3Q4AB

Crystal structure of the tpr domain of chip complexed with phosphorylated smad1 peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
132
structure length
132
Chain Sequence
SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STIP1 homology and U box-containing protein 1
publication title Molecular Mechanism of the Negative Regulation of Smad1/5 Protein by Carboxyl Terminus of Hsc70-interacting Protein (CHIP).
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/transcription
total genus 54
structure length 132
sequence length 132
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3q4aB00
3FP3A 4J8EA 2JLBA 5CCMA 2KCKA 3SF4A 4EQFA 4B94A 4JA9A 3AS4A 3Q49B 1P5QA 4N2QA 3BEEA 1YA0A 3Q5MA 5D0QD 2XCBA 3LY8A 5FJYA 1ZU2A 2FEZA 4HOSA 3UPVA 4H7XA 3ZN3A 4G25A 4F3VA 2I6HA 5G04J 3UQ3A 4HORA 3CEQA 3KAEA 1IYGA 3FFLA 4N5CA 5LCWC 5HQ8A 1Y8MA 4XIFA 2PZIA 2UWJG 4UI9K 3TAXA 5AYWD 4J0UA 3K9IA 5FZRA 4WNDA 1KT1A 4JHRA 3JYSA 4Y6WA 2PL2A 4G26A 3QKYA 3PDNA 1QQEA 2XGSA 4G2VA 2OOEA 3CV0A 4APOA 5C1DA 2C0MA 3ASFA 4WNGA 2VSNA 3AS8A 5EX0A 2VGYA 1QZ2A 3LY9A 3RIBA 3KS2A 5KJNA 1KT0A 4U04A 3QWVA 2YHCA 3LYAA 4KBQA 3PE3A 5D0OD 3QDNA 3QWWA 2QFCA 5G05C 3S7BA 3Q47B 2L6JA 2FI7A 5M72A 2XEVA 2UY1A 1W3BA 4UI9C 4CGVA 2Y4TA 3TG4A 2KCLA 4GPKA 3MA5A 3CK9A 2LSUA 1NZNA 3LPZA 3R9AB 3S7FA 3EDTB 3S7DA 1PC2A 4WNFA 3CK7A 4JA7A 4I9EA 2WQHA 3KD7A 3RO2A 3CVQA 2E2EA 2C0LA 4I2WA 3ZFWA 1XNFA 3TG5A 1NA0A 4GA2A 4HOQA 2Q7FA 3OXLA 2XCCA 4CDRA 4Y6CA 4GZ6A 2PQRA 4A1SA 4BWRA 3VTXA 3MEKA 2HO1A 3CVPA 3NF1A 4GA0A 4AIFA 2VGXA 4G23A 3CKBA 4YVOA 4JL0A 3QWPA 2KATA 4I9CA 3MV2B 2LSVA 5JJ7A 4N2SA 3AS5A 5FZSA 2PQNA 5A7DB 1HZ4A 4GA1A 3HYMB 4KXKB 2HR2A 2C2LA 4NRHB 5BW8C 2WPVA 4IN3B 4BTBA 3RO3A 4I17A 3CKCA 3FWVA 5JJ6A 5FT9A 3URZA 2AVPA 3O48A 4N3CA 4HOUA 2DBAA 4I2ZA 3U3WA 1WAO1 2J9QA 4RG9A 5EX3A 1A17A 3LKUA 3LCAA 5LCWJ 1HXIA 4YVQC 1ELWA 3MV3B 3OXFA 4G24A 5BNWA 2XPIA 2UY1B 2YQ8A 3GW4A 4CGWA 2R5SA 5CCLA 5DBKA 4U0ZA 4BTAA 3WXXA 5CHEE 1KLXA 2P58C 1IHGA 2IF4A 5KJLA 4AY6A 4N3BA 3UUXA 2XGOA 5FZQA 4J8DA 4O6FA 4BT9A 3GYZA 2KCVA 1B89A 4U07A 2VYIA 2FBNA 3SZ7A 2VGXB 5G05J 2Y4UA 3MKRA 5G04C 2VQ2A 4YNDA 5KJMA 2HYZA 4AM9A 2XGMA 4U0UA 1TJCA 3PE4A 4UI9J 3ASDA 4UQXA 5FTPA 4WNEA 4ME2A 4N3AA 4UQYA 1NA3A 4GZ5A 3VTYA 3ASGA 3N71A 3RU0A 5DIZA 3Q4AB 2FO7A 3E4BA 2NC9A 3GZ2A 3RJVA 4I1AA 3Q15A 1HH8A 4XI0A 4GYYA 4BT8A 4NQ0A 4LEUA 2V5FA 4GYOA 2LNIA 3CVLA 3IEGA 3ZGQA 5ARFA 3ULQA 4XI9A 2ONDA 4N39A 3CVNA 4U0SA 4GZ3A 1E96B 5JJTA 5ARGA 4KYOB 2IFUA 4W9RA 3LY7A 4ABNA 3ZHEB 2FF4A 5BT1A 1ZBPA 4J8FA 3U4TA 4WUYA 3GZ1A 3QOUA 4H7YA 3ZHEA 3ASHA 5KJKA 4GCOA 3RKVA 4HOTA 4AY5A 5EKQD 1OUVA 4GCNA 2KC7A 3S7JA 1FCHA 5HI7A 2BUGA 3TGOA 1WM5A 4UQZA 4RG6A 2VSYA 3OXGA 4GYWA 5A6CA 3CK8A 4G1TA 3ZPJA 2GW1A 3ESKA 1ELRA 2MHKA
chains in the Genus database with same CATH superfamily
3FP3A 4J8EA 3J5QB 3ZNGA 2JLBA 3EJNA 3FHEA 2X6KA 2KCKA 3HVEB 5ENNA 4FJZA 2WXHA 3NOCD 3HHMA 3Q49B 3CHQA 3DEPA 4BSXA 1NI1A 4N2QA 3BEEA 1YA0A 1V54E 3D9HA 3HVEA 1H2UA 1O1TA 2P9SG 2F0YA 3ZN3A 4HORA 3B13A 3PVLA 5FQ4A 2VTBB 4ANXA 5EYPF 1FVHA 5ENSD 1X81A 3TAXA 4J0UA 3K9IA 5FZRA 4WNDA 3JCKC 2ETBA 2P9IG 4BX9A 4J7WA 4JHRA 3TWXA 3HG0D 3HXBA 4QQIA 2XZTG 2WQ7A 4U96D 3HXFA 5C1DA 3V30A 4WNGA 5E75A 2V8SE 1U2VG 1QZ2A 3RAUA 4I6EA 2AXUA 4M3OA 4U04A 3E32A 5FQ6A 3QJZA 4IRUA 3UTMA 3PE3A 2QFCA 1E8ZA 1N4PA 3S7BA 4OAUC 3AG3E 4LCTA 4LSZE 4RVBA 3ZW3A 4URKA 3W9GA 4UI9C 4FP7A 4LUNU 3TG4A 2J08A 1HX8A 2KCLA 4TRQA 2WXMA 4HBDA 2J4BA 3EDTB 5D2MC 3W9FA 2DIWA 1LD7A 3RSEG 2MOWA 2OV8A 4WNFA 3NQPA 3LS8A 3D9LA 3KD7A 2ETAA 3EIQC 4A1GA 4YDEA 3D9JA 3ZFWA 1XNFA 5JMND 1N54A 4GA2A 1OT8A 3APCA 2NSZA 4LNBA 4B93B 4Y6CA 4EBAG 3ZXPA 3IV0A 2R17C 3Q7AA 3UT7A 5B3SE 5H7PA 3VTXA 2L0TB 2HO1A 4GA0A 2YHEA 4AIFA 4G23A 3WG7E 5IY5E 2KM4A 4J8YA 4JL0A 2B6CA 1YYHA 1HS6A 3FUJA 3KEZA 2XENA 2KZTB 5AAOA 5FZSA 4L2LA 2VSOE 5AQ7A 2WXKA 4GA1A 5BW8C 2WPVA 4IN3B 5B1AE 4EZJA 1E7UA 3AG2E 4OVVA 2KZTA 3FWVA 5JJ6A 1HE8A 2R05A 3APDA 3L17A 3RRUA 1WG0A 4NURA 4I2ZA 3TWQA 4RG9A 1Y6IA 1DCQA 3ZU7B 4TUUA 1INZA 3CQGB 1D8EA 1N52A 1UJJA 3OXFA 5CERB 4RLYA 3LVQE 2RG8A 3L13A 2YQ8A 3GW4A 4CGWA 3IBEA 2J8SD 4GTQA 4U0ZA 1MHQA 1KLXA 2P58C 3FU3A 2EILE 5CBNA 3MCXA 4K0RA 3ZKJA 1N0RA 3EU5A 4YDWA 2J49A 4AOFA 2JEKA 4GAAA 3MX3A 2X6FA 3D9IA 3TWVA 2R03A 3PREA 4U07A 2FBNA 3CLJA 3JQ1A 3BQOA 4DI3A 1S64A 2V4LA 2X38A 3QC1A 1SA4A 2WXIA 4YNDA 3PE4A 2KBXA 4UI9J 3Q78A 3ASDA 1S70B 4WNEA 4UUCA 1VDYA 4UWFA 4XZ4A 4DX2A 2LO6A 2GRNB 2IOLA 5ENQD 2XHEA 3NB2A 4A63B 1LD8A 3RU0A 5AARA 3MGBA 2FO7A 5LP0A 1FVFA 2XEHA 3ISMC 2RKKA 4GTMA 3HIZA 2NC9A 3IXEA 3GZ2A 3BU8A 3Q15A 3TJPA 4UWHA 4XI0A 3E33A 1TR4A 3VLEA 3SFZA 3APFA 4GTOA 4CYMD 2EIJE 1N94A 2ONDA 4JHKA 3CVNA 1OCZE 4JD2G 2F8XK 3AG4E 5JJTA 5FWQA 4W9RA 2VSXE 4IULA 5ANLA 4AVXA 4TXPA 4XEIG 4QFVA 2AXVA 1ZBPA 3G2TA 1JUQA 2WMOA 1SW6A 1TNOA 2BKGA 4PS8A 3C98A 2PNNA 3LDZA 3ML9A 3FULA 3Q7FA 5AJLA 1RW2A 2A5EA 4HOTA 3UI2A 2J4DA 4F1PA 2DWZA 3QNKA 1FCHA 5C2YA 3G2SA 4UQZA 4D10C 3FUFA 5G2NA 2ZIRA 3ZUVB 1S63A 4GTPA 1XGWA 3ASNE 4O60A 3AU4A 5ENOD 3DSXA 4KZ0A 3RK6A 5ENPD 5T4YA 5KBAA 1O1RA 1K1AA 5CCMA 5EIDA 4EQFA 1QYMA 3OAWA 2RFAA 4HXIA 4EZLA 5D0QD 4NACA 1L5JA 3LY8A 4B0ZA 4H7XA 1KZPA 4G25A 4F3VA 2NYJA 3ONLA 2I6HA 3UQ3A 2IO3C 5CECB 1LF8A 3FFLA 3QAQA 4FU3A 2AJAA 4MKTA 4MRUA 3BUAA 1Y8MA 1ELKA 4GTTA 2UWJG 3FY4A 3DEOA 4LERA 3PZ1A 2VJ8A 1HU3A 2GRLA 4BY6A 3CVWA 4DRXE 4I43A 4PS7A 5BXOA 3QKYA 3PDNA 1V55E 3TWUA 4OVUA 4APOA 2BTDA 4AV7A 2A4ZA 2WXFA 3JXJA 3UM1A 2WXOA 2VSNA 3AS8A 2PM7A 4HRLA 2VGYA 4CEMA 3UXGA 3KS2A 3L9TA 3DBSA 3NOGD 2Y1LE 4ZHBA 4KBQA 5D0OD 3B7SA 5LX8A 2LAHA 2Y3AA 1H6PA 3QWWA 3ABKE 3PS6A 2QYUA 4FA6A 5CMWA 2FI7A 2X6IA 3D9PA 5M72A 2XEVA 3FU5A 1O1SA 3D3MA 5JHAA 4GPKA 1N0QA 3JXIA 3MA5A 3QB2A 5KNHD 3FH7A 3TWWA 3CK9A 3R9AB 3S7FA 1E8WA 1PC2A 4JZYA 4FJYA 4MLPA 4A3TA 2C0LA 3TG5A 3JUEA 2Q7FA 3OXLA 4CDRA 2PQRA 3ULYA 4BWRA 2ZGDA 4GTSA 3MEKA 4U8VD 3ZYLA 3CVPA 3FTVA 1EPUA 4OAVB 2VGXA 1OWMA 3B7BA 3UM3A 2E0IA 4WWPA 2MYOA 4GTVA 3CKBA 4JW1A 4BX8A 2KATA 2XRZA 5JJ7A 3AS5A 1TNUA 1SQMA 3SD5A 5A7DB 3DSWA 2WXQA 4HI9A 2L9BA 4BTBA 4I17A 1OWPA 1SZAA 3OTNA 2IEJA 3VLDA 4AP2A 3O48A 4HOUA 1KPSB 3FU0A 2J9QA 4FADA 2WM9A 1A17A 1LTXA 3LKUA 4GZCA 3P1UA 3PZDA 1JCSA 4A55A 2FULA 4YVQC 5BXUA 3DSVA 4UWKA 3TXMA 1DC2A 1HO8A 3Q9UC 2XPZA 4DK5A 5KNGA 5EILA 2CG3A 4TXRA 4BTAA 1TEZA 3V79K 1IHGA 2IF4A 1EYHA 1UJKA 1MX4A 4JPSA 2XGOA 4C48B 5FZQA 4GTRA 2IO2C 3GYZA 1JWGA 2WXNA 2I1JA 2OEVA 3U66A 2Y4UA 3EU9A 4B8AA 2VQ2A 1UW4B 4GMLA 2VGEA 2QZAA 3Q79A 3FH5A 2XGMA 1ZB1A 3ZYQA 3IHVA 2M63A 5FTPA 3R7QA 2XRYA 3ABLE 3CGHA 4ME2A 2X3MA 2DZOA 1TNBA 4GZ5A 4G8KA 3SFXA 1A5EA 1AP7A 3CHOA 1OWLA 5ENRD 4ZFHA 4U7EB 1OWNA 1N95A 1SA5A 2IU1A 3MYVA 3RJVA 4CZ2D 1HH8A 3PZ3A 3SI5A 3FUMA 2CFZA 3PZ4A 4LEUA 2V5FA 2QYJA 2LNIA 1OCCE 2OCCE 4NIKA 4U0SA 4GZ3A 4F53A 3RRNB 2OVBA 3FH8A 2JABA 3UMVA 3S2AA 3ABME 3E34A 3B95A 4J8FA 3U4TA 3UIOC 4BFRA 3GZ1A 3QOUA 1D9SA 2P9UG 2GRRB 4GCOA 3CVVA 2H6FA 4AY5A 4CCAA 3I5PA 1K3ZD 4GMRA 4GCNA 1UG3A 3QARA 5HI7A 2DZNA 1N4QA 4YDYA 5BUZA 3FTZA 2XS1A 3ULEG 4ATZD 3LXUX 4GU5A 4HFGA 3L08A 4GMJA 1N11A 2XEEA 2MHKA 2B0OE 2QY7A 1E8XA 4HS2A 5HRYA 5T3RA 4XX5A 2EIKE 3UKRG 4BESA 2ZXWE 4CDMA 2WXPA 3FTYA 4U8HA 3LJ3A 3SF4A 3SNXA 4O1PA 2AXZA 2P9KG 1O5MA 3U64A 2R02A 3L16A 3R9MA 3Q5MA 5FJYA 1ZU2A 2FEZA 4HOSA 5FQ8A 2LXMA 3BG0B 2GRQB 3EHNA 2HE0A 2CHXA 5LCWC 5AN8A 1N9AA 5HQ8A 1HG2A 5G55A 3UM0A 3D9KA 1QBQA 2ZU6B 2XPYA 4YDOA 3UKUG 2I2OA 4CT0A 5AYWD 3FUKA 3CVXA 3P2BA 2NXPA 4JXTA 1YCSB 4K5BA 3L54A 2H6HA 4PUCA 1U3DA 3FU6A 4Y6WA 2PL2A 2YNQA 1JCRA 4APFA 1QQEA 1BPOA 2OOEA 1RZ4A 3ASFA 1UN9A 3C3OA 4F1SA 2LUHA 3NZSA 2LXLA 3EHMA 3BG1B 4EHMA 1E90A 3QWVA 4DX5D 3LYAA 2Y0BG 3QDNA 4DUIA 1TNZA 3TWTA 5G05C 4LRZA 4GB9A 3Q47B 2LAIA 4G11A 4XKCA 5CBOA 1BLXB 2R2LA 4K5CA 3C5RA 1TN8A 2UY1A 1W3BA 4L7TA 3DSUA 1PY1A 2IY0C 3FDHA 2LSUA 3CSTA 3V2OA 3LPZA 3IKOB 4AEZC 4I1OB 4I9EA 3HXEA 3AU5A 3RO2A 3ML8A 1G3NB 3CVQA 2E2EA 1MJ0A 1YMPA 4I2WA 4R7LA 5ANRA 1NA0A 1H2VC 5B1BE 1N4RA 4HOQA 3PRZA 4HLLA 5FIOA 1OCOE 1TJFA 4GZ6A 4A1SA 4F6RD 4C0MA 3CHRA 2R59A 3L6AA 3IHYA 4I6JA 4PDXA 4C0EA 1IQRA 2H6GA 3QWPA 3LVRE 2LSVA 3U9WA 2OVFA 4JB8P 5CEDB 3HYMB 4TV3A 4GPMA 2CG2A 1NL4A 4KXKB 2HR2A 2C2LA 3CIAA 4O1OA 2L0IA 4JC8A 2ILRA 3DXKG 3CVYA 3RRMB 1K8KG 3D9NA 3URZA 2AVPA 4N3CA 2DBAA 4A3VA 3U3WA 1HF8A 4L1BA 3LCAA 4OYSA 5LCWJ 2GRMA 4DI4A 3FUEA 5J08A 4HQDA 2GROB 1BI7B 2XPIA 1K1BA 4E6HA 2J09A 4BEPA 5KCMA 4ILIA 5AQAA 4LNUD 1BD8A 3V2XA 4EPZA 4K03A 4B89A 3TWSA 4TXQA 1TN7A 3WXXA 4L23A 2DYSE 5CHEE 1Z5SC 1MQSA 4ANVA 5KJLA 4AY6A 4DJAA 1PAQA 3G2VA 3C72A 3J5PA 1H6OA 4N3BA 2H6IA 2Y69E 3X2QE 3B7RL 4J8DA 4N5QA 1KZOA 2XS8A 2KCVA 3FUDA 1HG5A 4G8LA 3SZ7A 4DX1A 2VGXB 5G05J 3AAAC 2KXPC 3I4RB 5G04C 5KJMA 3CVUA 2BEDA 4AM9A 4U63A 2X6JA 3KEAA 4RSYA 3ZVVA 2WMNA 1TNYA 2F8YA 4EECA 5LOZA 4DX6D 4U8YD 3ZXSA 4ANUA 2ZGGA 3UM2A 3MZLB 4K5AB 5EYLA 3ASGA 3N71A 3SBTB 5DIZA 4HRMB 4HLEA 3Q4AB 4F7AA 4E85A 2WVIA 3CR3A 3DSSA 4X8QA 3UT4A 4C9BB 4I1AA 3FUNA 4TUMA 5FINA 5EIBE 3O4ZA 4NQ0A 2AWIA 1JPLA 3CVLA 4HNAD 3ULQA 3UT8A 5JHBA 4XKBA 3R7RA 3T9KA 4N39A 4KMOA 2VTBA 1SZ9A 3ESLA 1E96B 5ARGA 2IFUA 4ABNA 4BETA 3HXDA 3ZHEB 1IKND 1S0PA 3SHFA 3PEUB 1E7VA 3SBSA 4FHJA 4H7YA 3ZHEA 2CHWA 3ASHA 5KJKA 3CHMA 3ZYMA 1BI8B 4ACLA 1OCRE 5HKPA 3RKVA 5EKQD 4ANWA 4FLBA 2AW6A 2KC7A 3S7JA 3KSLA 2I9CA 3TGOA 2BUGA 2ZISA 3EUVA 5JA4D 1IHBA 3DPYA 1WM5A 4LG6A 2RD0A 3OXGA 4GYWA 5A6CA 3CK8A 4G1TA 3ZPJA 2L6BA 2GW1A 5AJDA 4MBGA 3E30A 3ESKA 2PM6A 1ELRA 1H6KA 1U3CA 4PH4B 1JWFA 3HRAA 2WB2A 3UIPC 3EHQA 4B94A 1TYQG 4JA9A 3AS4A 3F6QA 3FTXA 1P5QA 4WWOA 2WXLA 2GGFA 3T5VA 1OY3D 2XCBA 1NP7A 5J90A 1UOHA 4P29A 3HDXA 3UPVA 5G04J 3CEQA 3KAEA 1EDUA 3Q9NC 4V3IA 1IYGA 3VLFA 4N5CA 3PNTB 2WXGA 2V4HC 5HS0A 4XIFA 1WDYA 2PZIA 4WAFA 4FC8A 3ZYKA 4UI9K 3DPDA 4JEUA 3ASOE 1KT1A 1UN8A 1H0AA 3DRAA 3JYSA 4KVOA 1FT2A 2HM8A 3T5XA 4G26A 4WWNA 1E8YA 2XGSA 4G2VA 3CV0A 3CHPA 2C0MA 4DPRA 4JHJA 2F37A 2IOSA 4HI8A 5EDSA 5EX0A 3LY9A 4UWLA 3ZIMA 3RIBA 1BU9A 2WXJA 5KJNA 4Q94A 3CHSA 1KT0A 3ONKA 3EIJA 3FUIA 2I1KA 2YHCA 2GRPB 2L6JA 5BPPA 4FHKA 4J8SA 2Y4TA 4CGVA 5E76A 4LNGA 3TWRA 4BERA 1NZNA 1OWOA 4EZKA 1Z3YA 1N4SA 4AJWA 3S7DA 5FQ7A 3CK7A 4JA7A 3SY2A 1JCQA 2WQHA 3TXNA 5A23A 2J07A 3PUKA 5KWDA 1AWCB 3SQVA 2OEWA 4GZDA 4RQIA 5LFAA 4CT4A 2WXRA 2FO1E 3MJWA 4HRNA 2XCCA 3Q73A 5T8IA 1HFAA 3NF1A 4ILGA 5BV1A 5ITZF 2DCPA 3T8MA 3SGHA 3LEWA 3G2WA 4YVOA 3C3QA 2BF0X 3PNLB 1MYOA 2BKKB 4I9CA 3MV2B 4HVBA 4PS3A 4N2SA 4MS6A 1OXJA 2PQNA 1HZ4A 4M7CA 3QK0A 3ZRHA 3Q75A 1NFIE 4NRHB 2X6HA 4L9PA 3RO3A 1H19A 3CKCA 4XE0A 2XZDG 5FT9A 2P2CP 2P9PG 3SO8A 3EHRA 2V5QC 5ENTD 4JEHA 1WAO1 4JVSA 3FEYA 5EX3A 5AIJA 1SVXA 4ILHB 3FTUA 1DVPA 3UX4A 1HXIA 2IJGX 3FTWA 4ATGA 3L22A 1ELWA 3MV3B 4G24A 3FUHA 5BNWA 2UY1B 3UINC 1GW6A 5AENA 3MKQB 3V31A 2R5SA 5CCLA 4KT6B 5CRUA 5DBKA 2P9NG 4EBAA 3ZEFA 5BV0A 2DVWA 3I3NA 5AQ9A 2CFUA 1MZCA 2IONA 3MKQA 3FTSA 3NAWA 3D9MA 1DNPA 3B7UX 3UUXA 3I4GA 4U95D 2EQXA 2ETCA 4O6FA 4BT9A 3L82A 1Z3XA 2DYRE 1B89A 2VYIA 3AG1E 3T8KA 3MKRA 1H2TC 3DSTA 2HYZA 3E37A 3TL5A 4B8CB 4U0UA 1TJCA 4UQXA 3B7TA 3LJNA 4AXHA 1TN6A 2EIME 4CRWA 4N3AA 4UQYA 4DX7D 1NA3A 4ACKA 4CDNA 2EINE 4KVMA 3VTYA 3PZ2A 3KSQA 1FT1A 4DLQA 4FULA 3FEXA 3E4BA 3GZSA 2IQCA 1DCEA 1WY6A 2CHZA 3PEVB 5EN5D 3CQCB 4BT8A 4GYYA 3DWLG 4BSZB 3CSFA 4GYOA 4HB5A 3ENEA 3IEGA 3ZGQA 2V0PA 5ARFA 4I6GA 1Z6TA 4XI9A 1QNFA 1IQUA 2YINA 3PH0C 2QC9A 4UWGA 4J6IA 4KYOB 3JUIA 3LY7A 1IXVA 1Q2ZA 3NZUA 5CEAA 2FF4A 5BT1A 3SFYA 4L2YA 4I1MA 1EF1C 4DLOA 3HXCA 3PUJA 4WUYA 4IYPA 1FPPA 1X5BA 5CRVA 2RFMA 3AJIA 3NBNB 1MX2A 3JQ0A 1MX6A 4Q69A 4Z68A 3D9OA 2XQ0A 2P9LG 1OUVA 1D8DA 2MRIA 4KZCA 4RG6A 2VSYA 2WQ6A 2A5UA 5D66A 4FLHA 3DXMG 5AQBA 3G2UA 3C3RA 5CMYA 4Q96A
chains in the Genus database with same CATH topology
2QY7A 1E8XA 3RK6A 3FP3A 4J8EA 1JWFA 4HS2A 4PH4B 5T3RA 2WB2A 2JLBA 3EJNA 3FHEA 4XX5A 5T4YA 2X6KA 5CCMA 4CDMA 2KCKA 2WXPA 3FTYA 3HVEB 5ENNA 4U8HA 3LJ3A 3SF4A 4FJZA 2WXHA 4EQFA 4B94A 3SNXA 4JA9A 2AXZA 3AS4A 3HHMA 3Q49B 3CHQA 3OAWA 4BSXA 3FTXA 1P5QA 3U64A 4WWOA 2WXLA 4N2QA 3BEEA 2GGFA 3T5VA 4HXIA 4EZLA 1YA0A 3L16A 3Q5MA 5D0QD 4NACA 1L5JA 2XCBA 1NP7A 3LY8A 1ZU2A 2FEZA 5FJYA 4P29A 5J90A 4HOSA 3HVEA 1H2UA 3HDXA 4B0ZA 5FQ8A 3UPVA 4H7XA 3ZN3A 4G25A 4F3VA 3ONLA 2I6HA 5G04J 3UQ3A 4HORA 3CEQA 3KAEA 1EDUA 3BG0B 3B13A 4V3IA 1IYGA 3EHNA 2CHXA 3PVLA 1LF8A 3FFLA 3QAQA 4N5CA 4FU3A 5FQ4A 3VLFA 5LCWC 3PNTB 4MKTA 2VTBB 4MRUA 5HQ8A 1HG2A 5G55A 1Y8MA 2WXGA 4ANXA 4XIFA 1ELKA 2PZIA 4WAFA 3D9KA 2UWJG 2XPYA 2ZU6B 4FC8A 3ZYKA 2I2OA 4CT0A 1FVHA 3FY4A 4UI9K 3TAXA 3DPDA 4J0UA 5AYWD 3FUKA 3CVXA 3K9IA 5FZRA 3P2BA 2NXPA 4LERA 4JXTA 4JEUA 4WNDA 2VJ8A 1KT1A 1UN8A 1H0AA 3JCKC 4BX9A 1HU3A 2GRLA 3L54A 4JHRA 4BY6A 3JYSA 4PUCA 4KVOA 1U3DA 3CVWA 3FU6A 2HM8A 4Y6WA 2PL2A 3T5XA 4I43A 2YNQA 4PS7A 4G26A 4WWNA 3QKYA 2WQ7A 1E8YA 3PDNA 4APFA 1QQEA 2XGSA 1BPOA 4G2VA 2OOEA 3CV0A 4OVUA 4APOA 2BTDA 4AV7A 5C1DA 3CHPA 2A4ZA 2C0MA 2WXFA 3ASFA 1UN9A 4DPRA 4JHJA 4WNGA 2WXOA 2IOSA 2VSNA 3AS8A 4F1SA 2PM7A 5EDSA 5EX0A 5E75A 2V8SE 2VGYA 1QZ2A 3LY9A 4UWLA 3ZIMA 3RIBA 3KS2A 4CEMA 4I6EA 2WXJA 5KJNA 2AXUA 3DBSA 4Q94A 3NZSA 4M3OA 3CHSA 1KT0A 3EHMA 3BG1B 3ONKA 4U04A 5FQ6A 3QJZA 1E90A 3QWVA 3EIJA 4IRUA 3FUIA 2YHCA 2I1KA 3B7SA 3LYAA 3PE3A 2LAHA 2Y3AA 4KBQA 3QDNA 2QFCA 3QWWA 5D0OD 5LX8A 1E8ZA 5G05C 3PS6A 4LRZA 3S7BA 4FA6A 4GB9A 4LCTA 5CMWA 3Q47B 2L6JA 2LAIA 2FI7A 4G11A 4RVBA 5BPPA 3ZW3A 2X6IA 4XKCA 3D9PA 5M72A 4URKA 2XEVA 3FU5A 4FHKA 2UY1A 1W3BA 3D3MA 4UI9C 4FP7A 5JHAA 4J8SA 2Y4TA 1PY1A 4L7TA 2J08A 1HX8A 2KCLA 3MA5A 3QB2A 4LUNU 5E76A 3TG4A 4GPKA 3FDHA 3FH7A 3CK9A 4TRQA 2LSUA 2WXMA 3CSTA 1NZNA 1OWOA 3LPZA 2J4BA 3R9AB 3S7FA 3EDTB 4EZKA 1Z3YA 2DIWA 4AJWA 3S7DA 1E8WA 3IKOB 1PC2A 4AEZC 4JZYA 5FQ7A 2MOWA 4I1OB 2OV8A 4WNFA 3CK7A 4JA7A 4I9EA 3NQPA 3LS8A 2WQHA 3D9LA 3KD7A 3AU5A 3EIQC 4FJYA 4A1GA 3RO2A 3TXNA 4MLPA 3ML8A 5A23A 3D9JA 3CVQA 4A3TA 2E2EA 2C0LA 2J07A 3PUKA 4I2WA 4R7LA 1XNFA 3TG5A 3ZFWA 4GZDA 5ANRA 1NA0A 1H2VC 1N54A 5LFAA 4CT4A 2WXRA 4GA2A 3MJWA 3APCA 2NSZA 4HOQA 2Q7FA 3OXLA 3PRZA 2XCCA 4CDRA 4Y6CA 4EBAG 1TJFA 2R17C 2PQRA 3IV0A 4GZ6A 3UT7A 4A1SA 4BWRA 5T8IA 1HFAA 3VTXA 2L0TB 3MEKA 3ZYLA 2HO1A 3CVPA 3NF1A 4GA0A 2YHEA 3FTVA 4ILGA 4AIFA 4C0MA 5BV1A 1EPUA 2DCPA 1OWMA 2VGXA 4G23A 3T8MA 3CHRA 2R59A 2E0IA 3L6AA 4WWPA 3SGHA 3CKBA 4JW1A 3IHYA 3LEWA 4I6JA 4PDXA 3G2WA 4C0EA 1IQRA 2KM4A 4YVOA 4BX8A 4JL0A 2BF0X 3PNLB 3QWPA 2KATA 2XRZA 3LVRE 4I9CA 1HS6A 3MV2B 2LSVA 3FUJA 3KEZA 4HVBA 4PS3A 3U9WA 5JJ7A 2KZTB 3AS5A 4N2SA 3SD5A 1SQMA 2OVFA 4MS6A 5FZSA 2PQNA 2VSOE 4L2LA 5A7DB 1HZ4A 2WXKA 2WXQA 4GA1A 3HYMB 3QK0A 4TV3A 3ZRHA 2CG2A 4KXKB 2HR2A 2C2LA 3CIAA 2L9BA 4NRHB 5BW8C 2X6HA 2WPVA 4IN3B 4BTBA 4EZJA 1E7UA 3RO3A 4I17A 1OWPA 1H19A 1SZAA 2L0IA 2KZTA 3CKCA 1HE8A 3FWVA 4JC8A 4OVVA 3OTNA 4XE0A 5JJ6A 2ILRA 3APDA 3CVYA 5FT9A 3RRMB 3VLDA 3D9NA 3L17A 2AVPA 3URZA 4AP2A 3RRUA 3O48A 4N3CA 4NURA 4HOUA 2DBAA 4I2ZA 4JEHA 4A3VA 3U3WA 3FU0A 1WAO1 1HF8A 2J9QA 4FADA 4JVSA 4L1BA 4RG9A 2WM9A 3FEYA 5EX3A 1Y6IA 1A17A 5AIJA 3LKUA 4GZCA 3LCAA 4ILHB 3FTUA 1DVPA 4OYSA 5LCWJ 2GRMA 4TUUA 1INZA 3CQGB 3P1UA 3PZDA 3UX4A 1HXIA 4DI4A 3FUEA 2IJGX 5J08A 4A55A 2FULA 1N52A 3FTWA 3L22A 1ELWA 4YVQC 4ATGA 3MV3B 1UJJA 4UWKA 3TXMA 3OXFA 1HO8A 3LVQE 4G24A 3FUHA 2RG8A 5BNWA 2XPIA 2XPZA 3L13A 2UY1B 4DK5A 2YQ8A 1GW6A 3GW4A 4E6HA 2J09A 5KCMA 4ILIA 5AENA 4CGWA 4EPZA 3MKQB 4K03A 4B89A 3IBEA 2R5SA 5CCLA 2CG3A 4KT6B 5DBKA 4U0ZA 4EBAA 4BTAA 1MHQA 3WXXA 4L23A 5CHEE 1KLXA 3ZEFA 1TEZA 5BV0A 2P58C 1MQSA 3FU3A 4ANVA 1IHGA 3I3NA 2CFUA 3MCXA 2IF4A 5KJLA 4AY6A 4DJAA 2IONA 4K0RA 1PAQA 3MKQA 3G2VA 2J49A 3FTSA 1EYHA 4N3BA 4AOFA 3D9MA 2JEKA 1DNPA 4GAAA 1UJKA 3B7UX 3MX3A 4JPSA 3UUXA 2X6FA 3I4GA 2XGOA 2EQXA 3B7RL 3D9IA 5FZQA 4J8DA 4O6FA 4BT9A 3GYZA 1JWGA 1Z3XA 2KCVA 3FUDA 1B89A 2WXNA 1HG5A 3PREA 4U07A 2VYIA 2I1JA 2FBNA 3CLJA 3JQ1A 4CGVA 3SZ7A 4DI3A 3U66A 2VGXB 2V4LA 2X38A 5G05J 3QC1A 2Y4UA 3I4RB 3MKRA 5G04C 2WXIA 1H2TC 2VQ2A 4YNDA 4B8AA 5KJMA 3CVUA 2HYZA 1UW4B 4GMLA 3TL5A 4AM9A 4B8CB 4U63A 3FH5A 2XGMA 4U0UA 1TJCA 3PE4A 2X6JA 4UI9J 3ZYQA 4RSYA 3ASDA 3IHVA 4UQXA 2M63A 3B7TA 5FTPA 3ZVVA 3R7QA 4WNEA 4AXHA 2WMNA 2XRYA 4EECA 4UWFA 1VDYA 3CGHA 4ME2A 4N3AA 4UQYA 4XZ4A 2X3MA 5LOZA 4CRWA 2LO6A 3ZXSA 4ANUA 1NA3A 3MZLB 2IOLA 4ACKA 4CDNA 4GZ5A 4KVMA 2XHEA 3VTYA 3ASGA 3CHOA 3N71A 1OWLA 3RU0A 3SBTB 3MGBA 5DIZA 4HLEA 3Q4AB 1OWNA 2FO7A 4DLQA 4F7AA 5LP0A 1FVFA 4FULA 4E85A 3FEXA 2WVIA 3E4BA 3GZSA 2IU1A 2IQCA 1WY6A 2CHZA 3HIZA 3PEVB 2NC9A 3CR3A 3GZ2A 3MYVA 3UT4A 3RJVA 4C9BB 4I1AA 3Q15A 1HH8A 3CQCB 3TJPA 4UWHA 3FUNA 4XI0A 4GYYA 3SI5A 4BT8A 3FUMA 3VLEA 2CFZA 3SFZA 3O4ZA 4NQ0A 2AWIA 4LEUA 2V5FA 3APFA 3CSFA 4GYOA 1JPLA 2LNIA 3CVLA 3ENEA 3IEGA 3ZGQA 2V0PA 5ARFA 4I6GA 3ULQA 1Z6TA 3UT8A 5JHBA 4XI9A 2ONDA 1QNFA 4JHKA 4XKBA 3R7RA 1IQUA 4N39A 2YINA 3CVNA 3PH0C 4KMOA 4U0SA 2VTBA 4GZ3A 4F53A 1SZ9A 3ESLA 4UWGA 1E96B 4J6IA 3RRNB 5JJTA 5ARGA 4KYOB 5FWQA 2OVBA 3FH8A 3JUIA 2IFUA 4W9RA 3LY7A 2VSXE 4IULA 5ANLA 3S2AA 3UMVA 1S0PA 3ZHEB 4ABNA 4AVXA 3NZUA 2FF4A 4QFVA 3SHFA 2AXVA 5BT1A 4L2YA 3PEUB 1ZBPA 4J8FA 3G2TA 1E7VA 1JUQA 3U4TA 4I1MA 2WMOA 1EF1C 4DLOA 3SBSA 4BFRA 3PUJA 4PS8A 4FHJA 4WUYA 3GZ1A 3QOUA 4IYPA 1X5BA 3C98A 3ML9A 3LDZA 4H7YA 3ZHEA 2CHWA 3FULA 3ASHA 3JQ0A 4GCOA 3CHMA 5KJKA 3ZYMA 4Q69A 4ACLA 3D9OA 5AJLA 3RKVA 2XQ0A 4HOTA 3CVVA 4AY5A 5EKQD 4ANWA 2J4DA 4CCAA 3I5PA 4FLBA 2AW6A 1OUVA 4GCNA 2KC7A 3S7JA 3QNKA 1UG3A 3QARA 1FCHA 2I9CA 5HI7A 2BUGA 5C2YA 3TGOA 2MRIA 1WM5A 3G2SA 4UQZA 4D10C 4KZCA 4RG6A 3FUFA 5G2NA 5BUZA 2RD0A 2VSYA 3FTZA 3OXGA 4GYWA 5A6CA 2WQ6A 3LXUX 2A5UA 4FLHA 3CK8A 4GU5A 4G1TA 1XGWA 3ZPJA 2GW1A 3G2UA 5AJDA 4HFGA 3AU4A 3ESKA 3L08A 5CMYA 4GMJA 2PM6A 4Q96A 1ELRA 1H6KA 2MHKA 1U3CA 4KZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FP3 A;  4J8E A;  2JLB A;  5CCM A;  2KCK A;  3SF4 A;  4EQF A;  4B94 A;  4JA9 A;  3AS4 A;  3Q49 B;  1P5Q A;  4N2Q A;  3BEE A;  1YA0 A;  3Q5M A;  5D0Q D;  2XCB A;  3LY8 A;  5FJY A;  1ZU2 A;  2FEZ A;  4HOS A;  3UPV A;  4H7X A;  3ZN3 A;  4G25 A;  4F3V A;  2I6H A;  5G04 J;  3UQ3 A;  4HOR A;  3CEQ A;  3KAE A;  1IYG A;  3FFL A;  4N5C A;  5LCW C;  5HQ8 A;  1Y8M A;  4XIF A;  2PZI A;  2UWJ G;  4UI9 K;  3TAX A;  5AYW D;  4J0U A;  3K9I A;  5FZR A;  4WND A;  1KT1 A;  4JHR A;  3JYS A;  4Y6W A;  2PL2 A;  4G26 A;  3QKY A;  3PDN A;  1QQE A;  2XGS A;  4G2V A;  2OOE A;  3CV0 A;  4APO A;  5C1D A;  2C0M A;  3ASF A;  4WNG A;  2VSN A;  3AS8 A;  5EX0 A;  2VGY A;  1QZ2 A;  3LY9 A;  3RIB A;  3KS2 A;  5KJN A;  1KT0 A;  4U04 A;  3QWV A;  2YHC A;  3LYA A;  4KBQ A;  3PE3 A;  5D0O D;  3QDN A;  3QWW A;  2QFC A;  5G05 C;  3S7B A;  3Q47 B;  2L6J A;  2FI7 A;  5M72 A;  2XEV A;  2UY1 A;  1W3B A;  4UI9 C;  4CGV A;  2Y4T A;  3TG4 A;  2KCL A;  4GPK A;  3MA5 A;  3CK9 A;  2LSU A;  1NZN A;  3LPZ A;  3R9A B;  3S7F A;  3EDT B;  3S7D A;  1PC2 A;  4WNF A;  3CK7 A;  4JA7 A;  4I9E A;  2WQH A;  3KD7 A;  3RO2 A;  3CVQ A;  2E2E A;  2C0L A;  4I2W A;  3ZFW A;  1XNF A;  3TG5 A;  1NA0 A;  4GA2 A;  4HOQ A;  2Q7F A;  3OXL A;  2XCC A;  4CDR A;  4Y6C A;  4GZ6 A;  2PQR A;  4A1S A;  4BWR A;  3VTX A;  3MEK A;  2HO1 A;  3CVP A;  3NF1 A;  4GA0 A;  4AIF A;  2VGX A;  4G23 A;  3CKB A;  4YVO A;  4JL0 A;  3QWP A;  2KAT A;  4I9C A;  3MV2 B;  2LSV A;  5JJ7 A;  4N2S A;  3AS5 A;  5FZS A;  2PQN A;  5A7D B;  1HZ4 A;  4GA1 A;  3HYM B;  4KXK B;  2HR2 A;  2C2L A;  4NRH B;  5BW8 C;  2WPV A;  4IN3 B;  4BTB A;  3RO3 A;  4I17 A;  3CKC A;  3FWV A;  5JJ6 A;  5FT9 A;  3URZ A;  2AVP A;  3O48 A;  4N3C A;  4HOU A;  2DBA A;  4I2Z A;  3U3W A;  1WAO 1;  2J9Q A;  4RG9 A;  5EX3 A;  1A17 A;  3LKU A;  3LCA A;  5LCW J;  1HXI A;  4YVQ C;  1ELW A;  3MV3 B;  3OXF A;  4G24 A;  5BNW A;  2XPI A;  2UY1 B;  2YQ8 A;  3GW4 A;  4CGW A;  2R5S A;  5CCL A;  5DBK A;  4U0Z A;  4BTA A;  3WXX A;  5CHE E;  1KLX A;  2P58 C;  1IHG A;  2IF4 A;  5KJL A;  4AY6 A;  4N3B A;  3UUX A;  2XGO A;  5FZQ A;  4J8D A;  4O6F A;  4BT9 A;  3GYZ A;  2KCV A;  1B89 A;  4U07 A;  2VYI A;  2FBN A;  3SZ7 A;  2VGX B;  5G05 J;  2Y4U A;  3MKR A;  5G04 C;  2VQ2 A;  4YND A;  5KJM A;  2HYZ A;  4AM9 A;  2XGM A;  4U0U A;  1TJC A;  3PE4 A;  4UI9 J;  3ASD A;  4UQX A;  5FTP A;  4WNE A;  4ME2 A;  4N3A A;  4UQY A;  1NA3 A;  4GZ5 A;  3VTY A;  3ASG A;  3N71 A;  3RU0 A;  5DIZ A;  3Q4A B;  2FO7 A;  3E4B A;  2NC9 A;  3GZ2 A;  3RJV A;  4I1A A;  3Q15 A;  1HH8 A;  4XI0 A;  4GYY A;  4BT8 A;  4NQ0 A;  4LEU A;  2V5F A;  4GYO A;  2LNI A;  3CVL A;  3IEG A;  3ZGQ A;  5ARF A;  3ULQ A;  4XI9 A;  2OND A;  4N39 A;  3CVN A;  4U0S A;  4GZ3 A;  1E96 B;  5JJT A;  5ARG A;  4KYO B;  2IFU A;  4W9R A;  3LY7 A;  4ABN A;  3ZHE B;  2FF4 A;  5BT1 A;  1ZBP A;  4J8F A;  3U4T A;  4WUY A;  3GZ1 A;  3QOU A;  4H7Y A;  3ZHE A;  3ASH A;  5KJK A;  4GCO A;  3RKV A;  4HOT A;  4AY5 A;  5EKQ D;  1OUV A;  4GCN A;  2KC7 A;  3S7J A;  1FCH A;  5HI7 A;  2BUG A;  3TGO A;  1WM5 A;  4UQZ A;  4RG6 A;  2VSY A;  3OXG A;  4GYW A;  5A6C A;  3CK8 A;  4G1T A;  3ZPJ A;  2GW1 A;  3ESK A;  1ELR A;  2MHK A; 
#chains in the Genus database with same CATH topology
 3FP3 A;  4J8E A;  3J5Q B;  3ZNG A;  2JLB A;  3EJN A;  3FHE A;  2X6K A;  2KCK A;  3HVE B;  5ENN A;  4FJZ A;  2WXH A;  3NOC D;  3HHM A;  3Q49 B;  3CHQ A;  3DEP A;  4BSX A;  1NI1 A;  4N2Q A;  3BEE A;  1YA0 A;  1V54 E;  3D9H A;  3HVE A;  1H2U A;  1O1T A;  2P9S G;  2F0Y A;  3ZN3 A;  4HOR A;  3B13 A;  3PVL A;  5FQ4 A;  2VTB B;  4ANX A;  5EYP F;  1FVH A;  5ENS D;  1X81 A;  3TAX A;  4J0U A;  3K9I A;  5FZR A;  4WND A;  3JCK C;  2ETB A;  2P9I G;  4BX9 A;  4J7W A;  4JHR A;  3TWX A;  3HG0 D;  3HXB A;  4QQI A;  2XZT G;  2WQ7 A;  4U96 D;  3HXF A;  5C1D A;  3V30 A;  4WNG A;  5E75 A;  2V8S E;  1U2V G;  1QZ2 A;  3RAU A;  4I6E A;  2AXU A;  4M3O A;  4U04 A;  3E32 A;  5FQ6 A;  3QJZ A;  4IRU A;  3UTM A;  3PE3 A;  2QFC A;  1E8Z A;  1N4P A;  3S7B A;  4OAU C;  3AG3 E;  4LCT A;  4LSZ E;  4RVB A;  3ZW3 A;  4URK A;  3W9G A;  4UI9 C;  4FP7 A;  4LUN U;  3TG4 A;  2J08 A;  1HX8 A;  2KCL A;  4TRQ A;  2WXM A;  4HBD A;  2J4B A;  3EDT B;  5D2M C;  3W9F A;  2DIW A;  1LD7 A;  3RSE G;  2MOW A;  2OV8 A;  4WNF A;  3NQP A;  3LS8 A;  3D9L A;  3KD7 A;  2ETA A;  3EIQ C;  4A1G A;  4YDE A;  3D9J A;  3ZFW A;  1XNF A;  5JMN D;  1N54 A;  4GA2 A;  1OT8 A;  3APC A;  2NSZ A;  4LNB A;  4B93 B;  4Y6C A;  4EBA G;  3ZXP A;  3IV0 A;  2R17 C;  3Q7A A;  3UT7 A;  5B3S E;  5H7P A;  3VTX A;  2L0T B;  2HO1 A;  4GA0 A;  2YHE A;  4AIF A;  4G23 A;  3WG7 E;  5IY5 E;  2KM4 A;  4J8Y A;  4JL0 A;  2B6C A;  1YYH A;  1HS6 A;  3FUJ A;  3KEZ A;  2XEN A;  2KZT B;  5AAO A;  5FZS A;  4L2L A;  2VSO E;  5AQ7 A;  2WXK A;  4GA1 A;  5BW8 C;  2WPV A;  4IN3 B;  5B1A E;  4EZJ A;  1E7U A;  3AG2 E;  4OVV A;  2KZT A;  3FWV A;  5JJ6 A;  1HE8 A;  2R05 A;  3APD A;  3L17 A;  3RRU A;  1WG0 A;  4NUR A;  4I2Z A;  3TWQ A;  4RG9 A;  1Y6I A;  1DCQ A;  3ZU7 B;  4TUU A;  1INZ A;  3CQG B;  1D8E A;  1N52 A;  1UJJ A;  3OXF A;  5CER B;  4RLY A;  3LVQ E;  2RG8 A;  3L13 A;  2YQ8 A;  3GW4 A;  4CGW A;  3IBE A;  2J8S D;  4GTQ A;  4U0Z A;  1MHQ A;  1KLX A;  2P58 C;  3FU3 A;  2EIL E;  5CBN A;  3MCX A;  4K0R A;  3ZKJ A;  1N0R A;  3EU5 A;  4YDW A;  2J49 A;  4AOF A;  2JEK A;  4GAA A;  3MX3 A;  2X6F A;  3D9I A;  3TWV A;  2R03 A;  3PRE A;  4U07 A;  2FBN A;  3CLJ A;  3JQ1 A;  3BQO A;  4DI3 A;  1S64 A;  2V4L A;  2X38 A;  3QC1 A;  1SA4 A;  2WXI A;  4YND A;  3PE4 A;  2KBX A;  4UI9 J;  3Q78 A;  3ASD A;  1S70 B;  4WNE A;  4UUC A;  1VDY A;  4UWF A;  4XZ4 A;  4DX2 A;  2LO6 A;  2GRN B;  2IOL A;  5ENQ D;  2XHE A;  3NB2 A;  4A63 B;  1LD8 A;  3RU0 A;  5AAR A;  3MGB A;  2FO7 A;  5LP0 A;  1FVF A;  2XEH A;  3ISM C;  2RKK A;  4GTM A;  3HIZ A;  2NC9 A;  3IXE A;  3GZ2 A;  3BU8 A;  3Q15 A;  3TJP A;  4UWH A;  4XI0 A;  3E33 A;  1TR4 A;  3VLE A;  3SFZ A;  3APF A;  4GTO A;  4CYM D;  2EIJ E;  1N94 A;  2OND A;  4JHK A;  3CVN A;  1OCZ E;  4JD2 G;  2F8X K;  3AG4 E;  5JJT A;  5FWQ A;  4W9R A;  2VSX E;  4IUL A;  5ANL A;  4AVX A;  4TXP A;  4XEI G;  4QFV A;  2AXV A;  1ZBP A;  3G2T A;  1JUQ A;  2WMO A;  1SW6 A;  1TNO A;  2BKG A;  4PS8 A;  3C98 A;  2PNN A;  3LDZ A;  3ML9 A;  3FUL A;  3Q7F A;  5AJL A;  1RW2 A;  2A5E A;  4HOT A;  3UI2 A;  2J4D A;  4F1P A;  2DWZ A;  3QNK A;  1FCH A;  5C2Y A;  3G2S A;  4UQZ A;  4D10 C;  3FUF A;  5G2N A;  2ZIR A;  3ZUV B;  1S63 A;  4GTP A;  1XGW A;  3ASN E;  4O60 A;  3AU4 A;  5ENO D;  3DSX A;  4KZ0 A;  3RK6 A;  5ENP D;  5T4Y A;  5KBA A;  1O1R A;  1K1A A;  5CCM A;  5EID A;  4EQF A;  1QYM A;  3OAW A;  2RFA A;  4HXI A;  4EZL A;  5D0Q D;  4NAC A;  1L5J A;  3LY8 A;  4B0Z A;  4H7X A;  1KZP A;  4G25 A;  4F3V A;  2NYJ A;  3ONL A;  2I6H A;  3UQ3 A;  2IO3 C;  5CEC B;  1LF8 A;  3FFL A;  3QAQ A;  4FU3 A;  2AJA A;  4MKT A;  4MRU A;  3BUA A;  1Y8M A;  1ELK A;  4GTT A;  2UWJ G;  3FY4 A;  3DEO A;  4LER A;  3PZ1 A;  2VJ8 A;  1HU3 A;  2GRL A;  4BY6 A;  3CVW A;  4DRX E;  4I43 A;  4PS7 A;  5BXO A;  3QKY A;  3PDN A;  1V55 E;  3TWU A;  4OVU A;  4APO A;  2BTD A;  4AV7 A;  2A4Z A;  2WXF A;  3JXJ A;  3UM1 A;  2WXO A;  2VSN A;  3AS8 A;  2PM7 A;  4HRL A;  2VGY A;  4CEM A;  3UXG A;  3KS2 A;  3L9T A;  3DBS A;  3NOG D;  2Y1L E;  4ZHB A;  4KBQ A;  5D0O D;  3B7S A;  5LX8 A;  2LAH A;  2Y3A A;  1H6P A;  3QWW A;  3ABK E;  3PS6 A;  2QYU A;  4FA6 A;  5CMW A;  2FI7 A;  2X6I A;  3D9P A;  5M72 A;  2XEV A;  3FU5 A;  1O1S A;  3D3M A;  5JHA A;  4GPK A;  1N0Q A;  3JXI A;  3MA5 A;  3QB2 A;  5KNH D;  3FH7 A;  3TWW A;  3CK9 A;  3R9A B;  3S7F A;  1E8W A;  1PC2 A;  4JZY A;  4FJY A;  4MLP A;  4A3T A;  2C0L A;  3TG5 A;  3JUE A;  2Q7F A;  3OXL A;  4CDR A;  2PQR A;  3ULY A;  4BWR A;  2ZGD A;  4GTS A;  3MEK A;  4U8V D;  3ZYL A;  3CVP A;  3FTV A;  1EPU A;  4OAV B;  2VGX A;  1OWM A;  3B7B A;  3UM3 A;  2E0I A;  4WWP A;  2MYO A;  4GTV A;  3CKB A;  4JW1 A;  4BX8 A;  2KAT A;  2XRZ A;  5JJ7 A;  3AS5 A;  1TNU A;  1SQM A;  3SD5 A;  5A7D B;  3DSW A;  2WXQ A;  4HI9 A;  2L9B A;  4BTB A;  4I17 A;  1OWP A;  1SZA A;  3OTN A;  2IEJ A;  3VLD A;  4AP2 A;  3O48 A;  4HOU A;  1KPS B;  3FU0 A;  2J9Q A;  4FAD A;  2WM9 A;  1A17 A;  1LTX A;  3LKU A;  4GZC A;  3P1U A;  3PZD A;  1JCS A;  4A55 A;  2FUL A;  4YVQ C;  5BXU A;  3DSV A;  4UWK A;  3TXM A;  1DC2 A;  1HO8 A;  3Q9U C;  2XPZ A;  4DK5 A;  5KNG A;  5EIL A;  2CG3 A;  4TXR A;  4BTA A;  1TEZ A;  3V79 K;  1IHG A;  2IF4 A;  1EYH A;  1UJK A;  1MX4 A;  4JPS A;  2XGO A;  4C48 B;  5FZQ A;  4GTR A;  2IO2 C;  3GYZ A;  1JWG A;  2WXN A;  2I1J A;  2OEV A;  3U66 A;  2Y4U A;  3EU9 A;  4B8A A;  2VQ2 A;  1UW4 B;  4GML A;  2VGE A;  2QZA A;  3Q79 A;  3FH5 A;  2XGM A;  1ZB1 A;  3ZYQ A;  3IHV A;  2M63 A;  5FTP A;  3R7Q A;  2XRY A;  3ABL E;  3CGH A;  4ME2 A;  2X3M A;  2DZO A;  1TNB A;  4GZ5 A;  4G8K A;  3SFX A;  1A5E A;  1AP7 A;  3CHO A;  1OWL A;  5ENR D;  4ZFH A;  4U7E B;  1OWN A;  1N95 A;  1SA5 A;  2IU1 A;  3MYV A;  3RJV A;  4CZ2 D;  1HH8 A;  3PZ3 A;  3SI5 A;  3FUM A;  2CFZ A;  3PZ4 A;  4LEU A;  2V5F A;  2QYJ A;  2LNI A;  1OCC E;  2OCC E;  4NIK A;  4U0S A;  4GZ3 A;  4F53 A;  3RRN B;  2OVB A;  3FH8 A;  2JAB A;  3UMV A;  3S2A A;  3ABM E;  3E34 A;  3B95 A;  4J8F A;  3U4T A;  3UIO C;  4BFR A;  3GZ1 A;  3QOU A;  1D9S A;  2P9U G;  2GRR B;  4GCO A;  3CVV A;  2H6F A;  4AY5 A;  4CCA A;  3I5P A;  1K3Z D;  4GMR A;  4GCN A;  1UG3 A;  3QAR A;  5HI7 A;  2DZN A;  1N4Q A;  4YDY A;  5BUZ A;  3FTZ A;  2XS1 A;  3ULE G;  4ATZ D;  3LXU X;  4GU5 A;  4HFG A;  3L08 A;  4GMJ A;  1N11 A;  2XEE A;  2MHK A;  2B0O E;  2QY7 A;  1E8X A;  4HS2 A;  5HRY A;  5T3R A;  4XX5 A;  2EIK E;  3UKR G;  4BES A;  2ZXW E;  4CDM A;  2WXP A;  3FTY A;  4U8H A;  3LJ3 A;  3SF4 A;  3SNX A;  4O1P A;  2AXZ A;  2P9K G;  1O5M A;  3U64 A;  2R02 A;  3L16 A;  3R9M A;  3Q5M A;  5FJY A;  1ZU2 A;  2FEZ A;  4HOS A;  5FQ8 A;  2LXM A;  3BG0 B;  2GRQ B;  3EHN A;  2HE0 A;  2CHX A;  5LCW C;  5AN8 A;  1N9A A;  5HQ8 A;  1HG2 A;  5G55 A;  3UM0 A;  3D9K A;  1QBQ A;  2ZU6 B;  2XPY A;  4YDO A;  3UKU G;  2I2O A;  4CT0 A;  5AYW D;  3FUK A;  3CVX A;  3P2B A;  2NXP A;  4JXT A;  1YCS B;  4K5B A;  3L54 A;  2H6H A;  4PUC A;  1U3D A;  3FU6 A;  4Y6W A;  2PL2 A;  2YNQ A;  1JCR A;  4APF A;  1QQE A;  1BPO A;  2OOE A;  1RZ4 A;  3ASF A;  1UN9 A;  3C3O A;  4F1S A;  2LUH A;  3NZS A;  2LXL A;  3EHM A;  3BG1 B;  4EHM A;  1E90 A;  3QWV A;  4DX5 D;  3LYA A;  2Y0B G;  3QDN A;  4DUI A;  1TNZ A;  3TWT A;  5G05 C;  4LRZ A;  4GB9 A;  3Q47 B;  2LAI A;  4G11 A;  4XKC A;  5CBO A;  1BLX B;  2R2L A;  4K5C A;  3C5R A;  1TN8 A;  2UY1 A;  1W3B A;  4L7T A;  3DSU A;  1PY1 A;  2IY0 C;  3FDH A;  2LSU A;  3CST A;  3V2O A;  3LPZ A;  3IKO B;  4AEZ C;  4I1O B;  4I9E A;  3HXE A;  3AU5 A;  3RO2 A;  3ML8 A;  1G3N B;  3CVQ A;  2E2E A;  1MJ0 A;  1YMP A;  4I2W A;  4R7L A;  5ANR A;  1NA0 A;  1H2V C;  5B1B E;  1N4R A;  4HOQ A;  3PRZ A;  4HLL A;  5FIO A;  1OCO E;  1TJF A;  4GZ6 A;  4A1S A;  4F6R D;  4C0M A;  3CHR A;  2R59 A;  3L6A A;  3IHY A;  4I6J A;  4PDX A;  4C0E A;  1IQR A;  2H6G A;  3QWP A;  3LVR E;  2LSV A;  3U9W A;  2OVF A;  4JB8 P;  5CED B;  3HYM B;  4TV3 A;  4GPM A;  2CG2 A;  1NL4 A;  4KXK B;  2HR2 A;  2C2L A;  3CIA A;  4O1O A;  2L0I A;  4JC8 A;  2ILR A;  3DXK G;  3CVY A;  3RRM B;  1K8K G;  3D9N A;  3URZ A;  2AVP A;  4N3C A;  2DBA A;  4A3V A;  3U3W A;  1HF8 A;  4L1B A;  3LCA A;  4OYS A;  5LCW J;  2GRM A;  4DI4 A;  3FUE A;  5J08 A;  4HQD A;  2GRO B;  1BI7 B;  2XPI A;  1K1B A;  4E6H A;  2J09 A;  4BEP A;  5KCM A;  4ILI A;  5AQA A;  4LNU D;  1BD8 A;  3V2X A;  4EPZ A;  4K03 A;  4B89 A;  3TWS A;  4TXQ A;  1TN7 A;  3WXX A;  4L23 A;  2DYS E;  5CHE E;  1Z5S C;  1MQS A;  4ANV A;  5KJL A;  4AY6 A;  4DJA A;  1PAQ A;  3G2V A;  3C72 A;  3J5P A;  1H6O A;  4N3B A;  2H6I A;  2Y69 E;  3X2Q E;  3B7R L;  4J8D A;  4N5Q A;  1KZO A;  2XS8 A;  2KCV A;  3FUD A;  1HG5 A;  4G8L A;  3SZ7 A;  4DX1 A;  2VGX B;  5G05 J;  3AAA C;  2KXP C;  3I4R B;  5G04 C;  5KJM A;  3CVU A;  2BED A;  4AM9 A;  4U63 A;  2X6J A;  3KEA A;  4RSY A;  3ZVV A;  2WMN A;  1TNY A;  2F8Y A;  4EEC A;  5LOZ A;  4DX6 D;  4U8Y D;  3ZXS A;  4ANU A;  2ZGG A;  3UM2 A;  3MZL B;  4K5A B;  5EYL A;  3ASG A;  3N71 A;  3SBT B;  5DIZ A;  4HRM B;  4HLE A;  3Q4A B;  4F7A A;  4E85 A;  2WVI A;  3CR3 A;  3DSS A;  4X8Q A;  3UT4 A;  4C9B B;  4I1A A;  3FUN A;  4TUM A;  5FIN A;  5EIB E;  3O4Z A;  4NQ0 A;  2AWI A;  1JPL A;  3CVL A;  4HNA D;  3ULQ A;  3UT8 A;  5JHB A;  4XKB A;  3R7R A;  3T9K A;  4N39 A;  4KMO A;  2VTB A;  1SZ9 A;  3ESL A;  1E96 B;  5ARG A;  2IFU A;  4ABN A;  4BET A;  3HXD A;  3ZHE B;  1IKN D;  1S0P A;  3SHF A;  3PEU B;  1E7V A;  3SBS A;  4FHJ A;  4H7Y A;  3ZHE A;  2CHW A;  3ASH A;  5KJK A;  3CHM A;  3ZYM A;  1BI8 B;  4ACL A;  1OCR E;  5HKP A;  3RKV A;  5EKQ D;  4ANW A;  4FLB A;  2AW6 A;  2KC7 A;  3S7J A;  3KSL A;  2I9C A;  3TGO A;  2BUG A;  2ZIS A;  3EUV A;  5JA4 D;  1IHB A;  3DPY A;  1WM5 A;  4LG6 A;  2RD0 A;  3OXG A;  4GYW A;  5A6C A;  3CK8 A;  4G1T A;  3ZPJ A;  2L6B A;  2GW1 A;  5AJD A;  4MBG A;  3E30 A;  3ESK A;  2PM6 A;  1ELR A;  1H6K A;  1U3C A;  4PH4 B;  1JWF A;  3HRA A;  2WB2 A;  3UIP C;  3EHQ A;  4B94 A;  1TYQ G;  4JA9 A;  3AS4 A;  3F6Q A;  3FTX A;  1P5Q A;  4WWO A;  2WXL A;  2GGF A;  3T5V A;  1OY3 D;  2XCB A;  1NP7 A;  5J90 A;  1UOH A;  4P29 A;  3HDX A;  3UPV A;  5G04 J;  3CEQ A;  3KAE A;  1EDU A;  3Q9N C;  4V3I A;  1IYG A;  3VLF A;  4N5C A;  3PNT B;  2WXG A;  2V4H C;  5HS0 A;  4XIF A;  1WDY A;  2PZI A;  4WAF A;  4FC8 A;  3ZYK A;  4UI9 K;  3DPD A;  4JEU A;  3ASO E;  1KT1 A;  1UN8 A;  1H0A A;  3DRA A;  3JYS A;  4KVO A;  1FT2 A;  2HM8 A;  3T5X A;  4G26 A;  4WWN A;  1E8Y A;  2XGS A;  4G2V A;  3CV0 A;  3CHP A;  2C0M A;  4DPR A;  4JHJ A;  2F37 A;  2IOS A;  4HI8 A;  5EDS A;  5EX0 A;  3LY9 A;  4UWL A;  3ZIM A;  3RIB A;  1BU9 A;  2WXJ A;  5KJN A;  4Q94 A;  3CHS A;  1KT0 A;  3ONK A;  3EIJ A;  3FUI A;  2I1K A;  2YHC A;  2GRP B;  2L6J A;  5BPP A;  4FHK A;  4J8S A;  2Y4T A;  4CGV A;  5E76 A;  4LNG A;  3TWR A;  4BER A;  1NZN A;  1OWO A;  4EZK A;  1Z3Y A;  1N4S A;  4AJW A;  3S7D A;  5FQ7 A;  3CK7 A;  4JA7 A;  3SY2 A;  1JCQ A;  2WQH A;  3TXN A;  5A23 A;  2J07 A;  3PUK A;  5KWD A;  1AWC B;  3SQV A;  2OEW A;  4GZD A;  4RQI A;  5LFA A;  4CT4 A;  2WXR A;  2FO1 E;  3MJW A;  4HRN A;  2XCC A;  3Q73 A;  5T8I A;  1HFA A;  3NF1 A;  4ILG A;  5BV1 A;  5ITZ F;  2DCP A;  3T8M A;  3SGH A;  3LEW A;  3G2W A;  4YVO A;  3C3Q A;  2BF0 X;  3PNL B;  1MYO A;  2BKK B;  4I9C A;  3MV2 B;  4HVB A;  4PS3 A;  4N2S A;  4MS6 A;  1OXJ A;  2PQN A;  1HZ4 A;  4M7C A;  3QK0 A;  3ZRH A;  3Q75 A;  1NFI E;  4NRH B;  2X6H A;  4L9P A;  3RO3 A;  1H19 A;  3CKC A;  4XE0 A;  2XZD G;  5FT9 A;  2P2C P;  2P9P G;  3SO8 A;  3EHR A;  2V5Q C;  5ENT D;  4JEH A;  1WAO 1;  4JVS A;  3FEY A;  5EX3 A;  5AIJ A;  1SVX A;  4ILH B;  3FTU A;  1DVP A;  3UX4 A;  1HXI A;  2IJG X;  3FTW A;  4ATG A;  3L22 A;  1ELW A;  3MV3 B;  4G24 A;  3FUH A;  5BNW A;  2UY1 B;  3UIN C;  1GW6 A;  5AEN A;  3MKQ B;  3V31 A;  2R5S A;  5CCL A;  4KT6 B;  5CRU A;  5DBK A;  2P9N G;  4EBA A;  3ZEF A;  5BV0 A;  2DVW A;  3I3N A;  5AQ9 A;  2CFU A;  1MZC A;  2ION A;  3MKQ A;  3FTS A;  3NAW A;  3D9M A;  1DNP A;  3B7U X;  3UUX A;  3I4G A;  4U95 D;  2EQX A;  2ETC A;  4O6F A;  4BT9 A;  3L82 A;  1Z3X A;  2DYR E;  1B89 A;  2VYI A;  3AG1 E;  3T8K A;  3MKR A;  1H2T C;  3DST A;  2HYZ A;  3E37 A;  3TL5 A;  4B8C B;  4U0U A;  1TJC A;  4UQX A;  3B7T A;  3LJN A;  4AXH A;  1TN6 A;  2EIM E;  4CRW A;  4N3A A;  4UQY A;  4DX7 D;  1NA3 A;  4ACK A;  4CDN A;  2EIN E;  4KVM A;  3VTY A;  3PZ2 A;  3KSQ A;  1FT1 A;  4DLQ A;  4FUL A;  3FEX A;  3E4B A;  3GZS A;  2IQC A;  1DCE A;  1WY6 A;  2CHZ A;  3PEV B;  5EN5 D;  3CQC B;  4BT8 A;  4GYY A;  3DWL G;  4BSZ B;  3CSF A;  4GYO A;  4HB5 A;  3ENE A;  3IEG A;  3ZGQ A;  2V0P A;  5ARF A;  4I6G A;  1Z6T A;  4XI9 A;  1QNF A;  1IQU A;  2YIN A;  3PH0 C;  2QC9 A;  4UWG A;  4J6I A;  4KYO B;  3JUI A;  3LY7 A;  1IXV A;  1Q2Z A;  3NZU A;  5CEA A;  2FF4 A;  5BT1 A;  3SFY A;  4L2Y A;  4I1M A;  1EF1 C;  4DLO A;  3HXC A;  3PUJ A;  4WUY A;  4IYP A;  1FPP A;  1X5B A;  5CRV A;  2RFM A;  3AJI A;  3NBN B;  1MX2 A;  3JQ0 A;  1MX6 A;  4Q69 A;  4Z68 A;  3D9O A;  2XQ0 A;  2P9L G;  1OUV A;  1D8D A;  2MRI A;  4KZC A;  4RG6 A;  2VSY A;  2WQ6 A;  2A5U A;  5D66 A;  4FLH A;  3DXM G;  5AQB A;  3G2U A;  3C3R A;  5CMY A;  4Q96 A; 
#chains in the Genus database with same CATH homology
 2QY7 A;  1E8X A;  3RK6 A;  3FP3 A;  4J8E A;  1JWF A;  4HS2 A;  4PH4 B;  5T3R A;  2WB2 A;  2JLB A;  3EJN A;  3FHE A;  4XX5 A;  5T4Y A;  2X6K A;  5CCM A;  4CDM A;  2KCK A;  2WXP A;  3FTY A;  3HVE B;  5ENN A;  4U8H A;  3LJ3 A;  3SF4 A;  4FJZ A;  2WXH A;  4EQF A;  4B94 A;  3SNX A;  4JA9 A;  2AXZ A;  3AS4 A;  3HHM A;  3Q49 B;  3CHQ A;  3OAW A;  4BSX A;  3FTX A;  1P5Q A;  3U64 A;  4WWO A;  2WXL A;  4N2Q A;  3BEE A;  2GGF A;  3T5V A;  4HXI A;  4EZL A;  1YA0 A;  3L16 A;  3Q5M A;  5D0Q D;  4NAC A;  1L5J A;  2XCB A;  1NP7 A;  3LY8 A;  1ZU2 A;  2FEZ A;  5FJY A;  4P29 A;  5J90 A;  4HOS A;  3HVE A;  1H2U A;  3HDX A;  4B0Z A;  5FQ8 A;  3UPV A;  4H7X A;  3ZN3 A;  4G25 A;  4F3V A;  3ONL A;  2I6H A;  5G04 J;  3UQ3 A;  4HOR A;  3CEQ A;  3KAE A;  1EDU A;  3BG0 B;  3B13 A;  4V3I A;  1IYG A;  3EHN A;  2CHX A;  3PVL A;  1LF8 A;  3FFL A;  3QAQ A;  4N5C A;  4FU3 A;  5FQ4 A;  3VLF A;  5LCW C;  3PNT B;  4MKT A;  2VTB B;  4MRU A;  5HQ8 A;  1HG2 A;  5G55 A;  1Y8M A;  2WXG A;  4ANX A;  4XIF A;  1ELK A;  2PZI A;  4WAF A;  3D9K A;  2UWJ G;  2XPY A;  2ZU6 B;  4FC8 A;  3ZYK A;  2I2O A;  4CT0 A;  1FVH A;  3FY4 A;  4UI9 K;  3TAX A;  3DPD A;  4J0U A;  5AYW D;  3FUK A;  3CVX A;  3K9I A;  5FZR A;  3P2B A;  2NXP A;  4LER A;  4JXT A;  4JEU A;  4WND A;  2VJ8 A;  1KT1 A;  1UN8 A;  1H0A A;  3JCK C;  4BX9 A;  1HU3 A;  2GRL A;  3L54 A;  4JHR A;  4BY6 A;  3JYS A;  4PUC A;  4KVO A;  1U3D A;  3CVW A;  3FU6 A;  2HM8 A;  4Y6W A;  2PL2 A;  3T5X A;  4I43 A;  2YNQ A;  4PS7 A;  4G26 A;  4WWN A;  3QKY A;  2WQ7 A;  1E8Y A;  3PDN A;  4APF A;  1QQE A;  2XGS A;  1BPO A;  4G2V A;  2OOE A;  3CV0 A;  4OVU A;  4APO A;  2BTD A;  4AV7 A;  5C1D A;  3CHP A;  2A4Z A;  2C0M A;  2WXF A;  3ASF A;  1UN9 A;  4DPR A;  4JHJ A;  4WNG A;  2WXO A;  2IOS A;  2VSN A;  3AS8 A;  4F1S A;  2PM7 A;  5EDS A;  5EX0 A;  5E75 A;  2V8S E;  2VGY A;  1QZ2 A;  3LY9 A;  4UWL A;  3ZIM A;  3RIB A;  3KS2 A;  4CEM A;  4I6E A;  2WXJ A;  5KJN A;  2AXU A;  3DBS A;  4Q94 A;  3NZS A;  4M3O A;  3CHS A;  1KT0 A;  3EHM A;  3BG1 B;  3ONK A;  4U04 A;  5FQ6 A;  3QJZ A;  1E90 A;  3QWV A;  3EIJ A;  4IRU A;  3FUI A;  2YHC A;  2I1K A;  3B7S A;  3LYA A;  3PE3 A;  2LAH A;  2Y3A A;  4KBQ A;  3QDN A;  2QFC A;  3QWW A;  5D0O D;  5LX8 A;  1E8Z A;  5G05 C;  3PS6 A;  4LRZ A;  3S7B A;  4FA6 A;  4GB9 A;  4LCT A;  5CMW A;  3Q47 B;  2L6J A;  2LAI A;  2FI7 A;  4G11 A;  4RVB A;  5BPP A;  3ZW3 A;  2X6I A;  4XKC A;  3D9P A;  5M72 A;  4URK A;  2XEV A;  3FU5 A;  4FHK A;  2UY1 A;  1W3B A;  3D3M A;  4UI9 C;  4FP7 A;  5JHA A;  4J8S A;  2Y4T A;  1PY1 A;  4L7T A;  2J08 A;  1HX8 A;  2KCL A;  3MA5 A;  3QB2 A;  4LUN U;  5E76 A;  3TG4 A;  4GPK A;  3FDH A;  3FH7 A;  3CK9 A;  4TRQ A;  2LSU A;  2WXM A;  3CST A;  1NZN A;  1OWO A;  3LPZ A;  2J4B A;  3R9A B;  3S7F A;  3EDT B;  4EZK A;  1Z3Y A;  2DIW A;  4AJW A;  3S7D A;  1E8W A;  3IKO B;  1PC2 A;  4AEZ C;  4JZY A;  5FQ7 A;  2MOW A;  4I1O B;  2OV8 A;  4WNF A;  3CK7 A;  4JA7 A;  4I9E A;  3NQP A;  3LS8 A;  2WQH A;  3D9L A;  3KD7 A;  3AU5 A;  3EIQ C;  4FJY A;  4A1G A;  3RO2 A;  3TXN A;  4MLP A;  3ML8 A;  5A23 A;  3D9J A;  3CVQ A;  4A3T A;  2E2E A;  2C0L A;  2J07 A;  3PUK A;  4I2W A;  4R7L A;  1XNF A;  3TG5 A;  3ZFW A;  4GZD A;  5ANR A;  1NA0 A;  1H2V C;  1N54 A;  5LFA A;  4CT4 A;  2WXR A;  4GA2 A;  3MJW A;  3APC A;  2NSZ A;  4HOQ A;  2Q7F A;  3OXL A;  3PRZ A;  2XCC A;  4CDR A;  4Y6C A;  4EBA G;  1TJF A;  2R17 C;  2PQR A;  3IV0 A;  4GZ6 A;  3UT7 A;  4A1S A;  4BWR A;  5T8I A;  1HFA A;  3VTX A;  2L0T B;  3MEK A;  3ZYL A;  2HO1 A;  3CVP A;  3NF1 A;  4GA0 A;  2YHE A;  3FTV A;  4ILG A;  4AIF A;  4C0M A;  5BV1 A;  1EPU A;  2DCP A;  1OWM A;  2VGX A;  4G23 A;  3T8M A;  3CHR A;  2R59 A;  2E0I A;  3L6A A;  4WWP A;  3SGH A;  3CKB A;  4JW1 A;  3IHY A;  3LEW A;  4I6J A;  4PDX A;  3G2W A;  4C0E A;  1IQR A;  2KM4 A;  4YVO A;  4BX8 A;  4JL0 A;  2BF0 X;  3PNL B;  3QWP A;  2KAT A;  2XRZ A;  3LVR E;  4I9C A;  1HS6 A;  3MV2 B;  2LSV A;  3FUJ A;  3KEZ A;  4HVB A;  4PS3 A;  3U9W A;  5JJ7 A;  2KZT B;  3AS5 A;  4N2S A;  3SD5 A;  1SQM A;  2OVF A;  4MS6 A;  5FZS A;  2PQN A;  2VSO E;  4L2L A;  5A7D B;  1HZ4 A;  2WXK A;  2WXQ A;  4GA1 A;  3HYM B;  3QK0 A;  4TV3 A;  3ZRH A;  2CG2 A;  4KXK B;  2HR2 A;  2C2L A;  3CIA A;  2L9B A;  4NRH B;  5BW8 C;  2X6H A;  2WPV A;  4IN3 B;  4BTB A;  4EZJ A;  1E7U A;  3RO3 A;  4I17 A;  1OWP A;  1H19 A;  1SZA A;  2L0I A;  2KZT A;  3CKC A;  1HE8 A;  3FWV A;  4JC8 A;  4OVV A;  3OTN A;  4XE0 A;  5JJ6 A;  2ILR A;  3APD A;  3CVY A;  5FT9 A;  3RRM B;  3VLD A;  3D9N A;  3L17 A;  2AVP A;  3URZ A;  4AP2 A;  3RRU A;  3O48 A;  4N3C A;  4NUR A;  4HOU A;  2DBA A;  4I2Z A;  4JEH A;  4A3V A;  3U3W A;  3FU0 A;  1WAO 1;  1HF8 A;  2J9Q A;  4FAD A;  4JVS A;  4L1B A;  4RG9 A;  2WM9 A;  3FEY A;  5EX3 A;  1Y6I A;  1A17 A;  5AIJ A;  3LKU A;  4GZC A;  3LCA A;  4ILH B;  3FTU A;  1DVP A;  4OYS A;  5LCW J;  2GRM A;  4TUU A;  1INZ A;  3CQG B;  3P1U A;  3PZD A;  3UX4 A;  1HXI A;  4DI4 A;  3FUE A;  2IJG X;  5J08 A;  4A55 A;  2FUL A;  1N52 A;  3FTW A;  3L22 A;  1ELW A;  4YVQ C;  4ATG A;  3MV3 B;  1UJJ A;  4UWK A;  3TXM A;  3OXF A;  1HO8 A;  3LVQ E;  4G24 A;  3FUH A;  2RG8 A;  5BNW A;  2XPI A;  2XPZ A;  3L13 A;  2UY1 B;  4DK5 A;  2YQ8 A;  1GW6 A;  3GW4 A;  4E6H A;  2J09 A;  5KCM A;  4ILI A;  5AEN A;  4CGW A;  4EPZ A;  3MKQ B;  4K03 A;  4B89 A;  3IBE A;  2R5S A;  5CCL A;  2CG3 A;  4KT6 B;  5DBK A;  4U0Z A;  4EBA A;  4BTA A;  1MHQ A;  3WXX A;  4L23 A;  5CHE E;  1KLX A;  3ZEF A;  1TEZ A;  5BV0 A;  2P58 C;  1MQS A;  3FU3 A;  4ANV A;  1IHG A;  3I3N A;  2CFU A;  3MCX A;  2IF4 A;  5KJL A;  4AY6 A;  4DJA A;  2ION A;  4K0R A;  1PAQ A;  3MKQ A;  3G2V A;  2J49 A;  3FTS A;  1EYH A;  4N3B A;  4AOF A;  3D9M A;  2JEK A;  1DNP A;  4GAA A;  1UJK A;  3B7U X;  3MX3 A;  4JPS A;  3UUX A;  2X6F A;  3I4G A;  2XGO A;  2EQX A;  3B7R L;  3D9I A;  5FZQ A;  4J8D A;  4O6F A;  4BT9 A;  3GYZ A;  1JWG A;  1Z3X A;  2KCV A;  3FUD A;  1B89 A;  2WXN A;  1HG5 A;  3PRE A;  4U07 A;  2VYI A;  2I1J A;  2FBN A;  3CLJ A;  3JQ1 A;  4CGV A;  3SZ7 A;  4DI3 A;  3U66 A;  2VGX B;  2V4L A;  2X38 A;  5G05 J;  3QC1 A;  2Y4U A;  3I4R B;  3MKR A;  5G04 C;  2WXI A;  1H2T C;  2VQ2 A;  4YND A;  4B8A A;  5KJM A;  3CVU A;  2HYZ A;  1UW4 B;  4GML A;  3TL5 A;  4AM9 A;  4B8C B;  4U63 A;  3FH5 A;  2XGM A;  4U0U A;  1TJC A;  3PE4 A;  2X6J A;  4UI9 J;  3ZYQ A;  4RSY A;  3ASD A;  3IHV A;  4UQX A;  2M63 A;  3B7T A;  5FTP A;  3ZVV A;  3R7Q A;  4WNE A;  4AXH A;  2WMN A;  2XRY A;  4EEC A;  4UWF A;  1VDY A;  3CGH A;  4ME2 A;  4N3A A;  4UQY A;  4XZ4 A;  2X3M A;  5LOZ A;  4CRW A;  2LO6 A;  3ZXS A;  4ANU A;  1NA3 A;  3MZL B;  2IOL A;  4ACK A;  4CDN A;  4GZ5 A;  4KVM A;  2XHE A;  3VTY A;  3ASG A;  3CHO A;  3N71 A;  1OWL A;  3RU0 A;  3SBT B;  3MGB A;  5DIZ A;  4HLE A;  3Q4A B;  1OWN A;  2FO7 A;  4DLQ A;  4F7A A;  5LP0 A;  1FVF A;  4FUL A;  4E85 A;  3FEX A;  2WVI A;  3E4B A;  3GZS A;  2IU1 A;  2IQC A;  1WY6 A;  2CHZ A;  3HIZ A;  3PEV B;  2NC9 A;  3CR3 A;  3GZ2 A;  3MYV A;  3UT4 A;  3RJV A;  4C9B B;  4I1A A;  3Q15 A;  1HH8 A;  3CQC B;  3TJP A;  4UWH A;  3FUN A;  4XI0 A;  4GYY A;  3SI5 A;  4BT8 A;  3FUM A;  3VLE A;  2CFZ A;  3SFZ A;  3O4Z A;  4NQ0 A;  2AWI A;  4LEU A;  2V5F A;  3APF A;  3CSF A;  4GYO A;  1JPL A;  2LNI A;  3CVL A;  3ENE A;  3IEG A;  3ZGQ A;  2V0P A;  5ARF A;  4I6G A;  3ULQ A;  1Z6T A;  3UT8 A;  5JHB A;  4XI9 A;  2OND A;  1QNF A;  4JHK A;  4XKB A;  3R7R A;  1IQU A;  4N39 A;  2YIN A;  3CVN A;  3PH0 C;  4KMO A;  4U0S A;  2VTB A;  4GZ3 A;  4F53 A;  1SZ9 A;  3ESL A;  4UWG A;  1E96 B;  4J6I A;  3RRN B;  5JJT A;  5ARG A;  4KYO B;  5FWQ A;  2OVB A;  3FH8 A;  3JUI A;  2IFU A;  4W9R A;  3LY7 A;  2VSX E;  4IUL A;  5ANL A;  3S2A A;  3UMV A;  1S0P A;  3ZHE B;  4ABN A;  4AVX A;  3NZU A;  2FF4 A;  4QFV A;  3SHF A;  2AXV A;  5BT1 A;  4L2Y A;  3PEU B;  1ZBP A;  4J8F A;  3G2T A;  1E7V A;  1JUQ A;  3U4T A;  4I1M A;  2WMO A;  1EF1 C;  4DLO A;  3SBS A;  4BFR A;  3PUJ A;  4PS8 A;  4FHJ A;  4WUY A;  3GZ1 A;  3QOU A;  4IYP A;  1X5B A;  3C98 A;  3ML9 A;  3LDZ A;  4H7Y A;  3ZHE A;  2CHW A;  3FUL A;  3ASH A;  3JQ0 A;  4GCO A;  3CHM A;  5KJK A;  3ZYM A;  4Q69 A;  4ACL A;  3D9O A;  5AJL A;  3RKV A;  2XQ0 A;  4HOT A;  3CVV A;  4AY5 A;  5EKQ D;  4ANW A;  2J4D A;  4CCA A;  3I5P A;  4FLB A;  2AW6 A;  1OUV A;  4GCN A;  2KC7 A;  3S7J A;  3QNK A;  1UG3 A;  3QAR A;  1FCH A;  2I9C A;  5HI7 A;  2BUG A;  5C2Y A;  3TGO A;  2MRI A;  1WM5 A;  3G2S A;  4UQZ A;  4D10 C;  4KZC A;  4RG6 A;  3FUF A;  5G2N A;  5BUZ A;  2RD0 A;  2VSY A;  3FTZ A;  3OXG A;  4GYW A;  5A6C A;  2WQ6 A;  3LXU X;  2A5U A;  4FLH A;  3CK8 A;  4GU5 A;  4G1T A;  1XGW A;  3ZPJ A;  2GW1 A;  3G2U A;  5AJD A;  4HFG A;  3AU4 A;  3ESK A;  3L08 A;  5CMY A;  4GMJ A;  2PM6 A;  4Q96 A;  1ELR A;  1H6K A;  2MHK A;  1U3C A;  4KZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...