3Q4AB

Crystal structure of the tpr domain of chip complexed with phosphorylated smad1 peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
132
structure length
132
Chain Sequence
SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism of the Negative Regulation of Smad1/5 Protein by Carboxyl Terminus of Hsc70-interacting Protein (CHIP).
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/transcription
molecule keywords STIP1 homology and U box-containing protein 1
total genus 54
structure length 132
sequence length 132
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3q4aB00
4J8FA 3NF1A 4RG6A 4W9RA 4YVOA 2PL2A 3HYMB 5G05J 4CGVA 4N2SA 3JYSA 3K9IA 2DBAA 2VQ2A 2XCBA 5LCWJ 5EX3A 2Q7FA 2FBNA 2XGMA 2VYIA 4KXKB 2XEVA 3SZ7A 4BTBA 4J8EA 5CCMA 2PQRA 1ZU2A 2V5FA 3U4TA 4G24A 1ZBPA 4AY5A 2VSNA 5LCWC 5FZRA 1TJCA 4JL0A 1IYGA 2MHKA 5G04C 2P58C 2XPIA 3ESKA 3LKUA 4J0UA 4IN3B 4WNDA 4HOUA 4WUYA 4G23A 3PE4A 4N3AA 4O6FA 2FI7A 2NC9A 3AS8A 5JJTA 3Q5MA 4UI9K 4HOSA 4Y6WA 2KCVA 3PE3A 4U07A 3TAXA 3MV3B 4G25A 5ARGA 4G1TA 4I17A 4I1AA 3Q49B 4U0ZA 4AY6A 3OXLA 2UWJG 3RKVA 4B94A 1HZ4A 3R9AB 3S7BA 3MV2B 3CVLA 3S7FA 4WNGA 5G04J 3VTXA 2C0LA 3ASHA 1KLXA 4N39A 3RIBA 4BT8A 4CGWA 2Y4TA 3CV0A 3S7DA 2KCLA 4JHRA 1IHGA 4GA0A 3O48A 4EQFA 4GYYA 4NQ0A 5KJMA 3CKCA 4GZ6A 4APOA 3KD7A 2PZIA 5D0OD 3OXGA 1FCHA 2C0MA 2HYZA 3ASFA 1QZ2A 3FP3A 3Q15A 2E2EA 3QWPA 2VGXA 2UY1A 3AS4A 3BEEA 3MKRA 4JA9A 4UQZA 5ARFA 2BUGA 4WNFA 3GW4A 1HH8A 3MA5A 5HI7A 1ELWA 2WQHA 3QOUA 2GW1A 4NRHB 3RU0A 3ULQA 1NA3A 4GPKA 4GA1A 4G26A 3LY7A 5DIZA 5FZSA 4GYOA 3KS2A 2KC7A 3ASGA 2IF4A 2KCKA 3GZ2A 4U0SA 5FTPA 2FO7A 4I2ZA 4LEUA 4XI0A 2OOEA 3CVQA 3TG4A 4GCNA 4JA7A 2HO1A 3MEKA 4UI9C 3QKYA 5EX0A 4N3CA 3UUXA 2XGOA 3ZN3A 2PQNA 1WM5A 1Y8MA 3ZHEA 5KJNA 4HOTA 1PC2A 4GA2A 4N5CA 3QDNA 2XCCA 5KJKA 3CKBA 1A17A 3TGOA 3ZGQA 2L6JA 3GZ1A 3QWWA 5C1DA 3Q4AB 5EKQD 3LY9A 1OUVA 3QWVA 3RJVA 1ELRA 4YNDA 3RO3A 3RO2A 3TG5A 4F3VA 5KJLA 4G2VA 2KATA 4BTAA 2VGYA 4UI9J 2I6HA 4ABNA 4HOQA 2VSYA 4GZ5A 1HXIA 1E96B 2FF4A 2C2LA 5FT9A 3LY8A 5HQ8A 3ZHEB 5A6CA 3LCAA 2R5SA 4U04A 3FFLA 4XI9A 4KBQA 5AYWD 3AS5A 4N3BA 2LSUA 3OXFA 3URZA 1YA0A 1QQEA 4YVQC 3VTYA 1XNFA 3ZFWA 1P5QA 4WNEA 3E4BA 5BT1A 5A7DB 2UY1B 4RG9A 5JJ7A 3WXXA 4AIFA 1NA0A 3LPZA 3Q47B 4GZ3A 3ZPJA 1WAO1 3KAEA 4H7XA 4AM9A 4GYWA 1B89A 5D0QD 4BT9A 4I2WA 1KT1A 5FZQA 3U3WA 3LYAA 3GYZA 2Y4UA 3PDNA 3CEQA 4H7YA 4I9CA 2AVPA 2YQ8A 3N71A 2VGXB 5CCLA 2HR2A 5FJYA 1NZNA 2LSVA 3FWVA 4U0UA 3IEGA 3CK7A 2FEZA 1KT0A 5BNWA 3SF4A 5CHEE 5G05C 5M72A 2IFUA 2YHCA 3CK8A 4GCOA 2J9QA 4J8DA 4KYOB 5JJ6A 5BW8C 3UPVA 1W3BA 2QFCA 2XGSA 4I9EA 3S7JA 4ME2A 3CK9A 2WPVA 4UQXA 2ONDA 4Y6CA 2LNIA 4A1SA 2JLBA 3EDTB 3ASDA 4UQYA 4CDRA 4N2QA 5DBKA 4BWRA 3UQ3A 4HORA 3CVPA 3CVNA 4XIFA
chains in the Genus database with same CATH superfamily
3HXEA 4MLPA 3FEXA 5BPPA 2DBAA 3SZ7A 2EINE 3CR3A 1X81A 4JVSA 1ZBPA 2E0IA 1TJCA 3AG3E 4JL0A 1IYGA 4GTVA 4JEHA 3S2AA 3PH0C 4N3AA 2LXMA 4U07A 3G2WA 3J5QB 2DZNA 1S63A 2WXOA 2WXNA 4LCTA 3D9MA 3EU9A 1IHGA 4DUIA 2C0MA 2AXVA 1N11A 3MA5A 3C72A 5CMYA 1BI7B 2ZISA 4J7WA 3NZUA 1OWOA 2L9BA 3CHMA 3FY4A 2EIKE 3W9GA 2WXJA 4ILGA 1OT8A 3DEOA 4HRMB 3LY9A 3RO2A 2XZDG 3TG5A 3UT4A 5IY5E 2KATA 5CBOA 5CECB 3FH8A 2Y1LE 3L54A 3FTXA 4KBQA 4CCAA 4C48B 1K8KG 5EILA 5BT1A 1JPLA 3WXXA 3FUMA 4GTTA 3TXNA 3FUIA 2AVPA 5E76A 3W9FA 4CZ2D 1KT0A 1N0QA 2YHCA 3CK8A 5BW8C 1W3BA 1V55E 3ASDA 3VLFA 3RRMB 3DPYA 3I4RB 3ABME 4U8HA 3DPDA 3HYMB 4DX7D 4N2SA 4BEPA 5B3SE 1DNPA 4HI9A 1RW2A 3CVXA 3V30A 2MOWA 3IV0A 3KEAA 4WUYA 3ASOE 1ELKA 4Y6WA 4HBDA 1WDYA 1E8YA 4JEUA 2WQ7A 2F8YA 1BD8A 3FTUA 3R9MA 1N4PA 3IHYA 3UINC 1Z5SC 4PS8A 5KJMA 5FJYA 4CT4A 1INZA 3TXMA 3PZ3A 4BY6A 2V8SE 3IXEA 2WQHA 2X6IA 4GPKA 4GA1A 1WY6A 3CSFA 2XEHA 5A23A 3TG4A 3CHRA 4GPMA 2J07A 3UM3A 2XCCA 1A17A 3TGOA 3FH5A 3ZGQA 2I9CA 3CVWA 3GZ1A 3QWWA 5C1DA 4NURA 3CHPA 3Q4AB 4F3VA 3LVQE 3DSWA 5KJLA 2AWIA 2C2LA 3LY8A 1IHBA 2IO3C 4U04A 3FFLA 3E30A 3OXFA 3CVVA 3NAWA 3KAEA 1MHQA 1OWNA 4QQIA 2I2OA 3JCKC 4U8VD 2FEZA 5H7PA 2LXLA 2DWZA 3HXCA 4I6EA 3ISMC 2XGSA 3HG0D 3NOCD 4J8YA 4Y6CA 1KZPA 3SHFA 1H6KA 4TV3A 3FUEA 1E7VA 4ANWA 3EUVA 4O1PA 5G05J 2VQ2A 5EX3A 4KXKB 2V5FA 3U4TA 3MX3A 3JUIA 5CMWA 3TWQA 1S0PA 3ESKA 4AJWA 3TWSA 1H19A 3PE3A 3PUKA 4AY6A 3OXLA 2UWJG 2OVBA 3S7BA 3C98A 2C0LA 3ZNGA 1DC2A 4XEIG 4JHRA 4EQFA 4FJZA 2H6FA 3SGHA 1H2TC 3PREA 4KT6B 2MRIA 1EF1C 3D9LA 2HYZA 3HVEA 5DIZA 3DEPA 3HDXA 4WNFA 4BETA 3PEVB 2CHZA 4DI4A 4A3TA 2VSXE 3MEKA 4BESA 4HLEA 2XGOA 3ZRHA 3UMVA 4N5CA 1K1AA 2GROB 4A55A 3QWVA 3RO3A 3FTVA 4EBAA 2VGYA 2P9KG 1D9SA 1L5JA 2CFUA 1P5QA 3EU5A 5JJ7A 4AM9A 2WMNA 5EYPF 2R02A 3V79K 2RFAA 4I9CA 3N71A 1SZ9A 2VGXB 3CHSA 5CRVA 2WM9A 5JMND 3IEGA 3UKRG 3D9NA 4HOTA 5G05C 2WXQA 5EYLA 1EDUA 2LAIA 4ME2A 2LNIA 4A1SA 4EHMA 3UKUG 5T4YA 1S64A 3CVPA 3CVNA 3PZ2A 2IU1A 3D9KA 2XS8A 2WXRA 1HO8A 3EHMA 3ZYQA 3CHOA 1SVXA 3AS8A 4AV7A 3Q5MA 5ENNA 2P9PG 5ARGA 3AU5A 4U7EB 4BERA 4L2LA 4WNGA 3CIAA 3TWWA 2GRNB 3R7QA 3O4ZA 1HH8A 2GW1A 3JXJA 2QYUA 3KSLA 2YNQA 5AQBA 1Z3XA 4DI3A 1Y8MA 1JWFA 4HXIA 4J6IA 3V31A 4LNBA 3IBEA 2OVFA 4ABNA 5FT9A 5HQ8A 5A6CA 4XI9A 4N3BA 1QQEA 2XEEA 2PNNA 3B13A 1E8XA 2IJGX 4AIFA 1NA0A 1E7UA 4OAUC 3BG0B 3NZSA 4D10C 2ETBA 1NZNA 5EIBE 2LSVA 1H2VC 1HX8A 3EJNA 2OCCE 4KYOB 4ANUA 2QZAA 2ONDA 2BEDA 3D9HA 5DBKA 3IKOB 4RG6A 3QC1A 4KVMA 3JYSA 4UUCA 1TEZA 2JEKA 3JXIA 2XPZA 2WXPA 1TNOA 1YYHA 5AJLA 2YINA 1SZAA 4U0ZA 3BQOA 1H0AA 3DXKG 1KLXA 4TXQA 4GMLA 5KBAA 4RLYA 1FPPA 4UQZA 3BEEA 4I6GA 4HNAD 3FUNA 4M7CA 4HVBA 2CHWA 3ULEG 1Z6TA 5KCMA 2KC7A 3KSQA 3KEZA 4UWLA 2B6CA 4MKTA 2P9IG 3SNXA 3QDNA 1AWCB 3CKBA 1IQUA 4G8KA 1OUVA 2JABA 3RJVA 3C3RA 4U63A 5J08A 1YA0A 5T8IA 4F6RD 2AW6A 1N4SA 1HG2A 3DSTA 5KWDA 5FIOA 4F53A 4B8AA 3J5PA 4GTOA 4F1SA 4GTQA 3ZXPA 4URKA 1BU9A 2HM8A 4DK5A 3UM0A 2AXZA 3PRZA 2H6IA 4L23A 4B8CB 2XCBA 2FBNA 2XS1A 4UWKA 1OCCE 4C0EA 3PS6A 2GRPB 4DPRA 4F1PA 5AN8A 5G04C 5CBNA 5FQ8A 3NOGD 4IN3B 3QJZA 3ZYMA 2V0PA 1HG5A 4G25A 4K03A 3HIZA 5ENOD 1U3CA 2KXPC 4NQ0A 3RSEG 4JXTA 4V3IA 3MKRA 5EDSA 4YDWA 1UJKA 1TNYA 5LFAA 3G2UA 1Z3YA 4JZYA 2FO7A 4O60A 2KBXA 2A5UA 2ZXWE 3FU3A 3CSTA 3UT8A 5ANRA 5AQ9A 1OXJA 4UI9J 1SA5A 1EYHA 3CHQA 3FDHA 4FLBA 3FTZA 3B7UX 1UW4B 5LOZA 4TXPA 4GYWA 5D0QD 3U3WA 4HQDA 1N0RA 2P9LG 3DRAA 3AG1E 3ULYA 2J9QA 4PS7A 1V54E 4CDRA 1SA4A 4FADA 1QBQA 3JUEA 2KZTA 4XKCA 4B93B 3SFZA 3MJWA 1TJFA 4A63B 2CFZA 3TWXA 2XEVA 4TUMA 3D9OA 4GTMA 1FVFA 3DSVA 4BSXA 4CEMA 2VTBB 4WNDA 2L0IA 1N95A 2PM6A 4I17A 3Q49B 2EIME 3RKVA 4B94A 3R9AB 5AIJA 4CGWA 3P1UA 4LSZE 2J8SD 5T3RA 3BG1B 4BWRA 2RFMA 4LG6A 2J09A 2IF4A 3LJ3A 4B0ZA 5J90A 2OOEA 2J08A 2Y3AA 3BU8A 4N3CA 2PQNA 4I1OB 4J8SA 4LNUD 2XHEA 3ZUVB 3VLEA 4G2VA 4HOQA 4DJAA 4XX5A 3ZHEB 3T9KA 5AYWD 2GRLA 4HS2A 4WNEA 3CLJA 4GZDA 1TN6A 3FTYA 4EBAG 5FZQA 4ZHBA 3LYAA 3QB2A 3UT7A 3D9PA 2HR2A 4U0UA 4C9BB 4K0RA 2QFCA 2WPVA 4JC8A 3PVLA 4N2QA 1E8ZA 3TWUA 2WVIA 4FHKA 4W9RA 3CVUA 4YVOA 2PL2A 3L17A 4PUCA 4FP7A 3HRAA 2XPYA 3Q9NC 4CT0A 3QARA 2B0OE 3LVRE 2X6KA 1ZU2A 3QNKA 5FZRA 4XKBA 4MBGA 5G55A 3CVYA 2RG8A 4N39A 2ZU6B 2F0YA 3PZDA 3ZN3A 3FP3A 4JPSA 5CCMA 1GW6A 2BUGA 1Q2ZA 1X5BA 5HI7A 5FZSA 1VDYA 4I2ZA 3AG4E 4Q94A 3UUXA 3QKYA 2DZOA 1MQSA 3B7SA 3FU0A 3NQPA 3MKQB 1JCQA 2I6HA 1HFAA 1HU3A 3L16A 3ASNE 5A7DB 3GZSA 4GZ3A 1LD8A 3Q9UC 1FT2A 3PZ4A 5LP0A 3V2XA 3G2SA 3E34A 5HRYA 5BNWA 4J8DA 4HLLA 3VLDA 2P2CP 3ZIMA 3ZVVA 4I9EA 1N4QA 3CK9A 3EDTB 3C3OA 3MYVA 4M3OA 2CG3A 2DYRE 4EZJA 3X2QE 2WB2A 3SFYA 3ZXSA 4ANVA 3JQ0A 1WG0A 4BFRA 2VSNA 5LCWC 5HS0A 1UN9A 4ZFHA 5FQ7A 1NP7A 3ONKA 5FQ4A 4U95D 1IXVA 3LDZA 1D8EA 5BXOA 4I1AA 3S7FA 4EZKA 2ZGGA 4RSYA 3TWVA 2Y4TA 3U64A 1AP7A 1MZCA 3D9IA 2X6JA 3OXGA 3EHRA 4NACA 3SD5A 2E2EA 3ABLE 3QAQA 4WWOA 3LY7A 1IQRA 3B7RL 1QNFA 4U0SA 2ZIRA 2XQ0A 4UI9C 3MCXA 5ITZF 4RVBA 1O1SA 5KJNA 2IY0C 3C3QA 1NFIE 4FC8A 2IOLA 3FULA 2AXUA 4YNDA 3L9TA 2X38A 4G11A 3PNLB 3R7RA 3B95A 2IEJA 2LSUA 2R03A 1TYQG 3NB2A 3D9JA 2UY1B 5ENQD 2VSOE 1WAO1 1MJ0A 2R05A 3RRUA 1OY3D 3CEQA 2BF0X 1H6OA 2J4DA 3SF4A 4P29A 2XRYA 2F37A 5CERB 4ILIA 5B1BE 1MX2A 3PUJA 3SFXA 4HRNA 4DRXE 3I5PA 4E6HA 3L13A 2P9NG 3EIJA 5ANLA 2MHKA 1U3DA 4LERA 4NIKA 3SY2A 2V5QC 2IOSA 4TRQA 4BT8A 2J4BA 3S7DA 3ZEFA 1K1BA 4GA0A 3FUFA 3Q73A 2EIJE 3EHQA 2PZIA 5D0OD 1FCHA 3L22A 1H6PA 1QZ2A 3Q15A 1A5EA 3UTMA 3HXFA 1K3ZD 3AJIA 3SO8A 1BI8B 2XRZA 5JHBA 4GCNA 1TNBA 2EQXA 3ZHEA 3UIOC 4PS3A 2OEVA 4FLHA 3V2OA 1Y6IA 2FF4A 3SBSA 4L2YA 2R5SA 3ZFWA 4GU5A 3Q78A 1FT1A 1H2UA 3PEUB 4BT9A 4I2WA 2Y4UA 5EN5D 2X3MA 3U9WA 4OVUA 5CEDB 2WXHA 2IFUA 5D66A 3FU6A 2FULA 1XGWA 5JA4D 4CGVA 1G3NB 1HF8A 4OAVB 1DCEA 3T8KA 3FUKA 2NXPA 2PQRA 4WAFA 4KZCA 4JB8P 2WXKA 5FWQA 4LUNU 2P58C 2XPIA 3MGBA 4O6FA 3BUAA 2KZTB 4EPZA 1TN8A 3TJPA 3CVLA 4AVXA 3O48A 4GYYA 4FA6A 4HRLA 5JJTA 3FTSA 2H6HA 4CDNA 1IKND 4BX8A 4E85A 3CVQA 4EECA 2P9UG 3HXBA 4C0MA 1PC2A 2I1KA 1BLXB 3DSUA 4ACKA 4HB5A 2L6JA 4K5CA 1ELRA 4DX6D 1HE8A 4BTAA 3CGHA 1OWLA 1MX6A 3ZPJA 4APFA 3AS5A 2L0TB 4YVQC 5LX8A 4L9PA 5HKPA 3ZW3A 2OEWA 2KM4A 3FUDA 3SQVA 3ML9A 4JHJA 2A4ZA 3G2VA 5JJ6A 3Q79A 3UPVA 1ZB1A 2GRRB 5AAOA 2VGEA 3UQ3A 1QYMA 3DSXA 3HHMA 3T5VA 1NI1A 3U66A 2RKKA 3L08A 1OCOE 4K5BA 2YHEA 4G24A 4AY5A 3FEYA 3SI5A 4O1OA 3OAWA 2WXIA 2DYSE 4AOFA 3B7BA 3UX4A 4G23A 1JCRA 4WWPA 3FTWA 4ANXA 2KCVA 4CDMA 4UWHA 3LJNA 4G1TA 4N5QA 3ZU7B 1O1TA 2KCLA 1BPOA 2ILRA 5AJDA 4APOA 3QWPA 3NBNB 4JA9A 3GW4A 3UI2A 4I43A 4BSZB 3ASGA 2OV8A 1JWGA 5BV1A 4PH4B 5AQAA 4UWFA 2Y0BG 2LUHA 1N54A 2IQCA 2NYJA 2NSZA 4GMRA 5FQ6A 3DWLG 4DX2A 1OWPA 1OWMA 3APDA 2BKGA 2V4LA 2VSYA 4GZ5A 3PZ1A 3SBTB 2LO6A 3FH7A 1KT1A 1UOHA 1U2VG 2H6GA 3L82A 3CK7A 4MRUA 3ZKJA 1EPUA 2I1JA 4HORA 1MYOA 3FHEA 2XZTG 4J8FA 2BTDA 1FVHA 4K5AB 4B89A 4OVVA 3FUJA 1DVPA 3FUHA 3T8MA 3D3MA 4HOUA 5E75A 2FI7A 2XENA 3LEWA 4HOSA 4UI9K 5AENA 4QFVA 1HZ4A 3C5RA 4DLQA 3EIQC 3CKCA 4GTRA 4IYPA 2UY1A 4NRHB 4DLOA 4G26A 4GYOA 4WWNA 2HE0A 2WXGA 2R2LA 3APCA 4FU3A 1WM5A 3T5XA 1PAQA 4TUUA 1N9AA 5KNHD 1HXIA 1LTXA 3LCAA 3VTYA 4PDXA 5B1AE 1XNFA 2EILE 2M63A 3DBSA 3QK0A 4RG9A 4GB9A 2DCPA 2VJ8A 2BKKB 5CCLA 2GRQB 3TL5A 2CG2A 4DX1A 3ABKE 3IHVA 3LS8A 5FINA 5CHEE 4CRWA 3AU4A 2ETAA 4A1GA 1DCQA 4XIFA 4BX9A 1LF8A 4EZLA 2XGMA 3I3NA 3MZLB 4J8EA 2X6HA 3UXGA 3JQ1A 4Q69A 4AXHA 4LRZA 1N52A 4AP2A 2WXLA 2GGFA 3RK6A 3MV2B 2WMOA 2ZGDA 3RIBA 4XZ4A 3CV0A 1TNUA 3G2TA 4GZ6A 3KD7A 2QYJA 3VTXA 2VGXA 3AS4A 5ARFA 3Q75A 4YDEA 4ATGA 1NA3A 4ATZD 4CYMD 3KS2A 4LEUA 4XI0A 4JHKA 3ZYKA 1MX4A 4G8LA 3MKQA 2WXFA 3WG7E 3Q7AA 1YMPA 4I6JA 1E96B 3Q7FA 4HFGA 2ETCA 4H7XA 2QC9A 5BXUA 3PDNA 2YQ8A 3HVEB 3FWVA 3RAUA 3ML8A 4FHJA 5M72A 5CRUA 3S7JA 4UQXA 3E32A 1KPSB 3E33A 3CQGB 1S70B 2A5EA 4UWGA 3TWTA 4GZCA 2PM7A 1O5MA 2IONA 4BTBA 1JCSA 5CEAA 1E8WA 3LXUX 2LAHA 1SQMA 3LKUA 5KNGA 3PE4A 2AJAA 3TAXA 4HI8A 1UJJA 1D8DA 3RRNB 5G04J 4GTSA 1TN7A 3TWRA 3UM1A 1PY1A 2R17C 3ASFA 2DIWA 4I1MA 1O1RA 1RZ4A 1ELWA 4KZ0A 1LD7A 3ENEA 4AEZC 3HXDA 3GZ2A 2KCKA 4JA7A 2DVWA 5EX0A 4L7TA 5KJKA 5D2MC 3UM2A 5C2YA 5ENRD 3APFA 1E90A 1N94A 3ONLA 3EHNA 3ESLA 2GRMA 4KVOA 1OCZE 3URZA 5ENTD 1HS6A 3E4BA 2IO2C 4L1BA 1OCRE 4R7LA 1UG3A 4YDOA 5BV0A 4H7YA 1N4RA 1UN8A 5BUZA 1KZOA 3DXMG 4ILHB 4XE0A 4GCOA 2L6BA 4MS6A 2R59A 4DX5D 2WQ6A 2VTBA 4RQIA 3NF1A 2WXMA 4YDYA 3F6QA 3K9IA 5LCWJ 2Q7FA 3FU5A 2VYIA 2CHXA 4JD2G 4ACLA 2FO1E 5JHAA 3I4GA 1SW6A 4J0UA 2NC9A 5ENSD 4A3VA 3MV3B 3E37A 3ASHA 4Q96A 4FULA 3RU0A 3ULQA 1NL4A 3QOUA 1YCSB 2X6FA 2RD0A 5FTPA 3CQCB 4GMJA 2HO1A 3DSSA 4GA2A 4X8QA 3AAAC 4FJYA 5EKQD 1JUQA 2V4HC 4KMOA 5AARA 3AG2E 4LNGA 2MYOA 2Y69E 3UIPC 4GAAA 5ENPD 3P2BA 5G2NA 3B7TA 4F7AA 1TR4A 4U96D 4GTPA 2F8XK 3PNTB 3LPZA 3Q47B 4JW1A 3ZYLA 1B89A 5AQ7A 4TXRA 3GYZA 2QY7A 4IULA 3L6AA 4IRUA 1TNZA 2J49A 4U8YD 3OTNA 4OYSA 5EIDA 2JLBA 4UQYA 4Z68A 2P9SG
chains in the Genus database with same CATH topology
4J8FA 2BTDA 1FVHA 2CG3A 4RG6A 4EZJA 2WB2A 3QC1A 4KVMA 4MLPA 3JYSA 4B89A 3FEXA 5BPPA 1TEZA 2JEKA 4OVVA 2DBAA 3SZ7A 3ZXSA 2XPZA 3FUJA 2WXPA 4ANVA 3CR3A 3JQ0A 4JVSA 1ZBPA 4BFRA 2VSNA 5LCWC 2E0IA 5AJLA 2YINA 1TJCA 4JL0A 1DVPA 1IYGA 4JEHA 3FUHA 1UN9A 3S2AA 3T8MA 5FQ7A 3D3MA 1NP7A 4HOUA 5E75A 3PH0C 3ONKA 4N3AA 5FQ4A 2FI7A 3LEWA 4HOSA 4UI9K 1SZAA 3LDZA 5AENA 4U07A 4QFVA 3G2WA 4U0ZA 4I1AA 1H0AA 2WXOA 1HZ4A 2WXNA 3S7FA 4LCTA 3D9MA 4DLQA 1KLXA 3EIQC 4RSYA 4EZKA 2Y4TA 4GMLA 3U64A 1IHGA 3CKCA 3D9IA 2X6JA 3OXGA 4IYPA 2C0MA 4NACA 3SD5A 2AXVA 2E2EA 4UQZA 2UY1A 3BEEA 4I6GA 3MA5A 3QAQA 3FUNA 4NRHB 4WWOA 4DLOA 4HVBA 2CHWA 5CMYA 4G26A 3LY7A 1Z6TA 1IQRA 3B7RL 4GYOA 2KC7A 1QNFA 4U0SA 4WWNA 2WXGA 5KCMA 3KEZA 2XQ0A 4UWLA 4UI9C 4FU3A 3APCA 3NZUA 3MCXA 1OWOA 2L9BA 1WM5A 4MKTA 4RVBA 3T5XA 1PAQA 5KJNA 3CHMA 3FY4A 3QDNA 3SNXA 4TUUA 3CKBA 1IQUA 2WXJA 4ILGA 4FC8A 2IOLA 3LY9A 1OUVA 3FULA 3RJVA 2AXUA 4YNDA 3RO2A 3TG5A 2X38A 3UT4A 2KATA 4G11A 3PNLB 3R7RA 1HXIA 3FH8A 4U63A 3LCAA 5J08A 4KBQA 3L54A 3FTXA 3VTYA 2LSUA 4PDXA 4CCAA 1YA0A 5T8IA 1XNFA 3D9JA 2AW6A 2M63A 5BT1A 3DBSA 2UY1B 1HG2A 3QK0A 4RG9A 1JPLA 3WXXA 3FUMA 2VSOE 1WAO1 4GB9A 3TXNA 3RRUA 2DCPA 4HORA 2VJ8A 4F53A 3CEQA 4B8AA 3FUIA 2AVPA 5E76A 5CCLA 2BF0X 3TL5A 2J4DA 2CG2A 1KT0A 4F1SA 3LS8A 3IHVA 3SF4A 5CHEE 2YHCA 3CK8A 5BW8C 4CRWA 4URKA 4P29A 3AU4A 1W3BA 4A1GA 2XRYA 4ILIA 2HM8A 4DK5A 3ASDA 2AXZA 3VLFA 3RRMB 3PRZA 3I4RB 4XIFA 4BX9A 1LF8A 4U8HA 3DPDA 3HYMB 3PUJA 4L23A 4N2SA 4B8CB 2XCBA 3I5PA 4EZLA 2XGMA 2FBNA 3I3NA 3MZLB 1DNPA 4UWKA 4E6HA 4J8EA 2X6HA 3L13A 3CVXA 3JQ1A 4C0EA 3PS6A 4Q69A 3EIJA 4AXHA 2MOWA 5ANLA 4DPRA 3IV0A 2MHKA 4LRZA 5G04C 1U3DA 4LERA 5FQ8A 4WUYA 4IN3B 3QJZA 3ZYMA 2V0PA 1HG5A 1ELKA 4Y6WA 1N52A 4AP2A 2WXLA 1E8YA 2IOSA 4G25A 2GGFA 4JEUA 4TRQA 2WQ7A 3FTUA 3RK6A 3MV2B 4K03A 2WMOA 3IHYA 3RIBA 3HIZA 4BT8A 4XZ4A 2J4BA 3CV0A 3S7DA 4PS8A 3ZEFA 4GA0A 3FUFA 1U3CA 4NQ0A 5KJMA 4JXTA 3G2TA 4GZ6A 3KD7A 2PZIA 5D0OD 1FCHA 5FJYA 3L22A 3Q15A 1QZ2A 4V3IA 3VTXA 4CT4A 3TXMA 2VGXA 3AS4A 1INZA 3MKRA 5ARFA 4BY6A 2V8SE 5EDSA 2WQHA 2X6IA 1UJKA 4ATGA 4GPKA 1NA3A 4GA1A 1WY6A 5LFAA 3CSFA 2XRZA 3KS2A 5JHBA 3G2UA 1Z3YA 4JZYA 2FO7A 5A23A 4LEUA 4XI0A 3TG4A 4JHKA 4GCNA 2EQXA 3CHRA 3ZYKA 2A5UA 3ZHEA 2J07A 3FU3A 3MKQA 2XCCA 2WXFA 1A17A 3CSTA 3TGOA 3FH5A 3ZGQA 2I9CA 3CVWA 3GZ1A 3QWWA 5C1DA 4NURA 3CHPA 3Q4AB 3UT8A 4F3VA 3LVQE 5ANRA 5KJLA 4PS3A 4UI9J 2AWIA 4FLHA 1Y6IA 4I6JA 1E96B 2FF4A 2C2LA 3LY8A 3SBSA 4L2YA 2R5SA 4U04A 1EYHA 3CHQA 3FFLA 3ZFWA 3OXFA 3FDHA 4FLBA 3FTZA 4HFGA 4GU5A 3B7UX 1UW4B 3CVVA 1H2UA 5LOZA 3PEUB 3KAEA 4H7XA 1MHQA 4GYWA 1OWNA 5D0QD 2I2OA 4BT9A 4I2WA 3U3WA 2Y4UA 3PDNA 3JCKC 2YQ8A 3HVEB 3FWVA 2X3MA 2FEZA 3ML8A 4FHJA 3U9WA 4OVUA 2WXHA 5M72A 2IFUA 4I6EA 2J9QA 2XGSA 4PS7A 3S7JA 4UQXA 4Y6CA 3SHFA 1H6KA 4CDRA 4TV3A 3FU6A 3FUEA 4FADA 2FULA 1E7VA 3CQGB 4ANWA 1XGWA 2KZTA 4XKCA 5G05J 4UWGA 4CGVA 1HF8A 4GZCA 3SFZA 3MJWA 2PM7A 1TJFA 2IONA 2VQ2A 5EX3A 2CFZA 4BTBA 4KXKB 2XEVA 3FUKA 2NXPA 2PQRA 4WAFA 2V5FA 3U4TA 4KZCA 3MX3A 1E8WA 3D9OA 1FVFA 2WXKA 3JUIA 3LXUX 5FWQA 5CMWA 4BSXA 4LUNU 2LAHA 1SQMA 2P58C 1S0PA 2XPIA 4CEMA 2VTBB 3MGBA 3ESKA 3LKUA 4WNDA 2L0IA 3PE4A 4O6FA 4AJWA 2KZTB 1H19A 3PE3A 3PUKA 3TAXA 2PM6A 4EPZA 4I17A 4AY6A 3Q49B 3OXLA 1UJJA 2UWJG 3RKVA 2OVBA 4B94A 3RRNB 3R9AB 3S7BA 3TJPA 3CVLA 4AVXA 5AIJA 5G04J 3C98A 2C0LA 4CGWA 4JHRA 3P1UA 3O48A 4EQFA 4GYYA 5T3RA 4FJZA 3SGHA 1H2TC 3BG1B 3PREA 2MRIA 1EF1C 4KT6B 3D9LA 1PY1A 4BWRA 4FA6A 2HYZA 2R17C 3ASFA 2DIWA 3HVEA 4I1MA 5DIZA 5JJTA 3FTSA 3HDXA 4WNFA 4CDNA 1ELWA 4KZ0A 3PEVB 3ENEA 2J09A 4AEZC 3GZ2A 2CHZA 2IF4A 2KCKA 4BX8A 4DI4A 4E85A 3LJ3A 4A3TA 4B0ZA 5J90A 2OOEA 2VSXE 3CVQA 4JA7A 3MEKA 4EECA 2J08A 5EX0A 2Y3AA 4N3CA 2XGOA 4C0MA 2PQNA 4HLEA 4I1OB 3ZRHA 3UMVA 1PC2A 4L7TA 4N5CA 2I1KA 4J8SA 4ACKA 5KJKA 2L6JA 2XHEA 5C2YA 4A55A 3QWVA 3RO3A 1ELRA 3APFA 3VLEA 1HE8A 3FTVA 4G2VA 4BTAA 1E90A 2VGYA 4EBAA 3CGHA 1OWLA 3ONLA 3EHNA 3ESLA 4HOQA 2GRMA 4DJAA 4KVOA 4XX5A 3ZHEB 3ZPJA 5AYWD 4APFA 3AS5A 2GRLA 1L5JA 2L0TB 3URZA 4YVQC 4HS2A 2CFUA 5LX8A 1P5QA 1HS6A 4WNEA 3E4BA 3CLJA 4L1BA 4GZDA 4R7LA 5JJ7A 4AM9A 1UG3A 3ZW3A 2WMNA 3FTYA 4EBAG 5FZQA 3LYAA 3QB2A 5BV0A 4H7YA 2KM4A 4I9CA 3UT7A 3N71A 1SZ9A 2VGXB 3CHSA 3D9PA 1UN8A 2HR2A 3FUDA 2WM9A 5BUZA 4U0UA 3IEGA 3ML9A 4ILHB 3D9NA 4C9BB 4JHJA 2A4ZA 4XE0A 5G05C 2WXQA 4HOTA 3G2VA 4GCOA 4K0RA 5JJ6A 4MS6A 3UPVA 2QFCA 1EDUA 2LAIA 4ME2A 2WPVA 4JC8A 2LNIA 2R59A 4A1SA 2WQ6A 3PVLA 5T4YA 2VTBA 4N2QA 1E8ZA 3UQ3A 3CVPA 3CVNA 2WVIA 4FHKA 3HHMA 3NF1A 4W9RA 2IU1A 3CVUA 3D9KA 4YVOA 2PL2A 3T5VA 2WXMA 3L17A 4PUCA 2WXRA 3U66A 4FP7A 3K9IA 2XPYA 4CT0A 1HO8A 5LCWJ 2Q7FA 3L08A 3FU5A 2VYIA 3QARA 3LVRE 2X6KA 3EHMA 2CHXA 1ZU2A 2YHEA 3ZYQA 4G24A 3QNKA 4AY5A 3FEYA 5FZRA 3CHOA 3SI5A 4ACLA 3OAWA 5JHAA 2WXIA 3I4GA 4AOFA 4J0UA 4XKBA 3UX4A 4G23A 2NC9A 3AS8A 4AV7A 3Q5MA 4WWPA 5G55A 5ENNA 3FTWA 4ANXA 2KCVA 4CDMA 4UWHA 4A3VA 3MV3B 3AU5A 5ARGA 4G1TA 3CVYA 2RG8A 4L2LA 4WNGA 3CIAA 4N39A 3ASHA 2ZU6B 2KCLA 3R7QA 1BPOA 2ILRA 3PZDA 5AJDA 4APOA 4Q96A 3ZN3A 3QWPA 3FP3A 4JPSA 5CCMA 1GW6A 4FULA 4JA9A 2BUGA 3O4ZA 3GW4A 1HH8A 1X5BA 4I43A 5HI7A 3QOUA 3RU0A 2GW1A 3ULQA 2X6FA 5FZSA 1VDYA 2RD0A 3ASGA 2OV8A 5FTPA 3CQCB 1JWGA 4I2ZA 4Q94A 2YNQA 4GMJA 2HO1A 3UUXA 5BV1A 3QKYA 4PH4B 1Z3XA 4UWFA 4DI3A 1Y8MA 1MQSA 3B7SA 3FU0A 4GA2A 1JWFA 3NQPA 3MKQB 1N54A 4HXIA 4J6IA 2IQCA 4FJYA 2NSZA 5EKQD 1JUQA 5FQ6A 1OWPA 1OWMA 3APDA 4KMOA 2V4LA 3IBEA 2OVFA 2I6HA 4ABNA 2VSYA 1HFAA 4GZ5A 5FT9A 5HQ8A 5A6CA 4XI9A 4GAAA 4N3BA 3P2BA 1HU3A 1QQEA 5G2NA 3SBTB 3B7TA 2LO6A 3B13A 3L16A 5A7DB 4F7AA 1E8XA 3FH7A 3GZSA 2IJGX 4AIFA 1NA0A 3PNTB 3LPZA 3Q47B 4GZ3A 4JW1A 3ZYLA 1B89A 1E7UA 1KT1A 3GYZA 2QY7A 5LP0A 3BG0B 4IULA 3L6AA 3NZSA 4D10C 1NZNA 4IRUA 2LSVA 1H2VC 1HX8A 3CK7A 3EJNA 3G2SA 4MRUA 5BNWA 4J8DA 4KYOB 3VLDA 3ZIMA 1EPUA 3ZVVA 2J49A 4I9EA 4ANUA 3CK9A 3OTNA 2ONDA 2I1JA 4OYSA 2JLBA 3EDTB 4UQYA 3MYVA 5DBKA 3IKOB 4M3OA 3FHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8F A;  3NF1 A;  4RG6 A;  4W9R A;  4YVO A;  2PL2 A;  3HYM B;  5G05 J;  4CGV A;  4N2S A;  3JYS A;  3K9I A;  2DBA A;  2VQ2 A;  2XCB A;  5LCW J;  5EX3 A;  2Q7F A;  2FBN A;  2XGM A;  2VYI A;  4KXK B;  2XEV A;  3SZ7 A;  4BTB A;  4J8E A;  5CCM A;  2PQR A;  1ZU2 A;  2V5F A;  3U4T A;  4G24 A;  1ZBP A;  4AY5 A;  2VSN A;  5LCW C;  5FZR A;  1TJC A;  4JL0 A;  1IYG A;  2MHK A;  5G04 C;  2P58 C;  2XPI A;  3ESK A;  3LKU A;  4J0U A;  4IN3 B;  4WND A;  4HOU A;  4WUY A;  4G23 A;  3PE4 A;  4N3A A;  4O6F A;  2FI7 A;  2NC9 A;  3AS8 A;  5JJT A;  3Q5M A;  4UI9 K;  4HOS A;  4Y6W A;  2KCV A;  3PE3 A;  4U07 A;  3TAX A;  3MV3 B;  4G25 A;  5ARG A;  4G1T A;  4I17 A;  4I1A A;  3Q49 B;  4U0Z A;  4AY6 A;  3OXL A;  2UWJ G;  3RKV A;  4B94 A;  1HZ4 A;  3R9A B;  3S7B A;  3MV2 B;  3CVL A;  3S7F A;  4WNG A;  5G04 J;  3VTX A;  2C0L A;  3ASH A;  1KLX A;  4N39 A;  3RIB A;  4BT8 A;  4CGW A;  2Y4T A;  3CV0 A;  3S7D A;  2KCL A;  4JHR A;  1IHG A;  4GA0 A;  3O48 A;  4EQF A;  4GYY A;  4NQ0 A;  5KJM A;  3CKC A;  4GZ6 A;  4APO A;  3KD7 A;  2PZI A;  5D0O D;  3OXG A;  1FCH A;  2C0M A;  2HYZ A;  3ASF A;  1QZ2 A;  3FP3 A;  3Q15 A;  2E2E A;  3QWP A;  2VGX A;  2UY1 A;  3AS4 A;  3BEE A;  3MKR A;  4JA9 A;  4UQZ A;  5ARF A;  2BUG A;  4WNF A;  3GW4 A;  1HH8 A;  3MA5 A;  5HI7 A;  1ELW A;  2WQH A;  3QOU A;  2GW1 A;  4NRH B;  3RU0 A;  3ULQ A;  1NA3 A;  4GPK A;  4GA1 A;  4G26 A;  3LY7 A;  5DIZ A;  5FZS A;  4GYO A;  3KS2 A;  2KC7 A;  3ASG A;  2IF4 A;  2KCK A;  3GZ2 A;  4U0S A;  5FTP A;  2FO7 A;  4I2Z A;  4LEU A;  4XI0 A;  2OOE A;  3CVQ A;  3TG4 A;  4GCN A;  4JA7 A;  2HO1 A;  3MEK A;  4UI9 C;  3QKY A;  5EX0 A;  4N3C A;  3UUX A;  2XGO A;  3ZN3 A;  2PQN A;  1WM5 A;  1Y8M A;  3ZHE A;  5KJN A;  4HOT A;  1PC2 A;  4GA2 A;  4N5C A;  3QDN A;  2XCC A;  5KJK A;  3CKB A;  1A17 A;  3TGO A;  3ZGQ A;  2L6J A;  3GZ1 A;  3QWW A;  5C1D A;  3Q4A B;  5EKQ D;  3LY9 A;  1OUV A;  3QWV A;  3RJV A;  1ELR A;  4YND A;  3RO3 A;  3RO2 A;  3TG5 A;  4F3V A;  5KJL A;  4G2V A;  2KAT A;  4BTA A;  2VGY A;  4UI9 J;  2I6H A;  4ABN A;  4HOQ A;  2VSY A;  4GZ5 A;  1HXI A;  1E96 B;  2FF4 A;  2C2L A;  5FT9 A;  3LY8 A;  5HQ8 A;  3ZHE B;  5A6C A;  3LCA A;  2R5S A;  4U04 A;  3FFL A;  4XI9 A;  4KBQ A;  5AYW D;  3AS5 A;  4N3B A;  2LSU A;  3OXF A;  3URZ A;  1YA0 A;  1QQE A;  4YVQ C;  3VTY A;  1XNF A;  3ZFW A;  1P5Q A;  4WNE A;  3E4B A;  5BT1 A;  5A7D B;  2UY1 B;  4RG9 A;  5JJ7 A;  3WXX A;  4AIF A;  1NA0 A;  3LPZ A;  3Q47 B;  4GZ3 A;  3ZPJ A;  1WAO 1;  3KAE A;  4H7X A;  4AM9 A;  4GYW A;  1B89 A;  5D0Q D;  4BT9 A;  4I2W A;  1KT1 A;  5FZQ A;  3U3W A;  3LYA A;  3GYZ A;  2Y4U A;  3PDN A;  3CEQ A;  4H7Y A;  4I9C A;  2AVP A;  2YQ8 A;  3N71 A;  2VGX B;  5CCL A;  2HR2 A;  5FJY A;  1NZN A;  2LSV A;  3FWV A;  4U0U A;  3IEG A;  3CK7 A;  2FEZ A;  1KT0 A;  5BNW A;  3SF4 A;  5CHE E;  5G05 C;  5M72 A;  2IFU A;  2YHC A;  3CK8 A;  4GCO A;  2J9Q A;  4J8D A;  4KYO B;  5JJ6 A;  5BW8 C;  3UPV A;  1W3B A;  2QFC A;  2XGS A;  4I9E A;  3S7J A;  4ME2 A;  3CK9 A;  2WPV A;  4UQX A;  2OND A;  4Y6C A;  2LNI A;  4A1S A;  2JLB A;  3EDT B;  3ASD A;  4UQY A;  4CDR A;  4N2Q A;  5DBK A;  4BWR A;  3UQ3 A;  4HOR A;  3CVP A;  3CVN A;  4XIF A; 
#chains in the Genus database with same CATH topology
 3HXE A;  4MLP A;  3FEX A;  5BPP A;  2DBA A;  3SZ7 A;  2EIN E;  3CR3 A;  1X81 A;  4JVS A;  1ZBP A;  2E0I A;  1TJC A;  3AG3 E;  4JL0 A;  1IYG A;  4GTV A;  4JEH A;  3S2A A;  3PH0 C;  4N3A A;  2LXM A;  4U07 A;  3G2W A;  3J5Q B;  2DZN A;  1S63 A;  2WXO A;  2WXN A;  4LCT A;  3D9M A;  3EU9 A;  1IHG A;  4DUI A;  2C0M A;  2AXV A;  1N11 A;  3MA5 A;  3C72 A;  5CMY A;  1BI7 B;  2ZIS A;  4J7W A;  3NZU A;  1OWO A;  2L9B A;  3CHM A;  3FY4 A;  2EIK E;  3W9G A;  2WXJ A;  4ILG A;  1OT8 A;  3DEO A;  4HRM B;  3LY9 A;  3RO2 A;  2XZD G;  3TG5 A;  3UT4 A;  5IY5 E;  2KAT A;  5CBO A;  5CEC B;  3FH8 A;  2Y1L E;  3L54 A;  3FTX A;  4KBQ A;  4CCA A;  4C48 B;  1K8K G;  5EIL A;  5BT1 A;  1JPL A;  3WXX A;  3FUM A;  4GTT A;  3TXN A;  3FUI A;  2AVP A;  5E76 A;  3W9F A;  4CZ2 D;  1KT0 A;  1N0Q A;  2YHC A;  3CK8 A;  5BW8 C;  1W3B A;  1V55 E;  3ASD A;  3VLF A;  3RRM B;  3DPY A;  3I4R B;  3ABM E;  4U8H A;  3DPD A;  3HYM B;  4DX7 D;  4N2S A;  4BEP A;  5B3S E;  1DNP A;  4HI9 A;  1RW2 A;  3CVX A;  3V30 A;  2MOW A;  3IV0 A;  3KEA A;  4WUY A;  3ASO E;  1ELK A;  4Y6W A;  4HBD A;  1WDY A;  1E8Y A;  4JEU A;  2WQ7 A;  2F8Y A;  1BD8 A;  3FTU A;  3R9M A;  1N4P A;  3IHY A;  3UIN C;  1Z5S C;  4PS8 A;  5KJM A;  5FJY A;  4CT4 A;  1INZ A;  3TXM A;  3PZ3 A;  4BY6 A;  2V8S E;  3IXE A;  2WQH A;  2X6I A;  4GPK A;  4GA1 A;  1WY6 A;  3CSF A;  2XEH A;  5A23 A;  3TG4 A;  3CHR A;  4GPM A;  2J07 A;  3UM3 A;  2XCC A;  1A17 A;  3TGO A;  3FH5 A;  3ZGQ A;  2I9C A;  3CVW A;  3GZ1 A;  3QWW A;  5C1D A;  4NUR A;  3CHP A;  3Q4A B;  4F3V A;  3LVQ E;  3DSW A;  5KJL A;  2AWI A;  2C2L A;  3LY8 A;  1IHB A;  2IO3 C;  4U04 A;  3FFL A;  3E30 A;  3OXF A;  3CVV A;  3NAW A;  3KAE A;  1MHQ A;  1OWN A;  4QQI A;  2I2O A;  3JCK C;  4U8V D;  2FEZ A;  5H7P A;  2LXL A;  2DWZ A;  3HXC A;  4I6E A;  3ISM C;  2XGS A;  3HG0 D;  3NOC D;  4J8Y A;  4Y6C A;  1KZP A;  3SHF A;  1H6K A;  4TV3 A;  3FUE A;  1E7V A;  4ANW A;  3EUV A;  4O1P A;  5G05 J;  2VQ2 A;  5EX3 A;  4KXK B;  2V5F A;  3U4T A;  3MX3 A;  3JUI A;  5CMW A;  3TWQ A;  1S0P A;  3ESK A;  4AJW A;  3TWS A;  1H19 A;  3PE3 A;  3PUK A;  4AY6 A;  3OXL A;  2UWJ G;  2OVB A;  3S7B A;  3C98 A;  2C0L A;  3ZNG A;  1DC2 A;  4XEI G;  4JHR A;  4EQF A;  4FJZ A;  2H6F A;  3SGH A;  1H2T C;  3PRE A;  4KT6 B;  2MRI A;  1EF1 C;  3D9L A;  2HYZ A;  3HVE A;  5DIZ A;  3DEP A;  3HDX A;  4WNF A;  4BET A;  3PEV B;  2CHZ A;  4DI4 A;  4A3T A;  2VSX E;  3MEK A;  4BES A;  4HLE A;  2XGO A;  3ZRH A;  3UMV A;  4N5C A;  1K1A A;  2GRO B;  4A55 A;  3QWV A;  3RO3 A;  3FTV A;  4EBA A;  2VGY A;  2P9K G;  1D9S A;  1L5J A;  2CFU A;  1P5Q A;  3EU5 A;  5JJ7 A;  4AM9 A;  2WMN A;  5EYP F;  2R02 A;  3V79 K;  2RFA A;  4I9C A;  3N71 A;  1SZ9 A;  2VGX B;  3CHS A;  5CRV A;  2WM9 A;  5JMN D;  3IEG A;  3UKR G;  3D9N A;  4HOT A;  5G05 C;  2WXQ A;  5EYL A;  1EDU A;  2LAI A;  4ME2 A;  2LNI A;  4A1S A;  4EHM A;  3UKU G;  5T4Y A;  1S64 A;  3CVP A;  3CVN A;  3PZ2 A;  2IU1 A;  3D9K A;  2XS8 A;  2WXR A;  1HO8 A;  3EHM A;  3ZYQ A;  3CHO A;  1SVX A;  3AS8 A;  4AV7 A;  3Q5M A;  5ENN A;  2P9P G;  5ARG A;  3AU5 A;  4U7E B;  4BER A;  4L2L A;  4WNG A;  3CIA A;  3TWW A;  2GRN B;  3R7Q A;  3O4Z A;  1HH8 A;  2GW1 A;  3JXJ A;  2QYU A;  3KSL A;  2YNQ A;  5AQB A;  1Z3X A;  4DI3 A;  1Y8M A;  1JWF A;  4HXI A;  4J6I A;  3V31 A;  4LNB A;  3IBE A;  2OVF A;  4ABN A;  5FT9 A;  5HQ8 A;  5A6C A;  4XI9 A;  4N3B A;  1QQE A;  2XEE A;  2PNN A;  3B13 A;  1E8X A;  2IJG X;  4AIF A;  1NA0 A;  1E7U A;  4OAU C;  3BG0 B;  3NZS A;  4D10 C;  2ETB A;  1NZN A;  5EIB E;  2LSV A;  1H2V C;  1HX8 A;  3EJN A;  2OCC E;  4KYO B;  4ANU A;  2QZA A;  2OND A;  2BED A;  3D9H A;  5DBK A;  3IKO B;  4RG6 A;  3QC1 A;  4KVM A;  3JYS A;  4UUC A;  1TEZ A;  2JEK A;  3JXI A;  2XPZ A;  2WXP A;  1TNO A;  1YYH A;  5AJL A;  2YIN A;  1SZA A;  4U0Z A;  3BQO A;  1H0A A;  3DXK G;  1KLX A;  4TXQ A;  4GML A;  5KBA A;  4RLY A;  1FPP A;  4UQZ A;  3BEE A;  4I6G A;  4HNA D;  3FUN A;  4M7C A;  4HVB A;  2CHW A;  3ULE G;  1Z6T A;  5KCM A;  2KC7 A;  3KSQ A;  3KEZ A;  4UWL A;  2B6C A;  4MKT A;  2P9I G;  3SNX A;  3QDN A;  1AWC B;  3CKB A;  1IQU A;  4G8K A;  1OUV A;  2JAB A;  3RJV A;  3C3R A;  4U63 A;  5J08 A;  1YA0 A;  5T8I A;  4F6R D;  2AW6 A;  1N4S A;  1HG2 A;  3DST A;  5KWD A;  5FIO A;  4F53 A;  4B8A A;  3J5P A;  4GTO A;  4F1S A;  4GTQ A;  3ZXP A;  4URK A;  1BU9 A;  2HM8 A;  4DK5 A;  3UM0 A;  2AXZ A;  3PRZ A;  2H6I A;  4L23 A;  4B8C B;  2XCB A;  2FBN A;  2XS1 A;  4UWK A;  1OCC E;  4C0E A;  3PS6 A;  2GRP B;  4DPR A;  4F1P A;  5AN8 A;  5G04 C;  5CBN A;  5FQ8 A;  3NOG D;  4IN3 B;  3QJZ A;  3ZYM A;  2V0P A;  1HG5 A;  4G25 A;  4K03 A;  3HIZ A;  5ENO D;  1U3C A;  2KXP C;  4NQ0 A;  3RSE G;  4JXT A;  4V3I A;  3MKR A;  5EDS A;  4YDW A;  1UJK A;  1TNY A;  5LFA A;  3G2U A;  1Z3Y A;  4JZY A;  2FO7 A;  4O60 A;  2KBX A;  2A5U A;  2ZXW E;  3FU3 A;  3CST A;  3UT8 A;  5ANR A;  5AQ9 A;  1OXJ A;  4UI9 J;  1SA5 A;  1EYH A;  3CHQ A;  3FDH A;  4FLB A;  3FTZ A;  3B7U X;  1UW4 B;  5LOZ A;  4TXP A;  4GYW A;  5D0Q D;  3U3W A;  4HQD A;  1N0R A;  2P9L G;  3DRA A;  3AG1 E;  3ULY A;  2J9Q A;  4PS7 A;  1V54 E;  4CDR A;  1SA4 A;  4FAD A;  1QBQ A;  3JUE A;  2KZT A;  4XKC A;  4B93 B;  3SFZ A;  3MJW A;  1TJF A;  4A63 B;  2CFZ A;  3TWX A;  2XEV A;  4TUM A;  3D9O A;  4GTM A;  1FVF A;  3DSV A;  4BSX A;  4CEM A;  2VTB B;  4WND A;  2L0I A;  1N95 A;  2PM6 A;  4I17 A;  3Q49 B;  2EIM E;  3RKV A;  4B94 A;  3R9A B;  5AIJ A;  4CGW A;  3P1U A;  4LSZ E;  2J8S D;  5T3R A;  3BG1 B;  4BWR A;  2RFM A;  4LG6 A;  2J09 A;  2IF4 A;  3LJ3 A;  4B0Z A;  5J90 A;  2OOE A;  2J08 A;  2Y3A A;  3BU8 A;  4N3C A;  2PQN A;  4I1O B;  4J8S A;  4LNU D;  2XHE A;  3ZUV B;  3VLE A;  4G2V A;  4HOQ A;  4DJA A;  4XX5 A;  3ZHE B;  3T9K A;  5AYW D;  2GRL A;  4HS2 A;  4WNE A;  3CLJ A;  4GZD A;  1TN6 A;  3FTY A;  4EBA G;  5FZQ A;  4ZHB A;  3LYA A;  3QB2 A;  3UT7 A;  3D9P A;  2HR2 A;  4U0U A;  4C9B B;  4K0R A;  2QFC A;  2WPV A;  4JC8 A;  3PVL A;  4N2Q A;  1E8Z A;  3TWU A;  2WVI A;  4FHK A;  4W9R A;  3CVU A;  4YVO A;  2PL2 A;  3L17 A;  4PUC A;  4FP7 A;  3HRA A;  2XPY A;  3Q9N C;  4CT0 A;  3QAR A;  2B0O E;  3LVR E;  2X6K A;  1ZU2 A;  3QNK A;  5FZR A;  4XKB A;  4MBG A;  5G55 A;  3CVY A;  2RG8 A;  4N39 A;  2ZU6 B;  2F0Y A;  3PZD A;  3ZN3 A;  3FP3 A;  4JPS A;  5CCM A;  1GW6 A;  2BUG A;  1Q2Z A;  1X5B A;  5HI7 A;  5FZS A;  1VDY A;  4I2Z A;  3AG4 E;  4Q94 A;  3UUX A;  3QKY A;  2DZO A;  1MQS A;  3B7S A;  3FU0 A;  3NQP A;  3MKQ B;  1JCQ A;  2I6H A;  1HFA A;  1HU3 A;  3L16 A;  3ASN E;  5A7D B;  3GZS A;  4GZ3 A;  1LD8 A;  3Q9U C;  1FT2 A;  3PZ4 A;  5LP0 A;  3V2X A;  3G2S A;  3E34 A;  5HRY A;  5BNW A;  4J8D A;  4HLL A;  3VLD A;  2P2C P;  3ZIM A;  3ZVV A;  4I9E A;  1N4Q A;  3CK9 A;  3EDT B;  3C3O A;  3MYV A;  4M3O A;  2CG3 A;  2DYR E;  4EZJ A;  3X2Q E;  2WB2 A;  3SFY A;  3ZXS A;  4ANV A;  3JQ0 A;  1WG0 A;  4BFR A;  2VSN A;  5LCW C;  5HS0 A;  1UN9 A;  4ZFH A;  5FQ7 A;  1NP7 A;  3ONK A;  5FQ4 A;  4U95 D;  1IXV A;  3LDZ A;  1D8E A;  5BXO A;  4I1A A;  3S7F A;  4EZK A;  2ZGG A;  4RSY A;  3TWV A;  2Y4T A;  3U64 A;  1AP7 A;  1MZC A;  3D9I A;  2X6J A;  3OXG A;  3EHR A;  4NAC A;  3SD5 A;  2E2E A;  3ABL E;  3QAQ A;  4WWO A;  3LY7 A;  1IQR A;  3B7R L;  1QNF A;  4U0S A;  2ZIR A;  2XQ0 A;  4UI9 C;  3MCX A;  5ITZ F;  4RVB A;  1O1S A;  5KJN A;  2IY0 C;  3C3Q A;  1NFI E;  4FC8 A;  2IOL A;  3FUL A;  2AXU A;  4YND A;  3L9T A;  2X38 A;  4G11 A;  3PNL B;  3R7R A;  3B95 A;  2IEJ A;  2LSU A;  2R03 A;  1TYQ G;  3NB2 A;  3D9J A;  2UY1 B;  5ENQ D;  2VSO E;  1WAO 1;  1MJ0 A;  2R05 A;  3RRU A;  1OY3 D;  3CEQ A;  2BF0 X;  1H6O A;  2J4D A;  3SF4 A;  4P29 A;  2XRY A;  2F37 A;  5CER B;  4ILI A;  5B1B E;  1MX2 A;  3PUJ A;  3SFX A;  4HRN A;  4DRX E;  3I5P A;  4E6H A;  3L13 A;  2P9N G;  3EIJ A;  5ANL A;  2MHK A;  1U3D A;  4LER A;  4NIK A;  3SY2 A;  2V5Q C;  2IOS A;  4TRQ A;  4BT8 A;  2J4B A;  3S7D A;  3ZEF A;  1K1B A;  4GA0 A;  3FUF A;  3Q73 A;  2EIJ E;  3EHQ A;  2PZI A;  5D0O D;  1FCH A;  3L22 A;  1H6P A;  1QZ2 A;  3Q15 A;  1A5E A;  3UTM A;  3HXF A;  1K3Z D;  3AJI A;  3SO8 A;  1BI8 B;  2XRZ A;  5JHB A;  4GCN A;  1TNB A;  2EQX A;  3ZHE A;  3UIO C;  4PS3 A;  2OEV A;  4FLH A;  3V2O A;  1Y6I A;  2FF4 A;  3SBS A;  4L2Y A;  2R5S A;  3ZFW A;  4GU5 A;  3Q78 A;  1FT1 A;  1H2U A;  3PEU B;  4BT9 A;  4I2W A;  2Y4U A;  5EN5 D;  2X3M A;  3U9W A;  4OVU A;  5CED B;  2WXH A;  2IFU A;  5D66 A;  3FU6 A;  2FUL A;  1XGW A;  5JA4 D;  4CGV A;  1G3N B;  1HF8 A;  4OAV B;  1DCE A;  3T8K A;  3FUK A;  2NXP A;  2PQR A;  4WAF A;  4KZC A;  4JB8 P;  2WXK A;  5FWQ A;  4LUN U;  2P58 C;  2XPI A;  3MGB A;  4O6F A;  3BUA A;  2KZT B;  4EPZ A;  1TN8 A;  3TJP A;  3CVL A;  4AVX A;  3O48 A;  4GYY A;  4FA6 A;  4HRL A;  5JJT A;  3FTS A;  2H6H A;  4CDN A;  1IKN D;  4BX8 A;  4E85 A;  3CVQ A;  4EEC A;  2P9U G;  3HXB A;  4C0M A;  1PC2 A;  2I1K A;  1BLX B;  3DSU A;  4ACK A;  4HB5 A;  2L6J A;  4K5C A;  1ELR A;  4DX6 D;  1HE8 A;  4BTA A;  3CGH A;  1OWL A;  1MX6 A;  3ZPJ A;  4APF A;  3AS5 A;  2L0T B;  4YVQ C;  5LX8 A;  4L9P A;  5HKP A;  3ZW3 A;  2OEW A;  2KM4 A;  3FUD A;  3SQV A;  3ML9 A;  4JHJ A;  2A4Z A;  3G2V A;  5JJ6 A;  3Q79 A;  3UPV A;  1ZB1 A;  2GRR B;  5AAO A;  2VGE A;  3UQ3 A;  1QYM A;  3DSX A;  3HHM A;  3T5V A;  1NI1 A;  3U66 A;  2RKK A;  3L08 A;  1OCO E;  4K5B A;  2YHE A;  4G24 A;  4AY5 A;  3FEY A;  3SI5 A;  4O1O A;  3OAW A;  2WXI A;  2DYS E;  4AOF A;  3B7B A;  3UX4 A;  4G23 A;  1JCR A;  4WWP A;  3FTW A;  4ANX A;  2KCV A;  4CDM A;  4UWH A;  3LJN A;  4G1T A;  4N5Q A;  3ZU7 B;  1O1T A;  2KCL A;  1BPO A;  2ILR A;  5AJD A;  4APO A;  3QWP A;  3NBN B;  4JA9 A;  3GW4 A;  3UI2 A;  4I43 A;  4BSZ B;  3ASG A;  2OV8 A;  1JWG A;  5BV1 A;  4PH4 B;  5AQA A;  4UWF A;  2Y0B G;  2LUH A;  1N54 A;  2IQC A;  2NYJ A;  2NSZ A;  4GMR A;  5FQ6 A;  3DWL G;  4DX2 A;  1OWP A;  1OWM A;  3APD A;  2BKG A;  2V4L A;  2VSY A;  4GZ5 A;  3PZ1 A;  3SBT B;  2LO6 A;  3FH7 A;  1KT1 A;  1UOH A;  1U2V G;  2H6G A;  3L82 A;  3CK7 A;  4MRU A;  3ZKJ A;  1EPU A;  2I1J A;  4HOR A;  1MYO A;  3FHE A;  2XZT G;  4J8F A;  2BTD A;  1FVH A;  4K5A B;  4B89 A;  4OVV A;  3FUJ A;  1DVP A;  3FUH A;  3T8M A;  3D3M A;  4HOU A;  5E75 A;  2FI7 A;  2XEN A;  3LEW A;  4HOS A;  4UI9 K;  5AEN A;  4QFV A;  1HZ4 A;  3C5R A;  4DLQ A;  3EIQ C;  3CKC A;  4GTR A;  4IYP A;  2UY1 A;  4NRH B;  4DLO A;  4G26 A;  4GYO A;  4WWN A;  2HE0 A;  2WXG A;  2R2L A;  3APC A;  4FU3 A;  1WM5 A;  3T5X A;  1PAQ A;  4TUU A;  1N9A A;  5KNH D;  1HXI A;  1LTX A;  3LCA A;  3VTY A;  4PDX A;  5B1A E;  1XNF A;  2EIL E;  2M63 A;  3DBS A;  3QK0 A;  4RG9 A;  4GB9 A;  2DCP A;  2VJ8 A;  2BKK B;  5CCL A;  2GRQ B;  3TL5 A;  2CG2 A;  4DX1 A;  3ABK E;  3IHV A;  3LS8 A;  5FIN A;  5CHE E;  4CRW A;  3AU4 A;  2ETA A;  4A1G A;  1DCQ A;  4XIF A;  4BX9 A;  1LF8 A;  4EZL A;  2XGM A;  3I3N A;  3MZL B;  4J8E A;  2X6H A;  3UXG A;  3JQ1 A;  4Q69 A;  4AXH A;  4LRZ A;  1N52 A;  4AP2 A;  2WXL A;  2GGF A;  3RK6 A;  3MV2 B;  2WMO A;  2ZGD A;  3RIB A;  4XZ4 A;  3CV0 A;  1TNU A;  3G2T A;  4GZ6 A;  3KD7 A;  2QYJ A;  3VTX A;  2VGX A;  3AS4 A;  5ARF A;  3Q75 A;  4YDE A;  4ATG A;  1NA3 A;  4ATZ D;  4CYM D;  3KS2 A;  4LEU A;  4XI0 A;  4JHK A;  3ZYK A;  1MX4 A;  4G8L A;  3MKQ A;  2WXF A;  3WG7 E;  3Q7A A;  1YMP A;  4I6J A;  1E96 B;  3Q7F A;  4HFG A;  2ETC A;  4H7X A;  2QC9 A;  5BXU A;  3PDN A;  2YQ8 A;  3HVE B;  3FWV A;  3RAU A;  3ML8 A;  4FHJ A;  5M72 A;  5CRU A;  3S7J A;  4UQX A;  3E32 A;  1KPS B;  3E33 A;  3CQG B;  1S70 B;  2A5E A;  4UWG A;  3TWT A;  4GZC A;  2PM7 A;  1O5M A;  2ION A;  4BTB A;  1JCS A;  5CEA A;  1E8W A;  3LXU X;  2LAH A;  1SQM A;  3LKU A;  5KNG A;  3PE4 A;  2AJA A;  3TAX A;  4HI8 A;  1UJJ A;  1D8D A;  3RRN B;  5G04 J;  4GTS A;  1TN7 A;  3TWR A;  3UM1 A;  1PY1 A;  2R17 C;  3ASF A;  2DIW A;  4I1M A;  1O1R A;  1RZ4 A;  1ELW A;  4KZ0 A;  1LD7 A;  3ENE A;  4AEZ C;  3HXD A;  3GZ2 A;  2KCK A;  4JA7 A;  2DVW A;  5EX0 A;  4L7T A;  5KJK A;  5D2M C;  3UM2 A;  5C2Y A;  5ENR D;  3APF A;  1E90 A;  1N94 A;  3ONL A;  3EHN A;  3ESL A;  2GRM A;  4KVO A;  1OCZ E;  3URZ A;  5ENT D;  1HS6 A;  3E4B A;  2IO2 C;  4L1B A;  1OCR E;  4R7L A;  1UG3 A;  4YDO A;  5BV0 A;  4H7Y A;  1N4R A;  1UN8 A;  5BUZ A;  1KZO A;  3DXM G;  4ILH B;  4XE0 A;  4GCO A;  2L6B A;  4MS6 A;  2R59 A;  4DX5 D;  2WQ6 A;  2VTB A;  4RQI A;  3NF1 A;  2WXM A;  4YDY A;  3F6Q A;  3K9I A;  5LCW J;  2Q7F A;  3FU5 A;  2VYI A;  2CHX A;  4JD2 G;  4ACL A;  2FO1 E;  5JHA A;  3I4G A;  1SW6 A;  4J0U A;  2NC9 A;  5ENS D;  4A3V A;  3MV3 B;  3E37 A;  3ASH A;  4Q96 A;  4FUL A;  3RU0 A;  3ULQ A;  1NL4 A;  3QOU A;  1YCS B;  2X6F A;  2RD0 A;  5FTP A;  3CQC B;  4GMJ A;  2HO1 A;  3DSS A;  4GA2 A;  4X8Q A;  3AAA C;  4FJY A;  5EKQ D;  1JUQ A;  2V4H C;  4KMO A;  5AAR A;  3AG2 E;  4LNG A;  2MYO A;  2Y69 E;  3UIP C;  4GAA A;  5ENP D;  3P2B A;  5G2N A;  3B7T A;  4F7A A;  1TR4 A;  4U96 D;  4GTP A;  2F8X K;  3PNT B;  3LPZ A;  3Q47 B;  4JW1 A;  3ZYL A;  1B89 A;  5AQ7 A;  4TXR A;  3GYZ A;  2QY7 A;  4IUL A;  3L6A A;  4IRU A;  1TNZ A;  2J49 A;  4U8Y D;  3OTN A;  4OYS A;  5EID A;  2JLB A;  4UQY A;  4Z68 A;  2P9S G; 
#chains in the Genus database with same CATH homology
 4J8F A;  2BTD A;  1FVH A;  2CG3 A;  4RG6 A;  4EZJ A;  2WB2 A;  3QC1 A;  4KVM A;  4MLP A;  3JYS A;  4B89 A;  3FEX A;  5BPP A;  1TEZ A;  2JEK A;  4OVV A;  2DBA A;  3SZ7 A;  3ZXS A;  2XPZ A;  3FUJ A;  2WXP A;  4ANV A;  3CR3 A;  3JQ0 A;  4JVS A;  1ZBP A;  4BFR A;  2VSN A;  5LCW C;  2E0I A;  5AJL A;  2YIN A;  1TJC A;  4JL0 A;  1DVP A;  1IYG A;  4JEH A;  3FUH A;  1UN9 A;  3S2A A;  3T8M A;  5FQ7 A;  3D3M A;  1NP7 A;  4HOU A;  5E75 A;  3PH0 C;  3ONK A;  4N3A A;  5FQ4 A;  2FI7 A;  3LEW A;  4HOS A;  4UI9 K;  1SZA A;  3LDZ A;  5AEN A;  4U07 A;  4QFV A;  3G2W A;  4U0Z A;  4I1A A;  1H0A A;  2WXO A;  1HZ4 A;  2WXN A;  3S7F A;  4LCT A;  3D9M A;  4DLQ A;  1KLX A;  3EIQ C;  4RSY A;  4EZK A;  2Y4T A;  4GML A;  3U64 A;  1IHG A;  3CKC A;  3D9I A;  2X6J A;  3OXG A;  4IYP A;  2C0M A;  4NAC A;  3SD5 A;  2AXV A;  2E2E A;  4UQZ A;  2UY1 A;  3BEE A;  4I6G A;  3MA5 A;  3QAQ A;  3FUN A;  4NRH B;  4WWO A;  4DLO A;  4HVB A;  2CHW A;  5CMY A;  4G26 A;  3LY7 A;  1Z6T A;  1IQR A;  3B7R L;  4GYO A;  2KC7 A;  1QNF A;  4U0S A;  4WWN A;  2WXG A;  5KCM A;  3KEZ A;  2XQ0 A;  4UWL A;  4UI9 C;  4FU3 A;  3APC A;  3NZU A;  3MCX A;  1OWO A;  2L9B A;  1WM5 A;  4MKT A;  4RVB A;  3T5X A;  1PAQ A;  5KJN A;  3CHM A;  3FY4 A;  3QDN A;  3SNX A;  4TUU A;  3CKB A;  1IQU A;  2WXJ A;  4ILG A;  4FC8 A;  2IOL A;  3LY9 A;  1OUV A;  3FUL A;  3RJV A;  2AXU A;  4YND A;  3RO2 A;  3TG5 A;  2X38 A;  3UT4 A;  2KAT A;  4G11 A;  3PNL B;  3R7R A;  1HXI A;  3FH8 A;  4U63 A;  3LCA A;  5J08 A;  4KBQ A;  3L54 A;  3FTX A;  3VTY A;  2LSU A;  4PDX A;  4CCA A;  1YA0 A;  5T8I A;  1XNF A;  3D9J A;  2AW6 A;  2M63 A;  5BT1 A;  3DBS A;  2UY1 B;  1HG2 A;  3QK0 A;  4RG9 A;  1JPL A;  3WXX A;  3FUM A;  2VSO E;  1WAO 1;  4GB9 A;  3TXN A;  3RRU A;  2DCP A;  4HOR A;  2VJ8 A;  4F53 A;  3CEQ A;  4B8A A;  3FUI A;  2AVP A;  5E76 A;  5CCL A;  2BF0 X;  3TL5 A;  2J4D A;  2CG2 A;  1KT0 A;  4F1S A;  3LS8 A;  3IHV A;  3SF4 A;  5CHE E;  2YHC A;  3CK8 A;  5BW8 C;  4CRW A;  4URK A;  4P29 A;  3AU4 A;  1W3B A;  4A1G A;  2XRY A;  4ILI A;  2HM8 A;  4DK5 A;  3ASD A;  2AXZ A;  3VLF A;  3RRM B;  3PRZ A;  3I4R B;  4XIF A;  4BX9 A;  1LF8 A;  4U8H A;  3DPD A;  3HYM B;  3PUJ A;  4L23 A;  4N2S A;  4B8C B;  2XCB A;  3I5P A;  4EZL A;  2XGM A;  2FBN A;  3I3N A;  3MZL B;  1DNP A;  4UWK A;  4E6H A;  4J8E A;  2X6H A;  3L13 A;  3CVX A;  3JQ1 A;  4C0E A;  3PS6 A;  4Q69 A;  3EIJ A;  4AXH A;  2MOW A;  5ANL A;  4DPR A;  3IV0 A;  2MHK A;  4LRZ A;  5G04 C;  1U3D A;  4LER A;  5FQ8 A;  4WUY A;  4IN3 B;  3QJZ A;  3ZYM A;  2V0P A;  1HG5 A;  1ELK A;  4Y6W A;  1N52 A;  4AP2 A;  2WXL A;  1E8Y A;  2IOS A;  4G25 A;  2GGF A;  4JEU A;  4TRQ A;  2WQ7 A;  3FTU A;  3RK6 A;  3MV2 B;  4K03 A;  2WMO A;  3IHY A;  3RIB A;  3HIZ A;  4BT8 A;  4XZ4 A;  2J4B A;  3CV0 A;  3S7D A;  4PS8 A;  3ZEF A;  4GA0 A;  3FUF A;  1U3C A;  4NQ0 A;  5KJM A;  4JXT A;  3G2T A;  4GZ6 A;  3KD7 A;  2PZI A;  5D0O D;  1FCH A;  5FJY A;  3L22 A;  3Q15 A;  1QZ2 A;  4V3I A;  3VTX A;  4CT4 A;  3TXM A;  2VGX A;  3AS4 A;  1INZ A;  3MKR A;  5ARF A;  4BY6 A;  2V8S E;  5EDS A;  2WQH A;  2X6I A;  1UJK A;  4ATG A;  4GPK A;  1NA3 A;  4GA1 A;  1WY6 A;  5LFA A;  3CSF A;  2XRZ A;  3KS2 A;  5JHB A;  3G2U A;  1Z3Y A;  4JZY A;  2FO7 A;  5A23 A;  4LEU A;  4XI0 A;  3TG4 A;  4JHK A;  4GCN A;  2EQX A;  3CHR A;  3ZYK A;  2A5U A;  3ZHE A;  2J07 A;  3FU3 A;  3MKQ A;  2XCC A;  2WXF A;  1A17 A;  3CST A;  3TGO A;  3FH5 A;  3ZGQ A;  2I9C A;  3CVW A;  3GZ1 A;  3QWW A;  5C1D A;  4NUR A;  3CHP A;  3Q4A B;  3UT8 A;  4F3V A;  3LVQ E;  5ANR A;  5KJL A;  4PS3 A;  4UI9 J;  2AWI A;  4FLH A;  1Y6I A;  4I6J A;  1E96 B;  2FF4 A;  2C2L A;  3LY8 A;  3SBS A;  4L2Y A;  2R5S A;  4U04 A;  1EYH A;  3CHQ A;  3FFL A;  3ZFW A;  3OXF A;  3FDH A;  4FLB A;  3FTZ A;  4HFG A;  4GU5 A;  3B7U X;  1UW4 B;  3CVV A;  1H2U A;  5LOZ A;  3PEU B;  3KAE A;  4H7X A;  1MHQ A;  4GYW A;  1OWN A;  5D0Q D;  2I2O A;  4BT9 A;  4I2W A;  3U3W A;  2Y4U A;  3PDN A;  3JCK C;  2YQ8 A;  3HVE B;  3FWV A;  2X3M A;  2FEZ A;  3ML8 A;  4FHJ A;  3U9W A;  4OVU A;  2WXH A;  5M72 A;  2IFU A;  4I6E A;  2J9Q A;  2XGS A;  4PS7 A;  3S7J A;  4UQX A;  4Y6C A;  3SHF A;  1H6K A;  4CDR A;  4TV3 A;  3FU6 A;  3FUE A;  4FAD A;  2FUL A;  1E7V A;  3CQG B;  4ANW A;  1XGW A;  2KZT A;  4XKC A;  5G05 J;  4UWG A;  4CGV A;  1HF8 A;  4GZC A;  3SFZ A;  3MJW A;  2PM7 A;  1TJF A;  2ION A;  2VQ2 A;  5EX3 A;  2CFZ A;  4BTB A;  4KXK B;  2XEV A;  3FUK A;  2NXP A;  2PQR A;  4WAF A;  2V5F A;  3U4T A;  4KZC A;  3MX3 A;  1E8W A;  3D9O A;  1FVF A;  2WXK A;  3JUI A;  3LXU X;  5FWQ A;  5CMW A;  4BSX A;  4LUN U;  2LAH A;  1SQM A;  2P58 C;  1S0P A;  2XPI A;  4CEM A;  2VTB B;  3MGB A;  3ESK A;  3LKU A;  4WND A;  2L0I A;  3PE4 A;  4O6F A;  4AJW A;  2KZT B;  1H19 A;  3PE3 A;  3PUK A;  3TAX A;  2PM6 A;  4EPZ A;  4I17 A;  4AY6 A;  3Q49 B;  3OXL A;  1UJJ A;  2UWJ G;  3RKV A;  2OVB A;  4B94 A;  3RRN B;  3R9A B;  3S7B A;  3TJP A;  3CVL A;  4AVX A;  5AIJ A;  5G04 J;  3C98 A;  2C0L A;  4CGW A;  4JHR A;  3P1U A;  3O48 A;  4EQF A;  4GYY A;  5T3R A;  4FJZ A;  3SGH A;  1H2T C;  3BG1 B;  3PRE A;  2MRI A;  1EF1 C;  4KT6 B;  3D9L A;  1PY1 A;  4BWR A;  4FA6 A;  2HYZ A;  2R17 C;  3ASF A;  2DIW A;  3HVE A;  4I1M A;  5DIZ A;  5JJT A;  3FTS A;  3HDX A;  4WNF A;  4CDN A;  1ELW A;  4KZ0 A;  3PEV B;  3ENE A;  2J09 A;  4AEZ C;  3GZ2 A;  2CHZ A;  2IF4 A;  2KCK A;  4BX8 A;  4DI4 A;  4E85 A;  3LJ3 A;  4A3T A;  4B0Z A;  5J90 A;  2OOE A;  2VSX E;  3CVQ A;  4JA7 A;  3MEK A;  4EEC A;  2J08 A;  5EX0 A;  2Y3A A;  4N3C A;  2XGO A;  4C0M A;  2PQN A;  4HLE A;  4I1O B;  3ZRH A;  3UMV A;  1PC2 A;  4L7T A;  4N5C A;  2I1K A;  4J8S A;  4ACK A;  5KJK A;  2L6J A;  2XHE A;  5C2Y A;  4A55 A;  3QWV A;  3RO3 A;  1ELR A;  3APF A;  3VLE A;  1HE8 A;  3FTV A;  4G2V A;  4BTA A;  1E90 A;  2VGY A;  4EBA A;  3CGH A;  1OWL A;  3ONL A;  3EHN A;  3ESL A;  4HOQ A;  2GRM A;  4DJA A;  4KVO A;  4XX5 A;  3ZHE B;  3ZPJ A;  5AYW D;  4APF A;  3AS5 A;  2GRL A;  1L5J A;  2L0T B;  3URZ A;  4YVQ C;  4HS2 A;  2CFU A;  5LX8 A;  1P5Q A;  1HS6 A;  4WNE A;  3E4B A;  3CLJ A;  4L1B A;  4GZD A;  4R7L A;  5JJ7 A;  4AM9 A;  1UG3 A;  3ZW3 A;  2WMN A;  3FTY A;  4EBA G;  5FZQ A;  3LYA A;  3QB2 A;  5BV0 A;  4H7Y A;  2KM4 A;  4I9C A;  3UT7 A;  3N71 A;  1SZ9 A;  2VGX B;  3CHS A;  3D9P A;  1UN8 A;  2HR2 A;  3FUD A;  2WM9 A;  5BUZ A;  4U0U A;  3IEG A;  3ML9 A;  4ILH B;  3D9N A;  4C9B B;  4JHJ A;  2A4Z A;  4XE0 A;  5G05 C;  2WXQ A;  4HOT A;  3G2V A;  4GCO A;  4K0R A;  5JJ6 A;  4MS6 A;  3UPV A;  2QFC A;  1EDU A;  2LAI A;  4ME2 A;  2WPV A;  4JC8 A;  2LNI A;  2R59 A;  4A1S A;  2WQ6 A;  3PVL A;  5T4Y A;  2VTB A;  4N2Q A;  1E8Z A;  3UQ3 A;  3CVP A;  3CVN A;  2WVI A;  4FHK A;  3HHM A;  3NF1 A;  4W9R A;  2IU1 A;  3CVU A;  3D9K A;  4YVO A;  2PL2 A;  3T5V A;  2WXM A;  3L17 A;  4PUC A;  2WXR A;  3U66 A;  4FP7 A;  3K9I A;  2XPY A;  4CT0 A;  1HO8 A;  5LCW J;  2Q7F A;  3L08 A;  3FU5 A;  2VYI A;  3QAR A;  3LVR E;  2X6K A;  3EHM A;  2CHX A;  1ZU2 A;  2YHE A;  3ZYQ A;  4G24 A;  3QNK A;  4AY5 A;  3FEY A;  5FZR A;  3CHO A;  3SI5 A;  4ACL A;  3OAW A;  5JHA A;  2WXI A;  3I4G A;  4AOF A;  4J0U A;  4XKB A;  3UX4 A;  4G23 A;  2NC9 A;  3AS8 A;  4AV7 A;  3Q5M A;  4WWP A;  5G55 A;  5ENN A;  3FTW A;  4ANX A;  2KCV A;  4CDM A;  4UWH A;  4A3V A;  3MV3 B;  3AU5 A;  5ARG A;  4G1T A;  3CVY A;  2RG8 A;  4L2L A;  4WNG A;  3CIA A;  4N39 A;  3ASH A;  2ZU6 B;  2KCL A;  3R7Q A;  1BPO A;  2ILR A;  3PZD A;  5AJD A;  4APO A;  4Q96 A;  3ZN3 A;  3QWP A;  3FP3 A;  4JPS A;  5CCM A;  1GW6 A;  4FUL A;  4JA9 A;  2BUG A;  3O4Z A;  3GW4 A;  1HH8 A;  1X5B A;  4I43 A;  5HI7 A;  3QOU A;  3RU0 A;  2GW1 A;  3ULQ A;  2X6F A;  5FZS A;  1VDY A;  2RD0 A;  3ASG A;  2OV8 A;  5FTP A;  3CQC B;  1JWG A;  4I2Z A;  4Q94 A;  2YNQ A;  4GMJ A;  2HO1 A;  3UUX A;  5BV1 A;  3QKY A;  4PH4 B;  1Z3X A;  4UWF A;  4DI3 A;  1Y8M A;  1MQS A;  3B7S A;  3FU0 A;  4GA2 A;  1JWF A;  3NQP A;  3MKQ B;  1N54 A;  4HXI A;  4J6I A;  2IQC A;  4FJY A;  2NSZ A;  5EKQ D;  1JUQ A;  5FQ6 A;  1OWP A;  1OWM A;  3APD A;  4KMO A;  2V4L A;  3IBE A;  2OVF A;  2I6H A;  4ABN A;  2VSY A;  1HFA A;  4GZ5 A;  5FT9 A;  5HQ8 A;  5A6C A;  4XI9 A;  4GAA A;  4N3B A;  3P2B A;  1HU3 A;  1QQE A;  5G2N A;  3SBT B;  3B7T A;  2LO6 A;  3B13 A;  3L16 A;  5A7D B;  4F7A A;  1E8X A;  3FH7 A;  3GZS A;  2IJG X;  4AIF A;  1NA0 A;  3PNT B;  3LPZ A;  3Q47 B;  4GZ3 A;  4JW1 A;  3ZYL A;  1B89 A;  1E7U A;  1KT1 A;  3GYZ A;  2QY7 A;  5LP0 A;  3BG0 B;  4IUL A;  3L6A A;  3NZS A;  4D10 C;  1NZN A;  4IRU A;  2LSV A;  1H2V C;  1HX8 A;  3CK7 A;  3EJN A;  3G2S A;  4MRU A;  5BNW A;  4J8D A;  4KYO B;  3VLD A;  3ZIM A;  1EPU A;  3ZVV A;  2J49 A;  4I9E A;  4ANU A;  3CK9 A;  3OTN A;  2OND A;  2I1J A;  4OYS A;  2JLB A;  3EDT B;  4UQY A;  3MYV A;  5DBK A;  3IKO B;  4M3O A;  3FHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...