 5G05C 3I4GA 4RSYA 5AQAA 3R7QA 1LD8A 3ZXPA 4F1SA 3E33A 4U63A 4L1BA 4OAVB 1O1RA 3KSLA 5JJ7A 3IEGA 4YDWA 1OT8A 4N2QA 4J8SA 5ENSD 3FULA 3TWQA 4B8CB 2IO3C 4GTVA 4URKA 1N9AA 5AQ9A 1MHQA 3CVXA 3FP3A 3ZGQA 3ZW3A 4NIKA 2VSXE 2H6IA 5EDSA 2R05A 4FHKA 4TV3A 4RG9A 1FT2A 5HKPA 4ZHBA 2YINA 3CQCB 2I2OA 3UXGA 2YNQA 1DCEA 2R02A 3JXIA 1N95A 2WXHA 2XZDG 4LERA 4AY6A 4JB8P 3UT8A 4P29A 3LY8A 2BF0X 2AXUA 4YDYA 3D9NA 4HQDA 3ESKA 3TWWA 3PUKA 2B6CA 5CERB 1HH8A 4WNFA 5CBNA 3ISMC 1N4SA 2FF4A 2X6FA 3KEAA 3HHMA 3IHVA 2XCCA 3DSUA 4GPKA 3QWPA 4AVXA 2LAIA 4IN3B 1OXJA 5BXUA 3BU8A 4CT0A 4ATGA 3MEKA 1TJCA 1K1AA 3ABME 2HR2A 3HVEA 3ABKE 4B94A 2UWJG 2F8YA 2RD0A 4N2SA 2V8SE 2CG2A 2XEHA 3W9GA 2UY1A 5JJ6A 4GPMA 3MV3B 4J8DA 2IFUA 1P5QA 4FJZA 5DBKA 3CSFA 4ILHB 1PC2A 3ASFA 1NA3A 4FLBA 1S64A 1HS6A 4XI9A 3O4ZA 2EQXA 3K9IA 1QQEA 3FTVA 3JUEA 4HI9A 3JXJA 3SF4A 3ONLA 3CVLA 3NOGD 4G2VA 4GTTA 3CHSA 1OCCE 3KD7A 3NF1A 3SFZA 1EDUA 4EQFA 2XZTG 5KJNA 2J07A 1UW4B 4I1OB 1ZBPA 2KCVA 1A17A 4JXTA 4HI8A 4RLYA 1YYHA 2P58C 4O1PA 3E30A 4K0RA 3R7RA 4QQIA 3UI2A 1VDYA 3CVNA 2E2EA 3ENEA 2Y4UA 3VLFA 1ELRA 3TG5A 4GTRA 1S63A 2WXKA 3FTWA 4JPSA 5C1DA 1UJKA 2R03A 1U3DA 4WWPA 3UM0A 4HNAD 2VTBB 5BUZA 4HOSA 2EIKE 3AG3E 5D0QD 4ILIA 1Z6TA 4H7XA 1E8WA 1H2UA 4FP7A 3L82A 2EILE 1IXVA 2HM8A 4I6JA 3FU5A 3FU3A 3PZ1A 2BEDA 1BLXB 4OVVA 3T8KA 5J08A 2WB2A 1B89A 2PM7A 3RRNB 4E6HA 5EYLA 3L16A 4LEUA 4JC8A 3LY9A 3I3NA 4EBAG 2CG3A 3BG1B 2B0OE 5FQ6A 4AY5A 3EIQC 4UUCA 4Y6CA 3UKRG 4OYSA 4F6RD 5ENNA 1HFAA 2KZTB 4JZYA 4WNDA 2L0IA 1INZA 5ITZF 4DJAA 3EDTB 4Z68A 2VSNA 4TXRA 5G04C 2F37A 1TNZA 3PE3A 1FPPA 1O1SA 4ACLA 3LDZA 1Y8MA 2P9LG 4B89A 4HLEA 3D9HA 1N4QA 2WXMA 1E96B 1TJFA 1N94A 2DZOA 3MKQB 4G1TA 5B3SE 1H0AA 1FVFA 4UWHA 1XGWA 1E7VA 4DPRA 4YDEA 2FEZA 1EYHA 3DWLG 3C3RA 4BTBA 3RAUA 1D8DA 1D8EA 1ELWA 3CGHA 3OXGA 3VLDA 2FBNA 3WG7E 1KT1A 3BEEA 4U07A 1JWGA 4A1SA 4DI3A 3MYVA 2H6FA 3ULEG 4I1MA 1H19A 3MV2B 4K5BA 3FUFA 2IONA 4I1AA 1LTXA 3L13A 4APOA 2XGMA 3C3OA 3ABLE 5BXOA 5H7PA 4MS6A 1K3ZD 3DPYA 4U0SA 3V79K 3EHRA 3LY7A 2A4ZA 3TG4A 4HRMB 3R9MA 4B93B 4I6EA 2ILRA 2J09A 3Q9NC 3RSEG 5T3RA 3ZFWA 4BT8A 5FINA 3E4BA 3SO8A 3RO3A 3SD5A 3L54A 1HXIA 5BV1A 4JD2G 2QYJA 3D9OA 5G55A 3CVVA 3TWUA 4A55A 2GRRB 2AVPA 4N3CA 2L0TB 2X6JA 2CHXA 2X3MA 2KZTA 1QZ2A 4RQIA 3LVQE 3L17A 4JEUA 5CEAA 4XE0A 5AN8A 2ZIRA 4IRUA 3SHFA 1TN8A 1MZCA 2I9CA 3D9MA 3TXNA 3KS2A 3ZYKA 1N11A 3U66A 3LYAA 1FCHA 2AW6A 2QYUA 3ZUVB 3T9KA 3ZPJA 4A63B 1FT1A 3PEVB 1OUVA 5B1AE 2Y0BG 4GU5A 3FY4A 2AXVA 5EIDA 2P9PG 1NA0A 3RK6A 4N39A 3UPVA 5JJTA 1N0QA 3CVQA 2YQ8A 3T8MA 4GYOA 2MHKA 3SI5A 3GYZA 5ENPD 4XIFA 3DXMG 5LFAA 4JL0A 3B7RL 4I6GA 4GTQA 5LCWJ 1EPUA 3PVLA 4DX5D 3CLJA 1HF8A 3SBTB 3Q15A 4NRHB 2I6HA 2FO1E 1JUQA 1V54E 4FU3A 2XPIA 5FQ4A 2LNIA 4JW1A 5FQ7A 3NOCD 1IQUA 3B7TA 5FIOA 4KZ0A 4F7AA 4J0UA 4AJWA 5DIZA 3D9JA 1SZAA 3FH8A 2KATA 3HXBA 1YA0A 1N52A 3D3MA 4JEHA 3G2WA 3ZKJA 4L7TA 2XRZA 5FZRA 3KAEA 3OXFA 4U8VD 1K1BA 3ASOE 1OCZE 4UQZA 3UKUG 3W9FA 2BUGA 2LAHA 1HG2A 3SNXA 1LF8A 1O5MA 1JWFA 4G23A 3RRUA 4QFVA 4LUNU 1IHBA 1Q2ZA 2KXPC 5JA4D 5ENRD 2GGFA 4BX9A 2R59A 3E37A 4XZ4A 3VLEA 4UI9C 2X6HA 3ML8A 4F53A 2CHZA 5HS0A 4FHJA 4ATZD 1S0PA 4J7WA 5KWDA 3FHEA 1E8ZA 3FTZA 3LCAA 5CMYA 3RRMB 4EHMA 3HG0D 3D9KA 2P9IG 3U9WA 5J90A 1OWMA 4B8AA 2VGEA 1DNPA 4U8HA 4XKCA 2E0IA 4LRZA 2NC9A 5ANLA 4BX8A 1ELKA 3V2OA 2C0LA 3Q75A 3J5QB 4PS8A 2XHEA 2KC7A 4MKTA 3B7UX 3I5PA 4HFGA 2DBAA 4UWFA 3AU5A 2VGXB 3D9PA 4DLQA 2VGYA 3EHQA 3BUAA 5LOZA 3PZ2A 1YCSB 3FWVA 1MYOA 4HOUA 4DRXE 3FUDA 2CFZA 4J8FA 3Q4AB 4G24A 4BETA 1BD8A 4KYOB 4O6FA 4UWLA 4NACA 4O60A 3TXMA 1PAQA 3U64A 2GRQB 1SQMA 5B1BE 3X2QE 3DSVA 3SQVA 1BPOA 2C0MA 2WXGA 3L22A 2OEWA 2P9KG 5AAOA 3GW4A 4L9PA 3VTXA 4L2LA 3LXUX 3V2XA 1H6KA 3I4RB 2OOEA 4M7CA 3QKYA 4BTAA 4U95D 1V55E 5HRYA 5FJYA 3ZN3A 4G26A 3CVUA 1QBQA 3FUKA 3AU4A 1S70B 4GZCA 3FFLA 4TXQA 2J08A 4F1PA 4KT6B 2KCKA 2R17C 3R9AB 2X38A 1A5EA 3PZDA 3U4TA 1IHGA 4J8YA 4JA7A 4PUCA 2WPVA 2R5SA 1TN6A 4FLHA 4GCOA 3QB2A 3S7JA 2RFMA 4L2YA 4BERA 3HYMB 5CEDB 4DX1A 4G11A 2C2LA 4ACKA 4UI9K 2DYRE 4CT4A 2I1KA 3C98A 4DLOA 5A7DB 5AYWD 3FH7A 4H7YA 4LNGA 3LJNA 1H2VC 1JCRA 2F0YA 2WXIA 1E90A 2XPZA 4BSZB 1QNFA 2WXLA 2ETBA 2MRIA 1MX2A 4GZDA 1SW6A 5JHBA 3FUHA 5EX3A 4EPZA 3LS8A 2KM4A 4AIFA 2QZAA 1Z5SC 3AG2E 4DX6D 5KNHD 4K5AB 2NSZA 1N4PA 3FU6A 1NP7A 2ZISA 1UN8A 4APFA 2DWZA 4CEMA 4N5QA 3F6QA 2IF4A 3QOUA 2HYZA 2L6JA 5FWQA 5ARGA 2PZIA 3LEWA 5BT1A 2LXLA 1TNUA 4OAUC 5CHEE 4UQXA 4TUMA 2ZU6B 3P2BA 4IYPA 5AQBA 2WMOA 4GA1A 4HVBA 4I43A 2J8SD 1H6OA 5CECB 4GYWA 4ANWA 1H2TC 3Q7FA 3JCKC 4GMLA 4AV7A 1OWNA 5D0OD 5KNGA 3PH0C 2V4LA 5ARFA 2FI7A 3B7SA 4I17A 4HBDA 3AG1E 2A5UA 5FTPA 3EJNA 2XS1A 1WG0A 3EHNA 3MCXA 3URZA 2IOSA 4GA2A 3PUJA 3ZYMA 1UN9A 1RW2A 3Q73A 4U0UA 5EYPF 5AJDA 4AOFA 3ASNE 4I9EA 5E76A 4Q94A 4EZLA 5EILA 1NFIE 2VTBA 1YMPA 3ML9A 5LP0A 4U8YD 1WAO1 2VQ2A 3QWWA 1W3BA 3FEYA 2WXPA 3UTMA 4Q69A 2EINE 3JQ1A 3FDHA 4CDMA 3QDNA 3OXLA 3TL5A 1SVXA 5C2YA 2NXPA 4HOQA 4DUIA 3GZ1A 1LD7A 3Q5MA 2XS8A 3PNLB 3SZ7A 4ILGA 2ETCA 5JMND 4DK5A 4A3TA
chains in the Genus database with same CATH topology
2HR2A 2VGXA 4HXIA 3HVEA 4KZ0A 3UT4A 4B94A 2VJ8A 3BG0B 3DBSA 4WNGA 2UWJG 3FTUA 4F7AA 2XGSA 4FJYA 2RD0A 3LKUA 4J0UA 4AJWA 2HO1A 4F3VA 1HU3A 4N2SA 2V8SE 2CG2A 5A6CA 2UY1A 2BTDA 5DIZA 2OV8A 3QK0A 5JJ6A 4EBAA 3D9JA 1DVPA 3MV3B 4J8DA 2IFUA 1SZAA 3FH8A 1P5QA 4FJZA 4I9CA 2KATA 5DBKA 3CSFA 4ILHB 1PC2A 3ASFA 1NA3A 3QNKA 1Y6IA 1YA0A 4BWRA 2WXNA 1N52A 3CK8A 2PQNA 4FLBA 2JEKA 3D3MA 4JEHA 3G2WA 4KVOA 1HS6A 4L7TA 3RJVA 2XRZA 5FZRA 4XI9A 3IHYA 3O4ZA 3KAEA 2VYIA 2EQXA 3K9IA 4GYYA 1QQEA 3FTVA 3OXFA 4XX5A 3RIBA 3SF4A 4UQZA 3EIJA 3FUNA 3CVPA 1KLXA 2BUGA 3ONLA 2LAHA 5LX8A 3T5VA 1HG2A 5AIJA 2IJGX 3CVLA 3SNXA 1LF8A 4JA9A 1JWFA 3L6AA 4G23A 3ULQA 3RRUA 1JPLA 4QFVA 3ZXSA 2AWIA 4LUNU 2LSUA 2DIWA 4HORA 4TRQA 4G2VA 3CHSA 3KD7A 3NF1A 4HS2A 3RO2A 3ZHEB 3FUIA 1EDUA 3SFZA 4XKBA 4EQFA 3CEQA 4EPZA 3MJWA 2GGFA 1OWLA 3CKCA 3UT7A 5KJNA 4BX9A 2J07A 1UW4B 1ZU2A 4I1OB 1ZBPA 2R59A 4XZ4A 3VLEA 4UI9C 2KCVA 1A17A 2LSVA 4TUUA 4E85A 2X6HA 1UG3A 4JXTA 2J9QA 3MKQA 4KVMA 3ML8A 5LCWC 3AS4A 2P58C 2GRMA 4F53A 2CHZA 4PS3A 4K0RA 3R7RA 1SZ9A 4FHJA 4U04A 5G04J 1GW6A 4FC8A 1VDYA 3CVNA 2E2EA 3ENEA 1S0PA 2Y4UA 3VLFA 4BT9A 5BPPA 3FUJA 2MOWA 1E8YA 1ELRA 3FHEA 1E8ZA 3FTZA 2WM9A 3LCAA 5CMYA 3RRMB 3TG5A 4Y6WA 2WXKA 2WXJA 3FTWA 2X6KA 3D9KA 3MKRA 4LCTA 4JPSA 5C1DA 4Q96A 1UJKA 4DI4A 1U3DA 4WWPA 3S7FA 3G2VA 4ABNA 4RG6A 3TGOA 4WNEA 2VTBB 5BUZA 5KJKA 4PS7A 4HOSA 3U9WA 1TEZA 2I1JA 4N3AA 1IYGA 3AS8A 5J90A 1OWMA 1FVHA 4CDRA 3JQ0A 5BV0A 5D0QD 4B8AA 3PS6A 4ILIA 1DNPA 4U8HA 3ASHA 3HDXA 4XKCA 4R7LA 2E0IA 4LRZA 3QWVA 4KMOA 1Z6TA 4JHRA 2NC9A 5ANLA 4V3IA 4H7XA 4BX8A 1E8WA 1H2UA 1N54A 4G25A 4FP7A 3ZYQA 3Q49B 3QAQA 2DCPA 2J4DA 2HM8A 1ELKA 3CHPA 4W9RA 4J6IA 4I6JA 3FU5A 3FU3A 4MLPA 2XCBA 2IQCA 3CHQA 4L23A 2C0LA 3LJ3A 4KBQA 3CIAA 4FULA 5E75A 4OVVA 4GZ6A 4PS8A 2XHEA 3CQGB 3PDNA 2KC7A 4MKTA 3B7UX 2FULA 3I5PA 4HFGA 5J08A 2WB2A 3D9LA 2DBAA 1B89A 4UWFA 2GW1A 4YNDA 3AU5A 2VGXB 3S7DA 3HVEB 2PM7A 3D9PA 4GMJA 3RRNB 5FZSA 4E6HA 3SGHA 3SBSA 3L16A 4DLQA 4WAFA 4LEUA 2VGYA 3JYSA 4JC8A 5LOZA 5FT9A 2Y3AA 3CV0A 3DPDA 3APCA 3FWVA 3LY9A 3QC1A 4XI0A 1PY1A 4UWGA 3UMVA 4A3VA 3I3NA 4HOUA 2YHCA 3FUMA 4EBAG 3FUDA 2JLBA 3ASGA 2CG3A 2CFZA 2IOLA 3BG1B 4J8FA 5EKQD 2ONDA 3Q4AB 3IBEA 4G24A 4AY5A 2LO6A 5FQ6A 3EIQC 3NZSA 4Y6CA 4U0ZA 4OYSA 4GB9A 2V5FA 1HG5A 5ENNA 5KJMA 1HFAA 2KZTB 4KYOB 4D10C 4JZYA 4O6FA 4UWLA 2XEVA 4WNDA 2L0IA 3QARA 4NACA 4UQYA 2AXZA 3VTYA 4AXHA 1INZA 2WXQA 3QJZA 3TXMA 4BFRA 4DJAA 1PAQA 3U64A 2WVIA 3EDTB 4GA0A 1SQMA 4HOTA 3PREA 3NQPA 1HO8A 5M72A 3LVRE 2PL2A 1BPOA 3UX4A 2C0MA 2WXGA 4I2WA 3L22A 3ASDA 2VSNA 5G04C 3CKBA 2XQ0A 4CRWA 3PE3A 3GW4A 4CCAA 3EHMA 2FO7A 3VTXA 4ACLA 3LDZA 3FH5A 4L2LA 1Y8MA 3GZ2A 3LXUX 4B89A 2WQHA 1H6KA 4EZJA 4CGVA 2V0PA 3I4RB 4EZKA 3MZLB 4PDXA 2OOEA 4HLEA 2L9BA 2WXMA 3QKYA 4BTAA 5ANRA 3TAXA 3PE4A 1E96B 1TJFA 3CR3A 3HIZA 5FJYA 2PQRA 3ZN3A 3AS5A 2X6IA 4G26A 3G2UA 3MKQB 2IU1A 4G1TA 4GZ5A 2WXFA 3CVUA 2XPYA 1NZNA 3FUKA 1H0AA 1FVFA 3AU4A 5G05J 3S2AA 4UWHA 1XGWA 3U3WA 1E7VA 2M63A 4GZCA 4DPRA 3FFLA 3CK7A 2FEZA 2J08A 4JHKA 1EYHA 2GRLA 4WWOA 4KT6B 2KCKA 2R17C 3R9AB 4BTBA 1HE8A 2X38A 5CCMA 3ZHEA 4FA6A 2J49A 2XRYA 3PZDA 3U4TA 3APDA 1ELWA 1IHGA 4ANVA 2XGOA 4JA7A 3CGHA 3OXGA 3VLDA 4PUCA 2FBNA 5JHAA 1X5BA 3S7BA 3D9IA 1KT0A 5G2NA 2WPVA 2R5SA 1KT1A 3MX3A 1E7UA 4FLHA 3BEEA 1HX8A 4U07A 3UUXA 4WWNA 4GCOA 4PH4B 1JWGA 3QB2A 3S7JA 4A1SA 4AP2A 4DI3A 2WQ7A 1Z3YA 1Z3XA 4L2YA 3MYVA 1U3CA 4I1MA 3CHRA 3HYMB 1H19A 3MV2B 2WXOA 3FUFA 5HQ8A 4G11A 4JHJA 1L5JA 2IONA 4I1AA 2YHEA 2C2LA 4ACKA 4N5CA 2WMNA 4WUYA 4YVQC 3L13A 4APOA 4UI9K 3MA5A 2XGMA 4M3OA 3CVWA 4GAAA 3FU0A 4CT4A 1WM5A 4GCNA 2I1KA 3CSTA 3FTSA 4MS6A 4UWKA 3C98A 4DLOA 5A7DB 3IV0A 5AYWD 4UI9J 3ZVVA 3FH7A 4H7YA 3N71A 4U0SA 3ESLA 1H2VC 3LY7A 4BSXA 3T5XA 2WXIA 1E90A 2A4ZA 2XPZA 5KCMA 4J8EA 2CFUA 3FUEA 1QNFA 2WXLA 3TG4A 2MRIA 4GZDA 3FTXA 4I6EA 4KXKB 4C0EA 5JHBA 3MGBA 2ILRA 2J09A 3G2SA 3FUHA 4YVOA 4C9BB 5EX3A 5BNWA 3WXXA 4GZ3A 4N3BA 3IKOB 5FQ8A 2J4BA 3B13A 3TJPA 1UJJA 3PNTB 4NURA 5T3RA 2UY1B 2KM4A 3LS8A 5HI7A 3OTNA 3ZFWA 4BT8A 3PEUB 1WY6A 3RU0A 3E4BA 4AIFA 3RO3A 3SD5A 3FEXA 4CDNA 3L54A 4NQ0A 4MRUA 1HXIA 3LPZA 5AENA 2NSZA 5BV1A 3D9OA 5G55A 2VSYA 3RKVA 3CVVA 3FU6A 3ZRHA 4A55A 3O48A 4AEZC 3FTYA 1NP7A 5A23A 4C0MA 3G2TA 5G05C 4I2ZA 3I4GA 1UN8A 4RSYA 4ANUA 1OWOA 4APFA 3GZSA 2AVPA 3R7QA 4CEMA 4N3CA 2L0TB 4B0ZA 2IF4A 2Y4TA 3QOUA 2HYZA 4F1SA 2X6JA 2CHXA 4OVUA 2L6JA 4U63A 2X3MA 2KZTA 1EF1C 2RG8A 1QZ2A 5FWQA 4L1BA 4A1GA 3NZUA 5ARGA 2PZIA 3LEWA 3LVQE 5BT1A 3L17A 2OVFA 4FADA 4JEUA 5CHEE 4XE0A 4UQXA 5JJ7A 3IEGA 4KZCA 4RVBA 2ZU6B 3P2BA 4IYPA 2CHWA 4IRUA 3SHFA 5AJLA 2I9CA 2WMOA 3D9MA 4GA1A 3TXNA 4N2QA 4HVBA 4J8SA 4I43A 3KS2A 5CCLA 1IQRA 3ZYKA 3U66A 2VSOE 3LYAA 1FCHA 3FULA 3OAWA 1MQSA 2AW6A 4GYWA 4B8CB 4ANWA 1H2TC 4URKA 4IULA 3JCKC 4GMLA 4AV7A 1MHQA 1OWNA 3ZPJA 5D0OD 3CVXA 3CHMA 3P1UA 3PH0C 2V4LA 3KEZA 5ARFA 2FI7A 3B7SA 3FP3A 3PEVB 4K03A 2PM6A 4I17A 3ZGQA 3ZW3A 1OUVA 2VSXE 4GU5A 3Q47B 3FY4A 2AXVA 5EDSA 4FHKA 2OVBA 1NA0A 4TV3A 3RK6A 2A5UA 4N39A 5FTPA 3EJNA 4RG9A 3UPVA 3EHNA 3MCXA 3URZA 5JJTA 2YINA 2IOSA 4GA2A 3PUJA 3CVQA 2YQ8A 3ZYMA 1UN9A 1XNFA 3CQCB 3ONKA 2I2OA 3T8MA 5EX0A 4GYOA 5T4YA 2MHKA 2QFCA 2YNQA 3L08A 3SI5A 3UQ3A 4CGWA 2WXHA 3GYZA 4U0UA 4LERA 5AJDA 3JUIA 4AOFA 3CHOA 4XIFA 4AY6A 2WXRA 4I9EA 2Q7FA 4Q94A 5E76A 5FZQA 4ANXA 3ZYLA 4JL0A 4EZLA 5LFAA 5KJLA 3B7RL 3UT8A 4EECA 4P29A 2VTBA 3LY8A 2BF0X 2AXUA 4I6GA 3D9NA 3ML9A 3ESKA 5LP0A 4AM9A 5LCWJ 3CVYA 1EPUA 3PVLA 1WAO1 3PUKA 5BW8C 2VQ2A 1HZ4A 3ZIMA 3CLJA 3QWWA 1HH8A 1W3BA 1HF8A 2WXPA 3APFA 3FEYA 3Q15A 4WNFA 4NRHB 5T8IA 3SBTB 4ME2A 1E8XA 3CK9A 4Q69A 2I6HA 2KCLA 2FF4A 1JUQA 3JQ1A 4FU3A 2X6FA 3FDHA 4JVSA 3QDNA 4CDMA 3HHMA 3IHVA 2XCCA 1OWPA 2XPIA 3OXLA 5FQ4A 3TL5A 2WQ6A 2LNIA 4JW1A 4GPKA 2QY7A 3QWPA 5C2YA 4AVXA 2NXPA 4HOQA 2LAIA 4IN3B 5FQ7A 3GZ1A 3Q5MA 4CT0A 1IQUA 4ATGA 3MEKA 3B7TA 3PNLB 4BY6A 3SZ7A 1TJCA 4ILGA 3PRZA 3ZEFA 5CMWA 4DK5A 4A3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HR2 A;  2VGX A;  4B94 A;  4WNG A;  2UWJ G;  2XGS A;  3LKU A;  4J0U A;  2HO1 A;  4F3V A;  4N2S A;  5A6C A;  2UY1 A;  5DIZ A;  5JJ6 A;  4ME2 A;  3MV3 B;  4J8D A;  2IFU A;  1P5Q A;  4I9C A;  2KAT A;  5DBK A;  1PC2 A;  3ASF A;  1NA3 A;  4BWR A;  1YA0 A;  3CK8 A;  2PQN A;  3RJV A;  5FZR A;  4XI9 A;  3KAE A;  2VYI A;  3K9I A;  4GYY A;  1QQE A;  3OXF A;  3RIB A;  3SF4 A;  4UQZ A;  3CVP A;  1KLX A;  2BUG A;  3CVL A;  4JA9 A;  4G23 A;  3ULQ A;  2LSU A;  4HOR A;  4G2V A;  3KD7 A;  3NF1 A;  3RO2 A;  3ZHE B;  4EQF A;  3CEQ A;  3CKC A;  5KJN A;  1ZU2 A;  1ZBP A;  4UI9 C;  2KCV A;  1A17 A;  2LSV A;  2J9Q A;  5LCW C;  3AS4 A;  2P58 C;  4U04 A;  5G04 J;  3CVN A;  2E2E A;  2Y4U A;  4BT9 A;  1ELR A;  3LCA A;  3TG5 A;  4Y6W A;  5C1D A;  3MKR A;  3S7F A;  4ABN A;  4RG6 A;  3TGO A;  4WNE A;  5KJK A;  4HOS A;  4N3A A;  1IYG A;  3AS8 A;  4CDR A;  5D0Q D;  3ASH A;  3QWV A;  4JHR A;  2NC9 A;  4H7X A;  4G25 A;  3Q49 B;  4W9R A;  2XCB A;  2C0L A;  4KBQ A;  4GZ6 A;  3PDN A;  2KC7 A;  2DBA A;  1B89 A;  4YND A;  2GW1 A;  2VGX B;  3S7D A;  5FZS A;  4LEU A;  2VGY A;  3JYS A;  5FT9 A;  3CV0 A;  3FWV A;  3LY9 A;  4XI0 A;  4HOU A;  2YHC A;  2JLB A;  3ASG A;  5EKQ D;  4J8F A;  2OND A;  3Q4A B;  4G24 A;  4AY5 A;  4Y6C A;  4U0Z A;  2V5F A;  5KJM A;  4KYO B;  4O6F A;  2XEV A;  4WND A;  4UQY A;  3VTY A;  3EDT B;  4GA0 A;  4HOT A;  5M72 A;  2PL2 A;  2C0M A;  4I2W A;  3ASD A;  2VSN A;  5G04 C;  3CKB A;  3PE3 A;  3GW4 A;  2FO7 A;  3VTX A;  1Y8M A;  3GZ2 A;  2WQH A;  4CGV A;  2OOE A;  3QKY A;  4BTA A;  3TAX A;  3PE4 A;  1E96 B;  5FJY A;  2PQR A;  3ZN3 A;  3AS5 A;  4G26 A;  4G1T A;  4GZ5 A;  1NZN A;  5G05 J;  3U3W A;  3FFL A;  3CK7 A;  2FEZ A;  2KCK A;  3R9A B;  4BTB A;  5CCM A;  3ZHE A;  3U4T A;  1ELW A;  1IHG A;  2XGO A;  4JA7 A;  3OXG A;  2FBN A;  3S7B A;  1KT0 A;  2WPV A;  2R5S A;  1KT1 A;  3BEE A;  4U07 A;  3UUX A;  4GCO A;  3S7J A;  4A1S A;  3HYM B;  3MV2 B;  5HQ8 A;  4I1A A;  2C2L A;  4N5C A;  4WUY A;  4YVQ C;  4APO A;  4UI9 K;  3MA5 A;  2XGM A;  1WM5 A;  4GCN A;  5A7D B;  5AYW D;  4UI9 J;  4H7Y A;  3N71 A;  4U0S A;  3LY7 A;  4J8E A;  3TG4 A;  4KXK B;  4YVO A;  5EX3 A;  5BNW A;  3WXX A;  4GZ3 A;  4N3B A;  2UY1 B;  5HI7 A;  3ZFW A;  4BT8 A;  3RU0 A;  3E4B A;  4AIF A;  3RO3 A;  4NQ0 A;  1HXI A;  3LPZ A;  2VSY A;  3RKV A;  3O48 A;  5G05 C;  4I2Z A;  2AVP A;  4N3C A;  2IF4 A;  2Y4T A;  3QOU A;  2HYZ A;  2L6J A;  1QZ2 A;  5ARG A;  2PZI A;  5BT1 A;  5CHE E;  5JJ7 A;  4UQX A;  3IEG A;  4GA1 A;  4N2Q A;  3KS2 A;  5CCL A;  3LYA A;  1FCH A;  4GYW A;  3ZPJ A;  5D0O D;  5ARF A;  2FI7 A;  3FP3 A;  4I17 A;  3ZGQ A;  1OUV A;  3Q47 B;  1NA0 A;  4N39 A;  5FTP A;  4RG9 A;  3UPV A;  3URZ A;  5JJT A;  4GA2 A;  3CVQ A;  2YQ8 A;  1XNF A;  5EX0 A;  4GYO A;  2MHK A;  2QFC A;  3UQ3 A;  4CGW A;  3GYZ A;  4U0U A;  4XIF A;  4AY6 A;  4I9E A;  2Q7F A;  5FZQ A;  4JL0 A;  5KJL A;  3LY8 A;  3ESK A;  4AM9 A;  5LCW J;  1WAO 1;  5BW8 C;  2VQ2 A;  1HZ4 A;  3QWW A;  1HH8 A;  1W3B A;  3Q15 A;  4WNF A;  4NRH B;  3CK9 A;  2I6H A;  2KCL A;  2FF4 A;  3QDN A;  3OXL A;  2XCC A;  2XPI A;  4GPK A;  2LNI A;  3QWP A;  4HOQ A;  4IN3 B;  3GZ1 A;  3Q5M A;  3MEK A;  3SZ7 A;  1TJC A; 
#chains in the Genus database with same CATH topology
 4HXI A;  3UT4 A;  2VJ8 A;  3DBS A;  3FTU A;  4FJY A;  1BI8 B;  2ETA A;  1AP7 A;  2BKK B;  2BTD A;  2OV8 A;  4ME2 A;  4I9C A;  3QNK A;  1KZP A;  1MJ0 A;  2EIM E;  3RJV A;  4K5C A;  3IHY A;  4GYY A;  3RIB A;  3EIJ A;  1OCO E;  3T5V A;  2IJG X;  5ENO D;  4JA9 A;  3L6A A;  3ULQ A;  2MYO A;  3TWT A;  2GRN B;  3ZXS A;  2AWI A;  2LSU A;  2DIW A;  4HOR A;  1JCS A;  4LG6 A;  4HS2 A;  3RO2 A;  2P9S G;  3UT7 A;  1ZU2 A;  5EN5 D;  1N0R A;  2LSV A;  1NI1 A;  4TUU A;  3HXE A;  3MKQ A;  5LCW C;  2XEE A;  3AS4 A;  2GRM A;  3PZ4 A;  4BT9 A;  5BPP A;  4Y6W A;  2X6K A;  4LCT A;  4Q96 A;  4DI4 A;  3S7F A;  4RG6 A;  3TGO A;  1SA5 A;  2IY0 C;  1TEZ A;  2I1J A;  3AS8 A;  1FVH A;  4CDR A;  3JQ0 A;  5BV0 A;  2OCC E;  1DC2 A;  3PS6 A;  2RFA A;  2BKG A;  3ASH A;  4R7L A;  4V3I A;  2F8X K;  4G25 A;  4YDO A;  3QAQ A;  2DCP A;  2J4D A;  4HLL A;  3CHP A;  4J6I A;  4MLP A;  3CHQ A;  3LJ3 A;  3CIA A;  5D2M C;  4FUL A;  5E75 A;  1O1T A;  4GZ6 A;  3CQG B;  3PDN A;  2FUL A;  3AJI A;  3D9L A;  4YND A;  2GW1 A;  2V4H C;  3S7D A;  3HVE B;  4GMJ A;  5FZS A;  3SGH A;  5FT9 A;  3CV0 A;  3DPD A;  3APC A;  3QC1 A;  3UMV A;  2YHC A;  3DSW A;  4AXH A;  5EKQ D;  2OND A;  3IBE A;  2LO6 A;  3NZS A;  4U0Z A;  4GB9 A;  3SFX A;  1QYM A;  4D10 C;  2XEV A;  3C5R A;  4UQY A;  2AXZ A;  2WVI A;  4GA0 A;  3NAW A;  2KBX A;  1NL4 A;  1TYQ G;  3NQP A;  1HO8 A;  3L9T A;  3LVR E;  3UX4 A;  4I2W A;  3ASD A;  3CKB A;  4LSZ E;  2XQ0 A;  4CRW A;  3UIN C;  3TWV A;  3FH5 A;  3DSS A;  4EZJ A;  4CGV A;  4EZK A;  3MZL B;  5CRV A;  3NB2 A;  5ANR A;  3C72 A;  3CR3 A;  2IO2 C;  3EU5 A;  2X6I A;  4X8Q A;  4GZ5 A;  1NZN A;  4LNB A;  5G05 J;  2DVW A;  3UM1 A;  3AG4 E;  3CK7 A;  4JHK A;  4WWO A;  1RZ4 A;  5CCM A;  4FA6 A;  2J49 A;  3APD A;  4ANV A;  2XGO A;  3V31 A;  3D9I A;  1KT0 A;  5G2N A;  3MX3 A;  3UUX A;  4WWN A;  2JAB A;  1Z3Y A;  1Z3X A;  4DX7 D;  2LUH A;  2WXO A;  4JHJ A;  2YHE A;  4N5C A;  3EU9 A;  4WUY A;  4M3O A;  3FU0 A;  1WM5 A;  4GCN A;  3IV0 A;  4UI9 J;  3ZVV A;  3N71 A;  3ESL A;  4BSX A;  5KCM A;  2XEN A;  3FTX A;  5ENQ D;  4C0E A;  4YVO A;  4C9B B;  4GZ3 A;  5FQ8 A;  2J4B A;  3DEP A;  1UJJ A;  4NUR A;  5HI7 A;  3Q7A A;  3OTN A;  3PEU B;  1WY6 A;  3RU0 A;  2Y69 E;  1KZO A;  4CDN A;  3IXE A;  4U96 D;  5AEN A;  3V30 A;  2VSY A;  3RKV A;  1DCQ A;  3O48 A;  4CZ2 D;  5A23 A;  4C0M A;  1AWC B;  3G2T A;  4I2Z A;  4ANU A;  1OWO A;  3GZS A;  1G3N B;  4GTO A;  3C3Q A;  1BI7 B;  4B0Z A;  2Y4T A;  4OVU A;  1EF1 C;  2RG8 A;  4XEI G;  4A1G A;  3NZU A;  3AAA C;  2OVF A;  4FAD A;  3DSX A;  4KZC A;  4RVB A;  2CHW A;  5AJL A;  5CCL A;  1IQR A;  3EUV A;  2VSO E;  3OAW A;  5ENT D;  1MQS A;  4BES A;  4IUL A;  3CHM A;  3P1U A;  3Q78 A;  3KEZ A;  3HRA A;  4K03 A;  2PM6 A;  5CBO A;  3Q47 B;  2OVB A;  3B95 A;  4G8K A;  2RKK A;  4HRL A;  1XNF A;  3ZU7 B;  3ONK A;  5EX0 A;  5T4Y A;  2QFC A;  3L08 A;  3UQ3 A;  4CGW A;  3TWR A;  3JUI A;  3CHO A;  2ZGG A;  2WXR A;  2QC9 A;  2Q7F A;  4ANX A;  5FZQ A;  3ZYL A;  5KJL A;  4EEC A;  3NBN B;  1N4R A;  4AM9 A;  3CVY A;  1MX4 A;  5BW8 C;  3ZIM A;  1HZ4 A;  3APF A;  5T8I A;  1E8X A;  3CK9 A;  2KCL A;  2ZGD A;  4JVS A;  3DRA A;  4LNU D;  2WQ6 A;  1OWP A;  3SY2 A;  2QY7 A;  5AAR A;  1UOH A;  4TXP A;  4GMR A;  4CYM D;  4BY6 A;  3PRZ A;  3ZEF A;  5CMW A;  2VGX A;  3BG0 B;  4WNG A;  2XGS A;  3LKU A;  3Q9U C;  2HO1 A;  5IY5 E;  4F3V A;  1HU3 A;  1U2V G;  5A6C A;  3QK0 A;  4EBA A;  1DVP A;  3SFY A;  1Y6I A;  4BWR A;  2HE0 A;  2WXN A;  3CK8 A;  2PQN A;  2JEK A;  2DZN A;  4KVO A;  2VYI A;  3E32 A;  4XX5 A;  3FUN A;  2LXM A;  2P2C P;  3CVP A;  1KLX A;  1OY3 D;  5LX8 A;  5AIJ A;  1JPL A;  1H6P A;  4ZFH A;  4TRQ A;  5EIB E;  1TNB A;  3ZHE B;  3FUI A;  4XKB A;  3CEQ A;  2A5E A;  3MJW A;  1OWL A;  3CKC A;  4E85 A;  1TR4 A;  1UG3 A;  1IKN D;  4C48 B;  2J9Q A;  2ZXW E;  3B7B A;  4KVM A;  5KBA A;  4O1O A;  4PS3 A;  1SZ9 A;  4U04 A;  5G04 J;  1GW6 A;  4FC8 A;  4HRN A;  3FUJ A;  2MOW A;  1E8Y A;  2WM9 A;  2WXJ A;  3MKR A;  2PNN A;  5D66 A;  3G2V A;  4ABN A;  4WNE A;  3PZ3 A;  5KJK A;  4PS7 A;  1ZB1 A;  4N3A A;  1IYG A;  1TN7 A;  3HDX A;  3QWV A;  4KMO A;  4JHR A;  4U7E B;  2V5Q C;  1D9S A;  3HXD A;  1N54 A;  2OEV A;  3ZYQ A;  3Q49 B;  3KSQ A;  2GRO B;  4W9R A;  1MX6 A;  2XCB A;  2IQC A;  4L23 A;  2EIJ E;  4KBQ A;  1OCR E;  1TNY A;  3SBS A;  4WAF A;  3JYS A;  5AQ7 A;  2Y3A A;  2Y1L E;  4XI0 A;  1PY1 A;  4UWG A;  2AJA A;  4A3V A;  3FUM A;  2JLB A;  2IEJ A;  3ASG A;  2IOL A;  4MBG A;  1SA4 A;  2V5F A;  1HG5 A;  5KJM A;  3QAR A;  3VTY A;  2WXQ A;  3QJZ A;  4BFR A;  3UM2 A;  4HOT A;  1TNO A;  3PRE A;  5M72 A;  2PL2 A;  3UIP C;  3ZNG A;  5CRU A;  4CCA A;  3EHM A;  2FO7 A;  3TWS A;  3GZ2 A;  4BEP A;  2WQH A;  3DST A;  4GTM A;  2V0P A;  4PDX A;  1JCQ A;  2L9B A;  3TAX A;  3PE4 A;  3TWX A;  3HIZ A;  2PQR A;  3AS5 A;  4G8L A;  3G2U A;  2IU1 A;  2WXF A;  3J5P A;  2XPY A;  2DYS E;  3S2A A;  3U3W A;  1BU9 A;  2M63 A;  2GRL A;  1HE8 A;  3ULY A;  3ZHE A;  2XRY A;  2H6G A;  2NYJ A;  5JHA A;  1X5B A;  3S7B A;  1KPS B;  1WDY A;  1E7U A;  2GRP B;  1HX8 A;  3DEO A;  4PH4 B;  2R2L A;  4AP2 A;  2WQ7 A;  1U3C A;  3CHR A;  1K8K G;  5HQ8 A;  1L5J A;  2WMN A;  4YVQ C;  3MA5 A;  3DXK G;  3CVW A;  4GAA A;  3CST A;  3FTS A;  4UWK A;  2P9U G;  4GTS A;  2H6H A;  1X81 A;  3T5X A;  4J8E A;  2CFU A;  3FUE A;  4GTP A;  4KXK B;  3UIO C;  3MGB A;  3G2S A;  2P9N G;  5BNW A;  3WXX A;  3HXC A;  4N3B A;  3IKO B;  3TJP A;  3B13 A;  3PNT B;  2UY1 B;  2L6B A;  3UM3 A;  3FEX A;  3BQO A;  3E34 A;  3Q79 A;  4NQ0 A;  4MRU A;  3HXF A;  3LPZ A;  4HB5 A;  4DX2 A;  3ZRH A;  4AEZ C;  3FTY A;  5G05 C;  3I4G A;  4RSY A;  5AQA A;  3R7Q A;  1LD8 A;  3ZXP A;  4F1S A;  3E33 A;  4U63 A;  4L1B A;  4OAV B;  1O1R A;  3KSL A;  5JJ7 A;  3IEG A;  4YDW A;  1OT8 A;  4N2Q A;  4J8S A;  5ENS D;  3FUL A;  3TWQ A;  4B8C B;  2IO3 C;  4GTV A;  4URK A;  1N9A A;  5AQ9 A;  1MHQ A;  3CVX A;  3FP3 A;  3ZGQ A;  3ZW3 A;  4NIK A;  2VSX E;  2H6I A;  5EDS A;  2R05 A;  4FHK A;  4TV3 A;  4RG9 A;  1FT2 A;  5HKP A;  4ZHB A;  2YIN A;  3CQC B;  2I2O A;  3UXG A;  2YNQ A;  1DCE A;  2R02 A;  3JXI A;  1N95 A;  2WXH A;  2XZD G;  4LER A;  4AY6 A;  4JB8 P;  3UT8 A;  4P29 A;  3LY8 A;  2BF0 X;  2AXU A;  4YDY A;  3D9N A;  4HQD A;  3ESK A;  3TWW A;  3PUK A;  2B6C A;  5CER B;  1HH8 A;  4WNF A;  5CBN A;  3ISM C;  1N4S A;  2FF4 A;  2X6F A;  3KEA A;  3HHM A;  3IHV A;  2XCC A;  3DSU A;  4GPK A;  3QWP A;  4AVX A;  2LAI A;  4IN3 B;  1OXJ A;  5BXU A;  3BU8 A;  4CT0 A;  4ATG A;  3MEK A;  1TJC A;  1K1A A;  3ABM E;  2HR2 A;  3HVE A;  3ABK E;  4B94 A;  2UWJ G;  2F8Y A;  2RD0 A;  4N2S A;  2V8S E;  2CG2 A;  2XEH A;  3W9G A;  2UY1 A;  5JJ6 A;  4GPM A;  3MV3 B;  4J8D A;  2IFU A;  1P5Q A;  4FJZ A;  5DBK A;  3CSF A;  4ILH B;  1PC2 A;  3ASF A;  1NA3 A;  4FLB A;  1S64 A;  1HS6 A;  4XI9 A;  3O4Z A;  2EQX A;  3K9I A;  1QQE A;  3FTV A;  3JUE A;  4HI9 A;  3JXJ A;  3SF4 A;  3ONL A;  3CVL A;  3NOG D;  4G2V A;  4GTT A;  3CHS A;  1OCC E;  3KD7 A;  3NF1 A;  3SFZ A;  1EDU A;  4EQF A;  2XZT G;  5KJN A;  2J07 A;  1UW4 B;  4I1O B;  1ZBP A;  2KCV A;  1A17 A;  4JXT A;  4HI8 A;  4RLY A;  1YYH A;  2P58 C;  4O1P A;  3E30 A;  4K0R A;  3R7R A;  4QQI A;  3UI2 A;  1VDY A;  3CVN A;  2E2E A;  3ENE A;  2Y4U A;  3VLF A;  1ELR A;  3TG5 A;  4GTR A;  1S63 A;  2WXK A;  3FTW A;  4JPS A;  5C1D A;  1UJK A;  2R03 A;  1U3D A;  4WWP A;  3UM0 A;  4HNA D;  2VTB B;  5BUZ A;  4HOS A;  2EIK E;  3AG3 E;  5D0Q D;  4ILI A;  1Z6T A;  4H7X A;  1E8W A;  1H2U A;  4FP7 A;  3L82 A;  2EIL E;  1IXV A;  2HM8 A;  4I6J A;  3FU5 A;  3FU3 A;  3PZ1 A;  2BED A;  1BLX B;  4OVV A;  3T8K A;  5J08 A;  2WB2 A;  1B89 A;  2PM7 A;  3RRN B;  4E6H A;  5EYL A;  3L16 A;  4LEU A;  4JC8 A;  3LY9 A;  3I3N A;  4EBA G;  2CG3 A;  3BG1 B;  2B0O E;  5FQ6 A;  4AY5 A;  3EIQ C;  4UUC A;  4Y6C A;  3UKR G;  4OYS A;  4F6R D;  5ENN A;  1HFA A;  2KZT B;  4JZY A;  4WND A;  2L0I A;  1INZ A;  5ITZ F;  4DJA A;  3EDT B;  4Z68 A;  2VSN A;  4TXR A;  5G04 C;  2F37 A;  1TNZ A;  3PE3 A;  1FPP A;  1O1S A;  4ACL A;  3LDZ A;  1Y8M A;  2P9L G;  4B89 A;  4HLE A;  3D9H A;  1N4Q A;  2WXM A;  1E96 B;  1TJF A;  1N94 A;  2DZO A;  3MKQ B;  4G1T A;  5B3S E;  1H0A A;  1FVF A;  4UWH A;  1XGW A;  1E7V A;  4DPR A;  4YDE A;  2FEZ A;  1EYH A;  3DWL G;  3C3R A;  4BTB A;  3RAU A;  1D8D A;  1D8E A;  1ELW A;  3CGH A;  3OXG A;  3VLD A;  2FBN A;  3WG7 E;  1KT1 A;  3BEE A;  4U07 A;  1JWG A;  4A1S A;  4DI3 A;  3MYV A;  2H6F A;  3ULE G;  4I1M A;  1H19 A;  3MV2 B;  4K5B A;  3FUF A;  2ION A;  4I1A A;  1LTX A;  3L13 A;  4APO A;  2XGM A;  3C3O A;  3ABL E;  5BXO A;  5H7P A;  4MS6 A;  1K3Z D;  3DPY A;  4U0S A;  3V79 K;  3EHR A;  3LY7 A;  2A4Z A;  3TG4 A;  4HRM B;  3R9M A;  4B93 B;  4I6E A;  2ILR A;  2J09 A;  3Q9N C;  3RSE G;  5T3R A;  3ZFW A;  4BT8 A;  5FIN A;  3E4B A;  3SO8 A;  3RO3 A;  3SD5 A;  3L54 A;  1HXI A;  5BV1 A;  4JD2 G;  2QYJ A;  3D9O A;  5G55 A;  3CVV A;  3TWU A;  4A55 A;  2GRR B;  2AVP A;  4N3C A;  2L0T B;  2X6J A;  2CHX A;  2X3M A;  2KZT A;  1QZ2 A;  4RQI A;  3LVQ E;  3L17 A;  4JEU A;  5CEA A;  4XE0 A;  5AN8 A;  2ZIR A;  4IRU A;  3SHF A;  1TN8 A;  1MZC A;  2I9C A;  3D9M A;  3TXN A;  3KS2 A;  3ZYK A;  1N11 A;  3U66 A;  3LYA A;  1FCH A;  2AW6 A;  2QYU A;  3ZUV B;  3T9K A;  3ZPJ A;  4A63 B;  1FT1 A;  3PEV B;  1OUV A;  5B1A E;  2Y0B G;  4GU5 A;  3FY4 A;  2AXV A;  5EID A;  2P9P G;  1NA0 A;  3RK6 A;  4N39 A;  3UPV A;  5JJT A;  1N0Q A;  3CVQ A;  2YQ8 A;  3T8M A;  4GYO A;  2MHK A;  3SI5 A;  3GYZ A;  5ENP D;  4XIF A;  3DXM G;  5LFA A;  4JL0 A;  3B7R L;  4I6G A;  4GTQ A;  5LCW J;  1EPU A;  3PVL A;  4DX5 D;  3CLJ A;  1HF8 A;  3SBT B;  3Q15 A;  4NRH B;  2I6H A;  2FO1 E;  1JUQ A;  1V54 E;  4FU3 A;  2XPI A;  5FQ4 A;  2LNI A;  4JW1 A;  5FQ7 A;  3NOC D;  1IQU A;  3B7T A;  5FIO A;  4KZ0 A;  4F7A A;  4J0U A;  4AJW A;  5DIZ A;  3D9J A;  1SZA A;  3FH8 A;  2KAT A;  3HXB A;  1YA0 A;  1N52 A;  3D3M A;  4JEH A;  3G2W A;  3ZKJ A;  4L7T A;  2XRZ A;  5FZR A;  3KAE A;  3OXF A;  4U8V D;  1K1B A;  3ASO E;  1OCZ E;  4UQZ A;  3UKU G;  3W9F A;  2BUG A;  2LAH A;  1HG2 A;  3SNX A;  1LF8 A;  1O5M A;  1JWF A;  4G23 A;  3RRU A;  4QFV A;  4LUN U;  1IHB A;  1Q2Z A;  2KXP C;  5JA4 D;  5ENR D;  2GGF A;  4BX9 A;  2R59 A;  3E37 A;  4XZ4 A;  3VLE A;  4UI9 C;  2X6H A;  3ML8 A;  4F53 A;  2CHZ A;  5HS0 A;  4FHJ A;  4ATZ D;  1S0P A;  4J7W A;  5KWD A;  3FHE A;  1E8Z A;  3FTZ A;  3LCA A;  5CMY A;  3RRM B;  4EHM A;  3HG0 D;  3D9K A;  2P9I G;  3U9W A;  5J90 A;  1OWM A;  4B8A A;  2VGE A;  1DNP A;  4U8H A;  4XKC A;  2E0I A;  4LRZ A;  2NC9 A;  5ANL A;  4BX8 A;  1ELK A;  3V2O A;  2C0L A;  3Q75 A;  3J5Q B;  4PS8 A;  2XHE A;  2KC7 A;  4MKT A;  3B7U X;  3I5P A;  4HFG A;  2DBA A;  4UWF A;  3AU5 A;  2VGX B;  3D9P A;  4DLQ A;  2VGY A;  3EHQ A;  3BUA A;  5LOZ A;  3PZ2 A;  1YCS B;  3FWV A;  1MYO A;  4HOU A;  4DRX E;  3FUD A;  2CFZ A;  4J8F A;  3Q4A B;  4G24 A;  4BET A;  1BD8 A;  4KYO B;  4O6F A;  4UWL A;  4NAC A;  4O60 A;  3TXM A;  1PAQ A;  3U64 A;  2GRQ B;  1SQM A;  5B1B E;  3X2Q E;  3DSV A;  3SQV A;  1BPO A;  2C0M A;  2WXG A;  3L22 A;  2OEW A;  2P9K G;  5AAO A;  3GW4 A;  4L9P A;  3VTX A;  4L2L A;  3LXU X;  3V2X A;  1H6K A;  3I4R B;  2OOE A;  4M7C A;  3QKY A;  4BTA A;  4U95 D;  1V55 E;  5HRY A;  5FJY A;  3ZN3 A;  4G26 A;  3CVU A;  1QBQ A;  3FUK A;  3AU4 A;  1S70 B;  4GZC A;  3FFL A;  4TXQ A;  2J08 A;  4F1P A;  4KT6 B;  2KCK A;  2R17 C;  3R9A B;  2X38 A;  1A5E A;  3PZD A;  3U4T A;  1IHG A;  4J8Y A;  4JA7 A;  4PUC A;  2WPV A;  2R5S A;  1TN6 A;  4FLH A;  4GCO A;  3QB2 A;  3S7J A;  2RFM A;  4L2Y A;  4BER A;  3HYM B;  5CED B;  4DX1 A;  4G11 A;  2C2L A;  4ACK A;  4UI9 K;  2DYR E;  4CT4 A;  2I1K A;  3C98 A;  4DLO A;  5A7D B;  5AYW D;  3FH7 A;  4H7Y A;  4LNG A;  3LJN A;  1H2V C;  1JCR A;  2F0Y A;  2WXI A;  1E90 A;  2XPZ A;  4BSZ B;  1QNF A;  2WXL A;  2ETB A;  2MRI A;  1MX2 A;  4GZD A;  1SW6 A;  5JHB A;  3FUH A;  5EX3 A;  4EPZ A;  3LS8 A;  2KM4 A;  4AIF A;  2QZA A;  1Z5S C;  3AG2 E;  4DX6 D;  5KNH D;  4K5A B;  2NSZ A;  1N4P A;  3FU6 A;  1NP7 A;  2ZIS A;  1UN8 A;  4APF A;  2DWZ A;  4CEM A;  4N5Q A;  3F6Q A;  2IF4 A;  3QOU A;  2HYZ A;  2L6J A;  5FWQ A;  5ARG A;  2PZI A;  3LEW A;  5BT1 A;  2LXL A;  1TNU A;  4OAU C;  5CHE E;  4UQX A;  4TUM A;  2ZU6 B;  3P2B A;  4IYP A;  5AQB A;  2WMO A;  4GA1 A;  4HVB A;  4I43 A;  2J8S D;  1H6O A;  5CEC B;  4GYW A;  4ANW A;  1H2T C;  3Q7F A;  3JCK C;  4GML A;  4AV7 A;  1OWN A;  5D0O D;  5KNG A;  3PH0 C;  2V4L A;  5ARF A;  2FI7 A;  3B7S A;  4I17 A;  4HBD A;  3AG1 E;  2A5U A;  5FTP A;  3EJN A;  2XS1 A;  1WG0 A;  3EHN A;  3MCX A;  3URZ A;  2IOS A;  4GA2 A;  3PUJ A;  3ZYM A;  1UN9 A;  1RW2 A;  3Q73 A;  4U0U A;  5EYP F;  5AJD A;  4AOF A;  3ASN E;  4I9E A;  5E76 A;  4Q94 A;  4EZL A;  5EIL A;  1NFI E;  2VTB A;  1YMP A;  3ML9 A;  5LP0 A;  4U8Y D;  1WAO 1;  2VQ2 A;  3QWW A;  1W3B A;  3FEY A;  2WXP A;  3UTM A;  4Q69 A;  2EIN E;  3JQ1 A;  3FDH A;  4CDM A;  3QDN A;  3OXL A;  3TL5 A;  1SVX A;  5C2Y A;  2NXP A;  4HOQ A;  4DUI A;  3GZ1 A;  1LD7 A;  3Q5M A;  2XS8 A;  3PNL B;  3SZ7 A;  4ILG A;  2ETC A;  5JMN D;  4DK5 A;  4A3T A; 
#chains in the Genus database with same CATH homology
 2HR2 A;  2VGX A;  4HXI A;  3HVE A;  4KZ0 A;  3UT4 A;  4B94 A;  2VJ8 A;  3BG0 B;  3DBS A;  4WNG A;  2UWJ G;  3FTU A;  4F7A A;  2XGS A;  4FJY A;  2RD0 A;  3LKU A;  4J0U A;  4AJW A;  2HO1 A;  4F3V A;  1HU3 A;  4N2S A;  2V8S E;  2CG2 A;  5A6C A;  2UY1 A;  2BTD A;  5DIZ A;  2OV8 A;  3QK0 A;  5JJ6 A;  4EBA A;  3D9J A;  1DVP A;  3MV3 B;  4J8D A;  2IFU A;  1SZA A;  3FH8 A;  1P5Q A;  4FJZ A;  4I9C A;  2KAT A;  5DBK A;  3CSF A;  4ILH B;  1PC2 A;  3ASF A;  1NA3 A;  3QNK A;  1Y6I A;  1YA0 A;  4BWR A;  2WXN A;  1N52 A;  3CK8 A;  2PQN A;  4FLB A;  2JEK A;  3D3M A;  4JEH A;  3G2W A;  4KVO A;  1HS6 A;  4L7T A;  3RJV A;  2XRZ A;  5FZR A;  4XI9 A;  3IHY A;  3O4Z A;  3KAE A;  2VYI A;  2EQX A;  3K9I A;  4GYY A;  1QQE A;  3FTV A;  3OXF A;  4XX5 A;  3RIB A;  3SF4 A;  4UQZ A;  3EIJ A;  3FUN A;  3CVP A;  1KLX A;  2BUG A;  3ONL A;  2LAH A;  5LX8 A;  3T5V A;  1HG2 A;  5AIJ A;  2IJG X;  3CVL A;  3SNX A;  1LF8 A;  4JA9 A;  1JWF A;  3L6A A;  4G23 A;  3ULQ A;  3RRU A;  1JPL A;  4QFV A;  3ZXS A;  2AWI A;  4LUN U;  2LSU A;  2DIW A;  4HOR A;  4TRQ A;  4G2V A;  3CHS A;  3KD7 A;  3NF1 A;  4HS2 A;  3RO2 A;  3ZHE B;  3FUI A;  1EDU A;  3SFZ A;  4XKB A;  4EQF A;  3CEQ A;  4EPZ A;  3MJW A;  2GGF A;  1OWL A;  3CKC A;  3UT7 A;  5KJN A;  4BX9 A;  2J07 A;  1UW4 B;  1ZU2 A;  4I1O B;  1ZBP A;  2R59 A;  4XZ4 A;  3VLE A;  4UI9 C;  2KCV A;  1A17 A;  2LSV A;  4TUU A;  4E85 A;  2X6H A;  1UG3 A;  4JXT A;  2J9Q A;  3MKQ A;  4KVM A;  3ML8 A;  5LCW C;  3AS4 A;  2P58 C;  2GRM A;  4F53 A;  2CHZ A;  4PS3 A;  4K0R A;  3R7R A;  1SZ9 A;  4FHJ A;  4U04 A;  5G04 J;  1GW6 A;  4FC8 A;  1VDY A;  3CVN A;  2E2E A;  3ENE A;  1S0P A;  2Y4U A;  3VLF A;  4BT9 A;  5BPP A;  3FUJ A;  2MOW A;  1E8Y A;  1ELR A;  3FHE A;  1E8Z A;  3FTZ A;  2WM9 A;  3LCA A;  5CMY A;  3RRM B;  3TG5 A;  4Y6W A;  2WXK A;  2WXJ A;  3FTW A;  2X6K A;  3D9K A;  3MKR A;  4LCT A;  4JPS A;  5C1D A;  4Q96 A;  1UJK A;  4DI4 A;  1U3D A;  4WWP A;  3S7F A;  3G2V A;  4ABN A;  4RG6 A;  3TGO A;  4WNE A;  2VTB B;  5BUZ A;  5KJK A;  4PS7 A;  4HOS A;  3U9W A;  1TEZ A;  2I1J A;  4N3A A;  1IYG A;  3AS8 A;  5J90 A;  1OWM A;  1FVH A;  4CDR A;  3JQ0 A;  5BV0 A;  5D0Q D;  4B8A A;  3PS6 A;  4ILI A;  1DNP A;  4U8H A;  3ASH A;  3HDX A;  4XKC A;  4R7L A;  2E0I A;  4LRZ A;  3QWV A;  4KMO A;  1Z6T A;  4JHR A;  2NC9 A;  5ANL A;  4V3I A;  4H7X A;  4BX8 A;  1E8W A;  1H2U A;  1N54 A;  4G25 A;  4FP7 A;  3ZYQ A;  3Q49 B;  3QAQ A;  2DCP A;  2J4D A;  2HM8 A;  1ELK A;  3CHP A;  4W9R A;  4J6I A;  4I6J A;  3FU5 A;  3FU3 A;  4MLP A;  2XCB A;  2IQC A;  3CHQ A;  4L23 A;  2C0L A;  3LJ3 A;  4KBQ A;  3CIA A;  4FUL A;  5E75 A;  4OVV A;  4GZ6 A;  4PS8 A;  2XHE A;  3CQG B;  3PDN A;  2KC7 A;  4MKT A;  3B7U X;  2FUL A;  3I5P A;  4HFG A;  5J08 A;  2WB2 A;  3D9L A;  2DBA A;  1B89 A;  4UWF A;  2GW1 A;  4YND A;  3AU5 A;  2VGX B;  3S7D A;  3HVE B;  2PM7 A;  3D9P A;  4GMJ A;  3RRN B;  5FZS A;  4E6H A;  3SGH A;  3SBS A;  3L16 A;  4DLQ A;  4WAF A;  4LEU A;  2VGY A;  3JYS A;  4JC8 A;  5LOZ A;  5FT9 A;  2Y3A A;  3CV0 A;  3DPD A;  3APC A;  3FWV A;  3LY9 A;  3QC1 A;  4XI0 A;  1PY1 A;  4UWG A;  3UMV A;  4A3V A;  3I3N A;  4HOU A;  2YHC A;  3FUM A;  4EBA G;  3FUD A;  2JLB A;  3ASG A;  2CG3 A;  2CFZ A;  2IOL A;  3BG1 B;  4J8F A;  5EKQ D;  2OND A;  3Q4A B;  3IBE A;  4G24 A;  4AY5 A;  2LO6 A;  5FQ6 A;  3EIQ C;  3NZS A;  4Y6C A;  4U0Z A;  4OYS A;  4GB9 A;  2V5F A;  1HG5 A;  5ENN A;  5KJM A;  1HFA A;  2KZT B;  4KYO B;  4D10 C;  4JZY A;  4O6F A;  4UWL A;  2XEV A;  4WND A;  2L0I A;  3QAR A;  4NAC A;  4UQY A;  2AXZ A;  3VTY A;  4AXH A;  1INZ A;  2WXQ A;  3QJZ A;  3TXM A;  4BFR A;  4DJA A;  1PAQ A;  3U64 A;  2WVI A;  3EDT B;  4GA0 A;  1SQM A;  4HOT A;  3PRE A;  3NQP A;  1HO8 A;  5M72 A;  3LVR E;  2PL2 A;  1BPO A;  3UX4 A;  2C0M A;  2WXG A;  4I2W A;  3L22 A;  3ASD A;  2VSN A;  5G04 C;  3CKB A;  2XQ0 A;  4CRW A;  3PE3 A;  3GW4 A;  4CCA A;  3EHM A;  2FO7 A;  3VTX A;  4ACL A;  3LDZ A;  3FH5 A;  4L2L A;  1Y8M A;  3GZ2 A;  3LXU X;  4B89 A;  2WQH A;  1H6K A;  4EZJ A;  4CGV A;  2V0P A;  3I4R B;  4EZK A;  3MZL B;  4PDX A;  2OOE A;  4HLE A;  2L9B A;  2WXM A;  3QKY A;  4BTA A;  5ANR A;  3TAX A;  3PE4 A;  1E96 B;  1TJF A;  3CR3 A;  3HIZ A;  5FJY A;  2PQR A;  3ZN3 A;  3AS5 A;  2X6I A;  4G26 A;  3G2U A;  3MKQ B;  2IU1 A;  4G1T A;  4GZ5 A;  2WXF A;  3CVU A;  2XPY A;  1NZN A;  3FUK A;  1H0A A;  1FVF A;  3AU4 A;  5G05 J;  3S2A A;  4UWH A;  1XGW A;  3U3W A;  1E7V A;  2M63 A;  4GZC A;  4DPR A;  3FFL A;  3CK7 A;  2FEZ A;  2J08 A;  4JHK A;  1EYH A;  2GRL A;  4WWO A;  4KT6 B;  2KCK A;  2R17 C;  3R9A B;  4BTB A;  1HE8 A;  2X38 A;  5CCM A;  3ZHE A;  4FA6 A;  2J49 A;  2XRY A;  3PZD A;  3U4T A;  3APD A;  1ELW A;  1IHG A;  4ANV A;  2XGO A;  4JA7 A;  3CGH A;  3OXG A;  3VLD A;  4PUC A;  2FBN A;  5JHA A;  1X5B A;  3S7B A;  3D9I A;  1KT0 A;  5G2N A;  2WPV A;  2R5S A;  1KT1 A;  3MX3 A;  1E7U A;  4FLH A;  3BEE A;  1HX8 A;  4U07 A;  3UUX A;  4WWN A;  4GCO A;  4PH4 B;  1JWG A;  3QB2 A;  3S7J A;  4A1S A;  4AP2 A;  4DI3 A;  2WQ7 A;  1Z3Y A;  1Z3X A;  4L2Y A;  3MYV A;  1U3C A;  4I1M A;  3CHR A;  3HYM B;  1H19 A;  3MV2 B;  2WXO A;  3FUF A;  5HQ8 A;  4G11 A;  4JHJ A;  1L5J A;  2ION A;  4I1A A;  2YHE A;  2C2L A;  4ACK A;  4N5C A;  2WMN A;  4WUY A;  4YVQ C;  3L13 A;  4APO A;  4UI9 K;  3MA5 A;  2XGM A;  4M3O A;  3CVW A;  4GAA A;  3FU0 A;  4CT4 A;  1WM5 A;  4GCN A;  2I1K A;  3CST A;  3FTS A;  4MS6 A;  4UWK A;  3C98 A;  4DLO A;  5A7D B;  3IV0 A;  5AYW D;  4UI9 J;  3ZVV A;  3FH7 A;  4H7Y A;  3N71 A;  4U0S A;  3ESL A;  1H2V C;  3LY7 A;  4BSX A;  3T5X A;  2WXI A;  1E90 A;  2A4Z A;  2XPZ A;  5KCM A;  4J8E A;  2CFU A;  3FUE A;  1QNF A;  2WXL A;  3TG4 A;  2MRI A;  4GZD A;  3FTX A;  4I6E A;  4KXK B;  4C0E A;  5JHB A;  3MGB A;  2ILR A;  2J09 A;  3G2S A;  3FUH A;  4YVO A;  4C9B B;  5EX3 A;  5BNW A;  3WXX A;  4GZ3 A;  4N3B A;  3IKO B;  5FQ8 A;  2J4B A;  3B13 A;  3TJP A;  1UJJ A;  3PNT B;  4NUR A;  5T3R A;  2UY1 B;  2KM4 A;  3LS8 A;  5HI7 A;  3OTN A;  3ZFW A;  4BT8 A;  3PEU B;  1WY6 A;  3RU0 A;  3E4B A;  4AIF A;  3RO3 A;  3SD5 A;  3FEX A;  4CDN A;  3L54 A;  4NQ0 A;  4MRU A;  1HXI A;  3LPZ A;  5AEN A;  2NSZ A;  5BV1 A;  3D9O A;  5G55 A;  2VSY A;  3RKV A;  3CVV A;  3FU6 A;  3ZRH A;  4A55 A;  3O48 A;  4AEZ C;  3FTY A;  1NP7 A;  5A23 A;  4C0M A;  3G2T A;  5G05 C;  4I2Z A;  3I4G A;  1UN8 A;  4RSY A;  4ANU A;  1OWO A;  4APF A;  3GZS A;  2AVP A;  3R7Q A;  4CEM A;  4N3C A;  2L0T B;  4B0Z A;  2IF4 A;  2Y4T A;  3QOU A;  2HYZ A;  4F1S A;  2X6J A;  2CHX A;  4OVU A;  2L6J A;  4U63 A;  2X3M A;  2KZT A;  1EF1 C;  2RG8 A;  1QZ2 A;  5FWQ A;  4L1B A;  4A1G A;  3NZU A;  5ARG A;  2PZI A;  3LEW A;  3LVQ E;  5BT1 A;  3L17 A;  2OVF A;  4FAD A;  4JEU A;  5CHE E;  4XE0 A;  4UQX A;  5JJ7 A;  3IEG A;  4KZC A;  4RVB A;  2ZU6 B;  3P2B A;  4IYP A;  2CHW A;  4IRU A;  3SHF A;  5AJL A;  2I9C A;  2WMO A;  3D9M A;  4GA1 A;  3TXN A;  4N2Q A;  4HVB A;  4J8S A;  4I43 A;  3KS2 A;  5CCL A;  1IQR A;  3ZYK A;  3U66 A;  2VSO E;  3LYA A;  1FCH A;  3FUL A;  3OAW A;  1MQS A;  2AW6 A;  4GYW A;  4B8C B;  4ANW A;  1H2T C;  4URK A;  4IUL A;  3JCK C;  4GML A;  4AV7 A;  1MHQ A;  1OWN A;  3ZPJ A;  5D0O D;  3CVX A;  3CHM A;  3P1U A;  3PH0 C;  2V4L A;  3KEZ A;  5ARF A;  2FI7 A;  3B7S A;  3FP3 A;  3PEV B;  4K03 A;  2PM6 A;  4I17 A;  3ZGQ A;  3ZW3 A;  1OUV A;  2VSX E;  4GU5 A;  3Q47 B;  3FY4 A;  2AXV A;  5EDS A;  4FHK A;  2OVB A;  1NA0 A;  4TV3 A;  3RK6 A;  2A5U A;  4N39 A;  5FTP A;  3EJN A;  4RG9 A;  3UPV A;  3EHN A;  3MCX A;  3URZ A;  5JJT A;  2YIN A;  2IOS A;  4GA2 A;  3PUJ A;  3CVQ A;  2YQ8 A;  3ZYM A;  1UN9 A;  1XNF A;  3CQC B;  3ONK A;  2I2O A;  3T8M A;  5EX0 A;  4GYO A;  5T4Y A;  2MHK A;  2QFC A;  2YNQ A;  3L08 A;  3SI5 A;  3UQ3 A;  4CGW A;  2WXH A;  3GYZ A;  4U0U A;  4LER A;  5AJD A;  3JUI A;  4AOF A;  3CHO A;  4XIF A;  4AY6 A;  2WXR A;  4I9E A;  2Q7F A;  4Q94 A;  5E76 A;  5FZQ A;  4ANX A;  3ZYL A;  4JL0 A;  4EZL A;  5LFA A;  5KJL A;  3B7R L;  3UT8 A;  4EEC A;  4P29 A;  2VTB A;  3LY8 A;  2BF0 X;  2AXU A;  4I6G A;  3D9N A;  3ML9 A;  3ESK A;  5LP0 A;  4AM9 A;  5LCW J;  3CVY A;  1EPU A;  3PVL A;  1WAO 1;  3PUK A;  5BW8 C;  2VQ2 A;  1HZ4 A;  3ZIM A;  3CLJ A;  3QWW A;  1HH8 A;  1W3B A;  1HF8 A;  2WXP A;  3APF A;  3FEY A;  3Q15 A;  4WNF A;  4NRH B;  5T8I A;  3SBT B;  4ME2 A;  1E8X A;  3CK9 A;  4Q69 A;  2I6H A;  2KCL A;  2FF4 A;  1JUQ A;  3JQ1 A;  4FU3 A;  2X6F A;  3FDH A;  4JVS A;  3QDN A;  4CDM A;  3HHM A;  3IHV A;  2XCC A;  1OWP A;  2XPI A;  3OXL A;  5FQ4 A;  3TL5 A;  2WQ6 A;  2LNI A;  4JW1 A;  4GPK A;  2QY7 A;  3QWP A;  5C2Y A;  4AVX A;  2NXP A;  4HOQ A;  2LAI A;  4IN3 B;  5FQ7 A;  3GZ1 A;  3Q5M A;  4CT0 A;  1IQU A;  4ATG A;  3MEK A;  3B7T A;  3PNL B;  4BY6 A;  3SZ7 A;  1TJC A;  4ILG A;  3PRZ A;  3ZEF A;  5CMW A;  4DK5 A;  4A3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...