3Q4AB

Crystal structure of the tpr domain of chip complexed with phosphorylated smad1 peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
132
structure length
132
Chain Sequence
SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism of the Negative Regulation of Smad1/5 Protein by Carboxyl Terminus of Hsc70-interacting Protein (CHIP).
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/transcription
molecule keywords STIP1 homology and U box-containing protein 1
total genus 54
structure length 132
sequence length 132
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3q4aB00
5G04J 2C0LA 4AY5A 4U0UA 2YHCA 4N3AA 3S7BA 4BTAA 5DIZA 5CCLA 5M72A 3CK8A 5KJLA 1IHGA 2KCKA 2PQRA 2VYIA 3CKBA 3HYMB 4GPKA 4RG6A 3Q15A 5EKQD 5EX3A 3E4BA 5KJMA 3QWPA 2UY1B 2V5FA 1QQEA 4I1AA 1WM5A 3VTYA 3KS2A 1HXIA 3GW4A 3BEEA 4BTBA 3OXGA 4BWRA 3ZPJA 4J8EA 3CKCA 4ME2A 2IF4A 2PZIA 4CDRA 5FTPA 3URZA 3U3WA 1NA0A 3PDNA 3CVLA 3RO2A 5G05C 3CV0A 3QWVA 5CCMA 2XGSA 4I9EA 3LY9A 1HZ4A 3ZFWA 4EQFA 5CHEE 4W9RA 4WNGA 4Y6WA 3S7FA 3TAXA 4GCNA 4NRHB 5FJYA 2Q7FA 2VSNA 5DBKA 4G25A 2XEVA 2FF4A 4UI9C 4I17A 5FZSA 5A7DB 4N2QA 5D0QD 4G2VA 3ZGQA 2VGXA 3GZ2A 2VQ2A 3Q4AB 3CEQA 3MV3B 4XIFA 3LPZA 4B94A 5D0OD 2NC9A 5JJ6A 4KXKB 2XPIA 4LEUA 5HI7A 2FO7A 2KCVA 4GZ3A 4NQ0A 4U04A 2WQHA 3AS5A 3AS4A 3ASGA 2DBAA 4GYOA 3S7DA 3TG4A 2JLBA 3U4TA 5BT1A 2VGXB 2IFUA 3OXFA 5AYWD 2L6JA 5BNWA 2UY1A 1OUVA 3ZHEA 4XI9A 2FEZA 3ZN3A 2R5SA 3RU0A 4F3VA 4WNFA 5FZQA 4I2ZA 4GA1A 1NZNA 2KCLA 4GYWA 5G05J 4HOTA 2XGOA 4BT9A 3ASFA 4UQXA 4UI9J 3ULQA 4N39A 5EX0A 3ZHEB 3JYSA 4AIFA 4WNDA 2VSYA 4J8FA 3OXLA 5JJTA 1IYGA 3QWWA 2ONDA 3QKYA 3NF1A 4HOQA 4A1SA 3LY8A 4HOSA 1ELWA 1ELRA 3ESKA 2QFCA 2HR2A 4UI9K 4YVQC 3UQ3A 2AVPA 1A17A 3ASDA 1ZU2A 3GZ1A 4J8DA 3UUXA 4AY6A 4AM9A 3LY7A 2OOEA 3KD7A 3KAEA 3LCAA 1KT0A 1YA0A 4G23A 3RIBA 5KJNA 3MEKA 2C0MA 4GZ5A 2KATA 2XCCA 2KC7A 3GYZA 1Y8MA 3LYAA 2YQ8A 4GA2A 1NA3A 3CVPA 3S7JA 5G04C 3R9AB 2PL2A 4JA9A 2HO1A 3K9IA 3CVNA 2HYZA 4G1TA 5ARFA 3TG5A 4G26A 4HOUA 4JA7A 3RKVA 4GZ6A 1B89A 3Q47B 2GW1A 1HH8A 2MHKA 2FBNA 3MV2B 2P58C 1WAO1 3ASHA 1PC2A 1ZBPA 1FCHA 3FFLA 3FWVA 3O48A 4G24A 4KYOB 3WXXA 5HQ8A 2Y4UA 5LCWC 3CK9A 5C1DA 5A6CA 4N2SA 4CGVA 3Q5MA 5JJ7A 4HORA 3N71A 4U0ZA 4YNDA 1P5QA 2BUGA 4H7XA 4U07A 3CK7A 5ARGA 4N3CA 2C2LA 4GA0A 3RO3A 4ABNA 2VGYA 3PE3A 4U0SA 4GCOA 4BT8A 4APOA 4GYYA 4N3BA 5BW8C 3UPVA 1QZ2A 4WNEA 2LSUA 3IEGA 1XNFA 2FI7A 3FP3A 4JL0A 2PQNA 2WPVA 3RJVA 5LCWJ 3TGOA 2XGMA 2LNIA 3PE4A 4J0UA 4Y6CA 4UQZA 2J9QA 3AS8A 1KLXA 4WUYA 3SZ7A 2LSVA 5KJKA 2UWJG 1KT1A 3VTXA 4JHRA 4KBQA 5FT9A 3LKUA 3MKRA 3QOUA 1W3BA 2Y4TA 4O6FA 4N5CA 3Q49B 2E2EA 1E96B 4YVOA 3SF4A 5FZRA 4H7YA 1TJCA 2XCBA 4XI0A 3QDNA 4I9CA 4IN3B 4I2WA 3MA5A 3EDTB 4CGWA 2I6HA 4RG9A 3CVQA 4UQYA
chains in the Genus database with same CATH superfamily
3L16A 1BD8A 1OCCE 1UW4B 2JEKA 5LOZA 3D9MA 3QK0A 2XEHA 3ZPJA 4Q69A 4O60A 2RFAA 3LJNA 3PDNA 5LX8A 3CVLA 5G55A 4NRHB 2WXJA 4TXPA 3FEXA 4GMJA 4B94A 5CEAA 1SZ9A 3S7DA 1EPUA 5BT1A 5AYWD 2IOLA 2WXOA 4WWOA 3ULQA 4FLBA 3J5PA 4L2YA 2XZTG 2WXGA 1ELRA 4CCAA 4UI9K 3ASDA 3KEAA 3SY2A 3S2AA 4DJAA 2IONA 4OVVA 3RAUA 1XGWA 4GA2A 5C2YA 5T4YA 2PL2A 4JA9A 3ASOE 1O1SA 3CVNA 4AXHA 1TN6A 3UIOC 4B93B 2XS1A 1YMPA 4EPZA 5JHAA 2L0TB 3UIPC 4HORA 5ARGA 1NFIE 2XRYA 1TJFA 4APOA 2LSUA 3DWLG 4YDWA 5FQ8A 4UUCA 3G2VA 4YVOA 1BI8B 2QYJA 2A5UA 3Q75A 4I9CA 2I6HA 3L9TA 4U0UA 4ILHB 5KWDA 1AP7A 3HYMB 4A3VA 2V5FA 5ITZF 4Q96A 4GAAA 4J8EA 5CMWA 2WXIA 1U3DA 1N95A 1N0RA 4I9EA 1N9AA 4F53A 4GTSA 3E34A 3OTNA 4U8VD 5DBKA 3FU5A 2FF4A 4UI9C 1OCZE 3E33A 3V30A 3Q4AB 2NC9A 4RSYA 5JJ6A 3I5PA 2NSZA 2EQXA 4GYOA 5CEDB 4YDEA 3OXFA 3HIZA 5FZQA 4I2ZA 4GA1A 3DPDA 3CVWA 1N94A 1O1RA 2WXPA 3MCXA 4HOSA 1TNZA 3CGHA 4NACA 2Y1LE 2NXPA 1Z3YA 4HRMB 5CRUA 2HYZA 3C98A 3DSSA 4YDYA 5FWQA 5C1DA 5J08A 2V0PA 1H0AA 2F0YA 2WXKA 4GZCA 3EU9A 3UKUG 1TN8A 5FINA 3UM0A 2P2CP 3PZ3A 1KT1A 3U64A 2IY0C 4N5CA 4JD2G 4TUUA 3Q49B 4TXQA 2WQ6A 2YHEA 2YHCA 4N3AA 4F1SA 2RFMA 1D9SA 4GPKA 2VYIA 3UT7A 5EKQD 5D2MC 3FTWA 4APFA 3JUIA 1HFAA 3PS6A 3U66A 2WXFA 2PZIA 2CHZA 3RRUA 1RW2A 3G2UA 3QNKA 1K1BA 4JB8P 5FJYA 4WAFA 2GRLA 3AJIA 3C3OA 3I3NA 2WXQA 2BEDA 3JQ1A 3GZ2A 3BQOA 4TV3A 4V3IA 3RRNB 3V31A 1LD8A 4IRUA 4EZKA 4JEHA 4XI9A 3NQPA 3RU0A 3D9PA 4LUNU 4HFGA 4AIFA 3W9GA 3IKOB 4BFRA 1ELWA 2QFCA 2AXZA 3UQ3A 1ZU2A 3FH8A 2DZNA 2KATA 2J4DA 3GYZA 1NA3A 2PNNA 2IEJA 3D9JA 4L2LA 4KYOB 3O48A 4ANVA 5EIBE 1UG3A 3B7BA 2KXPC 4CGVA 3N71A 1SQMA 4BETA 4GA0A 4DX5D 3UM3A 4GMRA 5J90A 3T5XA 2FI7A 3JQ0A 3SZ7A 1OWMA 4J7WA 2IU1A 4EZJA 3ZYQA 4ABNA 2R2LA 2CFUA 4TUMA 1N4QA 3TWVA 4Q94A 1MX4A 3ONLA 3IHYA 4RG6A 1QQEA 4K5CA 1BU9A 4BTBA 2RG8A 3Q7FA 4HXIA 4EHMA 2VTBA 1U2VG 2VTBB 1NI1A 2X38A 1VDYA 2R03A 5E75A 1Z5SC 3HXCA 2WQ7A 2LXMA 3BU8A 1FVFA 3HRAA 3ZHEA 2WMOA 5BPPA 4HOTA 4UQXA 4EBAA 5JJTA 4HOQA 2J09A 3LY8A 4OVUA 2ZIRA 3FU0A 3CVXA 3UUXA 4AY6A 3KD7A 2Y69E 3ZW3A 2VSXE 3S7JA 3EHRA 3UKRG 3RKVA 1UJKA 2H6FA 3NOCD 2I9CA 4M7CA 3FWVA 4B89A 3ZRHA 4FC8A 2I1KA 4U0ZA 3NB2A 3U9WA 4BY6A 5AQ9A 1MJ0A 5AENA 3Q73A 4WWPA 5B3SE 3AS8A 3DSXA 4WUYA 4WWNA 3QOUA 1E96B 4HI8A 2E0IA 2LAIA 3QDNA 5FQ4A 1SZAA 1LTXA 4ILGA 5AARA 1H2TC 2KCKA 1QYMA 3L54A 3PZ1A 4K03A 5CBOA 1IKND 2J8SD 4YDOA 4KT6B 4DUIA 5FTPA 3PZ4A 1FT2A 3RO2A 3HXDA 5CCMA 4W9RA 3AG2E 4CEMA 3AG3E 3FUKA 3MYVA 3ZU7B 2VGXA 3DSVA 5D0OD 4IYPA 4KXKB 2J4BA 3FH5A 1E8YA 2WQHA 2VGXB 2CG3A 4F3VA 1SW6A 3HVEA 3SBTB 5AIJA 4HLLA 2EIJE 3LVQE 1KZPA 4N39A 1OY3D 4AP2A 2VSYA 1OWLA 3ZNGA 2KZTB 4PUCA 1Z3XA 4LCTA 4YVQC 3V2OA 1E90A 4FU3A 4LG6A 4HBDA 1NP7A 3DEOA 4U8YD 4FLHA 2F37A 3TWQA 4KZCA 2GRNB 1V54E 3Q47B 4LNGA 5T3RA 3EHQA 5IY5E 3RK6A 2DCPA 1E8ZA 2IO3C 4L23A 3TL5A 3ABME 5FIOA 4A1GA 3Q9UC 4U8HA 3IEGA 4ANWA 2WXRA 4QQIA 4UQZA 2FO1E 3D9KA 1G3NB 2E2EA 1TJCA 4I2WA 4RVBA 4GTTA 4ZHBA 3EHMA 4CRWA 4AY5A 3DXKG 5DIZA 3CK8A 4HQDA 5KJMA 3CSFA 1TN7A 3ONKA 5D66A 3VLDA 2QYUA 5ENRD 4F1PA 2XGSA 4DPRA 5KBAA 4C9BB 3Q78A 3HXFA 3TAXA 3CR3A 4A3TA 1Z6TA 5AQBA 3LPZA 1E7UA 4K5BA 1K3ZD 4IULA 4JPSA 2P9KG 4U04A 4FA6A 1TNUA 3UINC 2MRIA 3CHRA 1X5BA 1NZNA 4UI9J 1A5EA 4DK5A 1IYGA 4A1SA 3QAQA 3ESKA 1INZA 3KSQA 2EINE 2DZOA 1DVPA 4BX9A 2VSOE 4DRXE 2DVWA 1HG5A 1Y8MA 2AWIA 4G1TA 4G26A 4GZ6A 2GW1A 1PC2A 1O5MA 3CK9A 4B8AA 5JJ7A 1DCEA 3FUNA 4CYMD 3CK7A 4ATZD 3NBNB 3I4RB 3SNXA 3PE3A 4U0SA 5BW8C 4C0EA 5CMYA 3UT8A 4JL0A 3AU5A 4NURA 1KLXA 2IOSA 2LSVA 2UWJG 3PUJA 3VTXA 3ZXPA 4MBGA 4IN3B 1JPLA 3IXEA 2HO1A 3PH0C 4BSZB 1IHGA 2V8SE 1GW6A 5A23A 2XZDG 3HXBA 4I1OB 3D9IA 2NYJA 4JC8A 1OWPA 4PS3A 3ZFWA 3S7FA 4JEUA 4G25A 5A7DB 1D8EA 2VQ2A 4O1OA 5FQ7A 1Y6IA 3X2QE 2FO7A 4GZ3A 2QZAA 3AS5A 4C48B 2OVBA 3FTYA 2MYOA 4XEIG 3D9OA 1H6PA 3QWWA 2R05A 1A17A 3ENEA 3LXUX 3APFA 3Q9NC 3LY7A 3B7UX 1N52A 4HLEA 5KNGA 3TWRA 5EN5D 4LNUD 4JA7A 1MQSA 1H6OA 4UWFA 3WG7E 4LRZA 4JW1A 2WVIA 3R7QA 1OWOA 4GTPA 3EHNA 3RO3A 4J8SA 1FT1A 2CHWA 1N0QA 5HKPA 3LJ3A 2GRRB 3DSWA 1HF8A 4KBQA 5FT9A 2RKKA 2FULA 3MKQA 5CBNA 2V4LA 4KVMA 4DLOA 1OCRE 2C0LA 4BTAA 3CHQA 2EIME 4F7AA 4CT0A 3SI5A 2QY7A 4I1MA 3ABLE 3ML9A 1JWGA 1E8WA 1MX2A 2VGEA 4WNGA 4Y6WA 2VSNA 4BEPA 1UOHA 1EYHA 4N2QA 3ZGQA 2KM4A 3DXMG 1EF1C 2PM6A 4FADA 3AS4A 2JLBA 3IV0A 2XGOA 5EX0A 4CDNA 3OXLA 4KMOA 3HXEA 3CQCB 4O1PA 1JCQA 3HHMA 2RD0A 3SBSA 2H6GA 3KEZA 2AW6A 1N4PA 2H6IA 2WXMA 3ULYA 5KNHD 3KSLA 1KPSB 4J0UA 2J9QA 2CFZA 5AAOA 4O6FA 3PRZA 2Y4TA 4L9PA 2P9NG 5BXOA 3FHEA 1MYOA 4FJYA 4LERA 5KJLA 3CIAA 1H19A 5EX3A 2H6HA 4I43A 4K0RA 2UY1B 3VLEA 3BEEA 2DYSE 4AV7A 1ELKA 1PY1A 2XRZA 2XPYA 4XKCA 3FTZA 5E76A 3B7TA 1HO8A 5JA4D 1UJJA 3F6QA 1S70B 3FUIA 1HE8A 2LXLA 5HI7A 1K1AA 3UM1A 1IQRA 4M3OA 3ZN3A 3V2XA 3G2SA 3UXGA 3ZHEB 3P2BA 3JXIA 1S0PA 3NOGD 1JWFA 1WG0A 1HG2A 3ULEG 3SGHA 4NIKA 1RZ4A 5KCMA 1YA0A 1S64A 5EILA 3TG5A 3EIQC 2MHKA 1HH8A 4G11A 3MV2B 1WAO1 3FFLA 3SFZA 1ZB1A 2I1JA 4MKTA 2OCCE 3D9LA 1H6KA 2BUGA 4GZDA 4AOFA 4J8YA 4GYYA 5G2NA 2GROB 3CVUA 2PQNA 5HRYA 5AJDA 2X6KA 3FUFA 1W3BA 2WM9A 4XI0A 3ESLA 3G2WA 4HNAD 4E6HA 4U96D 3ISMC 2HM8A 4GB9A 2PM7A 5AQ7A 3DPYA 3SD5A 3IBEA 5AJLA 3L6AA 4BERA 2ZGDA 4BESA 3ZYMA 2Q7FA 2QC9A 3EU5A 4XIFA 2JABA 1N4RA 3U4TA 5BUZA 1H2VC 2P9IG 2Y0BG 3SFXA 3TWSA 3UTMA 5EYLA 3E37A 2XHEA 3JYSA 4MRUA 5EYPF 2ONDA 2HR2A 2MOWA 4J8DA 2LAHA 3D3MA 3HDXA 3LEWA 4ANXA 3JXJA 4GZ5A 2KC7A 4XE0A 3CVPA 3PNLB 3ZKJA 3ZXSA 4CT4A 1K8KG 5HQ8A 3RSEG 1FCHA 2B6CA 3PZDA 4FJZA 3FUDA 3C5RA 5B1BE 1HS6A 5ANLA 4ACKA 4WNEA 3L17A 3CVVA 4PH4B 3FUJA 4CZ2D 3LKUA 3SF4A 3Q79A 2X6IA 3EDTB 4B8CB 4TXRA 5ANRA 3L82A 3ZYLA 3QJZA 3PNTB 2PQRA 4L7TA 1E7VA 4XX5A 3E4BA 4P29A 3QWPA 2GRPB 1WM5A 3KS2A 4FHKA 3L13A 1LF8A 2P9UG 1IHBA 4JVSA 3QWVA 5H7PA 3FULA 1HZ4A 1QNFA 4GCNA 2XEVA 3FU3A 4R7LA 5D0QD 4MS6A 4LEUA 5ENQD 1TEZA 3MJWA 3ASGA 1SA4A 4GMLA 3G2TA 2AXVA 2J07A 4DI4A 2FEZA 3TWWA 3ZEFA 2WB2A 2X3MA 4I6JA 4BT9A 3HVEB 3HG0D 1TNOA 4C0MA 4PS8A 2AVPA 2X6FA 2ZXWE 4AM9A 2J08A 2J49A 3SO8A 3LCAA 3TXMA 5KJNA 3APDA 5B1AE 3AG4E 4DX2A 4G8KA 2WXLA 3L22A 4HOUA 3CLJA 2P58C 3ASHA 4DX1A 4G24A 4UWKA 3Q5MA 1JUQA 1H2UA 3EUVA 2DWZA 3C3RA 2EIKE 2VJ8A 3PE4A 2AJAA 2EILE 4HS2A 3NZUA 4PDXA 2ETAA 4RLYA 3CHMA 1OCOE 3ML8A 3QARA 4JXTA 4TRQA 3C3QA 4I1AA 3EIJA 3DRAA 2IF4A 2KZTA 3APCA 5ENTD 4CGWA 5CECB 4URKA 3QC1A 4I17A 4KZ0A 5HS0A 2BF0X 2OEVA 4Z68A 5BV1A 2OV8A 3BG1B 2DBAA 1L5JA 2A5EA 2BKKB 4GTVA 2IFUA 2L6JA 2IQCA 2I2OA 4OYSA 2L6BA 3QKYA 2R17C 4HRLA 4ANUA 3FH7A 4RQIA 3LS8A 1D8DA 1MX6A 2C0MA 1N4SA 3R9AB 3K9IA 4HB5A 3LVRE 1B89A 1X81A 3PUKA 4U95D 3E32A 3NZSA 1TYQG 1U3CA 1DCQA 4N2SA 4A55A 4YNDA 2Y3AA 1JCSA 1E8XA 4BT8A 4XZ4A 3FP3A 2WPVA 3TGOA 2XGMA 1NL4A 3FTSA 1N54A 5JHBA 3FUMA 3MKRA 3OAWA 3CHSA 1YYHA 3DBSA 5BV0A 4H7YA 2ILRA 2XQ0A 1UN9A 4RG9A 2ETCA 1OT8A 3S7BA 1TNBA 3TXNA 2CG2A 3DSUA 3VTYA 3C72A 3FUEA 3ZYKA 5EDSA 3T8KA 3FDHA 3PEVB 3JCKC 4EQFA 2XEEA 3D9HA 4OAVB 3V79K 4G2VA 3UX4A 4LNBA 3P1UA 3CEQA 3ABKE 5CRVA 4AJWA 4GU5A 3T8MA 3UM2A 2F8XK 3AAAC 1DNPA 2F8YA 4ATGA 2DIWA 2ZGGA 5AN8A 3GZ1A 1SA5A 4DX7D 3MEKA 3LYAA 4ILIA 5EIDA 3ZUVB 4FHJA 4FULA 2GRQB 3D9NA 3TWTA 4FP7A 3UT4A 5CERB 3CSTA 2B0OE 4AEZC 4X8QA 4H7XA 2R02A 3E30A 3R9MA 5AQAA 2VGYA 3FEYA 2ETBA 3B95A 4JZYA 5ENSD 4N3BA 2WXHA 4U63A 2LNIA 5KJKA 3PVLA 1PAQA 4L1BA 5FQ6A 2X6JA 2XCBA 1TR4A 1MHQA 3CKBA 4N5QA 4LSZE 1HXIA 3GW4A 3B7SA 4GTQA 4EBAG 4GTMA 3URZA 3NAWA 3I4GA 3BUAA 3CV0A 1UN8A 3AU4A 1WDYA 3PEUB 5BXUA 2ZU6B 2IJGX 1FPPA 2KCVA 3W9FA 3TG4A 3CVYA 5BNWA 5ENNA 4UWGA 2BKGA 2YNQA 2XS8A 5ENPD 3FTUA 3FUHA 3CHPA 1Q2ZA 1DC2A 4B0ZA 4GPMA 4D10C 2YQ8A 3L08A 1WY6A 5G04C 4I6EA 4J6IA 1JCRA 2OEWA 2FBNA 3T9KA 1ZBPA 2ZISA 1OWNA 4DX6D 2HE0A 1OXJA 4MLPA 3SFYA 1P5QA 3GZSA 1S63A 1QZ2A 5LFAA 4GTOA 4JHRA 1LD7A 3FU6A 3TWUA 1SVXA 5LP0A 5FZRA 3LDZA 1QBQA 3CVQA 3IHVA 4UQYA 5G04J 4CDMA 2LO6A 4F6RD 3Q15A 3VLFA 3OXGA 3CKCA 2GRMA 5JMND 3U3WA 3MGBA 2L0IA 2P9PG 4BSXA 2YINA 2A4ZA 5T8IA 4I6GA 3MV3B 1IXVA 3PZ2A 1BLXB 1FVHA 2UY1A 1OUVA 2V5QC 2KCLA 4GYWA 4G8LA 4BX8A 4J8FA 1EDUA 3KAEA 1KT0A 4G23A 3QB2A 4WNDA 4DLQA 1YCSB 1HX8A 4UWLA 5ARFA 4KVOA 3FTVA 4HI9A 4ACLA 3SQVA 2AXUA 3WXXA 4QFVA 5LCWC 3CQGB 2P9LG 1IQUA 4U07A 3T5VA 4GCOA 1V55E 2KBXA 4A63B 3UPVA 1XNFA 2WXNA 2V4HC 3FTXA 2IO2C 3UI2A 2L9BA 4JHJA 3AG1E 4UWHA 3MA5A 1BI7B 4JHKA 5M72A 5CCLA 3DSTA 3ZVVA 4DI3A 2R59A 3ASNE 4U7EB 3MX3A 2GGFA 3BG0B 2WMNA 4BWRA 4ME2A 2OVFA 4OAUC 4CDRA 3DEPA 3B13A 4XKBA 1NA0A 3TWXA 2X6HA 5G05C 3ZIMA 3LY9A 4ZFHA 4AVXA 3CHOA 5CHEE 2DYRE 3EJNA 2CHXA 5FZSA 3MKQB 1TNYA 2XPIA 4NQ0A 1O1TA 2XPZA 2R5SA 3RRMB 4WNFA 3SHFA 3R7RA 3MZLB 5G05J 2XENA 3ASFA 3O4ZA 5ENOD 4EECA 4E85A 1MZCA 4PS7A 3NF1A 4HRNA 3FY4A 3Q7AA 3PREA 2OOEA 2LUHA 3UMVA 3RIBA 4HVBA 3JUEA 4GTRA 2XCCA 2M63A 1KZOA 3B7RL 3J5QB 2Y4UA 5A6CA 4K5AB 3TJPA 1HU3A 4N3CA 2C2LA 1AWCB 2BTDA 1N11A 3RJVA 4EZLA 5LCWJ 4Y6CA 2P9SG 1BPOA
chains in the Genus database with same CATH topology
4ILGA 3S7BA 4FJYA 4LERA 3TXNA 3L16A 5KJLA 2CG2A 1H2TC 2KCKA 3L54A 1UW4B 3CIAA 2JEKA 1H19A 4K03A 5EX3A 4K0RA 4I43A 5LOZA 2UY1B 3D9MA 3QK0A 3VTYA 3VLEA 3FUEA 3BEEA 3ZYKA 5EDSA 3ZPJA 3FDHA 3PEVB 4KT6B 4AV7A 4Q69A 1ELKA 1PY1A 3JCKC 2XRZA 2XPYA 5FTPA 4XKCA 3PDNA 5LX8A 3CVLA 3RO2A 5CCMA 3FTZA 5E76A 5G55A 3B7TA 4EQFA 1HO8A 4W9RA 4NRHB 4CEMA 2WXJA 3FEXA 3FUKA 1UJJA 3MYVA 4G2VA 3UX4A 3FUIA 2VGXA 3P1UA 3CEQA 4GMJA 1HE8A 4B94A 5D0OD 4AJWA 4IYPA 4KXKB 2J4BA 4GU5A 5HI7A 1SZ9A 3FH5A 1E8YA 3T8MA 2WQHA 3S7DA 1EPUA 5BT1A 2VGXB 5AYWD 1IQRA 2CG3A 2IOLA 4M3OA 3ZN3A 4F3VA 1DNPA 2WXOA 3HVEA 3SBTB 4ATGA 3G2SA 4WWOA 5AIJA 3LVQE 2DIWA 3ULQA 4N39A 3ZHEB 4AP2A 2VSYA 3P2BA 4FLBA 1OWLA 2KZTB 4PUCA 1S0PA 4L2YA 1JWFA 2WXGA 1ELRA 1Z3XA 4CCAA 4LCTA 4UI9K 4YVQC 1HG2A 3ASDA 1E90A 3GZ1A 4FU3A 3SGHA 1NP7A 3S2AA 4DJAA 5KCMA 1YA0A 2IONA 4OVVA 3MEKA 1XGWA 4GA2A 3LYAA 4FLHA 5C2YA 4ILIA 5T4YA 2PL2A 4JA9A 3CVNA 4AXHA 3TG5A 4KZCA 4FHJA 4EPZA 4FULA 3EIQC 3Q47B 5T3RA 2MHKA 1HH8A 3D9NA 4G11A 3MV2B 4FP7A 1WAO1 3FFLA 3SFZA 3UT4A 5JHAA 3CSTA 3RK6A 4AEZC 2DCPA 2L0TB 2I1JA 1E8ZA 4HORA 4MKTA 4L23A 3D9LA 1H6KA 2BUGA 4H7XA 5ARGA 2XRYA 2VGYA 4GZDA 3FEYA 3TL5A 4AOFA 4JZYA 1TJFA 4A1GA 4APOA 4GYYA 4N3BA 2WXHA 4U8HA 5G2NA 4U63A 2LSUA 3IEGA 3CVUA 2PQNA 4ANWA 2LNIA 2WXRA 4UQZA 5KJKA 5AJDA 3PVLA 2X6KA 5FQ8A 3FUFA 3D9KA 3G2VA 1W3BA 4YVOA 1PAQA 2E2EA 4L1BA 5FQ6A 2A5UA 2X6JA 1TJCA 2WM9A 2XCBA 4XI0A 3ESLA 3G2WA 4I9CA 4I2WA 4RVBA 2I6HA 3EHMA 4CRWA 4AY5A 4U0UA 4ILHB 4E6HA 5DIZA 3CK8A 1MHQA 3CKBA 3HYMB 4A3VA 2HM8A 5KJMA 3CSFA 2V5FA 4GB9A 4Q96A 3ONKA 1HXIA 3GW4A 2PM7A 4GAAA 3SD5A 3B7SA 4J8EA 5CMWA 2WXIA 3VLDA 4EBAG 3IBEA 3URZA 1U3DA 5AJLA 3L6AA 3I4GA 3CV0A 2XGSA 4I9EA 4DPRA 4C9BB 1UN8A 4F53A 3TAXA 3ZYMA 3OTNA 2Q7FA 5DBKA 3FU5A 3CR3A 2FF4A 4UI9C 4A3TA 1Z6TA 3AU4A 3PEUB 4XIFA 3Q4AB 3LPZA 1E7UA 2NC9A 2ZU6B 2IJGX 4RSYA 5JJ6A 4IULA 3I5PA 4JPSA 2KCVA 4U04A 2NSZA 4FA6A 2EQXA 3U4TA 5BUZA 3TG4A 4GYOA 1H2VC 3OXFA 3CVYA 2MRIA 5BNWA 5ENNA 4UWGA 3CHRA 3HIZA 2YNQA 1X5BA 4GA1A 4I2ZA 1NZNA 5FZQA 3DPDA 3CVWA 3FTUA 4UI9J 2WXPA 2XHEA 4DK5A 3JYSA 4MRUA 1IYGA 3MCXA 2ONDA 3FUHA 4A1SA 3QAQA 4HOSA 3CHPA 3ESKA 2HR2A 3CGHA 1INZA 2MOWA 4J8DA 4NACA 2LAHA 3D3MA 1DVPA 5FQ4A 4BX9A 2NXPA 1Z3YA 2VSOE 3HDXA 3LEWA 4B0ZA 4ANXA 1HG5A 4GZ5A 2KC7A 1Y8MA 4XE0A 2YQ8A 3L08A 3CVPA 4D10C 1WY6A 3PNLB 5G04C 4I6EA 4J6IA 2AWIA 2HYZA 4G1TA 4G26A 3C98A 4GZ6A 2GW1A 3ZXSA 2FBNA 4CT4A 1PC2A 1ZBPA 1FCHA 5HQ8A 1OWNA 3PZDA 5FWQA 3CK9A 5C1DA 4B8AA 5JJ7A 3FUNA 4MLPA 5J08A 1P5QA 2V0PA 1H0AA 3CK7A 4FJZA 3FUDA 2WXKA 4GZCA 3I4RB 3GZSA 1HS6A 5ANLA 3SNXA 3PE3A 4U0SA 5BW8C 4ACKA 1QZ2A 4WNEA 4C0EA 5CMYA 3UT8A 5LFAA 3L17A 4JL0A 3AU5A 4NURA 3CVVA 4PH4B 1KLXA 2IOSA 2LSVA 2UWJG 1KT1A 3FUJA 3PUJA 4JHRA 3U64A 3VTXA 3LKUA 3FU6A 4N5CA 4TUUA 3Q49B 5LP0A 3SF4A 5FZRA 3LDZA 2WQ6A 4IN3B 2X6IA 1JPLA 3EDTB 2HO1A 4B8CB 3CVQA 3IHVA 4UQYA 2YHEA 5G04J 5ANRA 3ZYLA 2YHCA 3PH0C 4N3AA 4F1SA 3QJZA 1IHGA 3PNTB 2PQRA 4L7TA 2V8SE 2VYIA 3UT7A 2LO6A 4CDMA 4GPKA 5EKQD 3Q15A 1E7VA 4XX5A 3E4BA 1GW6A 4P29A 3QWPA 5A23A 1WM5A 3FTWA 3KS2A 3VLFA 4APFA 3JUIA 3OXGA 4I1OB 1HFAA 3CKCA 3D9IA 2WXFA 3PS6A 3U66A 4FHKA 2PZIA 4JC8A 2GRMA 3L13A 3U3WA 1LF8A 2CHZA 3MGBA 1OWPA 2L0IA 4JVSA 3RRUA 3QWVA 3G2UA 4BSXA 4PS3A 3QNKA 3FULA 1HZ4A 1QNFA 3ZFWA 2YINA 3S7FA 4GCNA 5FJYA 4WAFA 2GRLA 4JEUA 2A4ZA 4G25A 2XEVA 3FU3A 3I3NA 2WXQA 4R7LA 5T8IA 5A7DB 4I6GA 5D0QD 3JQ1A 3GZ2A 2VQ2A 3MV3B 4TV3A 5FQ7A 4MS6A 1Y6IA 4LEUA 4V3IA 3RRNB 1TEZA 2FO7A 4GZ3A 3MJWA 3AS5A 3ASGA 4GMLA 4IRUA 3G2TA 2AXVA 1FVHA 4EZKA 2J07A 4DI4A 4JEHA 2UY1A 1OUVA 4XI9A 2FEZA 2OVBA 3NQPA 3RU0A 3FTYA 3ZEFA 2WB2A 2KCLA 4GYWA 2X3MA 4I6JA 4BT9A 3D9PA 3HVEB 4LUNU 4BX8A 4HFGA 4AIFA 4J8FA 3D9OA 3IKOB 3QWWA 4BFRA 1EDUA 1ELWA 4C0MA 2QFCA 2AXZA 3UQ3A 4PS8A 2AVPA 1A17A 2X6FA 1ZU2A 3ENEA 3LXUX 3APFA 3FH8A 3LY7A 4AM9A 2J08A 2J49A 3B7UX 3KAEA 3LCAA 1N52A 3TXMA 1KT0A 4G23A 4HLEA 5KJNA 3APDA 3QB2A 4WNDA 2KATA 2J4DA 3GYZA 4DLQA 1HX8A 1NA3A 4UWLA 2WXLA 3L22A 5ARFA 4KVOA 4HOUA 4JA7A 1MQSA 3FTVA 3CLJA 2P58C 3D9JA 4L2LA 4ACLA 3ASHA 4KYOB 3O48A 4UWFA 4G24A 4ANVA 2AXUA 4LRZA 4QFVA 3WXXA 1UG3A 4UWKA 5LCWC 3CQGB 4JW1A 4CGVA 2WVIA 3Q5MA 3R7QA 1IQUA 1OWOA 3N71A 1JUQA 4U07A 1SQMA 3EHNA 1H2UA 4GA0A 3RO3A 3T5VA 4GCOA 4J8SA 5J90A 2CHWA 3UPVA 3T5XA 1XNFA 2FI7A 2WXNA 3LJ3A 2VJ8A 3FTXA 3PE4A 3JQ0A 3SZ7A 1OWMA 1HF8A 2IU1A 2L9BA 4EZJA 4JHJA 4KBQA 5FT9A 3ZYQA 4ABNA 4HS2A 2FULA 3MKQA 2CFUA 3NZUA 4PDXA 2V4LA 3MA5A 4KVMA 4UWHA 4DLOA 2C0LA 4Q94A 4JHKA 4BTAA 5CCLA 3ZVVA 4DI3A 5M72A 3CHMA 3CHQA 3ONLA 3ML8A 3IHYA 2R59A 4F7AA 4RG6A 3QARA 4JXTA 3MX3A 4TRQA 1QQEA 4I1AA 3EIJA 4CT0A 2GGFA 3BG0B 2WMNA 4BTBA 4BWRA 4ME2A 3SI5A 2OVFA 2QY7A 2IF4A 4CDRA 2RG8A 3B13A 4I1MA 4XKBA 1NA0A 2KZTA 3ML9A 2X6HA 1JWGA 1E8WA 5G05C 4HXIA 3ZIMA 3APCA 3LY9A 4CGWA 2VTBA 4AVXA 3CHOA 5CHEE 4WNGA 4Y6WA 3EJNA 4URKA 2VSNA 2VTBB 2CHXA 3QC1A 4I17A 5FZSA 3MKQB 4KZ0A 1EYHA 4N2QA 2X38A 3ZGQA 1VDYA 2KM4A 2BF0X 5E75A 2WQ7A 5BV1A 1EF1C 2XPIA 2OV8A 2PM6A 4NQ0A 4FADA 3BG1B 3AS4A 2DBAA 1L5JA 2JLBA 2IFUA 2XPZA 1FVFA 2L6JA 3ZHEA 2WMOA 2R5SA 3RRMB 5BPPA 4WNFA 3SHFA 3R7RA 3MZLB 5G05J 4HOTA 3IV0A 2XGOA 2IQCA 3ASFA 2I2OA 4UQXA 4EBAA 3O4ZA 4EECA 5EX0A 4CDNA 4OYSA 4E85A 5JJTA 3OXLA 4PS7A 3QKYA 3NF1A 2J09A 4HOQA 3LY8A 2R17C 4OVUA 3FY4A 3FU0A 3CVXA 3UUXA 3FH7A 4ANUA 4AY6A 3LS8A 3PREA 4KMOA 2OOEA 3KD7A 3UMVA 3ZW3A 3RIBA 2VSXE 3CQCB 4HVBA 2C0MA 3S7JA 2XCCA 2M63A 3R9AB 3K9IA 3HHMA 3LVRE 3RKVA 1B89A 1UJKA 3PUKA 2RD0A 3SBSA 2I9CA 3FWVA 4B89A 3B7RL 3ZRHA 3KEZA 4FC8A 2AW6A 2Y4UA 3NZSA 1U3CA 5A6CA 4N2SA 2WXMA 2I1KA 3TJPA 1HU3A 4A55A 4U0ZA 4YNDA 3U9WA 2Y3AA 4N3CA 4BY6A 2C2LA 2BTDA 1E8XA 4BT8A 4XZ4A 5AENA 4WWPA 3RJVA 4EZLA 3FP3A 2WPVA 3TGOA 5LCWJ 2XGMA 4J0UA 4Y6CA 2J9QA 3AS8A 2CFZA 4WUYA 3FTSA 1N54A 1BPOA 5JHBA 4WWNA 3FUMA 3MKRA 3QOUA 3PRZA 2Y4TA 4O6FA 3OAWA 1E96B 3CHSA 3DBSA 4H7YA 5BV0A 2E0IA 2ILRA 2LAIA 2XQ0A 3QDNA 1UN9A 1SZAA 3FHEA 4RG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G04 J;  2C0L A;  4AY5 A;  4U0U A;  2YHC A;  4N3A A;  3S7B A;  4BTA A;  5DIZ A;  5CCL A;  5M72 A;  3CK8 A;  5KJL A;  1IHG A;  2KCK A;  2PQR A;  2VYI A;  3CKB A;  3HYM B;  4GPK A;  4RG6 A;  3Q15 A;  5EKQ D;  5EX3 A;  3E4B A;  5KJM A;  3QWP A;  2UY1 B;  2V5F A;  1QQE A;  4I1A A;  1WM5 A;  3VTY A;  3KS2 A;  1HXI A;  3GW4 A;  3BEE A;  4BTB A;  3OXG A;  4BWR A;  3ZPJ A;  4J8E A;  3CKC A;  4ME2 A;  2IF4 A;  2PZI A;  4CDR A;  5FTP A;  3URZ A;  3U3W A;  1NA0 A;  3PDN A;  3CVL A;  3RO2 A;  5G05 C;  3CV0 A;  3QWV A;  5CCM A;  2XGS A;  4I9E A;  3LY9 A;  1HZ4 A;  3ZFW A;  4EQF A;  5CHE E;  4W9R A;  4WNG A;  4Y6W A;  3S7F A;  3TAX A;  4GCN A;  4NRH B;  5FJY A;  2Q7F A;  2VSN A;  5DBK A;  4G25 A;  2XEV A;  2FF4 A;  4UI9 C;  4I17 A;  5FZS A;  5A7D B;  4N2Q A;  5D0Q D;  4G2V A;  3ZGQ A;  2VGX A;  3GZ2 A;  2VQ2 A;  3Q4A B;  3CEQ A;  3MV3 B;  4XIF A;  3LPZ A;  4B94 A;  5D0O D;  2NC9 A;  5JJ6 A;  4KXK B;  2XPI A;  4LEU A;  5HI7 A;  2FO7 A;  2KCV A;  4GZ3 A;  4NQ0 A;  4U04 A;  2WQH A;  3AS5 A;  3AS4 A;  3ASG A;  2DBA A;  4GYO A;  3S7D A;  3TG4 A;  2JLB A;  3U4T A;  5BT1 A;  2VGX B;  2IFU A;  3OXF A;  5AYW D;  2L6J A;  5BNW A;  2UY1 A;  1OUV A;  3ZHE A;  4XI9 A;  2FEZ A;  3ZN3 A;  2R5S A;  3RU0 A;  4F3V A;  4WNF A;  5FZQ A;  4I2Z A;  4GA1 A;  1NZN A;  2KCL A;  4GYW A;  5G05 J;  4HOT A;  2XGO A;  4BT9 A;  3ASF A;  4UQX A;  4UI9 J;  3ULQ A;  4N39 A;  5EX0 A;  3ZHE B;  3JYS A;  4AIF A;  4WND A;  2VSY A;  4J8F A;  3OXL A;  5JJT A;  1IYG A;  3QWW A;  2OND A;  3QKY A;  3NF1 A;  4HOQ A;  4A1S A;  3LY8 A;  4HOS A;  1ELW A;  1ELR A;  3ESK A;  2QFC A;  2HR2 A;  4UI9 K;  4YVQ C;  3UQ3 A;  2AVP A;  1A17 A;  3ASD A;  1ZU2 A;  3GZ1 A;  4J8D A;  3UUX A;  4AY6 A;  4AM9 A;  3LY7 A;  2OOE A;  3KD7 A;  3KAE A;  3LCA A;  1KT0 A;  1YA0 A;  4G23 A;  3RIB A;  5KJN A;  3MEK A;  2C0M A;  4GZ5 A;  2KAT A;  2XCC A;  2KC7 A;  3GYZ A;  1Y8M A;  3LYA A;  2YQ8 A;  4GA2 A;  1NA3 A;  3CVP A;  3S7J A;  5G04 C;  3R9A B;  2PL2 A;  4JA9 A;  2HO1 A;  3K9I A;  3CVN A;  2HYZ A;  4G1T A;  5ARF A;  3TG5 A;  4G26 A;  4HOU A;  4JA7 A;  3RKV A;  4GZ6 A;  1B89 A;  3Q47 B;  2GW1 A;  1HH8 A;  2MHK A;  2FBN A;  3MV2 B;  2P58 C;  1WAO 1;  3ASH A;  1PC2 A;  1ZBP A;  1FCH A;  3FFL A;  3FWV A;  3O48 A;  4G24 A;  4KYO B;  3WXX A;  5HQ8 A;  2Y4U A;  5LCW C;  3CK9 A;  5C1D A;  5A6C A;  4N2S A;  4CGV A;  3Q5M A;  5JJ7 A;  4HOR A;  3N71 A;  4U0Z A;  4YND A;  1P5Q A;  2BUG A;  4H7X A;  4U07 A;  3CK7 A;  5ARG A;  4N3C A;  2C2L A;  4GA0 A;  3RO3 A;  4ABN A;  2VGY A;  3PE3 A;  4U0S A;  4GCO A;  4BT8 A;  4APO A;  4GYY A;  4N3B A;  5BW8 C;  3UPV A;  1QZ2 A;  4WNE A;  2LSU A;  3IEG A;  1XNF A;  2FI7 A;  3FP3 A;  4JL0 A;  2PQN A;  2WPV A;  3RJV A;  5LCW J;  3TGO A;  2XGM A;  2LNI A;  3PE4 A;  4J0U A;  4Y6C A;  4UQZ A;  2J9Q A;  3AS8 A;  1KLX A;  4WUY A;  3SZ7 A;  2LSV A;  5KJK A;  2UWJ G;  1KT1 A;  3VTX A;  4JHR A;  4KBQ A;  5FT9 A;  3LKU A;  3MKR A;  3QOU A;  1W3B A;  2Y4T A;  4O6F A;  4N5C A;  3Q49 B;  2E2E A;  1E96 B;  4YVO A;  3SF4 A;  5FZR A;  4H7Y A;  1TJC A;  2XCB A;  4XI0 A;  3QDN A;  4I9C A;  4IN3 B;  4I2W A;  3MA5 A;  3EDT B;  4CGW A;  2I6H A;  4RG9 A;  3CVQ A;  4UQY A; 
#chains in the Genus database with same CATH topology
 3L16 A;  1BD8 A;  1OCC E;  1UW4 B;  2JEK A;  5LOZ A;  3D9M A;  3QK0 A;  2XEH A;  3ZPJ A;  4Q69 A;  4O60 A;  2RFA A;  3LJN A;  3PDN A;  5LX8 A;  3CVL A;  5G55 A;  4NRH B;  2WXJ A;  4TXP A;  3FEX A;  4GMJ A;  4B94 A;  5CEA A;  1SZ9 A;  3S7D A;  1EPU A;  5BT1 A;  5AYW D;  2IOL A;  2WXO A;  4WWO A;  3ULQ A;  4FLB A;  3J5P A;  4L2Y A;  2XZT G;  2WXG A;  1ELR A;  4CCA A;  4UI9 K;  3ASD A;  3KEA A;  3SY2 A;  3S2A A;  4DJA A;  2ION A;  4OVV A;  3RAU A;  1XGW A;  4GA2 A;  5C2Y A;  5T4Y A;  2PL2 A;  4JA9 A;  3ASO E;  1O1S A;  3CVN A;  4AXH A;  1TN6 A;  3UIO C;  4B93 B;  2XS1 A;  1YMP A;  4EPZ A;  5JHA A;  2L0T B;  3UIP C;  4HOR A;  5ARG A;  1NFI E;  2XRY A;  1TJF A;  4APO A;  2LSU A;  3DWL G;  4YDW A;  5FQ8 A;  4UUC A;  3G2V A;  4YVO A;  1BI8 B;  2QYJ A;  2A5U A;  3Q75 A;  4I9C A;  2I6H A;  3L9T A;  4U0U A;  4ILH B;  5KWD A;  1AP7 A;  3HYM B;  4A3V A;  2V5F A;  5ITZ F;  4Q96 A;  4GAA A;  4J8E A;  5CMW A;  2WXI A;  1U3D A;  1N95 A;  1N0R A;  4I9E A;  1N9A A;  4F53 A;  4GTS A;  3E34 A;  3OTN A;  4U8V D;  5DBK A;  3FU5 A;  2FF4 A;  4UI9 C;  1OCZ E;  3E33 A;  3V30 A;  3Q4A B;  2NC9 A;  4RSY A;  5JJ6 A;  3I5P A;  2NSZ A;  2EQX A;  4GYO A;  5CED B;  4YDE A;  3OXF A;  3HIZ A;  5FZQ A;  4I2Z A;  4GA1 A;  3DPD A;  3CVW A;  1N94 A;  1O1R A;  2WXP A;  3MCX A;  4HOS A;  1TNZ A;  3CGH A;  4NAC A;  2Y1L E;  2NXP A;  1Z3Y A;  4HRM B;  5CRU A;  2HYZ A;  3C98 A;  3DSS A;  4YDY A;  5FWQ A;  5C1D A;  5J08 A;  2V0P A;  1H0A A;  2F0Y A;  2WXK A;  4GZC A;  3EU9 A;  3UKU G;  1TN8 A;  5FIN A;  3UM0 A;  2P2C P;  3PZ3 A;  1KT1 A;  3U64 A;  2IY0 C;  4N5C A;  4JD2 G;  4TUU A;  3Q49 B;  4TXQ A;  2WQ6 A;  2YHE A;  2YHC A;  4N3A A;  4F1S A;  2RFM A;  1D9S A;  4GPK A;  2VYI A;  3UT7 A;  5EKQ D;  5D2M C;  3FTW A;  4APF A;  3JUI A;  1HFA A;  3PS6 A;  3U66 A;  2WXF A;  2PZI A;  2CHZ A;  3RRU A;  1RW2 A;  3G2U A;  3QNK A;  1K1B A;  4JB8 P;  5FJY A;  4WAF A;  2GRL A;  3AJI A;  3C3O A;  3I3N A;  2WXQ A;  2BED A;  3JQ1 A;  3GZ2 A;  3BQO A;  4TV3 A;  4V3I A;  3RRN B;  3V31 A;  1LD8 A;  4IRU A;  4EZK A;  4JEH A;  4XI9 A;  3NQP A;  3RU0 A;  3D9P A;  4LUN U;  4HFG A;  4AIF A;  3W9G A;  3IKO B;  4BFR A;  1ELW A;  2QFC A;  2AXZ A;  3UQ3 A;  1ZU2 A;  3FH8 A;  2DZN A;  2KAT A;  2J4D A;  3GYZ A;  1NA3 A;  2PNN A;  2IEJ A;  3D9J A;  4L2L A;  4KYO B;  3O48 A;  4ANV A;  5EIB E;  1UG3 A;  3B7B A;  2KXP C;  4CGV A;  3N71 A;  1SQM A;  4BET A;  4GA0 A;  4DX5 D;  3UM3 A;  4GMR A;  5J90 A;  3T5X A;  2FI7 A;  3JQ0 A;  3SZ7 A;  1OWM A;  4J7W A;  2IU1 A;  4EZJ A;  3ZYQ A;  4ABN A;  2R2L A;  2CFU A;  4TUM A;  1N4Q A;  3TWV A;  4Q94 A;  1MX4 A;  3ONL A;  3IHY A;  4RG6 A;  1QQE A;  4K5C A;  1BU9 A;  4BTB A;  2RG8 A;  3Q7F A;  4HXI A;  4EHM A;  2VTB A;  1U2V G;  2VTB B;  1NI1 A;  2X38 A;  1VDY A;  2R03 A;  5E75 A;  1Z5S C;  3HXC A;  2WQ7 A;  2LXM A;  3BU8 A;  1FVF A;  3HRA A;  3ZHE A;  2WMO A;  5BPP A;  4HOT A;  4UQX A;  4EBA A;  5JJT A;  4HOQ A;  2J09 A;  3LY8 A;  4OVU A;  2ZIR A;  3FU0 A;  3CVX A;  3UUX A;  4AY6 A;  3KD7 A;  2Y69 E;  3ZW3 A;  2VSX E;  3S7J A;  3EHR A;  3UKR G;  3RKV A;  1UJK A;  2H6F A;  3NOC D;  2I9C A;  4M7C A;  3FWV A;  4B89 A;  3ZRH A;  4FC8 A;  2I1K A;  4U0Z A;  3NB2 A;  3U9W A;  4BY6 A;  5AQ9 A;  1MJ0 A;  5AEN A;  3Q73 A;  4WWP A;  5B3S E;  3AS8 A;  3DSX A;  4WUY A;  4WWN A;  3QOU A;  1E96 B;  4HI8 A;  2E0I A;  2LAI A;  3QDN A;  5FQ4 A;  1SZA A;  1LTX A;  4ILG A;  5AAR A;  1H2T C;  2KCK A;  1QYM A;  3L54 A;  3PZ1 A;  4K03 A;  5CBO A;  1IKN D;  2J8S D;  4YDO A;  4KT6 B;  4DUI A;  5FTP A;  3PZ4 A;  1FT2 A;  3RO2 A;  3HXD A;  5CCM A;  4W9R A;  3AG2 E;  4CEM A;  3AG3 E;  3FUK A;  3MYV A;  3ZU7 B;  2VGX A;  3DSV A;  5D0O D;  4IYP A;  4KXK B;  2J4B A;  3FH5 A;  1E8Y A;  2WQH A;  2VGX B;  2CG3 A;  4F3V A;  1SW6 A;  3HVE A;  3SBT B;  5AIJ A;  4HLL A;  2EIJ E;  3LVQ E;  1KZP A;  4N39 A;  1OY3 D;  4AP2 A;  2VSY A;  1OWL A;  3ZNG A;  2KZT B;  4PUC A;  1Z3X A;  4LCT A;  4YVQ C;  3V2O A;  1E90 A;  4FU3 A;  4LG6 A;  4HBD A;  1NP7 A;  3DEO A;  4U8Y D;  4FLH A;  2F37 A;  3TWQ A;  4KZC A;  2GRN B;  1V54 E;  3Q47 B;  4LNG A;  5T3R A;  3EHQ A;  5IY5 E;  3RK6 A;  2DCP A;  1E8Z A;  2IO3 C;  4L23 A;  3TL5 A;  3ABM E;  5FIO A;  4A1G A;  3Q9U C;  4U8H A;  3IEG A;  4ANW A;  2WXR A;  4QQI A;  4UQZ A;  2FO1 E;  3D9K A;  1G3N B;  2E2E A;  1TJC A;  4I2W A;  4RVB A;  4GTT A;  4ZHB A;  3EHM A;  4CRW A;  4AY5 A;  3DXK G;  5DIZ A;  3CK8 A;  4HQD A;  5KJM A;  3CSF A;  1TN7 A;  3ONK A;  5D66 A;  3VLD A;  2QYU A;  5ENR D;  4F1P A;  2XGS A;  4DPR A;  5KBA A;  4C9B B;  3Q78 A;  3HXF A;  3TAX A;  3CR3 A;  4A3T A;  1Z6T A;  5AQB A;  3LPZ A;  1E7U A;  4K5B A;  1K3Z D;  4IUL A;  4JPS A;  2P9K G;  4U04 A;  4FA6 A;  1TNU A;  3UIN C;  2MRI A;  3CHR A;  1X5B A;  1NZN A;  4UI9 J;  1A5E A;  4DK5 A;  1IYG A;  4A1S A;  3QAQ A;  3ESK A;  1INZ A;  3KSQ A;  2EIN E;  2DZO A;  1DVP A;  4BX9 A;  2VSO E;  4DRX E;  2DVW A;  1HG5 A;  1Y8M A;  2AWI A;  4G1T A;  4G26 A;  4GZ6 A;  2GW1 A;  1PC2 A;  1O5M A;  3CK9 A;  4B8A A;  5JJ7 A;  1DCE A;  3FUN A;  4CYM D;  3CK7 A;  4ATZ D;  3NBN B;  3I4R B;  3SNX A;  3PE3 A;  4U0S A;  5BW8 C;  4C0E A;  5CMY A;  3UT8 A;  4JL0 A;  3AU5 A;  4NUR A;  1KLX A;  2IOS A;  2LSV A;  2UWJ G;  3PUJ A;  3VTX A;  3ZXP A;  4MBG A;  4IN3 B;  1JPL A;  3IXE A;  2HO1 A;  3PH0 C;  4BSZ B;  1IHG A;  2V8S E;  1GW6 A;  5A23 A;  2XZD G;  3HXB A;  4I1O B;  3D9I A;  2NYJ A;  4JC8 A;  1OWP A;  4PS3 A;  3ZFW A;  3S7F A;  4JEU A;  4G25 A;  5A7D B;  1D8E A;  2VQ2 A;  4O1O A;  5FQ7 A;  1Y6I A;  3X2Q E;  2FO7 A;  4GZ3 A;  2QZA A;  3AS5 A;  4C48 B;  2OVB A;  3FTY A;  2MYO A;  4XEI G;  3D9O A;  1H6P A;  3QWW A;  2R05 A;  1A17 A;  3ENE A;  3LXU X;  3APF A;  3Q9N C;  3LY7 A;  3B7U X;  1N52 A;  4HLE A;  5KNG A;  3TWR A;  5EN5 D;  4LNU D;  4JA7 A;  1MQS A;  1H6O A;  4UWF A;  3WG7 E;  4LRZ A;  4JW1 A;  2WVI A;  3R7Q A;  1OWO A;  4GTP A;  3EHN A;  3RO3 A;  4J8S A;  1FT1 A;  2CHW A;  1N0Q A;  5HKP A;  3LJ3 A;  2GRR B;  3DSW A;  1HF8 A;  4KBQ A;  5FT9 A;  2RKK A;  2FUL A;  3MKQ A;  5CBN A;  2V4L A;  4KVM A;  4DLO A;  1OCR E;  2C0L A;  4BTA A;  3CHQ A;  2EIM E;  4F7A A;  4CT0 A;  3SI5 A;  2QY7 A;  4I1M A;  3ABL E;  3ML9 A;  1JWG A;  1E8W A;  1MX2 A;  2VGE A;  4WNG A;  4Y6W A;  2VSN A;  4BEP A;  1UOH A;  1EYH A;  4N2Q A;  3ZGQ A;  2KM4 A;  3DXM G;  1EF1 C;  2PM6 A;  4FAD A;  3AS4 A;  2JLB A;  3IV0 A;  2XGO A;  5EX0 A;  4CDN A;  3OXL A;  4KMO A;  3HXE A;  3CQC B;  4O1P A;  1JCQ A;  3HHM A;  2RD0 A;  3SBS A;  2H6G A;  3KEZ A;  2AW6 A;  1N4P A;  2H6I A;  2WXM A;  3ULY A;  5KNH D;  3KSL A;  1KPS B;  4J0U A;  2J9Q A;  2CFZ A;  5AAO A;  4O6F A;  3PRZ A;  2Y4T A;  4L9P A;  2P9N G;  5BXO A;  3FHE A;  1MYO A;  4FJY A;  4LER A;  5KJL A;  3CIA A;  1H19 A;  5EX3 A;  2H6H A;  4I43 A;  4K0R A;  2UY1 B;  3VLE A;  3BEE A;  2DYS E;  4AV7 A;  1ELK A;  1PY1 A;  2XRZ A;  2XPY A;  4XKC A;  3FTZ A;  5E76 A;  3B7T A;  1HO8 A;  5JA4 D;  1UJJ A;  3F6Q A;  1S70 B;  3FUI A;  1HE8 A;  2LXL A;  5HI7 A;  1K1A A;  3UM1 A;  1IQR A;  4M3O A;  3ZN3 A;  3V2X A;  3G2S A;  3UXG A;  3ZHE B;  3P2B A;  3JXI A;  1S0P A;  3NOG D;  1JWF A;  1WG0 A;  1HG2 A;  3ULE G;  3SGH A;  4NIK A;  1RZ4 A;  5KCM A;  1YA0 A;  1S64 A;  5EIL A;  3TG5 A;  3EIQ C;  2MHK A;  1HH8 A;  4G11 A;  3MV2 B;  1WAO 1;  3FFL A;  3SFZ A;  1ZB1 A;  2I1J A;  4MKT A;  2OCC E;  3D9L A;  1H6K A;  2BUG A;  4GZD A;  4AOF A;  4J8Y A;  4GYY A;  5G2N A;  2GRO B;  3CVU A;  2PQN A;  5HRY A;  5AJD A;  2X6K A;  3FUF A;  1W3B A;  2WM9 A;  4XI0 A;  3ESL A;  3G2W A;  4HNA D;  4E6H A;  4U96 D;  3ISM C;  2HM8 A;  4GB9 A;  2PM7 A;  5AQ7 A;  3DPY A;  3SD5 A;  3IBE A;  5AJL A;  3L6A A;  4BER A;  2ZGD A;  4BES A;  3ZYM A;  2Q7F A;  2QC9 A;  3EU5 A;  4XIF A;  2JAB A;  1N4R A;  3U4T A;  5BUZ A;  1H2V C;  2P9I G;  2Y0B G;  3SFX A;  3TWS A;  3UTM A;  5EYL A;  3E37 A;  2XHE A;  3JYS A;  4MRU A;  5EYP F;  2OND A;  2HR2 A;  2MOW A;  4J8D A;  2LAH A;  3D3M A;  3HDX A;  3LEW A;  4ANX A;  3JXJ A;  4GZ5 A;  2KC7 A;  4XE0 A;  3CVP A;  3PNL B;  3ZKJ A;  3ZXS A;  4CT4 A;  1K8K G;  5HQ8 A;  3RSE G;  1FCH A;  2B6C A;  3PZD A;  4FJZ A;  3FUD A;  3C5R A;  5B1B E;  1HS6 A;  5ANL A;  4ACK A;  4WNE A;  3L17 A;  3CVV A;  4PH4 B;  3FUJ A;  4CZ2 D;  3LKU A;  3SF4 A;  3Q79 A;  2X6I A;  3EDT B;  4B8C B;  4TXR A;  5ANR A;  3L82 A;  3ZYL A;  3QJZ A;  3PNT B;  2PQR A;  4L7T A;  1E7V A;  4XX5 A;  3E4B A;  4P29 A;  3QWP A;  2GRP B;  1WM5 A;  3KS2 A;  4FHK A;  3L13 A;  1LF8 A;  2P9U G;  1IHB A;  4JVS A;  3QWV A;  5H7P A;  3FUL A;  1HZ4 A;  1QNF A;  4GCN A;  2XEV A;  3FU3 A;  4R7L A;  5D0Q D;  4MS6 A;  4LEU A;  5ENQ D;  1TEZ A;  3MJW A;  3ASG A;  1SA4 A;  4GML A;  3G2T A;  2AXV A;  2J07 A;  4DI4 A;  2FEZ A;  3TWW A;  3ZEF A;  2WB2 A;  2X3M A;  4I6J A;  4BT9 A;  3HVE B;  3HG0 D;  1TNO A;  4C0M A;  4PS8 A;  2AVP A;  2X6F A;  2ZXW E;  4AM9 A;  2J08 A;  2J49 A;  3SO8 A;  3LCA A;  3TXM A;  5KJN A;  3APD A;  5B1A E;  3AG4 E;  4DX2 A;  4G8K A;  2WXL A;  3L22 A;  4HOU A;  3CLJ A;  2P58 C;  3ASH A;  4DX1 A;  4G24 A;  4UWK A;  3Q5M A;  1JUQ A;  1H2U A;  3EUV A;  2DWZ A;  3C3R A;  2EIK E;  2VJ8 A;  3PE4 A;  2AJA A;  2EIL E;  4HS2 A;  3NZU A;  4PDX A;  2ETA A;  4RLY A;  3CHM A;  1OCO E;  3ML8 A;  3QAR A;  4JXT A;  4TRQ A;  3C3Q A;  4I1A A;  3EIJ A;  3DRA A;  2IF4 A;  2KZT A;  3APC A;  5ENT D;  4CGW A;  5CEC B;  4URK A;  3QC1 A;  4I17 A;  4KZ0 A;  5HS0 A;  2BF0 X;  2OEV A;  4Z68 A;  5BV1 A;  2OV8 A;  3BG1 B;  2DBA A;  1L5J A;  2A5E A;  2BKK B;  4GTV A;  2IFU A;  2L6J A;  2IQC A;  2I2O A;  4OYS A;  2L6B A;  3QKY A;  2R17 C;  4HRL A;  4ANU A;  3FH7 A;  4RQI A;  3LS8 A;  1D8D A;  1MX6 A;  2C0M A;  1N4S A;  3R9A B;  3K9I A;  4HB5 A;  3LVR E;  1B89 A;  1X81 A;  3PUK A;  4U95 D;  3E32 A;  3NZS A;  1TYQ G;  1U3C A;  1DCQ A;  4N2S A;  4A55 A;  4YND A;  2Y3A A;  1JCS A;  1E8X A;  4BT8 A;  4XZ4 A;  3FP3 A;  2WPV A;  3TGO A;  2XGM A;  1NL4 A;  3FTS A;  1N54 A;  5JHB A;  3FUM A;  3MKR A;  3OAW A;  3CHS A;  1YYH A;  3DBS A;  5BV0 A;  4H7Y A;  2ILR A;  2XQ0 A;  1UN9 A;  4RG9 A;  2ETC A;  1OT8 A;  3S7B A;  1TNB A;  3TXN A;  2CG2 A;  3DSU A;  3VTY A;  3C72 A;  3FUE A;  3ZYK A;  5EDS A;  3T8K A;  3FDH A;  3PEV B;  3JCK C;  4EQF A;  2XEE A;  3D9H A;  4OAV B;  3V79 K;  4G2V A;  3UX4 A;  4LNB A;  3P1U A;  3CEQ A;  3ABK E;  5CRV A;  4AJW A;  4GU5 A;  3T8M A;  3UM2 A;  2F8X K;  3AAA C;  1DNP A;  2F8Y A;  4ATG A;  2DIW A;  2ZGG A;  5AN8 A;  3GZ1 A;  1SA5 A;  4DX7 D;  3MEK A;  3LYA A;  4ILI A;  5EID A;  3ZUV B;  4FHJ A;  4FUL A;  2GRQ B;  3D9N A;  3TWT A;  4FP7 A;  3UT4 A;  5CER B;  3CST A;  2B0O E;  4AEZ C;  4X8Q A;  4H7X A;  2R02 A;  3E30 A;  3R9M A;  5AQA A;  2VGY A;  3FEY A;  2ETB A;  3B95 A;  4JZY A;  5ENS D;  4N3B A;  2WXH A;  4U63 A;  2LNI A;  5KJK A;  3PVL A;  1PAQ A;  4L1B A;  5FQ6 A;  2X6J A;  2XCB A;  1TR4 A;  1MHQ A;  3CKB A;  4N5Q A;  4LSZ E;  1HXI A;  3GW4 A;  3B7S A;  4GTQ A;  4EBA G;  4GTM A;  3URZ A;  3NAW A;  3I4G A;  3BUA A;  3CV0 A;  1UN8 A;  3AU4 A;  1WDY A;  3PEU B;  5BXU A;  2ZU6 B;  2IJG X;  1FPP A;  2KCV A;  3W9F A;  3TG4 A;  3CVY A;  5BNW A;  5ENN A;  4UWG A;  2BKG A;  2YNQ A;  2XS8 A;  5ENP D;  3FTU A;  3FUH A;  3CHP A;  1Q2Z A;  1DC2 A;  4B0Z A;  4GPM A;  4D10 C;  2YQ8 A;  3L08 A;  1WY6 A;  5G04 C;  4I6E A;  4J6I A;  1JCR A;  2OEW A;  2FBN A;  3T9K A;  1ZBP A;  2ZIS A;  1OWN A;  4DX6 D;  2HE0 A;  1OXJ A;  4MLP A;  3SFY A;  1P5Q A;  3GZS A;  1S63 A;  1QZ2 A;  5LFA A;  4GTO A;  4JHR A;  1LD7 A;  3FU6 A;  3TWU A;  1SVX A;  5LP0 A;  5FZR A;  3LDZ A;  1QBQ A;  3CVQ A;  3IHV A;  4UQY A;  5G04 J;  4CDM A;  2LO6 A;  4F6R D;  3Q15 A;  3VLF A;  3OXG A;  3CKC A;  2GRM A;  5JMN D;  3U3W A;  3MGB A;  2L0I A;  2P9P G;  4BSX A;  2YIN A;  2A4Z A;  5T8I A;  4I6G A;  3MV3 B;  1IXV A;  3PZ2 A;  1BLX B;  1FVH A;  2UY1 A;  1OUV A;  2V5Q C;  2KCL A;  4GYW A;  4G8L A;  4BX8 A;  4J8F A;  1EDU A;  3KAE A;  1KT0 A;  4G23 A;  3QB2 A;  4WND A;  4DLQ A;  1YCS B;  1HX8 A;  4UWL A;  5ARF A;  4KVO A;  3FTV A;  4HI9 A;  4ACL A;  3SQV A;  2AXU A;  3WXX A;  4QFV A;  5LCW C;  3CQG B;  2P9L G;  1IQU A;  4U07 A;  3T5V A;  4GCO A;  1V55 E;  2KBX A;  4A63 B;  3UPV A;  1XNF A;  2WXN A;  2V4H C;  3FTX A;  2IO2 C;  3UI2 A;  2L9B A;  4JHJ A;  3AG1 E;  4UWH A;  3MA5 A;  1BI7 B;  4JHK A;  5M72 A;  5CCL A;  3DST A;  3ZVV A;  4DI3 A;  2R59 A;  3ASN E;  4U7E B;  3MX3 A;  2GGF A;  3BG0 B;  2WMN A;  4BWR A;  4ME2 A;  2OVF A;  4OAU C;  4CDR A;  3DEP A;  3B13 A;  4XKB A;  1NA0 A;  3TWX A;  2X6H A;  5G05 C;  3ZIM A;  3LY9 A;  4ZFH A;  4AVX A;  3CHO A;  5CHE E;  2DYR E;  3EJN A;  2CHX A;  5FZS A;  3MKQ B;  1TNY A;  2XPI A;  4NQ0 A;  1O1T A;  2XPZ A;  2R5S A;  3RRM B;  4WNF A;  3SHF A;  3R7R A;  3MZL B;  5G05 J;  2XEN A;  3ASF A;  3O4Z A;  5ENO D;  4EEC A;  4E85 A;  1MZC A;  4PS7 A;  3NF1 A;  4HRN A;  3FY4 A;  3Q7A A;  3PRE A;  2OOE A;  2LUH A;  3UMV A;  3RIB A;  4HVB A;  3JUE A;  4GTR A;  2XCC A;  2M63 A;  1KZO A;  3B7R L;  3J5Q B;  2Y4U A;  5A6C A;  4K5A B;  3TJP A;  1HU3 A;  4N3C A;  2C2L A;  1AWC B;  2BTD A;  1N11 A;  3RJV A;  4EZL A;  5LCW J;  4Y6C A;  2P9S G;  1BPO A; 
#chains in the Genus database with same CATH homology
 4ILG A;  3S7B A;  4FJY A;  4LER A;  3TXN A;  3L16 A;  5KJL A;  2CG2 A;  1H2T C;  2KCK A;  3L54 A;  1UW4 B;  3CIA A;  2JEK A;  1H19 A;  4K03 A;  5EX3 A;  4K0R A;  4I43 A;  5LOZ A;  2UY1 B;  3D9M A;  3QK0 A;  3VTY A;  3VLE A;  3FUE A;  3BEE A;  3ZYK A;  5EDS A;  3ZPJ A;  3FDH A;  3PEV B;  4KT6 B;  4AV7 A;  4Q69 A;  1ELK A;  1PY1 A;  3JCK C;  2XRZ A;  2XPY A;  5FTP A;  4XKC A;  3PDN A;  5LX8 A;  3CVL A;  3RO2 A;  5CCM A;  3FTZ A;  5E76 A;  5G55 A;  3B7T A;  4EQF A;  1HO8 A;  4W9R A;  4NRH B;  4CEM A;  2WXJ A;  3FEX A;  3FUK A;  1UJJ A;  3MYV A;  4G2V A;  3UX4 A;  3FUI A;  2VGX A;  3P1U A;  3CEQ A;  4GMJ A;  1HE8 A;  4B94 A;  5D0O D;  4AJW A;  4IYP A;  4KXK B;  2J4B A;  4GU5 A;  5HI7 A;  1SZ9 A;  3FH5 A;  1E8Y A;  3T8M A;  2WQH A;  3S7D A;  1EPU A;  5BT1 A;  2VGX B;  5AYW D;  1IQR A;  2CG3 A;  2IOL A;  4M3O A;  3ZN3 A;  4F3V A;  1DNP A;  2WXO A;  3HVE A;  3SBT B;  4ATG A;  3G2S A;  4WWO A;  5AIJ A;  3LVQ E;  2DIW A;  3ULQ A;  4N39 A;  3ZHE B;  4AP2 A;  2VSY A;  3P2B A;  4FLB A;  1OWL A;  2KZT B;  4PUC A;  1S0P A;  4L2Y A;  1JWF A;  2WXG A;  1ELR A;  1Z3X A;  4CCA A;  4LCT A;  4UI9 K;  4YVQ C;  1HG2 A;  3ASD A;  1E90 A;  3GZ1 A;  4FU3 A;  3SGH A;  1NP7 A;  3S2A A;  4DJA A;  5KCM A;  1YA0 A;  2ION A;  4OVV A;  3MEK A;  1XGW A;  4GA2 A;  3LYA A;  4FLH A;  5C2Y A;  4ILI A;  5T4Y A;  2PL2 A;  4JA9 A;  3CVN A;  4AXH A;  3TG5 A;  4KZC A;  4FHJ A;  4EPZ A;  4FUL A;  3EIQ C;  3Q47 B;  5T3R A;  2MHK A;  1HH8 A;  3D9N A;  4G11 A;  3MV2 B;  4FP7 A;  1WAO 1;  3FFL A;  3SFZ A;  3UT4 A;  5JHA A;  3CST A;  3RK6 A;  4AEZ C;  2DCP A;  2L0T B;  2I1J A;  1E8Z A;  4HOR A;  4MKT A;  4L23 A;  3D9L A;  1H6K A;  2BUG A;  4H7X A;  5ARG A;  2XRY A;  2VGY A;  4GZD A;  3FEY A;  3TL5 A;  4AOF A;  4JZY A;  1TJF A;  4A1G A;  4APO A;  4GYY A;  4N3B A;  2WXH A;  4U8H A;  5G2N A;  4U63 A;  2LSU A;  3IEG A;  3CVU A;  2PQN A;  4ANW A;  2LNI A;  2WXR A;  4UQZ A;  5KJK A;  5AJD A;  3PVL A;  2X6K A;  5FQ8 A;  3FUF A;  3D9K A;  3G2V A;  1W3B A;  4YVO A;  1PAQ A;  2E2E A;  4L1B A;  5FQ6 A;  2A5U A;  2X6J A;  1TJC A;  2WM9 A;  2XCB A;  4XI0 A;  3ESL A;  3G2W A;  4I9C A;  4I2W A;  4RVB A;  2I6H A;  3EHM A;  4CRW A;  4AY5 A;  4U0U A;  4ILH B;  4E6H A;  5DIZ A;  3CK8 A;  1MHQ A;  3CKB A;  3HYM B;  4A3V A;  2HM8 A;  5KJM A;  3CSF A;  2V5F A;  4GB9 A;  4Q96 A;  3ONK A;  1HXI A;  3GW4 A;  2PM7 A;  4GAA A;  3SD5 A;  3B7S A;  4J8E A;  5CMW A;  2WXI A;  3VLD A;  4EBA G;  3IBE A;  3URZ A;  1U3D A;  5AJL A;  3L6A A;  3I4G A;  3CV0 A;  2XGS A;  4I9E A;  4DPR A;  4C9B B;  1UN8 A;  4F53 A;  3TAX A;  3ZYM A;  3OTN A;  2Q7F A;  5DBK A;  3FU5 A;  3CR3 A;  2FF4 A;  4UI9 C;  4A3T A;  1Z6T A;  3AU4 A;  3PEU B;  4XIF A;  3Q4A B;  3LPZ A;  1E7U A;  2NC9 A;  2ZU6 B;  2IJG X;  4RSY A;  5JJ6 A;  4IUL A;  3I5P A;  4JPS A;  2KCV A;  4U04 A;  2NSZ A;  4FA6 A;  2EQX A;  3U4T A;  5BUZ A;  3TG4 A;  4GYO A;  1H2V C;  3OXF A;  3CVY A;  2MRI A;  5BNW A;  5ENN A;  4UWG A;  3CHR A;  3HIZ A;  2YNQ A;  1X5B A;  4GA1 A;  4I2Z A;  1NZN A;  5FZQ A;  3DPD A;  3CVW A;  3FTU A;  4UI9 J;  2WXP A;  2XHE A;  4DK5 A;  3JYS A;  4MRU A;  1IYG A;  3MCX A;  2OND A;  3FUH A;  4A1S A;  3QAQ A;  4HOS A;  3CHP A;  3ESK A;  2HR2 A;  3CGH A;  1INZ A;  2MOW A;  4J8D A;  4NAC A;  2LAH A;  3D3M A;  1DVP A;  5FQ4 A;  4BX9 A;  2NXP A;  1Z3Y A;  2VSO E;  3HDX A;  3LEW A;  4B0Z A;  4ANX A;  1HG5 A;  4GZ5 A;  2KC7 A;  1Y8M A;  4XE0 A;  2YQ8 A;  3L08 A;  3CVP A;  4D10 C;  1WY6 A;  3PNL B;  5G04 C;  4I6E A;  4J6I A;  2AWI A;  2HYZ A;  4G1T A;  4G26 A;  3C98 A;  4GZ6 A;  2GW1 A;  3ZXS A;  2FBN A;  4CT4 A;  1PC2 A;  1ZBP A;  1FCH A;  5HQ8 A;  1OWN A;  3PZD A;  5FWQ A;  3CK9 A;  5C1D A;  4B8A A;  5JJ7 A;  3FUN A;  4MLP A;  5J08 A;  1P5Q A;  2V0P A;  1H0A A;  3CK7 A;  4FJZ A;  3FUD A;  2WXK A;  4GZC A;  3I4R B;  3GZS A;  1HS6 A;  5ANL A;  3SNX A;  3PE3 A;  4U0S A;  5BW8 C;  4ACK A;  1QZ2 A;  4WNE A;  4C0E A;  5CMY A;  3UT8 A;  5LFA A;  3L17 A;  4JL0 A;  3AU5 A;  4NUR A;  3CVV A;  4PH4 B;  1KLX A;  2IOS A;  2LSV A;  2UWJ G;  1KT1 A;  3FUJ A;  3PUJ A;  4JHR A;  3U64 A;  3VTX A;  3LKU A;  3FU6 A;  4N5C A;  4TUU A;  3Q49 B;  5LP0 A;  3SF4 A;  5FZR A;  3LDZ A;  2WQ6 A;  4IN3 B;  2X6I A;  1JPL A;  3EDT B;  2HO1 A;  4B8C B;  3CVQ A;  3IHV A;  4UQY A;  2YHE A;  5G04 J;  5ANR A;  3ZYL A;  2YHC A;  3PH0 C;  4N3A A;  4F1S A;  3QJZ A;  1IHG A;  3PNT B;  2PQR A;  4L7T A;  2V8S E;  2VYI A;  3UT7 A;  2LO6 A;  4CDM A;  4GPK A;  5EKQ D;  3Q15 A;  1E7V A;  4XX5 A;  3E4B A;  1GW6 A;  4P29 A;  3QWP A;  5A23 A;  1WM5 A;  3FTW A;  3KS2 A;  3VLF A;  4APF A;  3JUI A;  3OXG A;  4I1O B;  1HFA A;  3CKC A;  3D9I A;  2WXF A;  3PS6 A;  3U66 A;  4FHK A;  2PZI A;  4JC8 A;  2GRM A;  3L13 A;  3U3W A;  1LF8 A;  2CHZ A;  3MGB A;  1OWP A;  2L0I A;  4JVS A;  3RRU A;  3QWV A;  3G2U A;  4BSX A;  4PS3 A;  3QNK A;  3FUL A;  1HZ4 A;  1QNF A;  3ZFW A;  2YIN A;  3S7F A;  4GCN A;  5FJY A;  4WAF A;  2GRL A;  4JEU A;  2A4Z A;  4G25 A;  2XEV A;  3FU3 A;  3I3N A;  2WXQ A;  4R7L A;  5T8I A;  5A7D B;  4I6G A;  5D0Q D;  3JQ1 A;  3GZ2 A;  2VQ2 A;  3MV3 B;  4TV3 A;  5FQ7 A;  4MS6 A;  1Y6I A;  4LEU A;  4V3I A;  3RRN B;  1TEZ A;  2FO7 A;  4GZ3 A;  3MJW A;  3AS5 A;  3ASG A;  4GML A;  4IRU A;  3G2T A;  2AXV A;  1FVH A;  4EZK A;  2J07 A;  4DI4 A;  4JEH A;  2UY1 A;  1OUV A;  4XI9 A;  2FEZ A;  2OVB A;  3NQP A;  3RU0 A;  3FTY A;  3ZEF A;  2WB2 A;  2KCL A;  4GYW A;  2X3M A;  4I6J A;  4BT9 A;  3D9P A;  3HVE B;  4LUN U;  4BX8 A;  4HFG A;  4AIF A;  4J8F A;  3D9O A;  3IKO B;  3QWW A;  4BFR A;  1EDU A;  1ELW A;  4C0M A;  2QFC A;  2AXZ A;  3UQ3 A;  4PS8 A;  2AVP A;  1A17 A;  2X6F A;  1ZU2 A;  3ENE A;  3LXU X;  3APF A;  3FH8 A;  3LY7 A;  4AM9 A;  2J08 A;  2J49 A;  3B7U X;  3KAE A;  3LCA A;  1N52 A;  3TXM A;  1KT0 A;  4G23 A;  4HLE A;  5KJN A;  3APD A;  3QB2 A;  4WND A;  2KAT A;  2J4D A;  3GYZ A;  4DLQ A;  1HX8 A;  1NA3 A;  4UWL A;  2WXL A;  3L22 A;  5ARF A;  4KVO A;  4HOU A;  4JA7 A;  1MQS A;  3FTV A;  3CLJ A;  2P58 C;  3D9J A;  4L2L A;  4ACL A;  3ASH A;  4KYO B;  3O48 A;  4UWF A;  4G24 A;  4ANV A;  2AXU A;  4LRZ A;  4QFV A;  3WXX A;  1UG3 A;  4UWK A;  5LCW C;  3CQG B;  4JW1 A;  4CGV A;  2WVI A;  3Q5M A;  3R7Q A;  1IQU A;  1OWO A;  3N71 A;  1JUQ A;  4U07 A;  1SQM A;  3EHN A;  1H2U A;  4GA0 A;  3RO3 A;  3T5V A;  4GCO A;  4J8S A;  5J90 A;  2CHW A;  3UPV A;  3T5X A;  1XNF A;  2FI7 A;  2WXN A;  3LJ3 A;  2VJ8 A;  3FTX A;  3PE4 A;  3JQ0 A;  3SZ7 A;  1OWM A;  1HF8 A;  2IU1 A;  2L9B A;  4EZJ A;  4JHJ A;  4KBQ A;  5FT9 A;  3ZYQ A;  4ABN A;  4HS2 A;  2FUL A;  3MKQ A;  2CFU A;  3NZU A;  4PDX A;  2V4L A;  3MA5 A;  4KVM A;  4UWH A;  4DLO A;  2C0L A;  4Q94 A;  4JHK A;  4BTA A;  5CCL A;  3ZVV A;  4DI3 A;  5M72 A;  3CHM A;  3CHQ A;  3ONL A;  3ML8 A;  3IHY A;  2R59 A;  4F7A A;  4RG6 A;  3QAR A;  4JXT A;  3MX3 A;  4TRQ A;  1QQE A;  4I1A A;  3EIJ A;  4CT0 A;  2GGF A;  3BG0 B;  2WMN A;  4BTB A;  4BWR A;  4ME2 A;  3SI5 A;  2OVF A;  2QY7 A;  2IF4 A;  4CDR A;  2RG8 A;  3B13 A;  4I1M A;  4XKB A;  1NA0 A;  2KZT A;  3ML9 A;  2X6H A;  1JWG A;  1E8W A;  5G05 C;  4HXI A;  3ZIM A;  3APC A;  3LY9 A;  4CGW A;  2VTB A;  4AVX A;  3CHO A;  5CHE E;  4WNG A;  4Y6W A;  3EJN A;  4URK A;  2VSN A;  2VTB B;  2CHX A;  3QC1 A;  4I17 A;  5FZS A;  3MKQ B;  4KZ0 A;  1EYH A;  4N2Q A;  2X38 A;  3ZGQ A;  1VDY A;  2KM4 A;  2BF0 X;  5E75 A;  2WQ7 A;  5BV1 A;  1EF1 C;  2XPI A;  2OV8 A;  2PM6 A;  4NQ0 A;  4FAD A;  3BG1 B;  3AS4 A;  2DBA A;  1L5J A;  2JLB A;  2IFU A;  2XPZ A;  1FVF A;  2L6J A;  3ZHE A;  2WMO A;  2R5S A;  3RRM B;  5BPP A;  4WNF A;  3SHF A;  3R7R A;  3MZL B;  5G05 J;  4HOT A;  3IV0 A;  2XGO A;  2IQC A;  3ASF A;  2I2O A;  4UQX A;  4EBA A;  3O4Z A;  4EEC A;  5EX0 A;  4CDN A;  4OYS A;  4E85 A;  5JJT A;  3OXL A;  4PS7 A;  3QKY A;  3NF1 A;  2J09 A;  4HOQ A;  3LY8 A;  2R17 C;  4OVU A;  3FY4 A;  3FU0 A;  3CVX A;  3UUX A;  3FH7 A;  4ANU A;  4AY6 A;  3LS8 A;  3PRE A;  4KMO A;  2OOE A;  3KD7 A;  3UMV A;  3ZW3 A;  3RIB A;  2VSX E;  3CQC B;  4HVB A;  2C0M A;  3S7J A;  2XCC A;  2M63 A;  3R9A B;  3K9I A;  3HHM A;  3LVR E;  3RKV A;  1B89 A;  1UJK A;  3PUK A;  2RD0 A;  3SBS A;  2I9C A;  3FWV A;  4B89 A;  3B7R L;  3ZRH A;  3KEZ A;  4FC8 A;  2AW6 A;  2Y4U A;  3NZS A;  1U3C A;  5A6C A;  4N2S A;  2WXM A;  2I1K A;  3TJP A;  1HU3 A;  4A55 A;  4U0Z A;  4YND A;  3U9W A;  2Y3A A;  4N3C A;  4BY6 A;  2C2L A;  2BTD A;  1E8X A;  4BT8 A;  4XZ4 A;  5AEN A;  4WWP A;  3RJV A;  4EZL A;  3FP3 A;  2WPV A;  3TGO A;  5LCW J;  2XGM A;  4J0U A;  4Y6C A;  2J9Q A;  3AS8 A;  2CFZ A;  4WUY A;  3FTS A;  1N54 A;  1BPO A;  5JHB A;  4WWN A;  3FUM A;  3MKR A;  3QOU A;  3PRZ A;  2Y4T A;  4O6F A;  3OAW A;  1E96 B;  3CHS A;  3DBS A;  4H7Y A;  5BV0 A;  2E0I A;  2ILR A;  2LAI A;  2XQ0 A;  3QDN A;  1UN9 A;  1SZA A;  3FHE A;  4RG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...