3Q4AB

Crystal structure of the tpr domain of chip complexed with phosphorylated smad1 peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
132
structure length
132
Chain Sequence
b'SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism of the Negative Regulation of Smad1/5 Protein by Carboxyl Terminus of Hsc70-interacting Protein (CHIP).
pubmed doi rcsb
molecule keywords STIP1 homology and U box-containing protein 1
source organism Mus musculus
molecule tags Ligase/transcription
total genus 54
structure length 132
sequence length 132
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3q4aB00
5FJYA 1QZ2A 2FF4A 4U0SA 4WNGA 2KCVA 4O6FA 4GYOA 2Q7FA 4G2VA 3AS4A 3TG4A 2ONDA 5EX0A 5FT9A 5ARGA 1FCHA 3QWWA 3CKCA 1KLXA 4N5CA 2V5FA 3R9AB 2HR2A 3LY9A 1A17A 3PDNA 4U04A 4N2QA 3RJVA 3ULQA 3GZ2A 4W9RA 2XCBA 4BT8A 4I9EA 3CEQA 4GYWA 5AYWD 4J0UA 2KATA 3CVPA 5JJ7A 3Q49B 5JJTA 2J9QA 4AY5A 3VTYA 2VYIA 5CCLA 3QDNA 4J8FA 3AS5A 3QKYA 5EKQD 5G05C 4APOA 4LEUA 4WNFA 4WNEA 2WPVA 4WNDA 5KJMA 3MV3B 3OXLA 4XIFA 5M72A 4XI0A 4A1SA 5HQ8A 2NC9A 2XGSA 5HI7A 4KXKB 3RIBA 3ZFWA 5BNWA 3QOUA 5FTPA 1KT1A 4XI9A 2FI7A 2VGXA 3RKVA 2KC7A 2VQ2A 4GZ6A 4UQXA 2VSNA 4UI9J 4N3AA 3QWVA 3S7BA 5FZSA 3MA5A 4NRHB 3Q5MA 4CGVA 4HORA 4Y6CA 1HH8A 3FWVA 4U0ZA 2LSVA 3JYSA 3U3WA 3NF1A 4U07A 2WQHA 3S7DA 4H7XA 3AS8A 2YQ8A 2VSYA 2P58C 4N3BA 2GW1A 4J8DA 4G25A 2PQRA 4GCNA 5A6CA 4BT9A 3U4TA 4UI9K 3N71A 2FBNA 4BTBA 1B89A 1OUVA 3LY8A 4J8EA 4UI9C 3O48A 2UY1B 3KS2A 3LY7A 5D0OD 3KAEA 3UQ3A 3CV0A 3GYZA 5ARFA 1WAO1 3ZHEA 3GW4A 4JA7A 4AY6A 2VGYA 2I6HA 3OXGA 2LSUA 4GZ3A 3QWPA 1PC2A 4ABNA 3CK7A 2Y4TA 2KCKA 5FZQA 5LCWJ 4YNDA 4BWRA 4N39A 2XGMA 4HOUA 5DIZA 2C0LA 3GZ1A 5KJKA 4AM9A 1KT0A 4HOTA 3CK8A 4GA1A 3URZA 4JHRA 5JJ6A 3MV2B 3RU0A 1ZU2A 3ASDA 1XNFA 4G26A 3OXFA 3HYMB 5CCMA 4KYOB 1IHGA 5FZRA 5EX3A 3K9IA 1W3BA 4N3CA 1QQEA 4EQFA 4HOQA 1ELWA 4RG9A 3TG5A 2PZIA 4U0UA 1E96B 5G04C 4G1TA 4N2SA 2C0MA 2DBAA 5LCWC 4I2ZA 1NA3A 3PE3A 3ESKA 3Q47B 3S7JA 4JA9A 3TGOA 2MHKA 3KD7A 4CDRA 2FO7A 3SF4A 3E4BA 2FEZA 4ME2A 3SZ7A 5C1DA 2IFUA 3FP3A 1WM5A 3ZN3A 2JLBA 2XEVA 4H7YA 3ASFA 3UPVA 2PL2A 4RG6A 4GZ5A 3Q4AB 1IYGA 3ASHA 1NZNA 3Q15A 4JL0A 3LKUA 3RO3A 5KJNA 4G24A 4HOSA 3ZGQA 4I9CA 1ZBPA 3CKBA 2LNIA 4UQZA 2XPIA 4GA2A 4AIFA 3ASGA 3LPZA 3LCAA 4YVOA 5G04J 3TAXA 5KJLA 4IN3B 2KCLA 5BT1A 2VGXB 3CVLA 1TJCA 2BUGA 2E2EA 4WUYA 5CHEE 3UUXA 3PE4A 2UY1A 3S7FA 2UWJG 4G23A 4I17A 3FFLA 4I2WA 2XGOA 4Y6WA 4GYYA 4I1AA 3WXXA 1P5QA 3RO2A 1HZ4A 4UQYA 4GCOA 3CVNA 3MEKA 5DBKA 3IEGA 2XCCA 3BEEA 3MKRA 2C2LA 3CVQA 1NA0A 4GPKA 2Y4UA 1Y8MA 2IF4A 1YA0A 3ZPJA 4GA0A 2PQNA 4B94A 4KBQA 4F3VA 1HXIA 1ELRA 2L6JA 2R5SA 4CGWA 2YHCA 5D0QD 2OOEA 5A7DB 2AVPA 3VTXA 2HO1A 5BW8C 3CK9A 2QFCA 2HYZA 3EDTB 4NQ0A 3ZHEB 5G05J 3LYAA 4BTAA 4YVQC
chains in the Genus database with same CATH superfamily
1QZ2A 5ENOD 1SZ9A 5CERB 4U0SA 2WXLA 2KCVA 4O6FA 1O1SA 2R17C 4G2VA 4V3IA 1KPSB 4HBDA 3FH8A 2H6FA 3CVVA 5EYLA 1FCHA 4Q96A 4AP2A 2WXIA 3I4GA 3V79K 3R9AB 2HR2A 1OWOA 4I9EA 4GYWA 1S63A 4J0UA 2KATA 2WXFA 3EUVA 4EZLA 4HQDA 1BLXB 3FTVA 5CECB 3AS5A 2CG3A 4APOA 2IEJA 3ZVVA 1D9SA 2PM7A 2WPVA 2WXRA 5ITZF 5KJMA 4K03A 1WG0A 4L2YA 3ZFWA 3C3QA 1KT1A 3KEAA 3FH5A 2FI7A 3Q75A 5AN8A 4B89A 3Q7FA 3EIJA 4TUMA 3D3MA 3PZ4A 2VSNA 4CRWA 1EF1C 3L13A 3HVEB 1X5BA 4N3AA 4PS7A 1JWGA 3S7BA 4XKCA 1D8EA 4I1MA 2H6HA 4Y6CA 3LVQE 1UW4B 3AG3E 2WXHA 4U0ZA 3V2XA 3TWUA 5CRUA 3SNXA 3S7DA 1E8WA 4H7XA 3FUEA 3NAWA 1HO8A 3FEXA 2GRNB 3CHQA 1BU9A 1E8ZA 3P2BA 4XX5A 2P58C 1K1AA 2F8XK 1IQRA 3MX3A 3JUIA 4J8DA 5KCMA 3ZXSA 4HLEA 5A6CA 3FTWA 4BT9A 4NURA 3NQPA 4GTQA 4KZ0A 3FTSA 1B89A 4K5CA 4UI9C 3V2OA 3FUDA 1Q2ZA 1HF8A 3QAQA 3JQ0A 3KAEA 4IRUA 3UQ3A 4ACKA 2OVFA 5EILA 4A55A 3SO8A 2WXKA 3ZHEA 2I9CA 3GW4A 2VGYA 3JXJA 2I6HA 4P29A 1MYOA 1TNOA 3D9NA 3QWPA 3PS6A 1N95A 2FULA 1PC2A 3UXGA 4NACA 3CK7A 4F6RD 4YNDA 4N39A 4HOUA 5DIZA 3SFXA 2IOSA 2C0LA 2XPYA 5FINA 1MHQA 5EIBE 3C5RA 2YINA 4CCAA 4F1PA 1LD8A 3ZYQA 3UI2A 1HS6A 1OY3D 4ATZD 3ASDA 1OT8A 1XNFA 1O1RA 3NBNB 1OWLA 3LS8A 3DBSA 3L54A 3FTYA 3EJNA 4CDNA 3IHVA 2IY0C 5FZRA 5EX3A 3K9IA 2ZU6B 1NI1A 3AG2E 2PZIA 4U0UA 5J08A 3D9LA 3AJIA 3ONLA 2DBAA 4I2ZA 4CYMD 3TWXA 2CFUA 2RKKA 3KSLA 1XGWA 1E8YA 3TGOA 5JMND 3LJNA 3ABME 3CSTA 1H2VC 3CHOA 2FO7A 1UG3A 4FHKA 3BUAA 2FEZA 4ME2A 4L23A 3E32A 4N5QA 1YCSB 5BPPA 3CHRA 1N4QA 2A4ZA 3B7SA 1PAQA 3CQGB 2BF0X 1N9AA 1NZNA 4JL0A 5CEAA 2J4BA 4J8SA 4TXRA 4HOSA 4GZDA 4WAFA 2OV8A 3P1UA 1JCQA 2F37A 1JPLA 4GA2A 3LPZA 4AOFA 1D8DA 4J7WA 5KNHD 3FTZA 1QYMA 5BT1A 3IV0A 2VGEA 4LUNU 2E2EA 4ZHBA 3FUHA 4JZYA 3UUXA 3PE4A 3FY4A 2UY1A 3TWWA 1SVXA 1G3NB 3CQCB 3HIZA 3EHNA 4I2WA 2XGOA 4MLPA 1P5QA 2BTDA 4I6EA 3FUJA 4BSXA 1QNFA 1N54A 2V4LA 4CT4A 1V54E 1HZ4A 4R7LA 3L16A 2OEWA 4EPZA 3MEKA 3ZYKA 2BEDA 2XCCA 3BEEA 3CR3A 3MKRA 2C2LA 2ZXWE 3FTUA 3CVQA 2WM9A 1GW6A 4WWOA 1N94A 1IXVA 4FADA 3PEVB 3PVLA 2Y4UA 1Y8MA 2VTBB 2X6KA 2R2LA 3TWTA 4UWFA 3UTMA 3DSWA 2XEEA 2R5SA 3FU6A 3FUMA 3QNKA 1MQSA 2DZNA 4JEUA 2X6JA 3CK9A 3T8KA 3NZSA 4NQ0A 3ZKJA 2HE0A 4GTSA 5B3SE 3LYAA 5HRYA 4WWPA 4CDMA 5ENRD 1UJKA 1FPPA 4DUIA 4GYOA 5ENSD 5ENNA 2J07A 1EYHA 5J90A 1NFIE 3FUFA 3C3OA 1TNZA 5EX0A 5FT9A 3TWRA 1K1BA 4MBGA 3QWWA 3CKCA 4F7AA 2Y3AA 1BD8A 1FVFA 2I2OA 1H2UA 3RJVA 4W9RA 4AXHA 2XCBA 4BT8A 3CEQA 2WB2A 5AYWD 3ABKE 4O1OA 3Q49B 5JJTA 1Z3YA 1OWNA 4OAVB 4CEMA 2X6IA 3HXDA 4J8FA 3FH7A 3FEYA 3LVRE 3QKYA 5EKQD 1N0QA 3C98A 5G05C 1N0RA 2RG8A 4GMJA 4U7EB 4ACLA 1BI8B 4WNDA 3CHPA 1Z5SC 4BX9A 3CVYA 4XIFA 5M72A 4A1SA 3UT4A 1KZOA 3FUIA 2NC9A 5CMWA 2XGSA 2L6BA 1VDYA 4IULA 1S70B 2IJGX 1X81A 5BXOA 1DCQA 4GZ6A 2P9KG 2CHZA 3DSXA 4UQXA 3APFA 5LX8A 4Q69A 5BV1A 2A5EA 4C9BB 4TXQA 3Q5MA 1OCOE 5AIJA 4CGVA 4HORA 2V0PA 5T3RA 2XPZA 4HB5A 2ZIRA 1K8KG 4UWKA 4PDXA 4LNBA 2KZTB 5T8IA 4UWGA 2VSXE 3EU5A 3PNLB 3X2QE 2QC9A 3PUKA 2VSYA 4FULA 3ULYA 4CT0A 2AXZA 3HVEA 4GCNA 3UT8A 3U4TA 1E7VA 5KWDA 1KZPA 3DSSA 4PS8A 4JPSA 2IOLA 3C72A 1U3CA 4PH4B 3LY7A 2J4DA 2KM4A 5EYPF 2F8YA 5ARFA 2R05A 3G2TA 3EHQA 5FQ6A 2WVIA 2WXQA 4AY6A 2IU1A 3FU5A 1H6OA 2WXNA 2ETBA 3OXGA 3G2UA 1E7UA 4GU5A 2LO6A 2KCKA 5FZQA 5LCWJ 3O4ZA 3ASOE 4G11A 4GAAA 2P9PG 3DSVA 4C0EA 1A5EA 3TL5A 5KJKA 1O1TA 5JA4D 1KT0A 4LG6A 2QYJA 1O5MA 4GA1A 5JJ6A 4HRLA 1FT1A 3Q79A 3MV2B 3RU0A 1ZU2A 4BETA 4M7CA 2GRMA 3AG1E 3HYMB 2J08A 3EU9A 1UJJA 1JUQA 2IO3C 4KYOB 4GTTA 3PZ2A 2L0IA 1IKND 4HOQA 4ILGA 4UWHA 3TG5A 4RLYA 3D9OA 2VJ8A 1E96B 3UKUG 4G8LA 4G1TA 4N2SA 2B0OE 2VSOE 1SQMA 1TEZA 1UN9A 3ESKA 3IKOB 3S7JA 2R02A 4JA9A 3KD7A 5FIOA 4I6JA 2WXOA 3FHEA 3L22A 4DK5A 3NOCD 4JD2G 2RFMA 3SF4A 4I43A 4XZ4A 4U8VD 2GRRB 5C1DA 1H19A 4GMLA 4JEHA 4B8AA 1MX6A 3ZN3A 3D9HA 1EDUA 3NOGD 2XEVA 2FO1E 4H7YA 3ASFA 4RSYA 3UPVA 4U8HA 2P9NG 4B8CB 3UM1A 3QK0A 3R9MA 3U66A 3Q15A 2WXGA 1H6PA 3LKUA 4U95D 4ATGA 1TNUA 3RRUA 3FULA 3QC1A 3CVLA 3TXNA 5H7PA 5ENTD 4F53A 4I17A 4ANUA 3DEPA 4L1BA 1E90A 2WXJA 2LXLA 4Y6WA 3WXXA 2DIWA 5KNGA 3SD5A 2WXMA 2R03A 1NP7A 3FTXA 2Y0BG 4E85A 5DBKA 3IEGA 2AW6A 3LEWA 4YDYA 3SBTB 4K5AB 1OXJA 5FQ7A 3ML8A 4GPKA 3PZ1A 2XHEA 4FLHA 3ZPJA 4TUUA 2OEVA 5D0QD 4OAUC 4OYSA 5T4YA 2ZISA 2BKGA 5BW8C 4IYPA 3AU5A 3UM0A 1QBQA 3PZDA 3ZNGA 2AXUA 4LNGA 3ZHEB 5CMYA 4XE0A 4FC8A 2J09A 2FF4A 3VLFA 2LAHA 4WNGA 3NB2A 2VTBA 3ZRHA 3QJZA 1WDYA 3NZUA 4D10C 4BERA 4XEIG 1MJ0A 3AS4A 2WXPA 4FP7A 2ONDA 4TV3A 4EECA 4WWNA 4DX5D 5FQ8A 4XKBA 3ZYMA 1KLXA 4N5CA 5ANLA 5LFAA 1TR4A 2B6CA 4JXTA 4MS6A 3RAUA 4A1GA 2H6IA 5EIDA 5B1AE 3UINC 2IONA 3SFYA 3LY9A 1A17A 3PDNA 3WG7E 4U04A 3ULQA 3GZ2A 3PREA 4KVOA 3Q9NC 5JJ7A 4A63B 2J9QA 3LXUX 4AY5A 2BKKB 2VYIA 4J8YA 5CCLA 2L0TB 2RD0A 2CHWA 4WNFA 2QYUA 4WNEA 1PY1A 2ILRA 3HXBA 1DVPA 3MV3B 1ELKA 3OXLA 1DCEA 5HI7A 4KXKB 4TXPA 3D9PA 5ANRA 5FTPA 3LDZA 1HU3A 4ANVA 3I3NA 3T5XA 4XI9A 3VLDA 2VGXA 5HKPA 3RKVA 2KC7A 4FJZA 2P9UG 5AAOA 3MKQB 5E76A 5CEDB 3DPDA 2MRIA 1JWFA 3PRZA 1RZ4A 3TWVA 1U2VG 2ZGGA 3DSUA 4NRHB 2P9SG 3T9KA 1HH8A 1N4PA 3T5VA 3W9GA 5CBNA 5E75A 3ESLA 3UKRG 2LSVA 3JYSA 3U3WA 3NF1A 3ML9A 5AQAA 4U07A 2WQHA 3AS8A 4HI8A 4UWLA 2YQ8A 3JQ1A 4Z68A 3CVWA 2DWZA 2AJAA 4N3BA 3U64A 3CGHA 2PQRA 1TYQG 3B7BA 4OVUA 4UI9K 5D66A 3CLJA 3APCA 3N71A 2FBNA 4BTBA 2RFAA 4GTVA 1FVHA 1HE8A 1LTXA 4J8EA 2EIKE 2CHXA 4DX7D 3JXIA 2UY1B 4FHJA 1Z3XA 4HS2A 3CV0A 3L17A 3RSEG 2EIJE 2L9BA 2MOWA 5KBAA 3G2SA 4LERA 3SI5A 3KEZA 3VLEA 3FUNA 2EIME 2Y4TA 5AQBA 4URKA 4BWRA 3UIOC 2XGMA 3RK6A 3GZ1A 4I6GA 3ZU7B 4AM9A 5BV0A 3CK8A 2GGFA 3TWSA 4DX2A 3CHSA 2Y69E 3ONKA 3SHFA 1INZA 5CRVA 4JHRA 5EDSA 3JCKC 3L9TA 5B1BE 3OXFA 1BPOA 2AWIA 5CCMA 5ENQD 1TN6A 3D9JA 1W3BA 3TJPA 4ANWA 1QQEA 4FA6A 1WY6A 1ELWA 3CVUA 2LXMA 3DXMG 4YDWA 5G04C 2ETAA 1TN7A 3Q78A 2C0MA 5LCWC 4GTOA 3U9WA 4EHMA 1UOHA 2XRYA 1JCRA 3IXEA 3TWQA 4DX6D 2IQCA 2X3MA 4MRUA 2QZAA 4B0ZA 2MHKA 3ULEG 1H2TC 4CDRA 4LRZA 1HFAA 3I4RB 3E4BA 3SZ7A 2DYSE 2EILE 2IFUA 1AP7A 2KXPC 3V30A 2GRQB 5ENPD 3HXEA 4HRNA 4K0RA 4RG6A 4GZ5A 3ASHA 3R7QA 3UX4A 4G24A 3MYVA 3DWLG 4I9CA 1ZBPA 2LNIA 4BX8A 3RRNB 2V8SE 2X38A 4AIFA 3ZUVB 3ASGA 3FU3A 4PUCA 3LCAA 3I5PA 5G04J 2DCPA 2YHEA 3AAAC 4LNUD 4L7TA 3RRMB 3TAXA 4KMOA 3Q73A 4Q94A 4QQIA 5BUZA 1TNBA 4WUYA 2F0YA 5CHEE 1Y6IA 3S7FA 4G23A 1OCCE 4YDEA 3FFLA 1U3DA 2CFZA 1YMPA 3AG4E 3ISMC 4RQIA 3ZIMA 2IO2C 4C48B 3RO2A 1JCSA 5JHBA 3FU0A 4BESA 5FWQA 2XENA 1MX4A 4BEPA 4HXIA 2X6FA 4KT6B 1NA0A 4G8KA 3E37A 4EZJA 3HRAA 3B95A 4HVBA 4TRQA 4KBQA 1FT2A 1N4RA 3SY2A 2J49A 2V4HC 1HXIA 1N11A 1ELRA 3SBSA 3PNTB 4X8QA 3B7RL 1IQUA 2YNQA 5A7DB 2OOEA 3VTXA 2HO1A 2JABA 4FLBA 4B93B 1K3ZD 3SFZA 3V31A 5JHAA 2HYZA 2HM8A 1HG5A 3AU4A 3EDTB 1IHBA 3UMVA 4BTAA 3DEOA 4YVQC 3DRAA 5FJYA 3ZYLA 2Q7FA 3OTNA 3ZEFA 3SGHA 1BI7B 3CVXA 3TG4A 4JB8P 2WMNA 5ARGA 3GZSA 4DX1A 1S0PA 3R7RA 4BFRA 2E0IA 3DPYA 2V5FA 3QARA 1SW6A 1V55E 4GZCA 1MX2A 3D9KA 4DLQA 4N2QA 5AJLA 3T8MA 4DPRA 4U8YD 3J5QB 3CVPA 3S2AA 4AV7A 2AXVA 3VTYA 2J8SD 3QDNA 2KBXA 2GRLA 4GMRA 4LEUA 1RW2A 1H6KA 3FUKA 2P2CP 4DI4A 1YYHA 4XI0A 2XRZA 5HQ8A 4APFA 4EBAA 3RIBA 2DVWA 5BNWA 5BXUA 3QOUA 3TXMA 4O1PA 1NL4A 1OCZE 2VQ2A 1SA4A 2WMOA 4JHKA 4GTPA 3L6AA 2XQ0A 4UI9J 1OWMA 3G2VA 3QWVA 3HXFA 3ABLE 5FZSA 3MA5A 1ZB1A 1DNPA 3KSQA 4U96D 3FWVA 3B7UX 4M3OA 1OWPA 4AEZC 4DI3A 5A23A 4KVMA 3D9IA 4ILHB 3IHYA 5AENA 4ILIA 1Z6TA 3B7TA 3UIPC 3MKQA 4L2LA 3ZXPA 3PZ3A 1S64A 2OVBA 2GW1A 2LAIA 4G25A 5FQ4A 2GROB 4KZCA 3F6QA 3PH0C 5AQ7A 4GPMA 1OUVA 2X6HA 3LY8A 5C2YA 4DRXE 3O48A 5IY5E 3KS2A 2ZGDA 5D0OD 3GYZA 4QFVA 3ASNE 4AJWA 1WAO1 4JA7A 2R59A 4UUCA 3CIAA 2LSUA 3QB2A 4U63A 4GZ3A 1H0AA 1N52A 3D9MA 4ABNA 3APDA 3HDXA 4O60A 3HXCA 4E6HA 4HNAD 3DSTA 4NIKA 2Y1LE 3Q7AA 4GB9A 4JVSA 2EQXA 2OCCE 4HOTA 2WQ7A 2NSZA 1AWCB 4L9PA 4MKTA 2PNNA 4LSZE 4JC8A 4K5BA 3URZA 4BSZB 2DYRE 3BU8A 1OCRE 1HX8A 5G55A 1HG2A 4G26A 3JUEA 4A3VA 5AJDA 4AVXA 3CSFA 2CG2A 1IHGA 2P9LG 3E33A 4N3CA 2M63A 4EQFA 4ZFHA 3W9FA 1SA5A 1TJFA 4RG9A 3ZW3A 3OAWA 2ETCA 5AARA 3IBEA 1NA3A 3HG0D 3PE3A 5G2NA 3Q47B 2MYOA 1MZCA 3E30A 3UM3A 3EHRA 4JHJA 3PUJA 1SZAA 4DJAA 1TNYA 3FDHA 2XS1A 3Q9UC 3UT7A 1DC2A 2JEKA 3BG1B 1TN8A 4PS3A 4YDOA 3B13A 2I1JA 3FP3A 1WM5A 5EN5D 2EINE 2I1KA 3L82A 2JLBA 4RVBA 2KZTA 1EPUA 3BG0B 2PL2A 2NYJA 3Q4AB 4C0MA 1IYGA 4LCTA 4EBAG 4CZ2D 2XZTG 3RO3A 5KJNA 3ZGQA 3CKBA 2H6GA 4UQZA 4HRMB 2XPIA 3UM2A 4YVOA 5KJLA 3CHMA 4I1OB 4IN3B 2KCLA 1LD7A 4FU3A 2VGXB 1TJCA 2A5UA 3LJ3A 2BUGA 2XS8A 1N4SA 2V5QC 3SQVA 2UWJG 3ENEA 3HHMA 4EZKA 2LUHA 4ANXA 3EIQC 4GYYA 4I1AA 2WQ6A 4BY6A 4UQYA 4GCOA 3CVNA 3MJWA 4A3TA 4GTMA 2QY7A 1UN8A 5LOZA 1E8XA 3EHMA 5AQ9A 2IF4A 4HI9A 3DXKG 1YA0A 4GTRA 4GA0A 2PQNA 4B94A 4F3VA 4F1SA 4HLLA 2XZDG 4OVVA 2GRPB 3BQOA 2NXPA 4HFGA 3E34A 2L6JA 4CGWA 2YHCA 3G2WA 2AVPA 2XEHA 4DLOA 3PEUB 3MCXA 3J5PA 3L08A 5LP0A 2QFCA 3MZLB 3C3RA 2P9IG 2PM6A 1L5JA 5HS0A 4J6IA 3MGBA 4FJYA 1LF8A 5CBOA 5D2MC 5G05J 2DZOA 4JW1A
chains in the Genus database with same CATH topology
4WWPA 5FJYA 1QZ2A 2J09A 4FC8A 4CDMA 1SZ9A 2FF4A 4U0SA 2LAHA 1UJKA 2KCVA 2WXLA 4WNGA 4O6FA 3VLFA 4GYOA 3ZYLA 2Q7FA 3OTNA 2VTBA 3ZRHA 3ZEFA 3QJZA 2R17C 5ENNA 2J07A 3NZUA 4G2VA 1EYHA 3SGHA 4D10C 5J90A 3FUFA 4V3IA 3AS4A 2WXPA 3CVXA 3TG4A 2WMNA 2ONDA 4FP7A 4TV3A 4EECA 5EX0A 5FT9A 5ARGA 3FH8A 3GZSA 3CVVA 1FCHA 4Q96A 4WWNA 1S0PA 3QWWA 3CKCA 5FQ8A 4XKBA 3ZYMA 4AP2A 4F7AA 3R7RA 1KLXA 2WXIA 2Y3AA 3I4GA 4BFRA 2E0IA 4N5CA 5ANLA 5LFAA 4JXTA 4MS6A 1FVFA 2I2OA 2V5FA 4A1GA 3QARA 3R9AB 1H2UA 4GZCA 2IONA 2HR2A 3LY9A 3D9KA 1A17A 3PDNA 4DLQA 4U04A 4N2QA 3RJVA 3ULQA 3GZ2A 3PREA 4W9RA 5AJLA 4AXHA 1OWOA 2XCBA 3T8MA 4I9EA 4BT8A 3CEQA 4GYWA 4DPRA 5AYWD 4J0UA 4KVOA 2WB2A 2KATA 3CVPA 5JJ7A 3S2AA 4AV7A 3Q49B 2WXFA 5JJTA 2J9QA 3LXUX 4EZLA 1Z3YA 1OWNA 2AXVA 2VYIA 3VTYA 4AY5A 3FTVA 4CEMA 2X6IA 5CCLA 3QDNA 4J8FA 3AS5A 2L0TB 3FH7A 2CG3A 2GRLA 3FEYA 3LVRE 3QKYA 5EKQD 3C98A 5G05C 2RG8A 4APOA 4GMJA 4LEUA 2RD0A 2CHWA 4ACLA 4WNFA 3ZVVA 4WNEA 1H6KA 3FUKA 1PY1A 2PM7A 2WPVA 2ILRA 2WXRA 4WNDA 3CHPA 1DVPA 4DI4A 4BX9A 5KJMA 4K03A 3MV3B 1ELKA 3OXLA 3CVYA 4XIFA 5M72A 4XI0A 4A1SA 3UT4A 2XRZA 5HQ8A 3FUIA 2NC9A 5CMWA 2XGSA 5HI7A 4APFA 4KXKB 4L2YA 4EBAA 3D9PA 3RIBA 3ZFWA 5BNWA 5ANRA 3QOUA 1VDYA 5FTPA 3LDZA 1KT1A 3TXMA 1HU3A 4IULA 4ANVA 3I3NA 3T5XA 3FH5A 4XI9A 2IJGX 2FI7A 3VLDA 2VGXA 3RKVA 2KC7A 2VQ2A 4B89A 4JHKA 2WMOA 4GZ6A 3EIJA 3D3MA 4FJZA 2CHZA 3MKQB 5E76A 4UQXA 3L6AA 2VSNA 3DPDA 3APFA 4CRWA 2MRIA 2XQ0A 5LX8A 4Q69A 5BV1A 1EF1C 1JWFA 3PRZA 3L13A 4UI9J 3HVEB 1OWMA 1X5BA 4N3AA 4PS7A 3G2VA 3QWVA 4C9BB 1JWGA 5FZSA 3S7BA 3MA5A 4NRHB 4XKCA 3Q5MA 5AIJA 4I1MA 1DNPA 4CGVA 2V0PA 4HORA 4Y6CA 3LVQE 1HH8A 3T5VA 1UW4B 5T3RA 2XPZA 4UWKA 3FWVA 2WXHA 4U0ZA 3B7UX 5E75A 4M3OA 3ESLA 2LSVA 4PDXA 2KZTB 3JYSA 5T8IA 1OWPA 3NF1A 3U3WA 4AEZC 3ML9A 4DI3A 5A23A 4U07A 3SNXA 2WQHA 4KVMA 3S7DA 4UWGA 3D9IA 2VSXE 1E8WA 4H7XA 3FUEA 3PNLB 1HO8A 3FEXA 4ILHB 3AS8A 3IHYA 3PUKA 4UWLA 2YQ8A 3CHQA 3JQ1A 2VSYA 4FULA 4CT0A 5AENA 1E8ZA 3P2BA 3CVWA 4ILIA 4XX5A 1Z6TA 3B7TA 2P58C 3MKQA 4L2LA 4N3BA 3U64A 1IQRA 2OVBA 2GW1A 2LAIA 3CGHA 2AXZA 3JUIA 2PQRA 3MX3A 3HVEA 4G25A 4J8DA 4KZCA 5FQ4A 4GCNA 5KCMA 3ZXSA 4HLEA 3UT8A 3FTWA 5A6CA 4BT9A 3U4TA 4NURA 4OVUA 1E7VA 3NQPA 4UI9K 3CLJA 3PH0C 3APCA 3N71A 4KZ0A 2FBNA 4PS8A 3FTSA 4BTBA 1B89A 1OUVA 1FVHA 1HE8A 2X6HA 3LY8A 5C2YA 4J8EA 4JPSA 2CHXA 4UI9C 2IOLA 3FUDA 3O48A 1U3CA 2UY1B 1HF8A 4PH4B 3KS2A 3LY7A 4FHJA 2J4DA 1Z3XA 3QAQA 5D0OD 2KM4A 3JQ0A 3KAEA 4HS2A 4IRUA 3UQ3A 4ACKA 2OVFA 3CV0A 3GYZA 3L17A 4QFVA 4A55A 5ARFA 3G2TA 1WAO1 4AJWA 2WXKA 2L9BA 3ZHEA 2I9CA 5FQ6A 3GW4A 2WVIA 2WXQA 4JA7A 4AY6A 2IU1A 2VGYA 2MOWA 2I6HA 2R59A 3FU5A 3CIAA 3G2SA 4LERA 4P29A 3KEZA 2WXNA 3OXGA 3SI5A 3G2UA 2LSUA 3VLEA 3QB2A 1E7UA 3D9NA 4U63A 4GZ3A 3QWPA 3PS6A 2FULA 1H0AA 1N52A 1PC2A 3D9MA 4ABNA 3APDA 3HDXA 4NACA 3FUNA 3CK7A 2LO6A 4GU5A 2Y4TA 4E6HA 2KCKA 5FZQA 5LCWJ 3O4ZA 4URKA 4YNDA 4BWRA 4N39A 2XGMA 4G11A 4GAAA 4HOUA 5DIZA 3RK6A 2IOSA 2C0LA 3GZ1A 4C0EA 4I6GA 3TL5A 5KJKA 4GB9A 4AM9A 4JVSA 2XPYA 2EQXA 1KT0A 5BV0A 3CK8A 2GGFA 4HOTA 2WQ7A 3CHSA 2NSZA 3ONKA 4MKTA 1MHQA 3SHFA 1INZA 2YINA 4JC8A 4GA1A 3URZA 4CCAA 4JHRA 5JJ6A 3ZYQA 1HS6A 3MV2B 5EDSA 3RU0A 1HX8A 1ZU2A 3ASDA 3JCKC 1XNFA 5G55A 2GRMA 1HG2A 1OWLA 3OXFA 3LS8A 4G26A 3HYMB 1BPOA 2AWIA 5AJDA 3DBSA 4A3VA 3L54A 4AVXA 2J08A 3FTYA 3EJNA 4CDNA 1UJJA 3CSFA 2CG2A 3IHVA 1JUQA 4KYOB 5CCMA 1IHGA 5FZRA 5EX3A 3K9IA 3D9JA 1W3BA 4N3CA 3TJPA 2M63A 4ANWA 1QQEA 4EQFA 4FA6A 1WY6A 2L0IA 2ZU6B 1TJFA 4HOQA 1ELWA 3CVUA 4ILGA 4RG9A 4UWHA 3TG5A 3D9OA 2PZIA 2VJ8A 4U0UA 1E96B 5G04C 3ZW3A 5J08A 3D9LA 4G1TA 4N2SA 3ONLA 2C0MA 3OAWA 2DBAA 5LCWC 3IBEA 2VSOE 1SQMA 4I2ZA 3U9WA 1TEZA 1NA3A 1UN9A 2XRYA 3PE3A 3ESKA 3IKOB 5G2NA 3Q47B 3S7JA 2CFUA 1XGWA 2IQCA 2X3MA 4MRUA 1E8YA 4JA9A 3TGOA 4B0ZA 2MHKA 3KD7A 4JHJA 1H2TC 3PUJA 4I6JA 2WXOA 3CSTA 3FHEA 3L22A 4DK5A 1H2VC 1SZAA 4CDRA 4DJAA 3CHOA 4LRZA 2FO7A 1UG3A 3FDHA 1HFAA 3SF4A 4FHKA 3I4RB 4I43A 3UT7A 4XZ4A 3E4BA 2FEZA 2JEKA 3BG1B 4ME2A 3SZ7A 4L23A 4PS3A 5C1DA 1H19A 2IFUA 3B13A 4GMLA 4JEHA 2I1JA 4B8AA 3FP3A 1WM5A 2I1KA 3ZN3A 5BPPA 1EDUA 3CHRA 2JLBA 4RVBA 2KZTA 2XEVA 1EPUA 3BG0B 4H7YA 2A4ZA 3ASFA 4K0RA 4RSYA 3UPVA 4U8HA 2PL2A 1PAQA 3B7SA 4RG6A 4GZ5A 3CQGB 3Q4AB 2BF0X 4B8CB 4C0MA 1IYGA 3ASHA 3R7QA 3UX4A 3QK0A 4LCTA 3U66A 1NZNA 4EBAG 3Q15A 2WXGA 4JL0A 3LKUA 2J4BA 3RO3A 4J8SA 5KJNA 4G24A 3MYVA 3ZGQA 4HOSA 4GZDA 1ZBPA 3CKBA 4I9CA 4WAFA 2LNIA 4BX8A 2OV8A 3P1UA 4UQZA 3RRNB 4ATGA 2XPIA 2V8SE 3RRUA 2X38A 1JPLA 4GA2A 4AIFA 3ASGA 3FU3A 3LPZA 4AOFA 4PUCA 3FULA 3LCAA 3I5PA 4YVOA 5G04J 2DCPA 2YHEA 4L7TA 3FTZA 3RRMB 3TAXA 5KJLA 3CHMA 4I1OB 4IN3B 4KMOA 2KCLA 5BT1A 3IV0A 4FU3A 2VGXB 3QC1A 3CVLA 4Q94A 1TJCA 2A5UA 3LJ3A 2BUGA 5BUZA 4LUNU 2E2EA 3TXNA 3FUHA 4WUYA 4JZYA 5CHEE 3UUXA 3PE4A 1Y6IA 3FY4A 2UY1A 3S7FA 4F53A 2UWJG 3ENEA 4G23A 4I17A 3HHMA 4ANUA 4EZKA 3FFLA 4L1BA 3CQCB 4ANXA 1E90A 3EIQC 3HIZA 1U3DA 2CFZA 3EHNA 4I2WA 2XGOA 2WXJA 4Y6WA 4GYYA 4I1AA 4MLPA 3WXXA 2WQ6A 1P5QA 4BY6A 2DIWA 2BTDA 4I6EA 3FUJA 3ZIMA 4BSXA 1QNFA 1N54A 2V4LA 3SD5A 2WXMA 4CT4A 3RO2A 1HZ4A 4UQYA 4GCOA 4R7LA 3L16A 5JHBA 3CVNA 1NP7A 3MJWA 3FU0A 4A3TA 4EPZA 3FTXA 3MEKA 4E85A 2QY7A 5FWQA 1UN8A 5LOZA 5DBKA 3IEGA 3ZYKA 2XCCA 2AW6A 3BEEA 3CR3A 3MKRA 1E8XA 3LEWA 2C2LA 3SBTB 3FTUA 3CVQA 4HXIA 3EHMA 2X6FA 2WM9A 1GW6A 4KT6B 4WWOA 5FQ7A 1NA0A 4FADA 3ML8A 3PEVB 3PVLA 4GPKA 2Y4UA 1Y8MA 2IF4A 2XHEA 4FLHA 1YA0A 2VTBB 3ZPJA 4GA0A 4EZJA 4HVBA 2X6KA 2PQNA 4TRQA 4B94A 4KBQA 4F3VA 4F1SA 2J49A 4OVVA 4TUUA 4UWFA 1HXIA 2NXPA 1ELRA 4HFGA 3SBSA 2L6JA 3PNTB 2R5SA 3FU6A 4CGWA 3B7RL 1IQUA 3FUMA 2YHCA 3QNKA 2YNQA 5D0QD 2OOEA 3G2WA 2AVPA 5A7DB 4OYSA 2HO1A 5T4YA 3VTXA 4DLOA 3PEUB 5BW8C 1MQSA 3MCXA 4IYPA 2X6JA 4JEUA 3L08A 5LP0A 3CK9A 3AU5A 4FLBA 3SFZA 2QFCA 3MZLB 2HYZA 5JHAA 3PZDA 2AXUA 2PM6A 1L5JA 2HM8A 4J6IA 1HG5A 3MGBA 4FJYA 1LF8A 3AU4A 3EDTB 3NZSA 4NQ0A 3ZHEB 5G05J 5CMYA 3UMVA 3LYAA 4BTAA 4JW1A 4XE0A 4YVQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJY A;  1QZ2 A;  2FF4 A;  4U0S A;  4WNG A;  2KCV A;  4O6F A;  4GYO A;  2Q7F A;  4G2V A;  3AS4 A;  3TG4 A;  2OND A;  5EX0 A;  5FT9 A;  5ARG A;  1FCH A;  3QWW A;  3CKC A;  1KLX A;  4N5C A;  2V5F A;  3R9A B;  2HR2 A;  3LY9 A;  1A17 A;  3PDN A;  4U04 A;  4N2Q A;  3RJV A;  3ULQ A;  3GZ2 A;  4W9R A;  2XCB A;  4BT8 A;  4I9E A;  3CEQ A;  4GYW A;  5AYW D;  4J0U A;  2KAT A;  3CVP A;  5JJ7 A;  3Q49 B;  5JJT A;  2J9Q A;  4AY5 A;  3VTY A;  2VYI A;  5CCL A;  3QDN A;  4J8F A;  3AS5 A;  3QKY A;  5EKQ D;  5G05 C;  4APO A;  4LEU A;  4WNF A;  4WNE A;  2WPV A;  4WND A;  5KJM A;  3MV3 B;  3OXL A;  4XIF A;  5M72 A;  4XI0 A;  4A1S A;  5HQ8 A;  2NC9 A;  2XGS A;  5HI7 A;  4KXK B;  3RIB A;  3ZFW A;  5BNW A;  3QOU A;  5FTP A;  1KT1 A;  4XI9 A;  2FI7 A;  2VGX A;  3RKV A;  2KC7 A;  2VQ2 A;  4GZ6 A;  4UQX A;  2VSN A;  4UI9 J;  4N3A A;  3QWV A;  3S7B A;  5FZS A;  3MA5 A;  4NRH B;  3Q5M A;  4CGV A;  4HOR A;  4Y6C A;  1HH8 A;  3FWV A;  4U0Z A;  2LSV A;  3JYS A;  3U3W A;  3NF1 A;  4U07 A;  2WQH A;  3S7D A;  4H7X A;  3AS8 A;  2YQ8 A;  2VSY A;  2P58 C;  4N3B A;  2GW1 A;  4J8D A;  4G25 A;  2PQR A;  4GCN A;  5A6C A;  4BT9 A;  3U4T A;  4UI9 K;  3N71 A;  2FBN A;  4BTB A;  1B89 A;  1OUV A;  3LY8 A;  4J8E A;  4UI9 C;  3O48 A;  2UY1 B;  3KS2 A;  3LY7 A;  5D0O D;  3KAE A;  3UQ3 A;  3CV0 A;  3GYZ A;  5ARF A;  1WAO 1;  3ZHE A;  3GW4 A;  4JA7 A;  4AY6 A;  2VGY A;  2I6H A;  3OXG A;  2LSU A;  4GZ3 A;  3QWP A;  1PC2 A;  4ABN A;  3CK7 A;  2Y4T A;  2KCK A;  5FZQ A;  5LCW J;  4YND A;  4BWR A;  4N39 A;  2XGM A;  4HOU A;  5DIZ A;  2C0L A;  3GZ1 A;  5KJK A;  4AM9 A;  1KT0 A;  4HOT A;  3CK8 A;  4GA1 A;  3URZ A;  4JHR A;  5JJ6 A;  3MV2 B;  3RU0 A;  1ZU2 A;  3ASD A;  1XNF A;  4G26 A;  3OXF A;  3HYM B;  5CCM A;  4KYO B;  1IHG A;  5FZR A;  5EX3 A;  3K9I A;  1W3B A;  4N3C A;  1QQE A;  4EQF A;  4HOQ A;  1ELW A;  4RG9 A;  3TG5 A;  2PZI A;  4U0U A;  1E96 B;  5G04 C;  4G1T A;  4N2S A;  2C0M A;  2DBA A;  5LCW C;  4I2Z A;  1NA3 A;  3PE3 A;  3ESK A;  3Q47 B;  3S7J A;  4JA9 A;  3TGO A;  2MHK A;  3KD7 A;  4CDR A;  2FO7 A;  3SF4 A;  3E4B A;  2FEZ A;  4ME2 A;  3SZ7 A;  5C1D A;  2IFU A;  3FP3 A;  1WM5 A;  3ZN3 A;  2JLB A;  2XEV A;  4H7Y A;  3ASF A;  3UPV A;  2PL2 A;  4RG6 A;  4GZ5 A;  3Q4A B;  1IYG A;  3ASH A;  1NZN A;  3Q15 A;  4JL0 A;  3LKU A;  3RO3 A;  5KJN A;  4G24 A;  4HOS A;  3ZGQ A;  4I9C A;  1ZBP A;  3CKB A;  2LNI A;  4UQZ A;  2XPI A;  4GA2 A;  4AIF A;  3ASG A;  3LPZ A;  3LCA A;  4YVO A;  5G04 J;  3TAX A;  5KJL A;  4IN3 B;  2KCL A;  5BT1 A;  2VGX B;  3CVL A;  1TJC A;  2BUG A;  2E2E A;  4WUY A;  5CHE E;  3UUX A;  3PE4 A;  2UY1 A;  3S7F A;  2UWJ G;  4G23 A;  4I17 A;  3FFL A;  4I2W A;  2XGO A;  4Y6W A;  4GYY A;  4I1A A;  3WXX A;  1P5Q A;  3RO2 A;  1HZ4 A;  4UQY A;  4GCO A;  3CVN A;  3MEK A;  5DBK A;  3IEG A;  2XCC A;  3BEE A;  3MKR A;  2C2L A;  3CVQ A;  1NA0 A;  4GPK A;  2Y4U A;  1Y8M A;  2IF4 A;  1YA0 A;  3ZPJ A;  4GA0 A;  2PQN A;  4B94 A;  4KBQ A;  4F3V A;  1HXI A;  1ELR A;  2L6J A;  2R5S A;  4CGW A;  2YHC A;  5D0Q D;  2OOE A;  5A7D B;  2AVP A;  3VTX A;  2HO1 A;  5BW8 C;  3CK9 A;  2QFC A;  2HYZ A;  3EDT B;  4NQ0 A;  3ZHE B;  5G05 J;  3LYA A;  4BTA A;  4YVQ C; 
#chains in the Genus database with same CATH topology
 1QZ2 A;  5ENO D;  1SZ9 A;  5CER B;  4U0S A;  2WXL A;  2KCV A;  4O6F A;  1O1S A;  2R17 C;  4G2V A;  4V3I A;  1KPS B;  4HBD A;  3FH8 A;  2H6F A;  3CVV A;  5EYL A;  1FCH A;  4Q96 A;  4AP2 A;  2WXI A;  3I4G A;  3V79 K;  3R9A B;  2HR2 A;  1OWO A;  4I9E A;  4GYW A;  1S63 A;  4J0U A;  2KAT A;  2WXF A;  3EUV A;  4EZL A;  4HQD A;  1BLX B;  3FTV A;  5CEC B;  3AS5 A;  2CG3 A;  4APO A;  2IEJ A;  3ZVV A;  1D9S A;  2PM7 A;  2WPV A;  2WXR A;  5ITZ F;  5KJM A;  4K03 A;  1WG0 A;  4L2Y A;  3ZFW A;  3C3Q A;  1KT1 A;  3KEA A;  3FH5 A;  2FI7 A;  3Q75 A;  5AN8 A;  4B89 A;  3Q7F A;  3EIJ A;  4TUM A;  3D3M A;  3PZ4 A;  2VSN A;  4CRW A;  1EF1 C;  3L13 A;  3HVE B;  1X5B A;  4N3A A;  4PS7 A;  1JWG A;  3S7B A;  4XKC A;  1D8E A;  4I1M A;  2H6H A;  4Y6C A;  3LVQ E;  1UW4 B;  3AG3 E;  2WXH A;  4U0Z A;  3V2X A;  3TWU A;  5CRU A;  3SNX A;  3S7D A;  1E8W A;  4H7X A;  3FUE A;  3NAW A;  1HO8 A;  3FEX A;  2GRN B;  3CHQ A;  1BU9 A;  1E8Z A;  3P2B A;  4XX5 A;  2P58 C;  1K1A A;  2F8X K;  1IQR A;  3MX3 A;  3JUI A;  4J8D A;  5KCM A;  3ZXS A;  4HLE A;  5A6C A;  3FTW A;  4BT9 A;  4NUR A;  3NQP A;  4GTQ A;  4KZ0 A;  3FTS A;  1B89 A;  4K5C A;  4UI9 C;  3V2O A;  3FUD A;  1Q2Z A;  1HF8 A;  3QAQ A;  3JQ0 A;  3KAE A;  4IRU A;  3UQ3 A;  4ACK A;  2OVF A;  5EIL A;  4A55 A;  3SO8 A;  2WXK A;  3ZHE A;  2I9C A;  3GW4 A;  2VGY A;  3JXJ A;  2I6H A;  4P29 A;  1MYO A;  1TNO A;  3D9N A;  3QWP A;  3PS6 A;  1N95 A;  2FUL A;  1PC2 A;  3UXG A;  4NAC A;  3CK7 A;  4F6R D;  4YND A;  4N39 A;  4HOU A;  5DIZ A;  3SFX A;  2IOS A;  2C0L A;  2XPY A;  5FIN A;  1MHQ A;  5EIB E;  3C5R A;  2YIN A;  4CCA A;  4F1P A;  1LD8 A;  3ZYQ A;  3UI2 A;  1HS6 A;  1OY3 D;  4ATZ D;  3ASD A;  1OT8 A;  1XNF A;  1O1R A;  3NBN B;  1OWL A;  3LS8 A;  3DBS A;  3L54 A;  3FTY A;  3EJN A;  4CDN A;  3IHV A;  2IY0 C;  5FZR A;  5EX3 A;  3K9I A;  2ZU6 B;  1NI1 A;  3AG2 E;  2PZI A;  4U0U A;  5J08 A;  3D9L A;  3AJI A;  3ONL A;  2DBA A;  4I2Z A;  4CYM D;  3TWX A;  2CFU A;  2RKK A;  3KSL A;  1XGW A;  1E8Y A;  3TGO A;  5JMN D;  3LJN A;  3ABM E;  3CST A;  1H2V C;  3CHO A;  2FO7 A;  1UG3 A;  4FHK A;  3BUA A;  2FEZ A;  4ME2 A;  4L23 A;  3E32 A;  4N5Q A;  1YCS B;  5BPP A;  3CHR A;  1N4Q A;  2A4Z A;  3B7S A;  1PAQ A;  3CQG B;  2BF0 X;  1N9A A;  1NZN A;  4JL0 A;  5CEA A;  2J4B A;  4J8S A;  4TXR A;  4HOS A;  4GZD A;  4WAF A;  2OV8 A;  3P1U A;  1JCQ A;  2F37 A;  1JPL A;  4GA2 A;  3LPZ A;  4AOF A;  1D8D A;  4J7W A;  5KNH D;  3FTZ A;  1QYM A;  5BT1 A;  3IV0 A;  2VGE A;  4LUN U;  2E2E A;  4ZHB A;  3FUH A;  4JZY A;  3UUX A;  3PE4 A;  3FY4 A;  2UY1 A;  3TWW A;  1SVX A;  1G3N B;  3CQC B;  3HIZ A;  3EHN A;  4I2W A;  2XGO A;  4MLP A;  1P5Q A;  2BTD A;  4I6E A;  3FUJ A;  4BSX A;  1QNF A;  1N54 A;  2V4L A;  4CT4 A;  1V54 E;  1HZ4 A;  4R7L A;  3L16 A;  2OEW A;  4EPZ A;  3MEK A;  3ZYK A;  2BED A;  2XCC A;  3BEE A;  3CR3 A;  3MKR A;  2C2L A;  2ZXW E;  3FTU A;  3CVQ A;  2WM9 A;  1GW6 A;  4WWO A;  1N94 A;  1IXV A;  4FAD A;  3PEV B;  3PVL A;  2Y4U A;  1Y8M A;  2VTB B;  2X6K A;  2R2L A;  3TWT A;  4UWF A;  3UTM A;  3DSW A;  2XEE A;  2R5S A;  3FU6 A;  3FUM A;  3QNK A;  1MQS A;  2DZN A;  4JEU A;  2X6J A;  3CK9 A;  3T8K A;  3NZS A;  4NQ0 A;  3ZKJ A;  2HE0 A;  4GTS A;  5B3S E;  3LYA A;  5HRY A;  4WWP A;  4CDM A;  5ENR D;  1UJK A;  1FPP A;  4DUI A;  4GYO A;  5ENS D;  5ENN A;  2J07 A;  1EYH A;  5J90 A;  1NFI E;  3FUF A;  3C3O A;  1TNZ A;  5EX0 A;  5FT9 A;  3TWR A;  1K1B A;  4MBG A;  3QWW A;  3CKC A;  4F7A A;  2Y3A A;  1BD8 A;  1FVF A;  2I2O A;  1H2U A;  3RJV A;  4W9R A;  4AXH A;  2XCB A;  4BT8 A;  3CEQ A;  2WB2 A;  5AYW D;  3ABK E;  4O1O A;  3Q49 B;  5JJT A;  1Z3Y A;  1OWN A;  4OAV B;  4CEM A;  2X6I A;  3HXD A;  4J8F A;  3FH7 A;  3FEY A;  3LVR E;  3QKY A;  5EKQ D;  1N0Q A;  3C98 A;  5G05 C;  1N0R A;  2RG8 A;  4GMJ A;  4U7E B;  4ACL A;  1BI8 B;  4WND A;  3CHP A;  1Z5S C;  4BX9 A;  3CVY A;  4XIF A;  5M72 A;  4A1S A;  3UT4 A;  1KZO A;  3FUI A;  2NC9 A;  5CMW A;  2XGS A;  2L6B A;  1VDY A;  4IUL A;  1S70 B;  2IJG X;  1X81 A;  5BXO A;  1DCQ A;  4GZ6 A;  2P9K G;  2CHZ A;  3DSX A;  4UQX A;  3APF A;  5LX8 A;  4Q69 A;  5BV1 A;  2A5E A;  4C9B B;  4TXQ A;  3Q5M A;  1OCO E;  5AIJ A;  4CGV A;  4HOR A;  2V0P A;  5T3R A;  2XPZ A;  4HB5 A;  2ZIR A;  1K8K G;  4UWK A;  4PDX A;  4LNB A;  2KZT B;  5T8I A;  4UWG A;  2VSX E;  3EU5 A;  3PNL B;  3X2Q E;  2QC9 A;  3PUK A;  2VSY A;  4FUL A;  3ULY A;  4CT0 A;  2AXZ A;  3HVE A;  4GCN A;  3UT8 A;  3U4T A;  1E7V A;  5KWD A;  1KZP A;  3DSS A;  4PS8 A;  4JPS A;  2IOL A;  3C72 A;  1U3C A;  4PH4 B;  3LY7 A;  2J4D A;  2KM4 A;  5EYP F;  2F8Y A;  5ARF A;  2R05 A;  3G2T A;  3EHQ A;  5FQ6 A;  2WVI A;  2WXQ A;  4AY6 A;  2IU1 A;  3FU5 A;  1H6O A;  2WXN A;  2ETB A;  3OXG A;  3G2U A;  1E7U A;  4GU5 A;  2LO6 A;  2KCK A;  5FZQ A;  5LCW J;  3O4Z A;  3ASO E;  4G11 A;  4GAA A;  2P9P G;  3DSV A;  4C0E A;  1A5E A;  3TL5 A;  5KJK A;  1O1T A;  5JA4 D;  1KT0 A;  4LG6 A;  2QYJ A;  1O5M A;  4GA1 A;  5JJ6 A;  4HRL A;  1FT1 A;  3Q79 A;  3MV2 B;  3RU0 A;  1ZU2 A;  4BET A;  4M7C A;  2GRM A;  3AG1 E;  3HYM B;  2J08 A;  3EU9 A;  1UJJ A;  1JUQ A;  2IO3 C;  4KYO B;  4GTT A;  3PZ2 A;  2L0I A;  1IKN D;  4HOQ A;  4ILG A;  4UWH A;  3TG5 A;  4RLY A;  3D9O A;  2VJ8 A;  1E96 B;  3UKU G;  4G8L A;  4G1T A;  4N2S A;  2B0O E;  2VSO E;  1SQM A;  1TEZ A;  1UN9 A;  3ESK A;  3IKO B;  3S7J A;  2R02 A;  4JA9 A;  3KD7 A;  5FIO A;  4I6J A;  2WXO A;  3FHE A;  3L22 A;  4DK5 A;  3NOC D;  4JD2 G;  2RFM A;  3SF4 A;  4I43 A;  4XZ4 A;  4U8V D;  2GRR B;  5C1D A;  1H19 A;  4GML A;  4JEH A;  4B8A A;  1MX6 A;  3ZN3 A;  3D9H A;  1EDU A;  3NOG D;  2XEV A;  2FO1 E;  4H7Y A;  3ASF A;  4RSY A;  3UPV A;  4U8H A;  2P9N G;  4B8C B;  3UM1 A;  3QK0 A;  3R9M A;  3U66 A;  3Q15 A;  2WXG A;  1H6P A;  3LKU A;  4U95 D;  4ATG A;  1TNU A;  3RRU A;  3FUL A;  3QC1 A;  3CVL A;  3TXN A;  5H7P A;  5ENT D;  4F53 A;  4I17 A;  4ANU A;  3DEP A;  4L1B A;  1E90 A;  2WXJ A;  2LXL A;  4Y6W A;  3WXX A;  2DIW A;  5KNG A;  3SD5 A;  2WXM A;  2R03 A;  1NP7 A;  3FTX A;  2Y0B G;  4E85 A;  5DBK A;  3IEG A;  2AW6 A;  3LEW A;  4YDY A;  3SBT B;  4K5A B;  1OXJ A;  5FQ7 A;  3ML8 A;  4GPK A;  3PZ1 A;  2XHE A;  4FLH A;  3ZPJ A;  4TUU A;  2OEV A;  5D0Q D;  4OAU C;  4OYS A;  5T4Y A;  2ZIS A;  2BKG A;  5BW8 C;  4IYP A;  3AU5 A;  3UM0 A;  1QBQ A;  3PZD A;  3ZNG A;  2AXU A;  4LNG A;  3ZHE B;  5CMY A;  4XE0 A;  4FC8 A;  2J09 A;  2FF4 A;  3VLF A;  2LAH A;  4WNG A;  3NB2 A;  2VTB A;  3ZRH A;  3QJZ A;  1WDY A;  3NZU A;  4D10 C;  4BER A;  4XEI G;  1MJ0 A;  3AS4 A;  2WXP A;  4FP7 A;  2OND A;  4TV3 A;  4EEC A;  4WWN A;  4DX5 D;  5FQ8 A;  4XKB A;  3ZYM A;  1KLX A;  4N5C A;  5ANL A;  5LFA A;  1TR4 A;  2B6C A;  4JXT A;  4MS6 A;  3RAU A;  4A1G A;  2H6I A;  5EID A;  5B1A E;  3UIN C;  2ION A;  3SFY A;  3LY9 A;  1A17 A;  3PDN A;  3WG7 E;  4U04 A;  3ULQ A;  3GZ2 A;  3PRE A;  4KVO A;  3Q9N C;  5JJ7 A;  4A63 B;  2J9Q A;  3LXU X;  4AY5 A;  2BKK B;  2VYI A;  4J8Y A;  5CCL A;  2L0T B;  2RD0 A;  2CHW A;  4WNF A;  2QYU A;  4WNE A;  1PY1 A;  2ILR A;  3HXB A;  1DVP A;  3MV3 B;  1ELK A;  3OXL A;  1DCE A;  5HI7 A;  4KXK B;  4TXP A;  3D9P A;  5ANR A;  5FTP A;  3LDZ A;  1HU3 A;  4ANV A;  3I3N A;  3T5X A;  4XI9 A;  3VLD A;  2VGX A;  5HKP A;  3RKV A;  2KC7 A;  4FJZ A;  2P9U G;  5AAO A;  3MKQ B;  5E76 A;  5CED B;  3DPD A;  2MRI A;  1JWF A;  3PRZ A;  1RZ4 A;  3TWV A;  1U2V G;  2ZGG A;  3DSU A;  4NRH B;  2P9S G;  3T9K A;  1HH8 A;  1N4P A;  3T5V A;  3W9G A;  5CBN A;  5E75 A;  3ESL A;  3UKR G;  2LSV A;  3JYS A;  3U3W A;  3NF1 A;  3ML9 A;  5AQA A;  4U07 A;  2WQH A;  3AS8 A;  4HI8 A;  4UWL A;  2YQ8 A;  3JQ1 A;  4Z68 A;  3CVW A;  2DWZ A;  2AJA A;  4N3B A;  3U64 A;  3CGH A;  2PQR A;  1TYQ G;  3B7B A;  4OVU A;  4UI9 K;  5D66 A;  3CLJ A;  3APC A;  3N71 A;  2FBN A;  4BTB A;  2RFA A;  4GTV A;  1FVH A;  1HE8 A;  1LTX A;  4J8E A;  2EIK E;  2CHX A;  4DX7 D;  3JXI A;  2UY1 B;  4FHJ A;  1Z3X A;  4HS2 A;  3CV0 A;  3L17 A;  3RSE G;  2EIJ E;  2L9B A;  2MOW A;  5KBA A;  3G2S A;  4LER A;  3SI5 A;  3KEZ A;  3VLE A;  3FUN A;  2EIM E;  2Y4T A;  5AQB A;  4URK A;  4BWR A;  3UIO C;  2XGM A;  3RK6 A;  3GZ1 A;  4I6G A;  3ZU7 B;  4AM9 A;  5BV0 A;  3CK8 A;  2GGF A;  3TWS A;  4DX2 A;  3CHS A;  2Y69 E;  3ONK A;  3SHF A;  1INZ A;  5CRV A;  4JHR A;  5EDS A;  3JCK C;  3L9T A;  5B1B E;  3OXF A;  1BPO A;  2AWI A;  5CCM A;  5ENQ D;  1TN6 A;  3D9J A;  1W3B A;  3TJP A;  4ANW A;  1QQE A;  4FA6 A;  1WY6 A;  1ELW A;  3CVU A;  2LXM A;  3DXM G;  4YDW A;  5G04 C;  2ETA A;  1TN7 A;  3Q78 A;  2C0M A;  5LCW C;  4GTO A;  3U9W A;  4EHM A;  1UOH A;  2XRY A;  1JCR A;  3IXE A;  3TWQ A;  4DX6 D;  2IQC A;  2X3M A;  4MRU A;  2QZA A;  4B0Z A;  2MHK A;  3ULE G;  1H2T C;  4CDR A;  4LRZ A;  1HFA A;  3I4R B;  3E4B A;  3SZ7 A;  2DYS E;  2EIL E;  2IFU A;  1AP7 A;  2KXP C;  3V30 A;  2GRQ B;  5ENP D;  3HXE A;  4HRN A;  4K0R A;  4RG6 A;  4GZ5 A;  3ASH A;  3R7Q A;  3UX4 A;  4G24 A;  3MYV A;  3DWL G;  4I9C A;  1ZBP A;  2LNI A;  4BX8 A;  3RRN B;  2V8S E;  2X38 A;  4AIF A;  3ZUV B;  3ASG A;  3FU3 A;  4PUC A;  3LCA A;  3I5P A;  5G04 J;  2DCP A;  2YHE A;  3AAA C;  4LNU D;  4L7T A;  3RRM B;  3TAX A;  4KMO A;  3Q73 A;  4Q94 A;  4QQI A;  5BUZ A;  1TNB A;  4WUY A;  2F0Y A;  5CHE E;  1Y6I A;  3S7F A;  4G23 A;  1OCC E;  4YDE A;  3FFL A;  1U3D A;  2CFZ A;  1YMP A;  3AG4 E;  3ISM C;  4RQI A;  3ZIM A;  2IO2 C;  4C48 B;  3RO2 A;  1JCS A;  5JHB A;  3FU0 A;  4BES A;  5FWQ A;  2XEN A;  1MX4 A;  4BEP A;  4HXI A;  2X6F A;  4KT6 B;  1NA0 A;  4G8K A;  3E37 A;  4EZJ A;  3HRA A;  3B95 A;  4HVB A;  4TRQ A;  4KBQ A;  1FT2 A;  1N4R A;  3SY2 A;  2J49 A;  2V4H C;  1HXI A;  1N11 A;  1ELR A;  3SBS A;  3PNT B;  4X8Q A;  3B7R L;  1IQU A;  2YNQ A;  5A7D B;  2OOE A;  3VTX A;  2HO1 A;  2JAB A;  4FLB A;  4B93 B;  1K3Z D;  3SFZ A;  3V31 A;  5JHA A;  2HYZ A;  2HM8 A;  1HG5 A;  3AU4 A;  3EDT B;  1IHB A;  3UMV A;  4BTA A;  3DEO A;  4YVQ C;  3DRA A;  5FJY A;  3ZYL A;  2Q7F A;  3OTN A;  3ZEF A;  3SGH A;  1BI7 B;  3CVX A;  3TG4 A;  4JB8 P;  2WMN A;  5ARG A;  3GZS A;  4DX1 A;  1S0P A;  3R7R A;  4BFR A;  2E0I A;  3DPY A;  2V5F A;  3QAR A;  1SW6 A;  1V55 E;  4GZC A;  1MX2 A;  3D9K A;  4DLQ A;  4N2Q A;  5AJL A;  3T8M A;  4DPR A;  4U8Y D;  3J5Q B;  3CVP A;  3S2A A;  4AV7 A;  2AXV A;  3VTY A;  2J8S D;  3QDN A;  2KBX A;  2GRL A;  4GMR A;  4LEU A;  1RW2 A;  1H6K A;  3FUK A;  2P2C P;  4DI4 A;  1YYH A;  4XI0 A;  2XRZ A;  5HQ8 A;  4APF A;  4EBA A;  3RIB A;  2DVW A;  5BNW A;  5BXU A;  3QOU A;  3TXM A;  4O1P A;  1NL4 A;  1OCZ E;  2VQ2 A;  1SA4 A;  2WMO A;  4JHK A;  4GTP A;  3L6A A;  2XQ0 A;  4UI9 J;  1OWM A;  3G2V A;  3QWV A;  3HXF A;  3ABL E;  5FZS A;  3MA5 A;  1ZB1 A;  1DNP A;  3KSQ A;  4U96 D;  3FWV A;  3B7U X;  4M3O A;  1OWP A;  4AEZ C;  4DI3 A;  5A23 A;  4KVM A;  3D9I A;  4ILH B;  3IHY A;  5AEN A;  4ILI A;  1Z6T A;  3B7T A;  3UIP C;  3MKQ A;  4L2L A;  3ZXP A;  3PZ3 A;  1S64 A;  2OVB A;  2GW1 A;  2LAI A;  4G25 A;  5FQ4 A;  2GRO B;  4KZC A;  3F6Q A;  3PH0 C;  5AQ7 A;  4GPM A;  1OUV A;  2X6H A;  3LY8 A;  5C2Y A;  4DRX E;  3O48 A;  5IY5 E;  3KS2 A;  2ZGD A;  5D0O D;  3GYZ A;  4QFV A;  3ASN E;  4AJW A;  1WAO 1;  4JA7 A;  2R59 A;  4UUC A;  3CIA A;  2LSU A;  3QB2 A;  4U63 A;  4GZ3 A;  1H0A A;  1N52 A;  3D9M A;  4ABN A;  3APD A;  3HDX A;  4O60 A;  3HXC A;  4E6H A;  4HNA D;  3DST A;  4NIK A;  2Y1L E;  3Q7A A;  4GB9 A;  4JVS A;  2EQX A;  2OCC E;  4HOT A;  2WQ7 A;  2NSZ A;  1AWC B;  4L9P A;  4MKT A;  2PNN A;  4LSZ E;  4JC8 A;  4K5B A;  3URZ A;  4BSZ B;  2DYR E;  3BU8 A;  1OCR E;  1HX8 A;  5G55 A;  1HG2 A;  4G26 A;  3JUE A;  4A3V A;  5AJD A;  4AVX A;  3CSF A;  2CG2 A;  1IHG A;  2P9L G;  3E33 A;  4N3C A;  2M63 A;  4EQF A;  4ZFH A;  3W9F A;  1SA5 A;  1TJF A;  4RG9 A;  3ZW3 A;  3OAW A;  2ETC A;  5AAR A;  3IBE A;  1NA3 A;  3HG0 D;  3PE3 A;  5G2N A;  3Q47 B;  2MYO A;  1MZC A;  3E30 A;  3UM3 A;  3EHR A;  4JHJ A;  3PUJ A;  1SZA A;  4DJA A;  1TNY A;  3FDH A;  2XS1 A;  3Q9U C;  3UT7 A;  1DC2 A;  2JEK A;  3BG1 B;  1TN8 A;  4PS3 A;  4YDO A;  3B13 A;  2I1J A;  3FP3 A;  1WM5 A;  5EN5 D;  2EIN E;  2I1K A;  3L82 A;  2JLB A;  4RVB A;  2KZT A;  1EPU A;  3BG0 B;  2PL2 A;  2NYJ A;  3Q4A B;  4C0M A;  1IYG A;  4LCT A;  4EBA G;  4CZ2 D;  2XZT G;  3RO3 A;  5KJN A;  3ZGQ A;  3CKB A;  2H6G A;  4UQZ A;  4HRM B;  2XPI A;  3UM2 A;  4YVO A;  5KJL A;  3CHM A;  4I1O B;  4IN3 B;  2KCL A;  1LD7 A;  4FU3 A;  2VGX B;  1TJC A;  2A5U A;  3LJ3 A;  2BUG A;  2XS8 A;  1N4S A;  2V5Q C;  3SQV A;  2UWJ G;  3ENE A;  3HHM A;  4EZK A;  2LUH A;  4ANX A;  3EIQ C;  4GYY A;  4I1A A;  2WQ6 A;  4BY6 A;  4UQY A;  4GCO A;  3CVN A;  3MJW A;  4A3T A;  4GTM A;  2QY7 A;  1UN8 A;  5LOZ A;  1E8X A;  3EHM A;  5AQ9 A;  2IF4 A;  4HI9 A;  3DXK G;  1YA0 A;  4GTR A;  4GA0 A;  2PQN A;  4B94 A;  4F3V A;  4F1S A;  4HLL A;  2XZD G;  4OVV A;  2GRP B;  3BQO A;  2NXP A;  4HFG A;  3E34 A;  2L6J A;  4CGW A;  2YHC A;  3G2W A;  2AVP A;  2XEH A;  4DLO A;  3PEU B;  3MCX A;  3J5P A;  3L08 A;  5LP0 A;  2QFC A;  3MZL B;  3C3R A;  2P9I G;  2PM6 A;  1L5J A;  5HS0 A;  4J6I A;  3MGB A;  4FJY A;  1LF8 A;  5CBO A;  5D2M C;  5G05 J;  2DZO A;  4JW1 A; 
#chains in the Genus database with same CATH homology
 4WWP A;  5FJY A;  1QZ2 A;  2J09 A;  4FC8 A;  4CDM A;  1SZ9 A;  2FF4 A;  4U0S A;  2LAH A;  1UJK A;  2KCV A;  2WXL A;  4WNG A;  4O6F A;  3VLF A;  4GYO A;  3ZYL A;  2Q7F A;  3OTN A;  2VTB A;  3ZRH A;  3ZEF A;  3QJZ A;  2R17 C;  5ENN A;  2J07 A;  3NZU A;  4G2V A;  1EYH A;  3SGH A;  4D10 C;  5J90 A;  3FUF A;  4V3I A;  3AS4 A;  2WXP A;  3CVX A;  3TG4 A;  2WMN A;  2OND A;  4FP7 A;  4TV3 A;  4EEC A;  5EX0 A;  5FT9 A;  5ARG A;  3FH8 A;  3GZS A;  3CVV A;  1FCH A;  4Q96 A;  4WWN A;  1S0P A;  3QWW A;  3CKC A;  5FQ8 A;  4XKB A;  3ZYM A;  4AP2 A;  4F7A A;  3R7R A;  1KLX A;  2WXI A;  2Y3A A;  3I4G A;  4BFR A;  2E0I A;  4N5C A;  5ANL A;  5LFA A;  4JXT A;  4MS6 A;  1FVF A;  2I2O A;  2V5F A;  4A1G A;  3QAR A;  3R9A B;  1H2U A;  4GZC A;  2ION A;  2HR2 A;  3LY9 A;  3D9K A;  1A17 A;  3PDN A;  4DLQ A;  4U04 A;  4N2Q A;  3RJV A;  3ULQ A;  3GZ2 A;  3PRE A;  4W9R A;  5AJL A;  4AXH A;  1OWO A;  2XCB A;  3T8M A;  4I9E A;  4BT8 A;  3CEQ A;  4GYW A;  4DPR A;  5AYW D;  4J0U A;  4KVO A;  2WB2 A;  2KAT A;  3CVP A;  5JJ7 A;  3S2A A;  4AV7 A;  3Q49 B;  2WXF A;  5JJT A;  2J9Q A;  3LXU X;  4EZL A;  1Z3Y A;  1OWN A;  2AXV A;  2VYI A;  3VTY A;  4AY5 A;  3FTV A;  4CEM A;  2X6I A;  5CCL A;  3QDN A;  4J8F A;  3AS5 A;  2L0T B;  3FH7 A;  2CG3 A;  2GRL A;  3FEY A;  3LVR E;  3QKY A;  5EKQ D;  3C98 A;  5G05 C;  2RG8 A;  4APO A;  4GMJ A;  4LEU A;  2RD0 A;  2CHW A;  4ACL A;  4WNF A;  3ZVV A;  4WNE A;  1H6K A;  3FUK A;  1PY1 A;  2PM7 A;  2WPV A;  2ILR A;  2WXR A;  4WND A;  3CHP A;  1DVP A;  4DI4 A;  4BX9 A;  5KJM A;  4K03 A;  3MV3 B;  1ELK A;  3OXL A;  3CVY A;  4XIF A;  5M72 A;  4XI0 A;  4A1S A;  3UT4 A;  2XRZ A;  5HQ8 A;  3FUI A;  2NC9 A;  5CMW A;  2XGS A;  5HI7 A;  4APF A;  4KXK B;  4L2Y A;  4EBA A;  3D9P A;  3RIB A;  3ZFW A;  5BNW A;  5ANR A;  3QOU A;  1VDY A;  5FTP A;  3LDZ A;  1KT1 A;  3TXM A;  1HU3 A;  4IUL A;  4ANV A;  3I3N A;  3T5X A;  3FH5 A;  4XI9 A;  2IJG X;  2FI7 A;  3VLD A;  2VGX A;  3RKV A;  2KC7 A;  2VQ2 A;  4B89 A;  4JHK A;  2WMO A;  4GZ6 A;  3EIJ A;  3D3M A;  4FJZ A;  2CHZ A;  3MKQ B;  5E76 A;  4UQX A;  3L6A A;  2VSN A;  3DPD A;  3APF A;  4CRW A;  2MRI A;  2XQ0 A;  5LX8 A;  4Q69 A;  5BV1 A;  1EF1 C;  1JWF A;  3PRZ A;  3L13 A;  4UI9 J;  3HVE B;  1OWM A;  1X5B A;  4N3A A;  4PS7 A;  3G2V A;  3QWV A;  4C9B B;  1JWG A;  5FZS A;  3S7B A;  3MA5 A;  4NRH B;  4XKC A;  3Q5M A;  5AIJ A;  4I1M A;  1DNP A;  4CGV A;  2V0P A;  4HOR A;  4Y6C A;  3LVQ E;  1HH8 A;  3T5V A;  1UW4 B;  5T3R A;  2XPZ A;  4UWK A;  3FWV A;  2WXH A;  4U0Z A;  3B7U X;  5E75 A;  4M3O A;  3ESL A;  2LSV A;  4PDX A;  2KZT B;  3JYS A;  5T8I A;  1OWP A;  3NF1 A;  3U3W A;  4AEZ C;  3ML9 A;  4DI3 A;  5A23 A;  4U07 A;  3SNX A;  2WQH A;  4KVM A;  3S7D A;  4UWG A;  3D9I A;  2VSX E;  1E8W A;  4H7X A;  3FUE A;  3PNL B;  1HO8 A;  3FEX A;  4ILH B;  3AS8 A;  3IHY A;  3PUK A;  4UWL A;  2YQ8 A;  3CHQ A;  3JQ1 A;  2VSY A;  4FUL A;  4CT0 A;  5AEN A;  1E8Z A;  3P2B A;  3CVW A;  4ILI A;  4XX5 A;  1Z6T A;  3B7T A;  2P58 C;  3MKQ A;  4L2L A;  4N3B A;  3U64 A;  1IQR A;  2OVB A;  2GW1 A;  2LAI A;  3CGH A;  2AXZ A;  3JUI A;  2PQR A;  3MX3 A;  3HVE A;  4G25 A;  4J8D A;  4KZC A;  5FQ4 A;  4GCN A;  5KCM A;  3ZXS A;  4HLE A;  3UT8 A;  3FTW A;  5A6C A;  4BT9 A;  3U4T A;  4NUR A;  4OVU A;  1E7V A;  3NQP A;  4UI9 K;  3CLJ A;  3PH0 C;  3APC A;  3N71 A;  4KZ0 A;  2FBN A;  4PS8 A;  3FTS A;  4BTB A;  1B89 A;  1OUV A;  1FVH A;  1HE8 A;  2X6H A;  3LY8 A;  5C2Y A;  4J8E A;  4JPS A;  2CHX A;  4UI9 C;  2IOL A;  3FUD A;  3O48 A;  1U3C A;  2UY1 B;  1HF8 A;  4PH4 B;  3KS2 A;  3LY7 A;  4FHJ A;  2J4D A;  1Z3X A;  3QAQ A;  5D0O D;  2KM4 A;  3JQ0 A;  3KAE A;  4HS2 A;  4IRU A;  3UQ3 A;  4ACK A;  2OVF A;  3CV0 A;  3GYZ A;  3L17 A;  4QFV A;  4A55 A;  5ARF A;  3G2T A;  1WAO 1;  4AJW A;  2WXK A;  2L9B A;  3ZHE A;  2I9C A;  5FQ6 A;  3GW4 A;  2WVI A;  2WXQ A;  4JA7 A;  4AY6 A;  2IU1 A;  2VGY A;  2MOW A;  2I6H A;  2R59 A;  3FU5 A;  3CIA A;  3G2S A;  4LER A;  4P29 A;  3KEZ A;  2WXN A;  3OXG A;  3SI5 A;  3G2U A;  2LSU A;  3VLE A;  3QB2 A;  1E7U A;  3D9N A;  4U63 A;  4GZ3 A;  3QWP A;  3PS6 A;  2FUL A;  1H0A A;  1N52 A;  1PC2 A;  3D9M A;  4ABN A;  3APD A;  3HDX A;  4NAC A;  3FUN A;  3CK7 A;  2LO6 A;  4GU5 A;  2Y4T A;  4E6H A;  2KCK A;  5FZQ A;  5LCW J;  3O4Z A;  4URK A;  4YND A;  4BWR A;  4N39 A;  2XGM A;  4G11 A;  4GAA A;  4HOU A;  5DIZ A;  3RK6 A;  2IOS A;  2C0L A;  3GZ1 A;  4C0E A;  4I6G A;  3TL5 A;  5KJK A;  4GB9 A;  4AM9 A;  4JVS A;  2XPY A;  2EQX A;  1KT0 A;  5BV0 A;  3CK8 A;  2GGF A;  4HOT A;  2WQ7 A;  3CHS A;  2NSZ A;  3ONK A;  4MKT A;  1MHQ A;  3SHF A;  1INZ A;  2YIN A;  4JC8 A;  4GA1 A;  3URZ A;  4CCA A;  4JHR A;  5JJ6 A;  3ZYQ A;  1HS6 A;  3MV2 B;  5EDS A;  3RU0 A;  1HX8 A;  1ZU2 A;  3ASD A;  3JCK C;  1XNF A;  5G55 A;  2GRM A;  1HG2 A;  1OWL A;  3OXF A;  3LS8 A;  4G26 A;  3HYM B;  1BPO A;  2AWI A;  5AJD A;  3DBS A;  4A3V A;  3L54 A;  4AVX A;  2J08 A;  3FTY A;  3EJN A;  4CDN A;  1UJJ A;  3CSF A;  2CG2 A;  3IHV A;  1JUQ A;  4KYO B;  5CCM A;  1IHG A;  5FZR A;  5EX3 A;  3K9I A;  3D9J A;  1W3B A;  4N3C A;  3TJP A;  2M63 A;  4ANW A;  1QQE A;  4EQF A;  4FA6 A;  1WY6 A;  2L0I A;  2ZU6 B;  1TJF A;  4HOQ A;  1ELW A;  3CVU A;  4ILG A;  4RG9 A;  4UWH A;  3TG5 A;  3D9O A;  2PZI A;  2VJ8 A;  4U0U A;  1E96 B;  5G04 C;  3ZW3 A;  5J08 A;  3D9L A;  4G1T A;  4N2S A;  3ONL A;  2C0M A;  3OAW A;  2DBA A;  5LCW C;  3IBE A;  2VSO E;  1SQM A;  4I2Z A;  3U9W A;  1TEZ A;  1NA3 A;  1UN9 A;  2XRY A;  3PE3 A;  3ESK A;  3IKO B;  5G2N A;  3Q47 B;  3S7J A;  2CFU A;  1XGW A;  2IQC A;  2X3M A;  4MRU A;  1E8Y A;  4JA9 A;  3TGO A;  4B0Z A;  2MHK A;  3KD7 A;  4JHJ A;  1H2T C;  3PUJ A;  4I6J A;  2WXO A;  3CST A;  3FHE A;  3L22 A;  4DK5 A;  1H2V C;  1SZA A;  4CDR A;  4DJA A;  3CHO A;  4LRZ A;  2FO7 A;  1UG3 A;  3FDH A;  1HFA A;  3SF4 A;  4FHK A;  3I4R B;  4I43 A;  3UT7 A;  4XZ4 A;  3E4B A;  2FEZ A;  2JEK A;  3BG1 B;  4ME2 A;  3SZ7 A;  4L23 A;  4PS3 A;  5C1D A;  1H19 A;  2IFU A;  3B13 A;  4GML A;  4JEH A;  2I1J A;  4B8A A;  3FP3 A;  1WM5 A;  2I1K A;  3ZN3 A;  5BPP A;  1EDU A;  3CHR A;  2JLB A;  4RVB A;  2KZT A;  2XEV A;  1EPU A;  3BG0 B;  4H7Y A;  2A4Z A;  3ASF A;  4K0R A;  4RSY A;  3UPV A;  4U8H A;  2PL2 A;  1PAQ A;  3B7S A;  4RG6 A;  4GZ5 A;  3CQG B;  3Q4A B;  2BF0 X;  4B8C B;  4C0M A;  1IYG A;  3ASH A;  3R7Q A;  3UX4 A;  3QK0 A;  4LCT A;  3U66 A;  1NZN A;  4EBA G;  3Q15 A;  2WXG A;  4JL0 A;  3LKU A;  2J4B A;  3RO3 A;  4J8S A;  5KJN A;  4G24 A;  3MYV A;  3ZGQ A;  4HOS A;  4GZD A;  1ZBP A;  3CKB A;  4I9C A;  4WAF A;  2LNI A;  4BX8 A;  2OV8 A;  3P1U A;  4UQZ A;  3RRN B;  4ATG A;  2XPI A;  2V8S E;  3RRU A;  2X38 A;  1JPL A;  4GA2 A;  4AIF A;  3ASG A;  3FU3 A;  3LPZ A;  4AOF A;  4PUC A;  3FUL A;  3LCA A;  3I5P A;  4YVO A;  5G04 J;  2DCP A;  2YHE A;  4L7T A;  3FTZ A;  3RRM B;  3TAX A;  5KJL A;  3CHM A;  4I1O B;  4IN3 B;  4KMO A;  2KCL A;  5BT1 A;  3IV0 A;  4FU3 A;  2VGX B;  3QC1 A;  3CVL A;  4Q94 A;  1TJC A;  2A5U A;  3LJ3 A;  2BUG A;  5BUZ A;  4LUN U;  2E2E A;  3TXN A;  3FUH A;  4WUY A;  4JZY A;  5CHE E;  3UUX A;  3PE4 A;  1Y6I A;  3FY4 A;  2UY1 A;  3S7F A;  4F53 A;  2UWJ G;  3ENE A;  4G23 A;  4I17 A;  3HHM A;  4ANU A;  4EZK A;  3FFL A;  4L1B A;  3CQC B;  4ANX A;  1E90 A;  3EIQ C;  3HIZ A;  1U3D A;  2CFZ A;  3EHN A;  4I2W A;  2XGO A;  2WXJ A;  4Y6W A;  4GYY A;  4I1A A;  4MLP A;  3WXX A;  2WQ6 A;  1P5Q A;  4BY6 A;  2DIW A;  2BTD A;  4I6E A;  3FUJ A;  3ZIM A;  4BSX A;  1QNF A;  1N54 A;  2V4L A;  3SD5 A;  2WXM A;  4CT4 A;  3RO2 A;  1HZ4 A;  4UQY A;  4GCO A;  4R7L A;  3L16 A;  5JHB A;  3CVN A;  1NP7 A;  3MJW A;  3FU0 A;  4A3T A;  4EPZ A;  3FTX A;  3MEK A;  4E85 A;  2QY7 A;  5FWQ A;  1UN8 A;  5LOZ A;  5DBK A;  3IEG A;  3ZYK A;  2XCC A;  2AW6 A;  3BEE A;  3CR3 A;  3MKR A;  1E8X A;  3LEW A;  2C2L A;  3SBT B;  3FTU A;  3CVQ A;  4HXI A;  3EHM A;  2X6F A;  2WM9 A;  1GW6 A;  4KT6 B;  4WWO A;  5FQ7 A;  1NA0 A;  4FAD A;  3ML8 A;  3PEV B;  3PVL A;  4GPK A;  2Y4U A;  1Y8M A;  2IF4 A;  2XHE A;  4FLH A;  1YA0 A;  2VTB B;  3ZPJ A;  4GA0 A;  4EZJ A;  4HVB A;  2X6K A;  2PQN A;  4TRQ A;  4B94 A;  4KBQ A;  4F3V A;  4F1S A;  2J49 A;  4OVV A;  4TUU A;  4UWF A;  1HXI A;  2NXP A;  1ELR A;  4HFG A;  3SBS A;  2L6J A;  3PNT B;  2R5S A;  3FU6 A;  4CGW A;  3B7R L;  1IQU A;  3FUM A;  2YHC A;  3QNK A;  2YNQ A;  5D0Q D;  2OOE A;  3G2W A;  2AVP A;  5A7D B;  4OYS A;  2HO1 A;  5T4Y A;  3VTX A;  4DLO A;  3PEU B;  5BW8 C;  1MQS A;  3MCX A;  4IYP A;  2X6J A;  4JEU A;  3L08 A;  5LP0 A;  3CK9 A;  3AU5 A;  4FLB A;  3SFZ A;  2QFC A;  3MZL B;  2HYZ A;  5JHA A;  3PZD A;  2AXU A;  2PM6 A;  1L5J A;  2HM8 A;  4J6I A;  1HG5 A;  3MGB A;  4FJY A;  1LF8 A;  3AU4 A;  3EDT B;  3NZS A;  4NQ0 A;  3ZHE B;  5G05 J;  5CMY A;  3UMV A;  3LYA A;  4BTA A;  4JW1 A;  4XE0 A;  4YVQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...