3Q4CA

Crystal structure of wild type braf kinase domain in complex with organometallic inhibitor cns292
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
264
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title The crystal structure of BRAF in complex with an organoruthenium inhibitor reveals a mechanism for inhibition of an active form of BRAF kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 68
structure length 264
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3q4cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3q4cA01
3CY3A 5IQIA 3I1AA 3EQBA 4BCJA 3BBTB 2XNBA 3HAMA 4L7FA 5BPYA 3LQ8A 5B0XA 3G5DA 4DGLC 4K33A 3SOAA 4P90A 3NUYA 1OIYA 5EDRA 2R3PA 3W2SA 4YGAA 4G5JA 3QWKA 2VWVA 4CZTA 3PA5A 5J7HA 1PMEA 5CI7A 3MBLA 4I1ZA 1YHWA 3NW5A 1M14A 3PE1A 2CKQA 2P2HA 2OG8A 3HV7A 2UW6A 3C4ZA 4HNIA 4ZTSA 3UNZA 2WQMA 5L8KA 4Y8DA 3Q6WA 4L46A 3TIYA 2YCQA 2RG6A 3OFMA 5EOLA 2XYUA 4Q9ZA 5AUZA 5EI6A 3FXXA 2XK9A 3ZFMA 3E93A 4FTJA 4A4LA 1R0PA 2BIYA 3KKVA 3EB0A 4FIIA 5E8TA 2UVYA 4FTOA 1GJOA 3ZSIA 1NY3A 4ZZMA 2YWVA 4NH1A 1YXSA 4RX9A 3OMVA 3ZYAA 2IO6A 4J97A 2KULA 4O7YA 2CMWA 3RNIA 4QMQA 4D2VA 4EOOA 2WGJA 4XH6A 5L8LA 5IQAA 3NNXA 2J90A 2XIRA 2JBOA 5DA3A 3I0QA 5FG8A 4X2NA 2JAVA 2RG5A 4KINA 4G5PA 4U7ZA 5IH5A 3ZFXA 3OWLA 4YLJA 3QX2A 3H9OA 4FUYA 4ARKA 4D9UA 3VWAA 5DT3A 2PVFA 3AXWA 2GS2A 3MPTA 3RKBA 4FIGA 3FMMA 2YZAA 4YLKA 4X2JA 3HECA 3HLLA 5AA8A 1RW8A 2Z02A 2WMBA 3VJOA 1K9AA 3O8UA 3S3IA 2QLQA 2C1AA 2BTRA 2JIIA 2ZB1A 5H8GA 4O1OA 1ZZ2A 2YFXA 3U54A 2A27A 4EOLA 5M07A 3Q04A 4ANMA 5CEPA 4L44A 2O64A 2RGPA 1HOWA 4DITA 4FTQA 2QG7A 1CKPA 3VULA 3HDMA 2G15A 5AP3A 3C1XA 4ZTLA 4LL0A 1FVRA 4YZCA 2I40A 3R21A 4CCUA 2GSFA 2IW6A 3W10A 2PVNA 5BVWA 3RK5A 4XG4A 5FTGA 3IDPA 5AR4A 4AS0A 3C4FA 3FBVA 1K3AA 4AGDA 3GGFA 1JBPE 2XCHA 3BE2A 2PK9A 3EZVA 3Q32A 5BYZA 3LVPA 2Z7QA 2E9UA 5AAGA 4X3FC 5BX0A 4IZAA 2P4IA 3BYSA 4HVHA 2QURA 5CEQA 5ANGA 4TN6A 3I7BA 4PNKA 1CKJA 2IVVA 2F7EE 3AMAA 1PMUA 3GC7A 4I5HA 2W0JA 3DDPA 4CFWA 2XJ0A 3QQGA 4O7ZA 1YI6A 2WMQA 4UXQA 1R3CA 4BCIA 4O0UA 1JNKA 4USDA 5LQFA 5L3AA 4LOQA 1REJA 1R0EA 2P2IA 4V0GA 3A8XA 1ZY5A 1XR1A 1Q61A 3NAXA 4RSSA 4RBLA 3EQDA 3NDMA 3Q4ZA 4MBJA 2ZVAA 3A7FA 2CNUA 4FKQA 2BKKA 3NEWA 3FI4A 1JQHA 4JJRA 3QL8A 5E8YA 3IPHA 1WBWA 2BTSA 5EKOA 2XNGA 1P4OA 1PXMA 3KMMA 3ZLWA 4QMXA 4E6DA 4JLCA 4FNYA 2ZJWA 3MJ1A 2A2AA 3FKOA 4I6HA 4LV5A 1Q41A 2VNWA 1MUOA 2GU8A 2B53A 3BPRA 5E1SA 2QKRA 4KRDA 4FE2A 3Q53A 3UO6A 4ZS4A 4XP0A 5HLPA 2XVDA 1BKXA 2CGVA 4G3CA 3QCYA 3W2QA 1Q4LA 2H8HA 4C33A 1OM1A 4PY1A 5IA2A 4M66A 4F70A 1YW2A 3BYUA 3QQLA 4PV0A 1F5QA 3G6HA 1WBOA 5CU3A 2WTVA 2ERKA 3FI3A 4FF8A 3BQRA 3RALA 4DTKA 4JQ8A 4EH2A 1JPAA 3D7TB 2ACXA 4E6AA 1MRYA 5HE0A 4IVCA 3UG2A 1YHVA 1YXVA 4J52A 4FK6A 4HCUA 1J7IA 5HIBA 4DFYA 2WEIA 5ANKA 5CAOA 4O27B 3UQFA 3E8DA 3CKWA 4QP4A 3FI8A 2ZDUA 4CFXA 1LPUA 2X7GA 4GFGA 5K4JA 4O7VA 4ORKA 1O6YA 4WRGA 3JYAA 3SC1A 5A6OA 5IQHA 3ERKA 1PF8A 1UU8A 3PY1A 3RAIA 4CFMA 3GQLA 3HEGA 3CY2A 2EXCX 2PY3A 3EL7A 5FXQA 4XLVA 5JQ5A 1YDSE 1Q97A 4EOKA 5B2LA 2PULA 4C4GA 5F9EA 4FEWA 1YWRA 2JDTA 2UZUE 4NKAA 5CSWA 4FL1A 2JAMA 4BI0A 3LLTA 4HW7A 5JK3A 2HWOA 2OKRA 1OUYA 1OKYA 3MTLA 1W7HA 4QP6A 1UU7A 1ZYCA 4YPSA 3SKCA 3UMXA 4CNHA 4HVIA 5BUJA 2QOCA 3QA8A 2WMVA 4GL9A 4ONAA 2V22A 2HK5A 5IKWA 4QTBA 3FL5A 5FEEA 4DBXA 2BHHA 5HTIA 3ATTA 2CN8A 2ITTA 5AWMA 3P79A 3HL7A 5HNBA 4BDEA 3TZ9A 3MH1A 5ANDA 3ZH8A 3FMHA 4OR5A 1WBPA 2R3HA 4J8MA 3D83A 2OLCA 4JOAA 3OZ6A 4D4RA 3W55A 4D58A 4Q2AA 4AUAA 4UY9A 2JDRA 4U81A 1SYKA 5A3XA 3NNWA 4XG8A 4AT5A 3NIZA 2GTMA 4F6UA 4GT4A 4ITJA 4QPAA 3CCNA 3TXOA 3SOCA 5JQ8A 4CCBA 4D1SA 5A4QA 3LXKA 3DLZA 1IAHA 4FICA 4BWXA 2JC6A 4ITHA 5DPVA 4AW2A 4BVUA 4AXAA 3OW3A 4MXXA 3U6IA 2BRMA 3WE8A 5KHWA 1YI3A 4IVDA 5KZIA 2R0IA 4DFXE 4FZFB 3GENA 1H1QA 4UMPA 2YIRA 4LYNA 4CGAA 4QP3A 2JKQA 4NCTA 4I23A 4R3CA 4LMUA 2E9PA 3G9LX 5HICA 4APPA 4U3ZA 4EK3A 4WD5A 2DUVA 4QNYA 2J0IA 2C5XA 1ND4A 4BGGA 4ENXA 1PXLA 1J7UA 4EJ7A 2JD5A 2WU6A 4Z3VA 3V5QA 4FKUA 3C50A 3QBNA 3KXXA 5EW8A 1JAMA 3Q9ZA 4QQ5A 3V51A 3LXPA 3K3JA 2P3GX 3TKHA 4HCTA 5DRDA 3FAAA 4EKLA 4C4JA 3FE3A 4TTHB 5T6KA 4EHEA 4JI9A 4EONA 3A4OX 2WOTA 3LM0A 5JFVA 3CEKA 4GK4A 2BRHA 5CT0A 2PU8A 3QYWA 3AT3A 4KAOA 3FEGA 3V6RA 3HV3A 4OT5A 3UZPA 5A46A 2OIQA 4YZMA 4ITIA 4PMPA 4TNDA 4QOXA 4YBKA 3R01A 4TL0A 5CF8A 3KN6A 4XRJA 3TEIA 5HBEA 4C62A 2XNMA 1Y8YA 3QKLA 3V5PA 3MFTA 3EKNA 3CJGA 3NUXA 3W2PA 4R5YA 5IMEA 1VJYA 2XIXA 4G6NA 4HYUA 5GIOE 2R3FA 2XK3A 3EQCA 5AA9A 2JDVA 3QFVA 3VHEA 1PRYA 2PUPA 4JT3A 3Q3BA 3D7TA 3POOA 4XNEA 2R64A 2OJJA 2QR8A 4KS8A 5FQDC 5FGKA 1QPDA 3DY7A 3NNUA 1B39A 4YR8A 2VD5A 3U8WA 5HVYA 3AMYA 4TT7A 5DR9A 4DN5A 2VGPA 4PRJA 1FPUA 4YC6A 5HGIA 5IQFA 3UC3A 3G0FA 3NSZA 4GFOA 4TW9A 4ZZOA 4ACGA 2FGIA 2W05A 3G6GA 4B9DA 3JVRA 2R3IA 3LFFA 3LAUA 4U79A 2WQBA 3G51A 4IAAA 3WF6A 3IO7A 4WBBB 4GG7A 4WUAA 3EFKA 4EK5A 4IM2A 2WTJA 4DYMA 4U0IA 3P5KA 3R7IA 5GZAA 3FSKA 4C3PA 4MBIA 1OBGA 5DN3A 1ZOEA 3A99A 1U54B 3GI3A 3PSCA 4X2GA 5H2UA 4RZWA 5HBJA 1ZMVA 1H1RA 2ESMA 3QGWA 4HGSA 2VNYA 4X3FB 3JY0A 4YZ9A 4Z55A 3TNIA 3I6UA 4ZEGA 2UVZA 1BI7A 4USEA 4NJDA 5D7VA 3K2LA 1TQPA 4UZHA 4I5MA 3W1FA 3IOKA 3AT2A 4Z7HA 1OIRA 3HMPA 5CF5A 1UV5A 3QTIA 4RMZA 2ZV8A 3F3UA 4EK4A 5BQ0A 4HVSA 5ITAA 3TV4A 4XEYA 1YVJA 2IN6A 4XOYA 4IWQA 5KUPA 2QC6A 3PXRA 3O51A 3LMHA 5LVPA 2BAQA 2OJIA 4LGHA 4QT1A 4X6QC 2W17A 5CAQA 4BIDA 4FGBA 4FKTA 1ZOHA 4I3ZA 5LXMA 3RAWA 3OCSA 1OITA 2WEVA 4MNFA 3ZZWA 4ZMFA 3RZFA 3ZBXA 2BFXA 4EOSA 5CEMA 2DYLA 3IW4A 3A60A 3QX4A 4GJ2A 4IC7A 4YPDA 3M11A 4BDCA 3GCUA 5JKGA 4BKZA 4C3RA 4F7SA 5KE0A 4ZAUA 5M06A 5FXSA 3KVWA 1NXKA 4ASXA 3R1NA 4NW5A 3BYVA 4GYGA 4BI2A 3WBLA 4MNEA 1VEBA 1Q5KA 4L8MA 4E8AA 5BVOA 2ONLC 3OF0A 1E1VA 1MRUA 4FNWA 4RQVA 4WNMA 3ZXTA 4W4XA 2UZDA 2CDZA 4BCOA 3UG1A 3FZTA 2DS1A 3AT4A 3PP0A 4J1RA 4JDHA 4QPSA 5LMKC 4D2TA 4W4WA 2OZAB 2R3JA 4G2FA 3DXQA 1H1WA 3A7JA 3S4QA 3FC2A 3RCJA 3ZEPA 2YM4A 3FUPA 4EWQA 4CVAA 4QP9A 4DA5A 4PX6A 2GHLA 3FV8A 4GVAA 3BYMA 1ZYLA 3UVRA 2SRCA 3A7IA 4EZ5A 5HLNA 3QC9A 1SNXA 4QNAA 4GVJA 2YWPA 5JZJA 4NYEA 4TXCA 3P86A 5EG3A 2X6EA 3FDNA 2GQSA 4LUEA 5CYIA 4EOJA 3TI1A 4I20A 1MQ4A 1J91A 2BR1A 4JR3A 3P9JA 5GNKA 3ROCA 1YWNA 3RCDA 5LVNA 4L3JA 5TOZA 5AUXA 5H9BA 2YIWA 3R30A 4AWIA 1IA9A 4I4FA 3FWQA 5C26A 2PL0A 2XK4A 3MW1A 3FMDA 3DDQA 2OH4A 4IX6A 1OBDA 4EH3A 2VWIA 4LOPA 4NM7A 3G2FA 4F7NA 5HU9A 3CQEA 3O2MA 4YZNA 4EZ7A 2QOLA 4BYIA 3P0MA 3HUBA 3GU7A 2ZM3A 2Y7JA 3BKBA 4IAYA 1DAWA 3DFCB 4JX3A 1DM2A 3PUPA 4FC0A 3D4QA 4X7QA 3VS4A 4JIAA 3LW0A 4PNIA 4WNOA 3K54A 5E1EA 2I0HA 2J0KA 2UZWE 4QMUA 5JZNA 3W33A 4G3EA 3C4XA 4CFNA 2WKMA 2FSTX 1IRKA 2JIVA 3I60A 4MEDA 5FUTA 1M2QA 3E3PA 5DNRA 3Q4UA 4ZS0A 3TNPC 2XNOA 4Z16A 3D7ZA 5HO7A 4QRCA 2XM8A 3FHRA 2BRGA 3MFUA 4DLIA 3FLQA 3IW8A 4F9WA 4TKSA 2GNJA 5HX6A 4YP8A 3ZXZA 1H00A 2C47A 2Z7RA 3EQRA 3NYVA 4PTGA 3PZHA 4FSQA 4V01A 2F4JA 3D5WA 3PPJA 4GU9A 4QP7A 5AUWA 4FSRA 4GS6A 3MDYA 3PRFA 5HESA 3CS9A 1WVYA 4BDAA 4EJNA 4A9SA 1Q8TA 4F7LA 5I3RA 3MY5A 3FHIA 4ERWA 3O0GA 1BI8A 4OTIA 2R3KA 2ITWA 3U4WA 5EHOA 2IW9A 1PYXA 5AV1A 3ZRLA 4OGRA 1TVOA 2G2IA 4X3FA 4YC3A 1V0OA 5EM5A 1DI9A 2X2MA 4L01A 2RKUA 4F0GA 2X2LA 3C13A 3H9RA 4ENYA 1PXPA 2B54A 4O22A 3NUSA 3C0GA 2BKZA 3LM5A 3R63A 4F99A 4CQGA 4GK3A 4BDKA 4CYIA 3PZEA 4CG8A 3HMNA 2HIWA 4EUUA 4F7JA 3MYGA 2BZKB 3UJGA 4CRLA 2OICA 4NJ3A 2OGVA 4QYHA 4FV2A 3TIZA 2QG5A 4XG6A 3BX5A 3RK9A 3MA6A 1KV2A 4TWPA 3VVHA 4NL0A 5DBXA 4MF0A 3WI6A 4A07A 3RK7A 4HPUE 2FA2A 4C4IA 2O2UA 3GUBA 4O96A 4GT5A 4NSTA 3OWJA 2GFSA 3PIZA 5L2WA 4TY1A 4IDTA 3ZM4A 3R8UA 3KEXA 5EQPA 5BMMA 4U43A 3VBQA 3VBYA 3KRXA 3ZSHA 2YERA 5DE2A 3SDJA 4PDYA 3F3TA 5HNGA 2C6EA 3EN6A 4RA5A 4X2KA 2B0QA 3U6HA 2QONA 4FT5A 3GCPA 2QU6A 4E6CA 4AZWA 3BGPA 2VTTA 3LOKA 4QD6A 2BUJA 5JT2A 3RP9A 5HHWA 3WILA 3V5WA 3KCFA 5CZIA 4DEDA 4PWNA 4D0XA 5C8KA 3E64A 5C4LA 3NPCA 4IANA 3P78A 3NUUA 3QD2B 3QRTA 2V7OA 4MD9E 4NCTC 4XBRA 3VQUA 3BWJA 3ITZA 4OBQA 2OJGA 4DCAA 4H3QA 2XZSA 5HE1A 1L3RE 1WVWA 3D5UA 3UZRA 4USFA 1FMOE 3N51A 2AC3A 1DS5A 3T9TA 3QRKA 4PDSA 4BDHA 4IXPA 3W2CA 2ITVA 2JBPA 2WXVA 4AGUA 4DEEA 4BBFA 2WMSA 3HMIA 4ZSEA 4Q5EA 4D4VA 5CTPA 1B38A 3HDNA 3HGKA 3QTQA 2WZJA 2HXLA 3E8EA 1FVVA 3ALNA 4FV7A 4M12A 4GIHA 3UDBA 5K5NA 1JOWB 3EL8A 4S2ZA 1LP4A 3KVXA 3CTQA 3P7CA 3OUKA 3COKA 4X0MA 3BELA 2EB2A 3FSFA 4NK9A 3KRRA 2GNLA 3EFLA 2QO2A 3GCVA 4U8ZA 3TKIA 3ODZX 4RJ8A 2QOFA 4UWCA 3MPMA 3L9MA 3VS3A 5LJJA 4BKYA 4OTQA 4QMZA 3BE9A 4RJ6A 2WQNA 2Y9QA 3IGGA 3V8TA 3H3CA 3UMWA 2FSMX 3DJ5A 4IWPA 4ALVA 3GC8A 4EOQA 5LMBA 2WMUA 4CFFA 3QQKA 5AM6A 1CDKA 2BAKA 4C35A 3VRYA 4EOMA 4BYJA 1J1BA 3HKOA 3OD6X 4U44A 4UV0A 1SZMA 2VN9A 2X7OA 2YM6A 2O3PA 4UWYA 4WIHA 5JFSA 4O83A 1OL6A 4FKWA 2QO7A 4GJ3A 2BDWA 1PHKA 3LIJA 3G15A 3AC8A 4ZTHA 2AYPA 1OL5A 5AR7A 3U55A 4YSMA 4H36A 3PE2A 4NFMA 4RJ7A 4TYGA 2V62A 4M14A 4F63A 5JFXA 2W06A 2J51A 3GU5A 5B7VA 3EN4A 4PPAA 2ZV2A 4FT9A 2XS0A 3LXLA 4D5KA 1JKSA 4Q9SA 4XV3A 5ANEA 5K5XA 1FINA 2WAJA 4R77A 2H34A 3ZZEA 4LI5A 5CSVA 3DT1A 4CKIA 1OL2A 4LOOA 3QTUA 4F9BA 4OLIA 4FIEA 2VTIA 5I9ZA 3PG1A 4K77A 5CVFA 1U5QA 4NM3A 4WKQA 3NGAA 3TACA 1ZAOA 3B8QA 4OTGA 3RWQA 3MH3A 5HG8A 1Q8WA 2XP2A 4FTKA 4EUTA 3AC5A 3B2WA 2GNHA 1LR4A 2I0EA 4W8EA 3SG8A 3GNIB 4AOTA 4O7SA 5A6NA 2J0LA 5CEKA 3N4VA 2WNTA 3OWKA 4G6LA 4C7TA 4XG3A 4AOIA 4QYFA 4MHAA 4R3PA 4BI1A 1PMVA 4UXLA 1M7NA 2R3GA 3ZBFA 4YJTA 3K5VA 4K9YA 5DHJA 2BALA 4MXYA 4QMVA 5LMAA 1AGWA 2FUMA 3QXPA 5ETCA 2UZNA 3DJ6A 4QTAA 4DFUA 3NS9A 2QI8A 2AUHA 3VUDA 4YHFA 3R8PA 4CTCA 2PZ5A 2WELA 3UOLA 1GZ8A 5JRQA 4YHTA 5AIKA 2QOOA 3R1SA 5A9UA 4Y85A 5HCXA 2PMOX 1OIUA 4IWOA 3JPVA 3MY0A 4MH7A 2W9FB 4M8TA 5IA0A 1UU3A 3C4WA 3FLZA 2R4BA 5M4IA 3LFNA 1XH9A 4MF1A 5IMXA 3TM0A 3QCSA 2QLUA 4Y5HA 4FKSA 2CKEA 3DBCA 4IHPA 3TV7A 3UGCA 4FT0A 4UYAA 4F09A 4FX3A 4G9CA 1H01A 3PXYA 3ZHPC 4EBWA 2R3RA 3DKFA 4BDBA 2OJ9A 2XF0A 5CEOA 5JMSA 3ZONA 4XG7A 3S0OA 3O17A 4OTPA 4DGOA 2VO6A 4N0SA 3UP2A 4D2WA 2Q0BA 3VN9A 4BB4A 5AEPA 3QQUA 4EC8A 5IA4A 3D14A 4FKLA 4DH8A 5EW9A 3HVCA 4FTTA 2XNEA 4F0FA 4F1TA 4JS8A 4ZIMA 2UVXA 2YHVA 4FBXA 1Q8UA 3AC4A 5EFQA 4YJNA 3R73A 3R9DA 3OCGA 3WYYA 4FV8A 5J1VA 2YM8A 5AP5A 3ACKA 4IB5A 1PYEA 3AD5A 4IACA 5AP2A 5JEBA 5AP1A 2Y4PA 2QODA 3Q6UA 3VRZA 4XP2A 4R78A 2A4LA 4IH8A 4B7TA 5FLFA 2X4ZA 3IGOA 3Q4CA 4F9AA 1B6CB 1SM2A 4PP7A 3HV4A 5C8MA 4R3RA 3V5TA 1O6LA 1WFCA 5AJQA 2OW3A 3BLHA 2J4ZA 1UKIA 3UODA 4E4MA 4QYYA 3SV0A 3KF4A 1UVRA 5E91A 5DYJA 2WIHA 3QD4A 5EI2A 3S95A 2FSOX 2GMXA 4BZOA 1H28A 3LCTA 4HZSA 4LUDA 5CY3A 1FMKA 1ZYDA 4W9WA 5FEQA 5AR2A 3R7YA 2X7FA 3THBA 4EHGA 3R04A 3VBXA 5KMJA 3TDVA 4M97A 3OUNB 3KREA 1OIQA 4FKJA 3MESA 3C0IA 4I0TA 2F2UA 4K0YA 1KE7A 4IJPA 3R7EA 4BR3A 3TN8A 3AC1A 4K6ZA 4WT6A 3VC4A 1H8FA 1U46A 3UQGA 4CLIA 3DXPA 3E92A 3COIA 2R7BA 3A2CA 3MH0A 3OVVA 4UMQA 3VW8A 5HO8A 1UNGA 4E4LA 4XOZA 3V01A 2UZVA 3REPA 1U4DA 3TKUA 1GIHA 5LOHA 2EXMA 4ASZA 4XV9A 4DBNA 2ONLA 1IR3A 5CU0A 4O84A 5AFVA 4I22A 3BU3A 4ANLA 4UMTA 4EK6A 5LMKA 2ZDTA 4NIFB 3TDWA 3QQJA 4BWPA 4C4EA 3HRCA 2O5KA 1QPEA 2BZJA 3IK3A 3PVBA 1YKRA 2BZHB 4BCNA 3VUHA 3BGZA 2YZLA 3PVUA 1LEWA 4IAIA 4U42A 3ZU7A 5IEVA 1ZMWA 3JVSA 5L8JA 2C5VA 2W1ZA 5IUHA 1OPJA 2YISA 4GW8A 4RVTA 4AT3A 4K1BA 3PY3A 1MQBA 4IAFA 4OW8A 4JQEA 5A4EA 2J5FA 1CTPE 3IOPA 3QZFA 5DGZA 4UALA 4HGEA 4RJ5A 5J9YA 5DEWA 5EH0A 2PWLA 4ACCA 4RJ4A 2EVAA 4Y5QA 3D2KA 3BV3A 5L2QA 3KGAA 5HEZA 3RJCA 3WZEA 5KBRA 3FPMA 4ZSAA 4PTCA 1H1PA 4TWCA 5BVNA 5HNIX 5IH6A 3FI2A 4CEGA 4IVBA 1VR2A 3V04A 2WB8A 4IX3A 5F4NA 3UYSA 2NPQA 4D0WA 3P08A 5HE2A 3E7VA 4NEUA 2OO8X 3Q9XA 1YDTE 1L8TA 5AV2A 5HTCA 3M1SA 4FV1A 4FUXA 4TYIA 3OCBA 3DBFA 3VO3A 4CSVA 4IBMA 1UWHA 4ID7A 2XK8A 4B4LA 5DR6A 4J7BA 1URCA 4Y72A 4O7TA 4JBVA 3DK7A 4RWLA 5B2MA 5KO1A 3OCTA 5KX8A 2PUNA 3R8VA 3W32A 1Z5MA 2VTMA 2FVDA 3LLAA 3GC9A 4CMUA 4CXAA 5CF6A 2QD9A 3JUHA 4C58A 2VTHA 4WSYA 2YDIA 2C6DA 2W96B 3O71A 3ZLYA 3ZCLA 2YJSA 5KMLA 3ULIA 4KUJA 3U9CA 3QUEA 4DFLA 3NR9A 1OGUA 2JKOA 4EC9A 4AX8A 5KMKA 3I7CA 4PMMA 3KF7A 4XG2A 4CFVA 3NMUF 4GMYA 4FV3A 5CAVA 4EH5A 2OJFE 2VTJA 3MSSA 2CNQA 3PJ1A 3PIYA 5IEXA 4OTFA 1H24A 3D0EA 3ZUTA 1YOJA 2CCIA 5HORA 3OT8A 3IS5A 3BHVA 3DS6A 3NYNA 4NUSA 3C4EA 5CZHA 3W2RA 3LQ3A 3WARA 4O91A 5DG5A 2X9EA 1PW2A 3FZOA 4FIFA 3SW7A 3FMJA 1WBNA 3L8PA 5LVOA 5CXHA 2RFDA 1ZZLA 3VBTA 3NCGA 2XM9A 3IDCA 3ORMA 4IIRA 1G8SA 4RWKA 5LWNA 4E1ZA 1KE9A 4WG3A 4M13A 1UNHA 3BCEA 1S9JA 4R6VA 3LQ5A 4FVQA 4AZSA 5I0BA 3ZDIA 5CX9A 5C1QB 1YXXA 1YQJA 2VTLA 2LGCA 4PTEA 1QMZA 1GZNA 5DR2A 5HCZA 4AAAA 3K3IA 3LJ1A 5E8XA 2WFYA 5HVKA 2X4FA 2X9FA 3SX9A 2J9MA 2C5NA 4DG0E 4FKOA 4LG4A 1QPCA 3NW7A 5IQEA 2BRNA 4YTCA 2YIQA 4RIWB 5EYKA 3HA6A 4U6RA 2C5OA 5KMNA 3R02A 3UIMA 2WPAA 3T9IA 4EK8A 2PVLA 4HCVA 4IB0A 2IJMA 3UO4A 4BN1A 2YABA 5L6PA 5M08A 4MNEB 1UNLA 3AG9A 4NIFA 3RPOA 3OOGA 5ICPA 2VWXA 3TNWA 2XK7A 1TQMA 5CNOA 2YAAA 4O21A 2PVKA 5HCYA 3DZQA 4RFYA 2R3QA 3TTJA 1NW1A 2P33A 2P55A 3NIEA 2Y6OA 3ORXA 3GFEA 3KFAA 4H1JA 1E1XA 4NT4A 2WQOA 2BRBA 4BCKA 3MIYA 4QO9A 1XH7A 4UMRA 5IQBA 4YHJA 4ZTNA 2XKEA 3UBDA 4I24A 5CVHA 4DH5A 4E4XA 3VBVA 2O8YA 4H3PA 4DEAA 1BL7A 5J7BA 3HMMA 3TNHA 2QOHA 4OTRA 3QQHA 1OI9A 3BLQA 2I0YA 3ZM9A 3ORPA 4QMMA 3ZEWA 4YO6A 3QXOA 4J8NA 3F6XA 4DE4A 1ZLTA 5E92A 5HE3A 5JRSA 3WF5A 3FYJX 5AR8A 4RIYB 2R2PA 2GNIA 4FG7A 4G3FA 4AZFA 2XJ1A 4RLLA 3V6SA 4E93A 3QAME 3JY9A 4ZY4A 5CXZA 2XH5A 4QMNA 4ALUA 3CIKA 3TJCA 4C34A 4U3YA 4RX5A 4JG6A 4D28A 2C6MA 1A48A 2ETKA 2VTSA 4DHFA 4FODA 3GC0A 1SVGA 2BFYA 2B9HA 2ITZA 2PE0A 3PXZA 5D1JA 3UVQA 5FDPA 4OTHA 3BI6A 4A4XA 1UU9A 1EH4A 4EH4A 3OBJA 4I94A 4QMYA 3FMKA 5BMSA 5B2KA 1FGKA 5M57A 3U6JA 2RL5A 3OROA 3GEQA 2RFSA 5IZFA 4FEUA 2X39A 2YITA 3HV6A 5CU6A 4X6RA 3CXWA 2GCDA 4M69B 4G3GA 3ZLSA 5EOBA 3L8XA 3I0OA 3TWJA 4R5SA 3RPRA 3CC6A 1Q24A 2BPMA 4ZJVA 3U87A 4O0SA 4BICA 2PVYA 4I5PA 2CKOA 3BHHA 4ACMA 3P7BA 4JBOA 2XK6A 3MVHA 1H27A 4FV6A 4TRLA 1GNGA 5TKDA 4DG3E 1WAKA 2YLEA 3UNJA 4NKSA 2Y8OA 3Q5ZA 3R8LA 1JSVA 2Q0NA 5HIDA 3TJDA 2NO3A 4I93A 5DLSA 4RPVA 4C59A 4O2ZA 4OBPA 3ZUUA 1I44A 4TNBA 2QU5A 4QMTA 5AX3A 2GQGA 4KBCA 4RC2A 2R5TA 4IZYA 3HZTA 5BYYA 3SA0A 4OAUC 3DKOA 4YJVA 5EDQA 4YTFA 2VTNA 3ACJA 2AC5A 3A4PA 1JSTA 5J8IA 5J95A 2WTIA 2J50A 4KB8A 3T3VA 3KXMA 2HCKA 4DCEA 2FO0A 5E9EA 1QL6A 3BHUA 3NVMB 2ITPA 2HZNA 1A9UA 2Z2WA 3TUCA 1PXNA 3RHXA 4NFNA 3F2RA 2QOQA 4D1XA 5IUGA 3WF8A 4CT2A 1NT2A 4B8LA 5AP0A 3C5IA 4QTEA 4RIWA 5CNNA 5A4LA 4BGQA 4U80A 2IVTA 4N70A 5CS6A 4F0IA 4NTSA 2P0CA 4L3PA 3SXFA 3IKAA 4RIXB 2GHMA 2J0MB 4WO5A 4FKIA 2OSCA 3COHA 4C38A 2IZTA 4RGJA 2CJMA 3AGLA 4E73A 2J0JA 3KN5A 1PY5A 4P4CA 5H8BA 5AV0A 1WZYA 2W1EA 4C36A 4GUBA 1G8AA 1Z57A 3F7WA 4JNWA 4EI4A 3QZGA 4FR4A 3L1SA 4E20A 5ETAA 3Q9WA 3ZDUA 5AUYA 4KIPA 4XV1A 4L6QA 4H3BA 1IG1A 1GAGA 1OUKA 2W5HA 4BDFA 3QRJA 4JIKA 3R8MA 1U5RA 3WF9A 1J7LA 2PTKA 2VWZA 3DTCA 3HAVA 1YDRE 1Y8GA 2XUUA 4DG2E 1XO2B 3OY3A 5FDXA 1H0WA 1M52A 3R00A 4W8DA 3WZKA 5A4CA 4RIYA 3UTOA 2VO0A 3DLSA 4ZOGA 3UQCA 3LCSA 4OTWA 4F65A 3CTJA 3QWJA 3PA4A 2C30A 4ZTQA 3F69A 3TG1A 4G9RA 3HP5A 4II5A 2RIOA 3HYHA 3F82A 4D1ZA 3QD3A 5AV3A 1P14A 3RZBA 4MX9A 4J98A 3PRIA 4N4SA 3DJ7A 4GFMA 4N6YA 4ACDA 4YJQA 3I6WA 1OL7A 1YOLA 4BIEA 3ZFYA 2VGOA 4BFMA 4CFUA 4EEVA 3EQGA 3L8SA 3PPZA 2Z7SA 4N6ZA 4HGTA 4K2RA 2C0OA 1MP8A 3LFSA 2W1DA 3EQPA 2CLQA 3O8PA 4O1PA 5CEIA 4D4SA 2E2BA 3KA0A 3Q2MA 2F2CB 1Z9XA 2QOIA 1KWPA 2VWYA 2XYNA 1O6KA 1XJDA 2UZBA 3A61A 4U41A 5L6OA 3RM7A 5CAUA 4R1VA 4M69A 4L53A 5EK7A 1OPKA 2GTNA 4FSYA 2Z8CA 4BF2A 1BLXA 2PZRA 2XNNA 4TWOA 5I9UA 1ZOGA 4H39A 4GG5A 4Y73A 3N4UA 1UWJA 2FSLX 1XH4A 2YDKA 4I0RA 3NZ0A 2REIA 3EMGA 1G3NA 3KL8A 2OBJA 3KC3A 4LQMA 5CALA 2OK1A 2XBJA 4PPCA 4ZZNA 4C37A 4AZVA 1YXTA 4IM0A 5D12A 4ZJIA 5D11A 4A9TA 2PZYA 2XMYA 4RVKA 4FGRA 3PFQA 2JIUA 2X8EA 1H07A 3F61A 3PWDA 4QTCA 4E5WA 1K2PA 2IVSA 2YACA 2C4GA 2WTKC 4XLIA 3L9LA 3KU2A 4EOIA 1RJBA 3L9PA 3WIKA 2IWIA 3S00A 4RWJA 4KRCA 1BUHA 3EQHA 4CTBA 3MH2A 1OECA 2E9VA 1W98A 3ZC5A 4BCQA 1ZXEA 4BHZA 3GOKA 2BZIB 2CGUA 4FSUA 2LAVA 4FEVA 3ZLXA 2C6IA 4J96A 4RZVA 4RJ3A 3ZC6A 5J79A 1RQQA 3GP0A 4Z9LA 1OB3A 3OBGA 1F3MC 3D2IA 4BIBA 3ENMA 4GYIA 4UZDA 4HNFA 2OI4X 4XYFA 5IQCA 1S9IA 3FZRA 5K4IA 2GHGA 5L4QA 4GCJA 4EOPA 4RT7A 4RIXA 5M4UA 3D15A 3QRUA 4U45A 5J5SA 2W1GA 4LGGA 3DAKA 1BYGA 1DI8A 4O6LA 3UOKA 5BVFA 3DQWA 3IDBA 4Y95A 5AP7A 4L3LA 4IFGA 5AUVA 1OVEA 3VUKA 4FVPA 3V3VA 3KXHA 3WZDA 4C61A 3FXZA 2YM3A 3A8WA 2JLDA 2VO7A 4M0YA 4O2PA 2WD1A 1XBBA 1NVQA 3QTWA 4AW1A 4MKCA 1YWVA 3EN5A 3MVJA 4IB3A 2RF9A 3VUIA 5HQ0A 2X0GA 2C6KA 2R3OA 5M56A 4G34A 3H0ZA 2XA4A 4JDKA 2QQ7A 4I0SA 3ANRA 2ZOQA 3EWHA 3FQEA 3GCQA 3NCZA 2W9ZB 3DZOA 1ZWSA 4O0VA 4QMWA 4U40A 4WG5A 2W1IA 5AAFA 3MVMA 4YU2A 2VTPA 5CQUA 1HCKA 4A7CA 2ITNA 4FSZA 4ALWA 4QP1A 3DPKA 4PDPA 4DT8A 4D2RA 1V1KA 3ALOA 3QU0A 4KD1A 2R3MA 1WVXA 3GVUA 4KBKA 1MRVA 4BCGA 3E8NA 2C5YA 3OOMA 4EQUA 3C0HA 3QQFA 1X8BA 2J7TA 3ZOSA 3JR1A 1PKGA 2Y0AA 3CBLA 4HYIA 3DK6A 4XX9A 3BQCA 2WTDA 2CPKE 5CVGA 5HI2A 3W16A 2OXDA 4FV5A 4GRBA 4AA0A 2BAJA 2C0TA 2O63A 3EN7A 4JXFA 1CMKE 2HZ4A 2V0DA 3I81A 1IEPA 4D4YA 4LV8A 1XH5A 3DU8A 3QCXA 5IA1A 3I5ZA 2Q83A 1XH6A 3CTHA 3PA3A 5F20A 3OC1A 4JDJA 2VWUA 4JX7A 3FQSA 5CASA 2ZM1A 3F3WA 2PMNX 5A4TA 3DBDA 5HTBA 3O8TA 5TT7A 3OTVA 1XWSA 1Y57A 5EM8A 3Q4TA 3QTRA 3IW6A 4DEHA 3HUCA 3FLNC 4G17A 4OTDA 4BCPA 3QTXA 5EKNA 3FY0A 4ANOA 2VWWA 3EHAA 3VUTA 4ANQA 1PXIA 2B9FA 3D94A 5E8WA 2W1FA 5D7AA 4JG8A 5EYMA 4E26A 3FQHA 3LHJA 4RX8A 4W4VA 3VNTA 5IEYA 3Q52A 2YA9A 2XB7A 3IW7A 4OUCA 2YJRA 2F9GA 4JR7A 3WOWA 2VX3A 3WZJA 3MB6A 2WMRA 3EOCA 3CR0A 5ANJA 3G9NA 3UE4A 2C3LA 4ZTRA 5HD7A 3SD0A 3CLYA 4C02A 5AUTA 1ATPE 3R1QA 4PL4A 4GIIA 5M55A 4AE6A 3QRIA 4F64A 5KBQA 2PZIA 3CD3A 3RPVA 5AAEA 5HIEA 2BILB 4FT3A 3PPKA 2YM5A 4IAZA 5CU4A 3RI1A 5IISA 3OG7A 3KMUA 4BC6A 4E3CA 2OIBA 3EJ1A 4DTBA 5ETIA 2X8DA 4JDIA 3FMLA 4RA4A 4ZTMA 4IX4A 2JGZA 4PF4A 5ETFA 1URWA 3I5NA 5J87A 3VS7A 4W4YA 1P4FA 5KMOA 4FNZA 4PPBA 4WBOA 1FQ1B 3SVVA 3KRLA 4CLJA 2ITYA 4WRSA 4BCMA 5JN2A 4FEXA 1OKWA 2E9OA 4IX5A 5AM7A 2UZEA 3UOHA 5FWKK 5GZ8A 4CD0A 2WQEA 4PUZA 3UYTA 4BTFA 3ATSA 4L43A 4YTHA 3UPXA 1ZYSA 4LGDA 4R7HA 5K0KA 4F4PA 2F7XE 4R7IA 4DT9A 1KV1A 3VAPA 3LCOA 4HZRA 2BCJA 4V05A 1P5EA 3M42A 5E7RA 3ROYA 3FLWA 3LCKA 5ACBC 5DVRA 4AA4A 2PVMA 2XBAA 3D5VA 3NUNA 1XBAA 5FRIA 2G1TA 5JGDA 1JWHA 4HPTE 3AC3A 4QP2A 4FKVA 3HX4A 2OZOA 4FZ7A 3A7HA 3VHKA 3VJNA 3GXLA 3BEAA 4DINA 2DWBA 3LJ0A 2XIZA 3MY1A 4FL2A 3NWWA 4M15A 2W7XA 2J6MA 2KTYA 2F57A 4FZ6A 4E5AX 4M84A 2NP8A 4YURA 3F5GA 3PWYA 3ORTA 3GBZA 4KKGA 4AW0A 2VTAA 4B0GA 4UYNA 2JFLA 2WTCA 3F3VA 4MCVA 3VUGA 3MJ2A 5E8VA 5M4CA 4I5CA 5A14A 2CLXA 3LFEA 3QLFA 3CGFA 2JKMA 3CD8A 4BZDA 2XJ2A 4D55A 2YEXA 4M7IA 3QTSA 3R2BA 2C6OA 4XUFA 4GT3A 3EYGA 3W18A 1H25A 3DAJA 3TTIA 3ZO1A 5EQYA 5IQDA 3SAYA 4OBOA 1V0BA 4D2SA 2WIPA 2X8IA 4FSNA 3ENHA 5AR5A 5AV4A 4O86A 4L9IA 3E87A 2IG7A 3KMWA 4CQEA 3OHTA 2WTKB 4I6FA 4GSBA 3BEGA 4IB1A 3NVKI 3RINA 2FH9A 3L9NA 3MV5A 2VTOA 3O96A 4QMLA 3M2WA 5E8SA 2PPQA 3LJ2A 4FYNA 2GQRA 3ELJA 5BUIA 5LCKA 4C2WA 4EWHA 4J95A 3GCSA 3MFRA 4CG9A 3DAEA 4IADA 4EYMA 1JLUE 4P7EA 4AFJA 5IA3A 3TZ7A 3KULB 3F5XA 1R39A 1XQZA 2GDOA 2C1BA 3FY2A 2OXYA 5DT0A 3MI9A 4YZBA 5BVDA 3RPSA 4HVGA 3UIBA 3KXNA 5GJGA 2WOUA 2C0IA 1PXKA 3PTGA 5FP6A 4DEGA 3AGMA 5L2IA 4DFZE 4OAVB 4AT4A 1CM8A 1VYZA 1XHAA 4RG0A 4S33A 2ZM4A 5HO6A 5AX9A 5HKMA 5I4NA 4RVLA 4O7NA 3QLGA 1PMNA 5CANA 5FEDA 3B2TA 1GZOA 4W9XA 1JKLA 3VS1A 3II5A 4UWBA 4NU1A 4XP3A 2GPHA 5DEYA 4C2VA 4O7LA 3MIAA 2EB3A 3E63A 4G16A 4JRNA 4QYEA 5HG7A 4DH3A 1SMHA 3V5LA 1KOAA 2WTWA 3S2PA 2UW5A 4EQCA 4DGNA 3BGQA 1M2PA 3EN9A 5IPJA 3S1HA 5L2TA 2B1PA 1NVSA 2UV2A 4FTCA 4RQKA 4DC2A 3MVLA 3PSBA 4S31A 4BBMA 5AUUA 2BDFA 4P2KA 3POZA 4QMSA 1W8CA 3FZSA 4C3FA 3SGCA 3UC4A 4YJSA 5E90A 5HD4A 4UMUA 3H0YA 2G01A 4H1MA 4BDDA 3NNVA 2W1HA 4PMTA 3LMGA 5L6WL 3OXIA 3ZO4A 3NUAA 2VU3A 3IW5A 2H9VA 1QCFA 3KXGA 4KABA 2VV9A 3CP9A 1CSNA 3C5UA 3AD4A 4BTJA 4HYSA 5FXRA 3LMIA 3UIUA 3QF9A 3FZPA 5TF9A 2UW4A 1Y91A 4WG4A 1ZY4A 3CPCA 4CMTA 3SG9A 3E62A 3Q9YA 4O0YA 4MYGA 4FSMA 3ZRKA 2EUFB 2YIYA 3AD6A 4WOVA 3P4KA 4ACHA 4IEBA 4FG8A 3FMEA 3QUDA 4MXZA 4XHKB 5HG9A 4EH7A 2G2FA 4RLKA 1T46A 4WA9A 4FVRA 2PYWA 3E7OA 3HV5A 4KNBA 2XEYA 4ZXTA 3D5XA 3RHKA 3RGFA 3H30A 4ZMEA 1QPJA 5JSMA 4I6QA 3HRFA 5E8UA 2ITXA 5KCVA 4MQ1A 1BL6A 3TUDA 2HOGA 2X6DA 4QMPA 5ANIA 3FJQE 4DFNA 4DFBA 1XH8A 4UX9A 4L42A 4RIOA 5HVJA 4GKHA 4ZLOA 1OKVA 4KS7A 2OFVA 3HNGA 3SW4A 3EQIA 4AG8A 1Q8ZA 5GJFA 4YSJA 3OXTA 1OKZA 4D5HA 1OPLA 4CKJA 4FTMA 2QOKA 4HOKA 5DT4A 4AOJA 1VYWA 4YMJA 1AD5A 2JFMA 3DKGA 3GT8A 5IA5A 3W8QA 2WU7A 2HYYA 3R0TA 3VUMA 2ERZE 2I0VA 5A54A 5GIPE 4ANBA 5JGAA 2Z7LA 4AN2A 4N57A 4AA5A 1YOMA 5DIAA 2B7AA 2CGXA 4ZJJA 3BIZA 5ACKA 2C69A 4QYGA 3DB6A 2PE1A 4UB7A 5IDNA 5I3OA 5KNJA 3RTPA 3TNQB 5LVMA 2GNGA 1IA8A 3ORKA 4EORA 4F6SA 4CZYB 1OMWA 2VAGA 4BCHA 2EXEA 3LXNA 2XKFA 5AP6A 3VW6A 3F3ZA 3KRWA 4QQCA 3KXZA 4ERKA 3IONA 3CGOA 5F94A 3ZO3A 2HW6A 3KULA 4IFCA 4FTRA 3UZTA 4JQ7A 4KIOA 4X3JA 2HELA 2W4OA 1WBTA 2RFEA 5CLPA 2YM7A 5J9LA 1J1CA 5DWRA 4DH7A 5KKRC 4IWDA 3ZTXA 2QOBA 3W8LA 2YDJA 5DMZA 1Y6AA 3A7GA 2I7QA 4APCA 1KE6A 5BUEA 4JG7A 3UP7A 3GFWA 4ZP5A 3CQUA 2X1NA 3P23A 1BX6A 2Y4IC 2CNVA 3PSDA 4G31A 5HLWA 3UOJA 3SRVB 3V8WA 4YTIA 2DQ7X 2HENA 5C03A 5CF4A 4KKHA 4DEIA 4RC3A 4R1YA 3E3BX 3R8ZA 4O82A 5D10A 3H10A 4E7WA 2XKDA 4G6OA 2PZPA 2VTQA 4FV9A 1UKHA 4I41A 4FTIA 4PQNA 5M53A 3R7UA 1ZRZA 4MQ2A 4JAIA 3TCPA 2I1MA 3QTZA 4BTKA 1FVTA 3LFDA 5LCJA 5AP4A 2XIKA 4C8BA 2UZTA 4V04A 3ORIA 1P2AA 4I4EA 5KZ0A 5HZNA 2GS6A 4IAKA 4KSQA 3C51A 5CI6A 3EFWA 2C6LA 3PLSA 1ZYJA 4ASEA 5LARA 4FTNA 3PXKA 3ET7A 3FZ1A 4LL5A 2ITUA 5E4HA 2A19B 1LUFA 1GIIA 2I6LA 5FBNC 3D9VA 3LFBA 3SXRA 5EW3A 3WZUA 4O0TA 3E5AA 3KB7A 3QD0A 5L2SA 4MD7E 5DH3A 4Q5HA 4PDOA 4HGLA 3ZS5A 2C3IB 3CQWA 4XMOA 4A9YA 5DRBA 3CKXA 1KE5A 2IVUA 3NYOA 1SVHA 4LMNA 5K3YA 4YNEA 3OWPA 4DH1A 5IG1A 3KY2A 5HG5A 2RFNA 2HWPA 3ZSGA 1PXOA 5BYLA 1E9HA 1GZKA 3EZRA 3OEZA 2PMLX 3CJFA 3DB8A 4O0RA 3QKKA 4FL3A 2OH0E 4G1WA 3VF9A 1OL1A 2CKPA 4IW0A 1WCCA 2BDJA 3BYOA 4IJ9A 4MXCA 2BMCA 3KRJA 3PJ3A 5K9IA 4KWPA 2W1CA 2UW3A 3R1YA 4ZY6A 3SQQA 1APME 5M09A 4MWHA 4XBUA 3EH9A 5GZ9A 5GHVA 5JGBA 4GUEA 1JKTA 4BDIA 2ITOA 3R9OA 3DV3A 2QHNA 4FSTA 4BRXA 3R28A 4BWKA 3T3UA 2VUWA 4R7BA 2WMWA 1JSUA 2QR7A 1Q99A 3EYHA 2XIYA 1YRPA 1FOTA 4WSQA 3PP1A 2IZRA 4YJOA 4AF3A 3LPBA 2ZV7A 1W84A 1W82A 2XCKA 3GQIA 5FP5A 3DNEA 2V55A 4WUNA 4QQTA 3DFAA 3PDTA 3U9NA 4JAJA 5FBOA 3FL4A 5GINE 1R1WA 1GOLA 4BHNA 1Q62A 2UW9A 4HYHA 1FGIA 1YHSA 4MD8E 3W2OA 2IPXA 3OXZA 4FV0A 3QKMA 5C01A 4XCUA 2GFCA 3QUPA 1IAJA 4AFEA 3MGYA 4AE9A 4FK3A 4FI1A 4TPTA 4S30A 3PXFA 4TYHB 3QA0A 1M17A 3O7LB 3Q96A 3PJCA 4FIHA 1GIJA 5EHLA 5EYCA 1TQIA 2PVHA 2R7IA 2VX1A 5IH4A 4U9AA 1JVPP 3QALE 3VS2A 4BDJA 4KKEA 1ZARA 1JKKA 2BHEA 4GV1A 1IASA 3RNYA 4UBAA 4CYJA 4KIKB 3TUBA 4DTAA 3PVGA 1I09A 4JL9A 3DOGA 1WBVA 3F5PA 3DQXA 5F1ZA 3R9HA 4E6QA 4RFZA 1SNUA 3DBQA 4GH2A 2B52A 2HY0A 3QHRA 3U4UA 3LZBA 2FB8A 4J53A 4F6WA 1O9UA 5AR3A 4B8MA 5CT7A 3NW6A 3O50A 4YC8A 5KMMA 2F7ZE 3ORLA 2YCRA 4Y83A 2W99B 4K18A 3OP5A 4BTMA 4RVMA 3VS5A 1V0PA 4NWMA 3N4TA 3E8CA 4I21A 3FLSA 4C57A 4L45A 3SRVA 2Z60A 4BL1A 5I5ZA 3OTUA 2R0UA 4X2FA 1DAYA 5M4FA 3PXQA 5FTQA 5IUIA 3WIGA 2GS7A 1TKIA 3VQHA 2CGWA 3HP2A 4GU6A 2ETRA 5HBHA 2UUEA 4QTDA 5LWMA 4L7SA 3HA8A 3NAYA 5JH6A 3NYXA 2JEDA 3TZ8A 4QP8A 2GNFA 3R7GA 2HZIA 4FG9A 4WNKA 2YCFA 3LE6A 4FTUA 4JBPA 4KSPA 3WF7A 4CV8A 3FLYA 2W5BA 2QHMA 3R71A 3QYZA 4O38A 4EYJA 2HW7A 4PP9A 4A06A 3OS3A 3TV6A 2IZSA 3AC2A 4BKJA 4R8QA 3LFQA 5J5TA 2QVSE 1REKA 3MTFA 4BDGA 1KSWA 4H05A 4ZSLA 4EQMA 4IVAA 2PE2A 4FV4A 4A9RA 4K8AA 4FIJA 4BGHA 3T8OA 4E5BA 3RBWA 4LFIA 4AACA 4BZNA 4CT1A 4WHZA 5EM6A 5HOAA 4FKRA 3VIDA 2O0UA 2C68A 3MA3A 4RWIA 3TT0A 3VBWA 3PJ2A 2PUUA 4B6LA 1YI4A 5I9WA 4ZSJA 2XKCA 4FEQA 4NM5A 3KK8A 3LFCA 3MS9A 3UVPA 4I92A 1ZMUA 2W4KA 3BV2A 3FXWA 4MBLA 1T45A 3PG3A 4NM0A 4S34A 5FM3A 3WYXA 4Z7GA 5C4KA 3U51A 2QO9A 5FM2A 2WMAA 3QZHA 4JBQA 3GU8A 2VX0A 5CENA 3FMNA 2V7AA 4P5ZA 3BZ3A 3BU5A 4LRMA 1XBCA 2PMIA 4P5QA 3RWPA 4FT7A 3CPBA 2FYSA 2X81A 3KK9A 4DEBA 4DLJA 1OZ1A 5IF1A 2VZ6A 2PSQA 5EQEA 3K5UA 4AP7A 3TZMA 2NRYA 1A06A 2H96A 3N9XA 3ORZA 4NZWB 4QMOA 1ERKA 2WHBA 4ZK5A 2Y6MA 2YAKA 1RDQE 5KKRB 5CSHA 5CU2A 2OIDA 3DK3A 3DBEA 3CSVA 5CAPA 4L67A 4O0WA 3R6XA 5EDPA 5F95A 3FYKX 4MXOA 3MWUA 2UZOA 4FKGA 4PL5A 2Y4IB 4FOBA 2XNPA 4YJRA 4HJOA 2O65A 3ANQA 5IDPA 4DGMA 1SVEA 4CMOA 3G0EA 1YXUA 3OY1A 5I9VA 4EHVA 3QZIA 2ZB0A 2YLFA 3AOXA 4TYHA 4KA3A 2G9XA 5G6VA 1LEZA 3DCVA 3I4BA 3I79A 3QGYA 4D2PA 4IZ5A 4U5JA 3UPZA 3NRMA 2H6DA 3R7VA 4C4FA 4U97A 2VTRA 3BU6A 3COMA 3GU6A 2XEZA 5I9YA 1HCLA 5HU3A 3F88A 3VS0A 2F49A 4KIKA 4YJUA 5DFPA 2QKWB 4FZAB 4LM5A 4XJ0A 5AIRA 5EYDA 5T3QA 3ID6C 4J99A 4ZSGA 3O23A 3OEFX 4IDVA 2JITA 3FC1X 1WMKA 3CE3A 4IM3A 4FTAA 2ITQA 1U54A 4H58A 5EHYA 3TL8A 3SLSA 2JDSA 4TWNA 5AMNA 4B99A 4OT6A 3EQFA 3EIDA 3FKNA 2E9NA 4JRVA 5KHXA 3LKMA 4EZ3A 4D9TA 4LRJA 4MVFA 5LVLA 4AQCA 4YO4A 5AADA 3IQ7A 2VWBA 4NTTA 1G5SA 3RPYA 2W4JA 2NRUA 3R22A 3RAHA 5DI1A 2PUIA 2UZLA 5JFWA 5GJDA 5FD2A 2HAKA 1RE8A 4FOCA 4YZDA 4ZLYA 1KUTA 4O0XA 5J9ZA 2ZMDA 3NUPA 4F08A 4GEOA 2B55A 3DTWA 3JS2A 3O7LD 4QQJA 3R2YA 2BROA 4FKPA 4BBEA 3AQVA 2CSNA 3E88A 3F9NA 2JKKA 4XV2A 3VS6A 1WBSA 5M44A 1VZOA 3FKLA 3Q2JA 2CN5A 4FTLA 4M68A 4XS2A 4F1OA 2NNWB 3VF8A 2IW8A 4IC8A 4F9CA 4F9YA 5IU2A 4FSWA 3V5JA 2XRUA 3BLRA 2J5EA 4NW6A 4YUQA 4UEUA 4S32A 3QHWA 2C3KA 4FNXA 3P1AA 3LFAA 1H0VA 1KE8A 4G3DA 2C6TA 5EI8A 3RMFA 3A62A 4FA2A 1Q3DA 2UW8A 2ZV9A 4O7RA 1FBNA 4M67A 2OF2A 1PKDA 2OZAA 3L8VA 2RSVA 4L00A 4TYJA 3G90X 3JXWA 5D9HA 3BHYA 3EKKA 3IG7A 4EKKA 4O81A 5M51A 3RM6A 1U59A 4FYOA 2WO6A 4MAOA 4CV9A 5IQGA 4I6BA 4WNPA 3R83A 3C4CA 4IMYA 4XG9A 5H3QA 2VO3A 4F1MA 3QC4A 3ZRMA 3OW4A 1J3HA 1UA2A 5T68A 2ZMCA 3C9WA 2ETMA 2PHKA 1KOBA 4YJPA 4YNOA 4DGGA 4O7WA 3LCDA 3PJ8A 4AZTA 3QCQA 4MK0A 4ANNA 4ZY5A 4BY9E 3NX8A 3DA6A 5C27A 4AGWA 3IECA 4L52A 1H08A 3MPAA 5BVEA 2C3JA 4ANSA 3WE4A 5EM7A 3R7OA 2W5AA 2A1AB 2VRXA 1Q8YA 4M3QA 4LRKA 4AU8A 4FZDB 2XRWA 3P7AA 3PVWA 5E8ZA 5TO8A 3EFJA 3H4JA 5TR6A 2QNJA 4MXAA 2HXQA 2B4SB 2YCSA 2BIKB 2ZAZA 1W83A 1M7QA 3RAKA 3Q60A 4EH8A 4K11A 2OFUA 4RRVA 3H9FA 4XRLA 3AMBA 5H8EA 1BMKA 4RX7A 3MFSA 4KBAA 3DNDA 3F5UA 4RFMA 3DXNA 5C8NA 1Q3WA 3BWFA 4BCFA 1XKKA 2JDOA 1NA7A 4ZLZA 4EL9A 4CRSA 1STCE 3UIXA 2UW0A 3FPQA 4L68A 5TE0A 3B8RA 4AN9A 4AW5A 4EH9A 2B9IA 4MWIA 4PMSA 4RC4A 4QPMA 4JVGA 5KMIA 3RVGA 3NLBA 3HMOA 2PVRA 3KCKA 2OXXA 2WMXA 2IZUA 1CKIA 3UO5A 1H1SA 2R3NA 4MTAA 3F2NA 4PL3A 4TZRA 4CZUA 3Q5IA 4Y46A 4CKRA 4IZ7A 5D41A 2YIXA 2J2IB 2R9SA 2OU7A 1H4LA 3GB2A 1W0XC 2YN8A 3ODYX 2HZ0A 3SXSA 3C7QA 2V5QA 3KQ7A 4EBVA 4EH6A 5I9XA 2B9JA 3OT3A 3F2AA 4AGCA 4AZEA 1R78A 3MB7A 3SHEA 5DOSA 4C0TA 2PVJA 3UNKA 5CQWA 4EHZA 4GKIA 1PXJA 3V8SA 5FTOA 3R9NA 3BHTA 3ZMMA 4IQ6A 4AN3A 4IE9A 2G2HA 1NVRA 5CWZA 5CSPA 5J1WA 5ANOA 3PY0A 3MN3A 4DF3A 1AQ1A 3G33A 5BVKA 2OWBA 3ULZA 4A9UA 4TYEA 3PIXA 4J71A 3ZUVA 4KIQA 3F7ZA 4M0ZA 3R9RA 3PYYA 2CCHA 4V0GB 2X2KA 3BRBA 4UN0C 3GOPA 4FMQA 4C4HA 2OF4A 2WMTA 4GK2A 4A4OA 2UW7A 5BNJA 2BVAA 2EU9A 1Y6BA 4O6EA 5C9CA 3ETAA 3DGKA 3F66A 1H26A 1PJKA 2EWAA 4YLLA 3ZO2A 1F0QA 3DKCA 5HX8A 2ZYBA 3HRBA 4DAWA 2HY81 4YBJA 2QCSA 1GY3A 3GU4A 5G1XA 5K0XA 3PLAE 3ORNA 2A0CX 4X21A 5CSXA 4ASDA 3BBWA 4E4NA 1M2RA 4HVDA 2CHLA 2R3LA
chains in the Genus database with same CATH superfamily
3CY3A 5IQIA 3I1AA 3EQBA 4BCJA 3BBTB 2XNBA 3HAMA 4L7FA 5BPYA 3LQ8A 5B0XA 3G5DA 4DGLC 4K33A 3SOAA 4P90A 3NUYA 1OIYA 5EDRA 2R3PA 3W2SA 4YGAA 4G5JA 3QWKA 2VWVA 4CZTA 3PA5A 5J7HA 1PMEA 5CI7A 3MBLA 4I1ZA 1YHWA 3NW5A 1M14A 3PE1A 2CKQA 2P2HA 2OG8A 3HV7A 2UW6A 3C4ZA 4HNIA 4ZTSA 3UNZA 2WQMA 5L8KA 4Y8DA 3Q6WA 4L46A 3TIYA 2YCQA 2RG6A 3OFMA 5EOLA 2XYUA 4Q9ZA 5AUZA 5EI6A 3FXXA 2XK9A 3ZFMA 3E93A 4FTJA 4A4LA 1R0PA 2BIYA 3KKVA 3EB0A 4FIIA 5E8TA 2UVYA 4FTOA 1GJOA 3ZSIA 1NY3A 4ZZMA 2YWVA 4NH1A 1YXSA 4RX9A 3OMVA 3ZYAA 2IO6A 4J97A 2KULA 4O7YA 2CMWA 3RNIA 4QMQA 4D2VA 4EOOA 2WGJA 4XH6A 5L8LA 5IQAA 3NNXA 2J90A 2XIRA 2JBOA 5DA3A 3I0QA 5FG8A 4X2NA 2JAVA 2RG5A 4KINA 4G5PA 4U7ZA 5IH5A 3ZFXA 3OWLA 4YLJA 3QX2A 3H9OA 4FUYA 4ARKA 4D9UA 3VWAA 5DT3A 2PVFA 3AXWA 2GS2A 3MPTA 3RKBA 4FIGA 3FMMA 2YZAA 4YLKA 4X2JA 3HECA 3HLLA 5AA8A 1RW8A 1ST4A 2Z02A 2WMBA 3VJOA 1K9AA 3O8UA 3S3IA 2QLQA 2C1AA 2BTRA 2JIIA 2ZB1A 5H8GA 4O1OA 1ZZ2A 2YFXA 3U54A 2A27A 4EOLA 5M07A 3Q04A 4ANMA 5CEPA 4L44A 2O64A 2RGPA 1HOWA 4DITA 4FTQA 2QG7A 1CKPA 3AKKA 3VULA 3HDMA 2G15A 5AP3A 3C1XA 4ZTLA 4LL0A 1FVRA 4YZCA 2I40A 3R21A 4CCUA 2GSFA 2IW6A 3W10A 2PVNA 5BVWA 3RK5A 4XG4A 5FTGA 3IDPA 5AR4A 4AS0A 3C4FA 3FBVA 1K3AA 4AGDA 3GGFA 1JBPE 2XCHA 3BE2A 2PK9A 3EZVA 3Q32A 5BYZA 3LVPA 2Z7QA 2E9UA 5AAGA 4X3FC 5BX0A 4IZAA 2P4IA 3BYSA 4HVHA 2QURA 5CEQA 5ANGA 4TN6A 3I7BA 4PNKA 1CKJA 2IVVA 2F7EE 3AMAA 1PMUA 3GC7A 4I5HA 2W0JA 3DDPA 4CFWA 2XJ0A 3QQGA 4O7ZA 1YI6A 2WMQA 4UXQA 1R3CA 4BCIA 4O0UA 4LV7A 1JNKA 4USDA 5LQFA 5L3AA 4BJJA 4LOQA 1REJA 1R0EA 2P2IA 4V0GA 3A8XA 1ZY5A 1XR1A 1Q61A 3NAXA 4RSSA 4RBLA 2XARA 3EQDA 3NDMA 3Q4ZA 4MBJA 2ZVAA 3A7FA 2CNUA 4FKQA 2BKKA 3NEWA 3FI4A 1JQHA 4JJRA 3QL8A 5E8YA 3IPHA 1WBWA 2BTSA 5EKOA 2XNGA 1P4OA 1PXMA 3KMMA 3ZLWA 4QMXA 4E6DA 4JLCA 4FNYA 2ZJWA 3MJ1A 2A2AA 3FKOA 4I6HA 4LV5A 1Q41A 2VNWA 1MUOA 2GU8A 2B53A 3BPRA 5E1SA 2QKRA 4KRDA 4FE2A 3Q53A 3UO6A 4ZS4A 4XP0A 5HLPA 2XVDA 1BKXA 2CGVA 4G3CA 3QCYA 3W2QA 1Q4LA 2H8HA 4C33A 1OM1A 4PY1A 5IA2A 4M66A 4F70A 1YW2A 3BYUA 3QQLA 4PV0A 1F5QA 3G6HA 1WBOA 5CU3A 2WTVA 2ERKA 3FI3A 4FF8A 3BQRA 3RALA 4DTKA 4JQ8A 4EH2A 1JPAA 3D7TB 2ACXA 4E6AA 1MRYA 5HE0A 4IVCA 3UG2A 1YHVA 1YXVA 4J52A 4FK6A 4HCUA 1J7IA 5HIBA 4DFYA 2WEIA 5ANKA 5CAOA 4O27B 3UQFA 3E8DA 3CKWA 4QP4A 3FI8A 2ZDUA 4CFXA 1LPUA 2X7GA 4GFGA 5K4JA 4O7VA 4ORKA 1O6YA 4WRGA 3JYAA 3SC1A 5A6OA 5IQHA 3ERKA 1PF8A 1UU8A 3PY1A 3RAIA 4CFMA 3GQLA 3HEGA 3CY2A 2EXCX 2PY3A 3EL7A 5FXQA 4XLVA 5JQ5A 1YDSE 1Q97A 4EOKA 5B2LA 2PULA 2ZFYA 4C4GA 5F9EA 4FEWA 1YWRA 2JDTA 2UZUE 4NKAA 5CSWA 4FL1A 2JAMA 4BI0A 3LLTA 4HW7A 5JK3A 2HWOA 2OKRA 1OUYA 1OKYA 3MTLA 1W7HA 4QP6A 1UU7A 1ZYCA 4YPSA 3SKCA 3UMXA 4CNHA 4QDVA 4HVIA 5BUJA 2QOCA 3QA8A 2WMVA 4GL9A 4ONAA 2V22A 2HK5A 5IKWA 4QTBA 3FL5A 5FEEA 4DBXA 2BHHA 5HTIA 3ATTA 2CN8A 2ITTA 5AWMA 3P79A 3HL7A 5HNBA 4BDEA 3TZ9A 3MH1A 5ANDA 3ZH8A 3FMHA 4OR5A 1WBPA 2R3HA 4J8MA 3D83A 4DDGA 2OLCA 4JOAA 3OZ6A 4D4RA 3W55A 4D58A 2X0OA 4Q2AA 4AUAA 4UY9A 2JDRA 4U81A 1SYKA 5A3XA 3NNWA 4XG8A 4AT5A 3NIZA 2GTMA 4F6UA 4GT4A 4ITJA 4QPAA 3CCNA 3TXOA 3SOCA 5JQ8A 4CCBA 4D1SA 5A4QA 3LXKA 3DLZA 1IAHA 4FICA 4BWXA 2JC6A 4ITHA 5DPVA 4AW2A 4BVUA 4AXAA 3OW3A 4MXXA 3U6IA 2BRMA 3WE8A 5KHWA 1YI3A 4IVDA 5KZIA 2R0IA 4DFXE 4FZFB 3GENA 1H1QA 4UMPA 2YIRA 4LYNA 4CGAA 4QP3A 2JKQA 4NCTA 4I23A 4R3CA 4LMUA 2E9PA 3G9LX 5HICA 4APPA 4U3ZA 4EK3A 4WD5A 2DUVA 4QNYA 2J0IA 2C5XA 1ND4A 4BGGA 4DDIA 4ENXA 1PXLA 1J7UA 4EJ7A 2JD5A 2WU6A 4Z3VA 3V5QA 4FKUA 3C50A 3QBNA 3KXXA 5EW8A 1JAMA 3Q9ZA 4QQ5A 3V51A 3LXPA 3K3JA 2P3GX 3TKHA 4HCTA 5DRDA 3FAAA 4EKLA 4C4JA 3FE3A 4TTHB 5T6KA 4EHEA 4JI9A 4EONA 3A4OX 2WOTA 3LM0A 5JFVA 3CEKA 4GK4A 2BRHA 5CT0A 2PU8A 3QYWA 3AT3A 4KAOA 3FEGA 3V6RA 3HV3A 4OT5A 3UZPA 5A46A 2OIQA 4YZMA 4ITIA 4PMPA 4TNDA 4QOXA 4YBKA 3R01A 4TL0A 5CF8A 3KN6A 4XRJA 3TEIA 5HBEA 4C62A 2XNMA 1Y8YA 3QKLA 3V5PA 3MFTA 3EKNA 3CJGA 3NUXA 3W2PA 4R5YA 5IMEA 1VJYA 2AEGA 2XIXA 4G6NA 4HYUA 5GIOE 2R3FA 2XK3A 3EQCA 5AA9A 2JDVA 3QFVA 3VHEA 1PRYA 2PUPA 4JT3A 3Q3BA 3D7TA 3POOA 4XNEA 2R64A 2OJJA 2QR8A 4KS8A 5FQDC 5FGKA 1QPDA 3DY7A 3NNUA 1B39A 4YR8A 2VD5A 3U8WA 5HVYA 3AMYA 4TT7A 5DR9A 4DN5A 2VGPA 4PRJA 1FPUA 4YC6A 5HGIA 5IQFA 3UC3A 3G0FA 3NSZA 4GFOA 4TW9A 4ZZOA 4ACGA 2FGIA 2W05A 3G6GA 4B9DA 3JVRA 2R3IA 3LFFA 3LAUA 4U79A 2WQBA 3G51A 4IAAA 3WF6A 3IO7A 4WBBB 4GG7A 4WUAA 3EFKA 4EK5A 4IM2A 2WTJA 4DYMA 4U0IA 3P5KA 3R7IA 5GZAA 3FSKA 4C3PA 4MBIA 1OBGA 5DN3A 1ZOEA 3A99A 3W0NA 1U54B 3GI3A 3PSCA 4X2GA 5H2UA 2NYAA 4RZWA 5HBJA 1ZMVA 1H1RA 2ESMA 3QGWA 4HGSA 2VNYA 4X3FB 3JY0A 4YZ9A 4Z55A 3TNIA 3I6UA 4ZEGA 2UVZA 1BI7A 4USEA 4NJDA 5D7VA 3K2LA 1TQPA 4UZHA 4I5MA 3W1FA 3IOKA 3AT2A 4Z7HA 1OIRA 3HMPA 5CF5A 1UV5A 3QTIA 4RMZA 2ZV8A 3F3UA 4EK4A 5BQ0A 4HVSA 5ITAA 3TV4A 4XEYA 1YVJA 2IN6A 4XOYA 4IWQA 5KUPA 2QC6A 3PXRA 3O51A 3LMHA 5LVPA 2BAQA 2OJIA 4LGHA 4QT1A 4X6QC 2W17A 5CAQA 4BIDA 4FGBA 4FKTA 1ZOHA 4I3ZA 5LXMA 3RAWA 3OCSA 1OITA 2WEVA 4MNFA 3ZZWA 4ZMFA 3RZFA 3ZBXA 2BFXA 4EOSA 5CEMA 2DYLA 3IW4A 3A60A 3QX4A 4GJ2A 4IC7A 4YPDA 3M11A 4BDCA 3GCUA 5JKGA 4BKZA 4C3RA 4F7SA 5KE0A 4ZAUA 5M06A 5FXSA 3KVWA 1NXKA 4ASXA 3R1NA 4NW5A 3BYVA 4GYGA 4BI2A 3WBLA 4MNEA 1VEBA 1Q5KA 4L8MA 4E8AA 5BVOA 2ONLC 3OF0A 1E1VA 1MRUA 4FNWA 4RQVA 4WNMA 3ZXTA 3P5JC 4W4XA 2UZDA 2CDZA 4BCOA 3UG1A 3FZTA 2DS1A 3AT4A 3PP0A 4J1RA 4JDHA 4QPSA 5LMKC 4D2TA 4W4WA 2OZAB 2R3JA 4G2FA 3DXQA 1H1WA 3A7JA 3S4QA 3FC2A 3RCJA 3ZEPA 2YM4A 3FUPA 4EWQA 4CVAA 4QP9A 4DA5A 4PX6A 2GHLA 3FV8A 4GVAA 3BYMA 1ZYLA 3UVRA 2SRCA 3A7IA 4EZ5A 5HLNA 3QC9A 1SNXA 3KIOC 4QNAA 4GVJA 2YWPA 5JZJA 4NYEA 4TXCA 3P86A 5EG3A 2X6EA 3FDNA 2GQSA 4LUEA 5CYIA 4EOJA 3TI1A 4I20A 1MQ4A 1J91A 2BR1A 4JR3A 3P9JA 5GNKA 3ROCA 1YWNA 3RCDA 5LVNA 4L3JA 5TOZA 5AUXA 5H9BA 2YIWA 3R30A 4AWIA 1IA9A 4I4FA 3FWQA 5C26A 2PL0A 2XK4A 3MW1A 3FMDA 2XANA 3DDQA 2OH4A 4IX6A 1OBDA 4EH3A 2VWIA 4LOPA 4NM7A 3G2FA 4F7NA 5HU9A 3CQEA 3O2MA 4YZNA 4EZ7A 2QOLA 4BYIA 3P0MA 3HUBA 3GU7A 2ZM3A 3O5AA 2Y7JA 3BKBA 4IAYA 1DAWA 3DFCB 4JX3A 1DM2A 3PUPA 4FC0A 3D4QA 4X7QA 3VS4A 4JIAA 3LW0A 4PNIA 4WNOA 3K54A 5E1EA 2I0HA 2J0KA 2UZWE 4QMUA 5JZNA 3W33A 4G3EA 3C4XA 4CFNA 2WKMA 2FSTX 1IRKA 2JIVA 3I60A 4MEDA 5FUTA 1M2QA 3E3PA 5DNRA 3Q4UA 4ZS0A 3TNPC 2XNOA 4Z16A 3D7ZA 5HO7A 4QRCA 2XM8A 3FHRA 2BRGA 3MFUA 4DLIA 3FLQA 3IW8A 4F9WA 4TKSA 2GNJA 5HX6A 4YP8A 3ZXZA 1H00A 2C47A 2Z7RA 3EQRA 3NYVA 4PTGA 3PZHA 4FSQA 4V01A 2F4JA 3D5WA 3PPJA 4GU9A 4QP7A 5AUWA 4F78A 4FSRA 4GS6A 3MDYA 3PRFA 5HESA 3CS9A 1WVYA 4BDAA 4EJNA 4A9SA 1Q8TA 4F7LA 5I3RA 3MY5A 3FHIA 4ERWA 3O0GA 1BI8A 4OTIA 2R3KA 2ITWA 3U4WA 5EHOA 2IW9A 1PYXA 5AV1A 3ZRLA 4OGRA 1TVOA 2G2IA 4X3FA 4YC3A 1V0OA 5EM5A 1DI9A 3VONA 2X2MA 4L01A 2RKUA 4F0GA 2X2LA 3C13A 3H9RA 4ENYA 1PXPA 2B54A 4O22A 3NUSA 3C0GA 2BKZA 3LM5A 3R63A 4F99A 4CQGA 4GK3A 4BDKA 4CYIA 3PZEA 4CG8A 3HMNA 2HIWA 4EUUA 4F7JA 3MYGA 2BZKB 3UJGA 4CRLA 2OICA 4NJ3A 2OGVA 4QYHA 4FV2A 3TIZA 2QG5A 4XG6A 3BX5A 3RK9A 3MA6A 1KV2A 4TWPA 3VVHA 4NL0A 4O4EA 4MF0A 5DBXA 3WI6A 4A07A 3RK7A 4HPUE 2FA2A 4C4IA 2O2UA 3GUBA 4O96A 4GT5A 4NSTA 3OWJA 2GFSA 3PIZA 5L2WA 4TY1A 4IDTA 3ZM4A 3R8UA 3KEXA 5EQPA 5BMMA 4U43A 3VBQA 3VBYA 3KRXA 3ZSHA 2YERA 5DE2A 3SDJA 4PDYA 3F3TA 5HNGA 2C6EA 3EN6A 4RA5A 4X2KA 2B0QA 3U6HA 2QONA 4FT5A 3GCPA 2QU6A 4E6CA 4AAYA 4AZWA 3BGPA 2VTTA 3LOKA 4QD6A 2BUJA 5JT2A 3RP9A 5HHWA 3WILA 3V5WA 3KCFA 5CZIA 4DEDA 4PWNA 4D0XA 5C8KA 3E64A 5C4LA 3NPCA 4IANA 3P78A 3NUUA 3QD2B 3QRTA 2V7OA 4MD9E 4NCTC 4XBRA 3VQUA 3BWJA 3ITZA 4OBQA 2OJGA 4DCAA 4H3QA 2XZSA 5HE1A 1L3RE 1WVWA 3D5UA 3UZRA 4USFA 1FMOE 3N51A 2AC3A 1DS5A 3T9TA 3QRKA 4PDSA 4BDHA 4IXPA 3W2CA 2ITVA 2JBPA 2WXVA 4AGUA 4DEEA 4BBFA 2WMSA 3HMIA 4ZSEA 3PUFC 4Q5EA 4D4VA 5CTPA 1B38A 3HDNA 3HGKA 3QTQA 2WZJA 2HXLA 3E8EA 1FVVA 3ALNA 4FV7A 4M12A 4GIHA 3UDBA 5K5NA 1JOWB 3EL8A 4S2ZA 1LP4A 3KVXA 3CTQA 3P7CA 3OUKA 3COKA 4X0MA 3BELA 2EB2A 3FSFA 4NK9A 3KRRA 2GNLA 3EFLA 2QO2A 3GCVA 4U8ZA 3TKIA 3ODZX 4RJ8A 2QOFA 4UWCA 3MPMA 3L9MA 3VS3A 5LJJA 4BKYA 4OTQA 4QMZA 3BE9A 4RJ6A 2WQNA 2Y9QA 3IGGA 3V8TA 3H3CA 3UMWA 2FSMX 3DJ5A 4IWPA 4ALVA 3GC8A 4EOQA 5LMBA 2WMUA 4CFFA 3QQKA 5AM6A 1CDKA 2BAKA 4C35A 3VRYA 4EOMA 4BYJA 1J1BA 3HKOA 3OD6X 4U44A 4UV0A 1SZMA 2VN9A 2X7OA 2YM6A 2O3PA 4UWYA 4WIHA 5JFSA 3BL9A 4O83A 1OL6A 4FKWA 2QO7A 4GJ3A 2BDWA 1PHKA 3LIJA 3G15A 3AC8A 4ZTHA 2AYPA 1OL5A 5AR7A 3U55A 4YSMA 4H36A 3PE2A 4NFMA 4RJ7A 4TYGA 2V62A 4M14A 4F63A 5JFXA 3W0OA 2W06A 2J51A 3GU5A 5B7VA 3EN4A 4PPAA 2ZV2A 4FT9A 2XS0A 3LXLA 4D5KA 1JKSA 4Q9SA 4XV3A 5ANEA 5K5XA 1FINA 2WAJA 4R77A 2H34A 3ZZEA 4LI5A 5CSVA 3DT1A 4CKIA 1OL2A 4LOOA 3QTUA 4F9BA 4OLIA 4FIEA 2VTIA 5I9ZA 3PG1A 4K77A 5CVFA 1U5QA 4NM3A 4WKQA 3NGAA 3TACA 1ZAOA 3B8QA 4OTGA 3RWQA 3MH3A 5HG8A 1Q8WA 2XP2A 4FTKA 4EUTA 3AC5A 3B2WA 2GNHA 1LR4A 2I0EA 4W8EA 3SG8A 3GNIB 4AOTA 4O7SA 5A6NA 2J0LA 5CEKA 3N4VA 2WNTA 3OWKA 4G6LA 4C7TA 4XG3A 4AOIA 4QYFA 4MHAA 4R3PA 4BI1A 1PMVA 4UXLA 1M7NA 2R3GA 3ZBFA 4MUQA 4YJTA 3K5VA 4K9YA 5DHJA 2BALA 4MXYA 4QMVA 5LMAA 1AGWA 2FUMA 3QXPA 3UDTA 5ETCA 2UZNA 3DJ6A 4QTAA 4DFUA 3NS9A 2QI8A 2AUHA 3VUDA 4YHFA 3R8PA 4CTCA 2PZ5A 2WELA 3UOLA 1GZ8A 5JRQA 4YHTA 5AIKA 2QOOA 3R1SA 2AQXA 5A9UA 4Y85A 5HCXA 2PMOX 1OIUA 4IWOA 3JPVA 3MY0A 4MH7A 2W9FB 4M8TA 5IA0A 1UU3A 3C4WA 3FLZA 2R4BA 5M4IA 3LFNA 1XH9A 4MF1A 5IMXA 3TM0A 3QCSA 2QLUA 4Y5HA 4FKSA 2CKEA 3DBCA 4IHPA 3TV7A 3UGCA 4FT0A 4UYAA 4F09A 4FX3A 4G9CA 1H01A 3PXYA 3ZHPC 4EBWA 2R3RA 3DKFA 4BDBA 2OJ9A 2XF0A 5CEOA 5JMSA 3ZONA 4XG7A 3S0OA 3O17A 4OTPA 4DGOA 2VO6A 4N0SA 3UP2A 4D2WA 2Q0BA 3VN9A 4BB4A 5AEPA 3QQUA 4EC8A 5IA4A 3D14A 4FKLA 4DH8A 5EW9A 3HVCA 4FTTA 2XNEA 4F0FA 4F1TA 4JS8A 4ZIMA 2UVXA 2YHVA 4FBXA 1Q8UA 3AC4A 5EFQA 4YJNA 3R73A 3R9DA 3OCGA 3WYYA 4FV8A 5J1VA 2YM8A 5AP5A 3ACKA 4IB5A 1PYEA 3AD5A 2XAOA 4IACA 5AP2A 5JEBA 5AP1A 2Y4PA 2QODA 3Q6UA 3VRZA 4XP2A 4R78A 2A4LA 4IH8A 4B7TA 5FLFA 2X4ZA 3IGOA 3Q4CA 4F9AA 1B6CB 1SM2A 4PP7A 3HV4A 5C8MA 4R3RA 3V5TA 1O6LA 1WFCA 5AJQA 2OW3A 3BLHA 2J4ZA 1UKIA 3UODA 4E4MA 4QYYA 3SV0A 3KF4A 1UVRA 5E91A 5DYJA 2WIHA 3QD4A 5EI2A 3S95A 2FSOX 2GMXA 4BZOA 1H28A 3LCTA 4HZSA 4LUDA 5CY3A 1FMKA 1ZYDA 4W9WA 5FEQA 5AR2A 3R7YA 2X7FA 3THBA 4EHGA 3R04A 3VBXA 5KMJA 3TDVA 4M97A 3OUNB 3KREA 1OIQA 4FKJA 3MESA 3C0IA 4I0TA 2F2UA 4K0YA 1KE7A 4IJPA 3R7EA 4BR3A 3TN8A 3AC1A 4K6ZA 4WT6A 3VC4A 4FJVA 1H8FA 1U46A 3PFYA 3UQGA 4CLIA 3DXPA 3E92A 3COIA 2R7BA 3A2CA 3MH0A 3OVVA 4UMQA 3VW8A 5HO8A 1UNGA 4E4LA 4XOZA 3V01A 2UZVA 3REPA 1U4DA 3TKUA 1GIHA 5LOHA 2EXMA 4ASZA 4XV9A 4DBNA 2ONLA 1IR3A 5CU0A 4O84A 5AFVA 4I22A 3BU3A 4ANLA 5BV3A 4UMTA 4EK6A 5LMKA 2ZDTA 4NIFB 3TDWA 3QQJA 4BWPA 4C4EA 3HRCA 2O5KA 1QPEA 2BZJA 3IK3A 3PVBA 1YKRA 2BZHB 4BCNA 3VUHA 3BGZA 2YZLA 3PVUA 1LEWA 4IAIA 4U42A 3ZU7A 5IEVA 1ZMWA 3JVSA 5L8JA 2C5VA 2W1ZA 5IUHA 1OPJA 2YISA 4GW8A 4RVTA 4AT3A 4K1BA 3NFFB 3PY3A 1MQBA 4IAFA 4OW8A 4JQEA 5A4EA 2J5FA 1CTPE 3IOPA 3QZFA 5DGZA 4UALA 4HGEA 4RJ5A 5J9YA 5DEWA 5EH0A 2PWLA 4ACCA 4RJ4A 2EVAA 4Y5QA 3D2KA 3BV3A 5L2QA 3KGAA 5HEZA 3RJCA 3WZEA 5KBRA 3FPMA 4ZSAA 4PTCA 1H1PA 4TWCA 5BVNA 5HNIX 5IH6A 3FI2A 4CEGA 1VLRA 4IVBA 1VR2A 3V04A 2WB8A 4IX3A 4O4BB 5F4NA 3UYSA 2NPQA 4D0WA 3P08A 5HE2A 3E7VA 4NEUA 2OO8X 3Q9XA 1YDTE 1L8TA 5AV2A 5HTCA 3M1SA 4FV1A 4FUXA 4TYIA 3OCBA 3DBFA 3VO3A 4CSVA 4IBMA 1UWHA 4ID7A 1W2DA 2XK8A 5DR6A 4B4LA 4J7BA 1URCA 4Y72A 4O7TA 4JBVA 3DK7A 4RWLA 5B2MA 5KO1A 3OCTA 5KX8A 2PUNA 3R8VA 3W32A 1Z5MA 2VTMA 2FVDA 3LLAA 3GC9A 4CMUA 4CXAA 5CF6A 2QD9A 3JUHA 4C58A 2VTHA 4WSYA 2YDIA 2C6DA 2W96B 3O71A 3ZLYA 3ZCLA 2YJSA 5KMLA 3ULIA 4KUJA 3U9CA 3QUEA 4DFLA 3NR9A 1OGUA 2JKOA 4EC9A 4AX8A 5KMKA 3I7CA 4PMMA 3KF7A 4XG2A 4CFVA 3NMUF 4GMYA 4FV3A 5CAVA 4EH5A 2OJFE 2VTJA 3MSSA 2CNQA 3PJ1A 3PIYA 5IEXA 4OTFA 1H24A 3D0EA 3ZUTA 1YOJA 2CCIA 5HORA 3OT8A 3IS5A 3BHVA 3DS6A 3NYNA 4NUSA 3C4EA 5CZHA 3W2RA 3LQ3A 3WARA 4O91A 5DG5A 2X9EA 1PW2A 3FZOA 4FIFA 3SW7A 3FMJA 1WBNA 3L8PA 5LVOA 5CXHA 2RFDA 1ZZLA 3VBTA 3NCGA 2XM9A 3IDCA 3ORMA 4IIRA 1G8SA 4RWKA 5LWNA 4E1ZA 1KE9A 4WG3A 4M13A 1UNHA 3BCEA 1S9JA 4R6VA 3LQ5A 4FVQA 4AZSA 5I0BA 3ZDIA 5CX9A 5C1QB 1YXXA 1YQJA 2VTLA 2LGCA 4PTEA 1QMZA 1GZNA 5DR2A 5HCZA 4AAAA 3K3IA 3LJ1A 5E8XA 2WFYA 5HVKA 2X4FA 2X9FA 3SX9A 2J9MA 2C5NA 4DG0E 4FKOA 4LG4A 1QPCA 3NW7A 5IQEA 2BRNA 4YTCA 2YIQA 4RIWB 5EYKA 3HA6A 4U6RA 2C5OA 5KMNA 3R02A 3UIMA 2WPAA 3T9IA 4EK8A 2PVLA 4HCVA 4IB0A 2IJMA 3UO4A 4BN1A 2YABA 5L6PA 5M08A 4MNEB 1UNLA 3AG9A 4NIFA 3RPOA 3OOGA 5ICPA 2VWXA 3TNWA 2XK7A 1TQMA 5CNOA 2YAAA 4O21A 2PVKA 5HCYA 3DZQA 4RFYA 2R3QA 3TTJA 1NW1A 2P33A 2P55A 3NIEA 2Y6OA 3ORXA 3GFEA 3KFAA 4H1JA 1E1XA 4NT4A 2WQOA 2BRBA 4BCKA 3MIYA 4QO9A 1ST0A 1XH7A 4UMRA 5IQBA 4YHJA 4ZTNA 2XKEA 3UBDA 4I24A 5CVHA 4DH5A 4E4XA 3VBVA 2O8YA 4H3PA 4DEAA 1BL7A 5J7BA 3HMMA 3TNHA 2QOHA 4OTRA 3QQHA 1OI9A 3BLQA 2I0YA 3ZM9A 3ORPA 4QMMA 3ZEWA 4YO6A 4DHJA 3QXOA 4J8NA 3F6XA 4DE4A 1ZLTA 5E92A 5HE3A 5JRSA 3WF5A 3FYJX 5AR8A 4RIYB 2R2PA 2GNIA 4FG7A 4G3FA 4AZFA 2XJ1A 4RLLA 3V6SA 4E93A 3QAME 3JY9A 4ZY4A 5CXZA 2XALA 2XH5A 4QMNA 4ALUA 3CIKA 3TJCA 4C34A 4U3YA 4RX5A 4JG6A 4D28A 2C6MA 1A48A 2ETKA 2VTSA 4DHFA 4FODA 3GC0A 1SVGA 2BFYA 2B9HA 2ITZA 2PE0A 3PXZA 5D1JA 3UVQA 5FDPA 4OTHA 3BI6A 4A4XA 1UU9A 1EH4A 4EH4A 3OBJA 4I94A 4QMYA 3FMKA 5BMSA 5B2KA 1FGKA 5M57A 3U6JA 2RL5A 3OROA 3GEQA 2RFSA 5IZFA 4FEUA 2X39A 2YITA 3HV6A 5CU6A 4X6RA 3CXWA 2GCDA 4M69B 4G3GA 3ZLSA 5EOBA 3L8XA 3I0OA 3TWJA 4R5SA 3RPRA 3CC6A 1Q24A 2BPMA 4ZJVA 3U87A 4O0SA 4BICA 2PVYA 4I5PA 2CKOA 3BHHA 4ACMA 3P7BA 4JBOA 2XK6A 3MVHA 1H27A 4FV6A 4TRLA 1GNGA 5TKDA 4DG3E 1WAKA 2YLEA 3UNJA 4NKSA 2Y8OA 3Q5ZA 3R8LA 1JSVA 2Q0NA 4FRFA 5HIDA 3TJDA 2NO3A 4I93A 5DLSA 4RPVA 1XMLA 4C59A 4O2ZA 4OBPA 3ZUUA 1I44A 4TNBA 2QU5A 4QMTA 5AX3A 2GQGA 4KBCA 4RC2A 2R5TA 4IZYA 3HZTA 5BYYA 3SA0A 4OAUC 3DKOA 4YJVA 5EDQA 4YTFA 2VTNA 3ACJA 2AC5A 3A4PA 1JSTA 5J8IA 5J95A 2WTIA 2J50A 4KB8A 3T3VA 3KXMA 2HCKA 4DCEA 3UDZA 2FO0A 5E9EA 1QL6A 3BHUA 3NVMB 2ITPA