3Q4CA

Crystal structure of wild type braf kinase domain in complex with organometallic inhibitor cns292
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
264
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title The crystal structure of BRAF in complex with an organoruthenium inhibitor reveals a mechanism for inhibition of an active form of BRAF kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 68
structure length 264
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3q4cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3q4cA01
3LXPA 2ZV9A 5LVNA 3TUBA 4OTGA 2GU8A 4CD0A 2I1MA 5HE2A 4O0TA 4USEA 3AOXA 3P1AA 3VBYA 4DTKA 2RKUA 3CTJA 4U42A 2J5EA 4YC6A 2E9PA 2PVNA 1I09A 3C4WA 4FEVA 4KSPA 5KO1A 5FP6A 4DG0E 2I0HA 3VBXA 5DN3A 2GNFA 2ZV8A 3G0EA 4U6RA 4IB0A 5M06A 4IW0A 4RZWA 5I3OA 4PV0A 3KXMA 2ITQA 2YM5A 4ACMA 2PE1A 4OLIA 3TV7A 2B9HA 2WQMA 3FMJA 4HGSA 2V7AA 4I0RA 4YLJA 5AP0A 2QLQA 4RLLA 4Q9ZA 2WKMA 4O84A 3UNZA 1PW2A 3M11A 5FQDC 4AE6A 2C69A 4M0ZA 5F1ZA 4WG4A 2WGJA 2A0CX 2Y4IB 3ZSHA 4FKSA 1T46A 3UTOA 5LWMA 4L7FA 3LCKA 3WYYA 4MNEA 4IB5A 4AUAA 4CGAA 5GJFA 4KD1A 4FZ7A 2C3KA 4FNWA 5KMNA 3MB7A 2PULA 4Y95A 3G6GA 1SVEA 5FD2A 4LOOA 3R71A 1ZMUA 2JFLA 4PQNA 2OJ9A 4X3FA 5BYZA 4FIJA 4MHAA 4DFLA 1UKHA 4HZSA 2CJMA 2W1FA 4GL9A 3OT8A 4BCGA 2ZB1A 2YIXA 4BDBA 1Q8TA 5DGZA 3ROCA 3GT8A 2CLQA 5C8KA 5IA4A 1FGKA 4W9XA 4JQ7A 3WE4A 3MW1A 2PWLA 4I1ZA 3JR1A 4JBVA 3CR0A 5DYJA 3G90X 4DG2E 4JDJA 5CVHA 4DEHA 1REKA 4PL3A 1OKVA 2RFSA 3OMVA 2XBAA 3ZEPA 3N51A 5J7HA 1AD5A 1JKSA 2XIRA 4D4YA 2YCQA 3CKWA 5KMJA 2WMUA 5BUIA 1Y8GA 3FPMA 2OFUA 1HCLA 1R3CA 2ZYBA 3IDCA 3DLSA 2OG8A 5EM7A 4BWKA 1U54A 4ERKA 3GFWA 5L2SA 3KK8A 4EOSA 5J9ZA 1H28A 4L45A 5FBNC 4H1MA 5IUIA 4ACGA 2HAKA 2PVRA 3AD5A 1Y91A 4QP8A 2ITWA 4ZJJA 2OJGA 4RA4A 2BFYA 3R8PA 1LP4A 3ZUUA 5CEKA 4UMTA 4XV3A 3SDJA 3HDMA 4BTMA 4M15A 2OZAB 2UVZA 2XS0A 4IC8A 1YWVA 3B2WA 3QCQA 5TKDA 4TWNA 3UZTA 5C26A 4MXCA 2DQ7X 3JXWA 4V0GB 4RJ8A 4EL9A 4F9CA 3AC3A 3O7LB 4DFUA 1PF8A 4RX9A 3R7YA 4MXAA 1TKIA 4D1SA 3FBVA 2CGWA 3BU5A 4RRVA 3DFCB 4IZYA 1I44A 3E7VA 3OWPA 3PVGA 4ZSLA 4TZRA 3OS3A 5HI2A 3H30A 1SYKA 2UZBA 2VGOA 1CDKA 3KC3A 5GJDA 4O7YA 4K9YA 4QMSA 4E3CA 3V6SA 1FPUA 2HK5A 3DZOA 3UJGA 2FVDA 3NYXA 2F7XE 4FOCA 3RJCA 2BVAA 4RT7A 3MV5A 4QMMA 3KRRA 5T3QA 1IG1A 3KXXA 4G2FA 5HO8A 1J7LA 1H0VA 3GOKA 4GVAA 4RJ4A 5CX9A 4U80A 2YAKA 5GIOE 2YIYA 3SXSA 4AZSA 1IA8A 2Z7QA 4NIFA 4HJOA 2DYLA 5L6OA 3FI4A 2R3IA 3PXQA 3QYWA 4M67A 3EFKA 5KNJA 3UQCA 2C5XA 3EWHA 4FK3A 1ZYCA 3MFTA 4FZFB 1YXTA 4E26A 4BBMA 3NNWA 3UIUA 4IAIA 4QMTA 3LFDA 2BHHA 3QQJA 5FM3A 3V5LA 4AZWA 4C59A 3W8LA 3GB2A 3LLTA 2YZLA 3H9OA 4RFYA 1V0OA 4TWPA 3V6RA 5K5NA 1ZARA 5KUPA 3EKKA 5CANA 3W10A 3VUIA 3AC2A 2UZEA 4RFMA 3UE4A 1F3MC 2I0EA 4KAOA 3Q9XA 5AP5A 5B2LA 2BPMA 4Y72A 5IMEA 3PYYA 3DBQA 5HCYA 4C3PA 3FY0A 1OKZA 3F2AA 2QQ7A 4ENYA 4XMOA 3MH3A 2Z60A 3Q96A 4YJOA 1YOJA 4F0IA 4YBKA 5LJJA 1R0PA 4FKLA 3V51A 4DH8A 5DIAA 3UYSA 3FQSA 1H1PA 5F95A 3C9WA 3KULB 4HPUE 5FG8A 2IZTA 2J2IB 4ZSEA 4EH3A 3ZZEA 3LHJA 4L3JA 5J79A 5IDPA 2R3LA 3K54A 4M7IA 3CJGA 4OUCA 4A07A 4DFZE 1F0QA 2XYUA 4FVRA 3CY2A 4YZCA 4IFGA 3Q60A 4CLIA 2BRMA 2PTKA 3FE3A 3MY1A 2XNBA 4DLJA 4LMNA 5A6NA 1ND4A 2IVUA 3UZRA 2ETKA 4ZTMA 1QMZA 4RVKA 3BV2A 4MF1A 3CCNA 4N6YA 2UW7A 4LFIA 3Q4TA 3WE8A 2B0QA 2GNLA 3SLSA 4G6OA 2X6DA 2OH4A 2ITUA 3HRBA 2PVFA 2C6LA 3PRFA 3MY0A 4F1TA 3COIA 3UMWA 4EH6A 5BUEA 3VRZA 4YSMA 4AT3A 4BCKA 2CCHA 1E9HA 2A4LA 5ANIA 2UW8A 1HOWA 3ZBFA 2J0JA 3LCSA 3PFQA 4JXFA 4L9IA 4U43A 4EKLA 3QYZA 2JIUA 1MRYA 4PNKA 4XG2A 5K0XA 3EQFA 4NWMA 4R3CA 5L2TA 3I0OA 4DEAA 3TNWA 2XNGA 5FM2A 3KB7A 4FVQA 3ZZWA 1E1XA 4FIEA 4XYFA 3T9IA 3IO7A 1TVOA 3VW8A 5JQ5A 3SQQA 3N4UA 4FTTA 3PVBA 1OIRA 4ZK5A 2OZAA 4G6NA 3CIKA 4BI1A 1R78A 1H8FA 4FV3A 5G1XA 4FTKA 3JPVA 4BI2A 5A4EA 5L4QA 3IOKA 2W1DA 3BU3A 3QUEA 5E90A 3WBLA 5HTCA 5FEQA 4RQVA 3FMLA 3DZQA 4ZTQA 3BQRA 4EHGA 3LQ3A 4CFUA 3ELJA 4CV9A 3NYNA 4E93A 2CGXA 3SC1A 1OITA 2JDSA 2X7FA 3BPRA 2PVKA 4FTCA 5D7AA 4EH2A 4KB8A 1ZYDA 2WU7A 3MA6A 3V5PA 2CGUA 2HOGA 3LIJA 3LFNA 4AF3A 4IFCA 5HE3A 3H3CA 1WMKA 2E9OA 4BZDA 5FUTA 5FXSA 1XJDA 2QHMA 4ORKA 5AV0A 4QNAA 1DI9A 2PL0A 2X2KA 3AD4A 4FIGA 5HG9A 4ANNA 4M13A 3CY3A 5A4CA 4IWPA 1OL2A 3BCEA 3BV3A 2YM8A 3E92A 3HA6A 3NRMA 3PPKA 3FLZA 2AYPA 2Z7LA 5TR6A 3DAKA 4FL2A 3NCGA 4RG0A 1PYXA 3R7EA 2JBPA 4HCVA 4ITIA 2GNJA 2V22A 3EJ1A 1VYZA 4UMUA 3VWAA 3EYHA 4N6ZA 3WF5A 3ZBXA 5J7BA 3QTXA 2P55A 3IW4A 4QOXA 2B9FA 3G5DA 3HMOA 3R00A 4KIKB 5KMOA 5DWRA 3FQEA 3ZFMA 2OO8X 4KUJA 3DT1A 5ICPA 3F2RA 2QKRA 1YHWA 3DDQA 2VWIA 3JVSA 1QL6A 4MXZA 3FMHA 4FTAA 3BGZA 5JFVA 4F9YA 1REJA 4R8QA 4ZXTA 3TG1A 4B8MA 3V8SA 4J97A 3U4UA 5CSXA 1BL6A 4EYMA 3A4PA 4IX5A 1YI4A 3AT3A 3Q5IA 4RBLA 4BCQA 4QMVA 3U9CA 5C1QB 5IH5A 4RMZA 4ACDA 2AC3A 2PVMA 5CS6A 5CVFA 1OMWA 5TT7A 1F5QA 5I9WA 1W83A 4MEDA 1UU9A 2YJRA 4CCBA 4TYJA 3KULA 2OH0E 4P4CA 4EOQA 5H3QA 3HMPA 4U3YA 3L9MA 1MQ4A 3TEIA 4KBKA 4C33A 3OFMA 4RIOA 3CTHA 3I81A 4QMPA 3UPXA 2BAJA 3LFQA 3O8TA 4ZTRA 1OGUA 5IQDA 3QCXA 5IG1A 2HW6A 5EKNA 2EB2A 4H3QA 2W9ZB 2H9VA 3IW7A 4QP9A 2UW0A 2WMRA 4IX6A 4EOPA 5DPVA 2J0LA 3MPMA 3NUYA 4NCTC 3Q2MA 2JLDA 3C13A 3HVCA 5M4IA 3LCOA 3R8UA 3ZXZA 1J1CA 3I1AA 2ITZA 4GK2A 4WNKA 2R7BA 4AOIA 2CGVA 3E62A 3O23A 1OPKA 2VTQA 4YTFA 2PSQA 2OZOA 4L52A 1XQZA 4NFMA 3SOAA 5CAUA 3Q6WA 2XVDA 3HAMA 4J8NA 4UZHA 4X2GA 5HD4A 1H4LA 4G3DA 4D2SA 2XBJA 2R7IA 3RNIA 1JKLA 5IQBA 5E4HA 4BKJA 4FG7A 4MNFA 4DF3A 5HGIA 5CNNA 4AW5A 4RC4A 3TKIA 2W7XA 2QOFA 3WZUA 2B54A 3M42A 3RAKA 1W0XC 3NNVA 4YPSA 5E8SA 4M84A 5IA1A 4BKYA 3C4CA 4YURA 4KA3A 3UMXA 3ALNA 2EXCX 1KV1A 4N0SA 3CP9A 2JC6A 4JNWA 4UZDA 5J5TA 4A06A 4XG3A 2W5AA 4TNBA 3EN5A 2GHLA 4GK4A 5CAVA 5M08A 4RGJA 3A2CA 1H1SA 4PWNA 2VTJA 4D2RA 4G31A 4GIHA 4F09A 1UA2A 1L3RE 3E8NA 3HP2A 3ODZX 2V0DA 4EBVA 4JQ8A 1NVSA 3ACJA 5CSWA 4AQCA 1P4OA 2GDOA 4NJ3A 4FKUA 2EVAA 4C4IA 2WZJA 4D1ZA 4OTRA 3G9LX 4JG8A 1H1WA 4EOIA 3VW6A 3ORPA 4BF2A 2XA4A 5FDXA 1GY3A 3NUSA 4FKTA 4CFWA 4QP4A 3A62A 4FKRA 3LOKA 1MP8A 4BN1A 1PMVA 3ORNA 4Q2AA 4LRKA 1RJBA 3MN3A 2I7QA 3BYSA 2W1EA 1OIQA 4MKCA 3FI2A 3VF9A 4HVGA 1FGIA 5DNRA 5AM7A 1OBGA 3NW5A 5ETFA 3IDPA 1Y8YA 5HTIA 4FA2A 1XO2B 2B9IA 4IAYA 3NEWA 4XOZA 2JDTA 4EK5A 2XF0A 4CVAA 4QMOA 5M4CA 4BR3A 2CN5A 4BIDA 5JGAA 4DFXE 3JY0A 3L8SA 4PMTA 1YWRA 3PRIA 2BIYA 4LV5A 3QWJA 4TWCA 5CVGA 3MJ2A 3EN6A 1J1BA 2PE0A 3CPBA 3NNXA 5CZHA 5DEYA 4AW0A 4MCVA 3DNEA 4PY1A 4WD5A 2G2HA 5IPJA 4O6LA 4Z16A 5AUTA 4NZWB 1P5EA 4QTBA 3RCJA 4UXQA 3R9RA 3RCDA 4KIKA 4OTDA 4CTBA 3TDWA 5EK7A 4DBNA 5HE0A 1PKDA 2RFDA 3NZ0A 4G3FA 5DT4A 4X6RA 3A7GA 3NUAA 4PDYA 4LL0A 1M2PA 3DGKA 1UWHA 4EOKA 3FZOA 4FG9A 1JSVA 1KE5A 4HYHA 1SNXA 2VD5A 4PPBA 5IQGA 4QMZA 1GJOA 4W4WA 5AUYA 4LGGA 4PL4A 3W2OA 2B9JA 5E8YA 4QMYA 4XP2A 2GSFA 1YQJA 2E9NA 1AQ1A 3V5QA 4BDGA 4IX4A 2VAGA 4KKGA 3BBWA 3I5ZA 3I79A 4IANA 3IW8A 1YOMA 5BMMA 3R9DA 3SRVB 4FVPA 4IEBA 4F6SA 3FZPA 1K9AA 3GXLA 5L2QA 2ITNA 4YR8A 5A9UA 2OSCA 5CALA 4FSMA 4J98A 5LMKC 3LMIA 4KS8A 1H24A 3QTIA 5AR5A 3UZPA 1KE8A 1M52A 2DUVA 4KIQA 1IAHA 2V7OA 3OBJA 4O0YA 4APCA 2XNOA 2ZDTA 4PMPA 3F5XA 4JAJA 1VZOA 2YWPA 4ASXA 4D55A 3QA0A 4QPAA 2IG7A 2CKOA 2J51A 5HLNA 2YIRA 3AC5A 2IO6A 3L8XA 4GV1A 5EOBA 3IQ7A 4MQ1A 3R7IA 2ONLC 3MIYA 4RSSA 5EM8A 3HV3A 1XBCA 3UG1A 4D2TA 3FL5A 5DR6A 3VN9A 2B55A 3QD4A 5J95A 4CCUA 4EQCA 2P2HA 5EQYA 4ENXA 4YNOA 4AT4A 5C01A 4B4LA 1OL6A 4IAKA 3TNHA 3DBCA 1LEWA 4N4SA 3RAHA 3OWKA 4FIHA 4JG7A 4IM2A 3ANRA 1RE8A 3VC4A 3BIZA 5IEYA 1PMNA 4WKQA 3RZFA 5HESA 4BC6A 4M3QA 5IU2A 4BB4A 3WZKA 2ZAZA 5EI6A 4G34A 5HX6A 4DFBA 2QVSE 2VX0A 3MVHA 1KOBA 5L8LA 4AOJA 5KZ0A 4BDAA 2PZ5A 4FEUA 4PF4A 4S33A 3NX8A 3FLNC 4JBQA 5F94A 2JAVA 5A14A 2YIWA 4V04A 4GT4A 5J9LA 3D0EA 3D7TB 2XCKA 3TIZA 2XKEA 4EOOA 2FSMX 4BFMA 5BVOA 1SNUA 4FT7A 2WMSA 1NXKA 3PY3A 5EOLA 4EH8A 4FSYA 3D5XA 5F20A 3UG2A 2W1CA 2WTKC 2ZM4A 1PXPA 1YXSA 4NM7A 3ZMMA 2X0GA 4I92A 4C36A 4R7IA 3UVPA 2QO9A 3DV3A 2QKWB 4HCUA 3P7AA 4AXAA 4C2WA 2IVTA 5J1WA 4YC8A 2PU8A 3UQGA 3WIGA 4QYHA 2R3MA 4AZTA 4KIOA 5IQIA 4BGHA 1KE6A 4E6DA 4O2PA 2UZUE 4AN9A 4ANBA 5E9EA 1WBNA 2OF2A 1ZOEA 3OROA 4DFNA 5FWKK 4E5WA 2JEDA 5EYCA 4J53A 4OBOA 3FMEA 4A9SA 4O2ZA 4YZDA 4BCOA 4J71A 1XH7A 4AX8A 4BDJA 4WO5A 2R4BA 4FEWA 2W9FB 4I6QA 1PHKA 4O7SA 4H1JA 4EK8A 3NIEA 4AGUA 3OY1A 5AV1A 2F7ZE 2BRNA 5C8NA 4CEGA 4FZ6A 4L00A 1LUFA 4ZP5A 4AP7A 4P5ZA 1JKKA 3IDBA 2BIKB 3V8TA 4IDVA 3ZONA 3VRYA 5KBQA 3RI1A 4F7JA 5B7VA 5IH4A 4RIYB 4OTPA 4H39A 4ZEGA 4CNHA 3OY3A 3RBWA 3GFEA 1CSNA 2C6KA 4I0TA 4MBIA 4XHKB 2W4KA 4C7TA 4F99A 2GHGA 2WTKB 5I9ZA 3GC8A 2KTYA 4O82A 3BHUA 4RWKA 5I9XA 3Q9WA 4D2WA 4QMXA 3FY2A 1OL1A 3B2TA 3F3TA 4FTJA 2G9XA 5IA5A 1ZOHA 3F3WA 1W84A 5K0KA 1HCKA 3R83A 4X2NA 4U9AA 3ZFXA 3ZRKA 4HVHA 3SRVA 3VHEA 1SZMA 2F7EE 4ZY4A 4C37A 1WAKA 3R30A 3OWLA 3Q5ZA 3D83A 4YNEA 4UWYA 1VYWA 1VJYA 3AT2A 3PUPA 3D5VA 4FSRA 1VEBA 4XV9A 4H3BA 3C0IA 3OWJA 5DVRA 4XV2A 1UNHA 2HY0A 3MESA 4BCNA 4HOKA 2DS1A 4FSTA 2Z7SA 1XH6A 3GCSA 3KF7A 2C4GA 4UB7A 4A7CA 3O71A 3QQGA 3W55A 5JRQA 4LRMA 5AAGA 4DEEA 3R0TA 4LI5A 4RJ5A 4X3JA 4U5JA 4XEYA 5DT3A 3GC0A 3AGMA 2HCKA 4PMSA 4KKHA 1ERKA 5KMKA 4YJUA 3PA5A 4W4YA 3IKAA 4Y8DA 4FSZA 1GIJA 1ZZ2A 2IVSA 3QQFA 2VWBA 2XP2A 3ZLSA 1Z5MA 4DGOA 5H8GA 3DA6A 2XCHA 5M4FA 4E6QA 4YJTA 4ASDA 4YO6A 5IQFA 5DRBA 4XG7A 5AUUA 5JQ8A 5CAQA 4FI1A 4C34A 4OTHA 1U46A 3LXNA 3R1NA 3BWFA 1FVVA 2W99B 3FZ1A 5EKOA 4QMLA 4AA0A 1FQ1B 4D4VA 1YHSA 3QZFA 2BROA 4UWBA 4KBAA 4QMUA 4C61A 5AA9A 5BQ0A 3Q2JA 4FE2A 1GNGA 2WMBA 3QRJA 5ANDA 3R8LA 5GIPE 4FG8A 2OJJA 2HYYA 2P33A 3KVXA 1FVTA 4RVLA 2C68A 3ZEWA 2ERZE 4DE4A 3F88A 4ZLOA 3A60A 4EOJA 4XG6A 5LMKA 3GU7A 1T45A 5BYYA 4QQ5A 3OD6X 4LG4A 3ORIA 2VN9A 3I5NA 2PZRA 4Y83A 1ZMWA 1GZKA 4CT2A 4Y85A 3D7TA 3EH9A 3LW0A 3UVQA 3DLZA 3ZS5A 4FMQA 2WEVA 2W17A 5I5ZA 3OCGA 4NM3A 4AA5A 2X7GA 3QX4A 4PDOA 4UMQA 5CT0A 3FJQE 4RC3A 5CLPA 5DG5A 3FSFA 3OW3A 4G5PA 4USDA 3W16A 3QC4A 2ONLA 2OIBA 1ATPE 2W4JA 4ITHA 4AE9A 3COKA 5LCJA 3FMMA 3QCSA 4MQ2A 4A4OA 4D4RA 2P2IA 3SA0A 3UIXA 5E8XA 2XIZA 3EQDA 4GFGA 3E8CA 1PXJA 2O64A 2JDRA 4HVSA 5JEBA 3BKBA 4YZBA 4Y5QA 4FV2A 5CF8A 2HY81 5C8MA 3QLFA 4MWIA 3FLWA 4AACA 1KOAA 2G2IA 3QD3A 2QONA 3MTFA 2J0KA 3DK6A 3EZVA 2YZAA 2F2CB 3GVUA 5CQUA 2EB3A 1XHAA 4D2VA 3D4QA 3REPA 4D9UA 2C5NA 3RPOA 5ANJA 5JH6A 3E88A 4C58A 1OVEA 2YWVA 4EH7A 4WBBB 2UV2A 5GNKA 4F1MA 2GS2A 2JKOA 2W4OA 4TYHA 4JDHA 3ZCLA 4IVCA 3QKKA 1JQHA 1LPUA 3SD0A 4X2JA 1CTPE 3ZO4A 4AOTA 2CHLA 2QU6A 3BWJA 3WYXA 4WUNA 4QP6A 4EWHA 4GEOA 5M55A 4RIYA 3QUPA 3D2KA 2SRCA 3ERKA 4F7NA 3QRUA 3UDBA 4EEVA 2JKQA 2VWWA 5TO8A 3S1HA 2H8HA 4ASZA 5AUWA 3D14A 3PG1A 4ACCA 3C4ZA 3HL7A 3F69A 5I0BA 3HMIA 4FTRA 4U8ZA 1TQPA 4D1XA 2V5QA 3OCTA 2O8YA 1W7HA 3PSCA 2JAMA 3QQLA 2VTAA 2P3GX 3KRLA 3PJ1A 4XP3A 2XNMA 4TN6A 3LVPA 4QP3A 3D5WA 3QQKA 5CAOA 4BICA 3ORLA 4AW1A 3S2PA 3E3BX 2XKDA 4WRSA 2YCSA 3RM6A 4TKSA 1J91A 3NUNA 2V62A 5JGDA 3UNKA 3FMKA 1XR1A 1A9UA 2VWXA 5EH0A 4WA9A 3VUGA 2XM9A 4E6CA 4JR3A 3HV4A 3Q3BA 3LM0A 3E87A 5BVFA 4IAAA 3CQUA 3L8VA 3PIYA 4FTIA 4ZLZA 4DGNA 2F9GA 3VVHA 2BMCA 4PL5A 4HYSA 3M1SA 4IADA 1GZ8A 3VUDA 2YLFA 2KULA 3FHIA 2W06A 5H9BA 2BRHA 3HYHA 3R1QA 4U79A 3FEGA 4FOBA 2RFNA 2IW6A 1PXKA 3PZHA 1K3AA 4RA5A 5ITAA 2QHNA 4G3EA 4YC3A 4FV4A 3I7BA 3PJCA 5FXQA 4QTDA 3NVMB 4BTFA 4PDSA 4WBOA 5AR2A 1UNGA 2CMWA 4I5CA 4UY9A 3COMA 4GYIA 1KUTA 5JFXA 4IC7A 5K4IA 2HWOA 3DK3A 4TW9A 4HYUA 3VBQA 4AT5A 3BI6A 5GZAA 4L3PA 3R1YA 3ZC5A 4J95A 3BLHA 5HNBA 4CFFA 1BLXA 3F5UA 4E20A 4B99A 3F9NA 3ZRMA 3FLYA 4B6LA 4QYGA 5KMLA 5GINE 2YCFA 2YEXA 2NNWB 1QPCA 3FZTA 4R3RA 1Y6BA 3EYGA 1ZLTA 3P08A 3MPTA 2R2PA 5HLWA 3DTCA 4QYEA 1XBAA 5CEPA 5M09A 2OJFE 1PXMA 1NT2A 5IA3A 2R5TA 3RM7A 3RMFA 3LXLA 3UO6A 3ULZA 2Z8CA 1WVWA 4MBJA 4YJPA 3DXQA 4GRBA 2Z2WA 3JY9A 3SG9A 5BUJA 2QNJA 2ITPA 5CSVA 1ZWSA 3RALA 4PX6A 4EH4A 3E7OA 2WO6A 4KRCA 3A61A 2ZVAA 2ESMA 4JS8A 5FGKA 5HVJA 4BKZA 4ZMFA 4CQEA 4FNYA 3ZXTA 4C35A 4DC2A 4O7TA 3R7UA 5AFVA 5HE1A 4EBWA 2XK4A 4J96A 2IWIA 3NPCA 2BAQA 4HGTA 4L8MA 1J3HA 2ITXA 4AW2A 1QCFA 4C02A 1DI8A 4NYEA 4FEQA 4IZ7A 3F61A 3LCDA 4IXPA 2WTVA 1DM2A 3ZM4A 3UNJA 4IJ9A 4CMTA 5A4TA 3G0FA 3V5JA 2OXDA 4G9RA 4D0XA 3PXFA 4QMQA 2EU9A 3UC3A 2WQBA 3DJ5A 4CYJA 2Y7JA 3DBFA 3DNDA 4RLKA 2B52A 2WFYA 5HVYA 3E8EA 3FI8A 3RHKA 2GQSA 3JYAA 3RGFA 4FYOA 5C4KA 2R64A 2QR7A 4KIPA 4FSUA 4IJPA 5CQWA 5D1JA 3HECA 5ETAA 3OXIA 5JK3A 3UQFA 2VTRA 3QL8A 4C4EA 3CQEA 4LGDA 4OT5A 4XNEA 5A6OA 3HZTA 3WOWA 4UYNA 4DEIA 4RPVA 3NGAA 3K3JA 3P78A 3ZLXA 4D0WA 3RHXA 1U5RA 1CM8A 4PTCA 4M8TA 3BGPA 4FGBA 3TNPC 1G5SA 3NMUF 4M97A 3I0QA 2WNTA 5B2KA 1Q8ZA 4TTHB 4L46A 3JUHA 3MFRA 4NK9A 4ANSA 4E1ZA 5C4LA 3LXKA 5GJGA 5AADA 2P0CA 4WOVA 4RX7A 3TXOA 4RZVA 4Z7HA 2Q0BA 2HENA 4IH8A 4ZJVA 2XRWA 3LFFA 3UOJA 4DGMA 2ZJWA 1O6KA 4DG3E 3MBLA 2FA2A 4BCFA 2XK9A 4IHPA 4DGGA 4EI4A 1LEZA 5HU9A 4G3CA 4JBPA 4EH5A 3PIXA 1PRYA 4C4GA 4OTQA 4ZAUA 4AFJA 4ALUA 3GCPA 3KFAA 5D10A 4CMUA 5CEIA 3SV0A 1BI8A 4U40A 1WBWA 4GUEA 4DTAA 4AGDA 5BVWA 5AV3A 3U51A 4IWDA 3OOMA 4F1OA 1YXUA 3UODA 2W5BA 2OJIA 3B8QA 3LMGA 1A06A 4FKPA 4FODA 5HEZA 4Z55A 5CU4A 3NLBA 5CZIA 5HG5A 3KRJA 4MXXA 3UP2A 3FUPA 3TT0A 1FMOE 4C2VA 2C0OA 4CQGA 4GKIA 2J90A 4ZOGA 4L53A 3G51A 5EHLA 2VRXA 4FL1A 5CT7A 5GHVA 3ULIA 3K3IA 4M68A 3VJOA 3NAXA 1ZY5A 2PUUA 4HPTE 5AP3A 2BFXA 4GU6A 4BCHA 5AA8A 2W05A 3S0OA 3VJNA 5FXRA 3QTUA 4Q5EA 4WNOA 4XRLA 1BX6A 3QC9A 5D7VA 4C4JA 3UO5A 4FV8A 3VBVA 3SGCA 5CENA 1X8BA 2E9UA 3AD6A 4FBXA 4MTAA 2JIIA 4WIHA 3VAPA 4CTCA 3BYUA 1H0WA 3GCVA 4YLKA 4ACHA 3MYGA 5BNJA 2ETMA 4AGWA 3R7VA 4NUSA 4B9DA 3EB0A 2VU3A 2QOOA 4R6VA 4U3ZA 3FZRA 3TWJA 4JDKA 2BTSA 4GW8A 2QOQA 5AP2A 4YTIA 4S34A 2JDVA 3ZLYA 4DH7A 1JNKA 2C1BA 2YM3A 2IN6A 2XJ2A 2XJ0A 3PZEA 4HNIA 4ANLA 4G9CA 3AMYA 4DINA 3ORZA 2FH9A 3OT3A 4YUQA 4FZAB 3W2CA 2CCIA 3GP0A 4I5MA 4S2ZA 3WZEA 2WOTA 1BKXA 3DY7A 1DAYA 4CFVA 1JOWB 2XEYA 1OI9A 1XH4A 4YJRA 3HRCA 4XBUA 5EHOA 4LMUA 4BVUA 4CSVA 4PRJA 4CKIA 2FB8A 2V55A 4IM3A 4GCJA 2RFEA 4GJ3A 1OBDA 2ITOA 4QQCA 3M2WA 4NTSA 2R0UA 3P7CA 4O38A 4MVFA 3R7GA 4FV6A 4WT6A 5HBJA 2LAVA 3VIDA 2Z02A 2BAKA 3KN5A 4FKOA 4AZEA 5D9HA 4NW5A 4DYMA 3MB6A 2J50A 4NM0A 4C38A 4TNDA 5L3AA 2R3HA 4F70A 4JJRA 4FC0A 3C1XA 1G3NA 2C6IA 3CKXA 5E7RA 1P2AA 3OTVA 3PP1A 2UZVA 2BDWA 2PZYA 5A54A 2BCJA 3VNTA 3BBTB 5L2IA 4CRLA 4BY9E 2GPHA 3QTSA 5AWMA 3HX4A 1Y57A 3CGFA 3KKVA 2OWBA 3ORTA 4K33A 4X6QC 3ZFYA 3IGOA 1A48A 2RL5A 3BX5A 3IGGA 3EMGA 4V01A 2PZPA 3C50A 2AUHA 3R28A 2UZTA 4PP7A 3MVLA 3P4KA 1JWHA 3VS5A 2I0VA 5IH6A 4AGCA 2A1AB 3P23A 3F5PA 5LVLA 3TKUA 4D28A 3LFEA 3BLRA 4YPDA 3H10A 2CKEA 5FTQA 1Q61A 4JL9A 4JQEA 3PSBA 4GK3A 4Z3VA 2UZDA 1XH9A 5L2WA 2WQOA 2JD5A 1IRKA 2B7AA 4EONA 1YVJA 3O0GA 1Q8YA 4IM0A 2JFMA 4FTOA 3NUXA 5HBHA 3VS4A 2YDJA 4YO4A 2O5KA 1WBOA 4DAWA 1SVHA 4XLIA 5E91A 3TM0A 2PMOX 1IA9A 5BVEA 3QQUA 3QTZA 3TZ9A 4YJSA 4E4NA 4JG6A 1IASA 4W9WA 5HHWA 2ETRA 4O7VA 4KS7A 2CNVA 2R3KA 4CYIA 5CEQA 3FL4A 5FLFA 3KCKA 1S9IA 3VQUA 4QP2A 5LMBA 5DRDA 2UZOA 2A27A 4QYYA 3KXZA 4HGEA 4BWXA 4PUZA 2VO3A 4CFNA 1Z57A 2GNIA 4TYIA 4W4VA 4QTCA 3DJ7A 3G6HA 4FL3A 5AX9A 4JDIA 3WF9A 3PJ3A 5HCXA 4EJNA 4IVAA 5DR2A 3QD0A 4DHFA 4YMJA 5BVNA 3R9OA 3DAEA 4L7SA 5JZNA 3VULA 4FKVA 3ZH8A 5BYLA 4ASEA 3ZYAA 4YLLA 3H0YA 3HV5A 2WMAA 2VTTA 3OXZA 4KINA 4NJDA 2E9VA 4FUXA 3R01A 1FBNA 2YIQA 4MWHA 3PDTA 3L8PA 1YW2A 4CZYB 3RKBA 3IW5A 4C62A 1S9JA 3ZHPC 4O7ZA 3GENA 4E73A 2H96A 1JAMA 3KN6A 4RIWB 4BL1A 3UIBA 4C3FA 3BLQA 5JMSA 3SAYA 3HDNA 2C5VA 2X1NA 3R6XA 5CSHA 4CT1A 4TL0A 3FMNA 4WNMA 2C6DA 1V0BA 3FKLA 2ZMDA 4KNBA 3ORMA 5EQEA 4K18A 4IIRA 1YOLA 2ITTA 2JITA 4UEUA 4K11A 4EOLA 2RF9A 3OG7A 3RPYA 3F3VA 1B6CB 3QUDA 3E64A 3K2LA 4ID7A 3WI6A 4AN3A 5F4NA 2CKPA 2XUUA 3D7ZA 4GH2A 3OP5A 3EN9A 5IA2A 3R73A 1IEPA 3MDYA 3PY0A 2WPAA 3AC8A 5EDQA 3C51A 3AXWA 3F3UA 3EFWA 4FV9A 2WAJA 3MH0A 1YDTE 4YJQA 1U4DA 4JBOA 1WBTA 2JGZA 4JIAA 5DA3A 1FINA 2VV9A 4IVBA 4RJ3A 4K2RA 4G3GA 3P0MA 3GU6A 4JX7A 4P90A 4RVTA 4BDCA 2X81A 5E1SA 3FLQA 5TE0A 4D4SA 4RIXB 4MD8E 3CEKA 3TUCA 4R7BA 4I6BA 5K5XA 2UW9A 5IUHA 3TUDA 3AQVA 1H27A 4DT8A 1WBSA 3QCYA 2ZMCA 3FDNA 4TXCA 1R0EA 3QZGA 4L3LA 3U8WA 2OIDA 4WHZA 2YABA 1Q8UA 4RFZA 3SXFA 3T8OA 5IEXA 1V1KA 3QZHA 1G8SA 3T3VA 1JLUE 4NU1A 1Q24A 2QCSA 3PVWA 5DEWA 4OBQA 3VS0A 5AV2A 5CF6A 3W33A 2PMIA 4TRLA 4V05A 2PMLX 3LJ2A 4O0UA 4R7HA 4XS2A 3VUHA 1PYEA 3W8QA 3DKGA 4NEUA 4QT1A 3QALE 4CZUA 3PY1A 5J87A 3LFSA 4CV8A 4DH1A 4D5HA 4F9AA 2OU7A 2O63A 3QRKA 2GFCA 2X4ZA 4APPA 3QF9A 2YFXA 4E6AA 3UO4A 5LWNA 4ANMA 2H34A 3GUBA 4ZSJA 3MTLA 2QOBA 3U6HA 3EL7A 3ZSGA 5J1VA 4X3FC 4BHNA 4ZTNA 1K2PA 2NP8A 4F65A 1L8TA 4O81A 3VS3A 2GQRA 2XKFA 3ZLWA 3L9PA 4RWIA 2IPXA 5LVPA 3PE2A 4UN0C 4BCJA 5JGBA 3VUKA 2EXEA 1O9UA 5AP4A 2YITA 2WMTA 4J8MA 4K0YA 2CN8A 2Q0NA 1JBPE 4NCTA 2W5HA 2X4FA 4G17A 2VO0A 3DKFA 3D2IA 5AP1A 4L42A 2BDFA 2FYSA 3EIDA 3HNGA 3R63A 3LAUA 4ARKA 4C57A 5EYKA 5AJQA 1UU3A 2FSTX 4U41A 4F4PA 4U44A 3CSVA 2UVXA 2VTHA 4FTLA 1YHVA 5FEDA 4RC2A 4G16A 1FMKA 2W1ZA 3C0GA 3DCVA 5EM5A 5JRSA 4E7WA 4LQMA 5DBXA 5KHWA 2W1HA 4GT3A 3NYVA 4KBCA 4OGRA 5AM6A 3OZ6A 4IZAA 5FDPA 3KCFA 4WG3A 4IB3A 3PXRA 1Q97A 3H9RA 3BYVA 2IZRA 4FV0A 5JN2A 1Q3WA 2FO0A 4CMOA 3C4EA 3C4XA 3DFAA 3NCZA 4GIIA 3HGKA 4O7LA 3PPJA 4F7LA 2QD9A 2X9EA 2PVYA 4OBPA 5A4QA 3L9NA 5H8EA 2VX1A 3Q9ZA 4EK4A 3Q04A 3AC1A 2RSVA 4RIWA 3R2YA 4TYHB 5D11A 3NYOA 2X8DA 3FLSA 4I6FA 4LV8A 3RZBA 4BDHA 3UC4A 3H4JA 4EC9A 5D41A 3PVUA 3RK5A 4I6HA 1WBVA 3LE6A 4AWIA 2PHKA 2HZNA 5IDNA 4FGRA 1NW1A 4IB1A 3LCTA 1P4FA 3FYKX 4TWOA 4HZRA 2GNGA 4B7TA 4DCEA 4R1VA 1YI6A 3O96A 3DXPA 4XLVA 1O6YA 4AAAA 4BGQA 3EFJA 4AG8A 2J0MB 5ACKA 2HZ0A 2YJSA 4GYGA 4S31A 3KA0A 3QLGA 4MAOA 4E5AX 2Q83A 4DA5A 4FSWA 4R77A 5LVOA 4BIEA 4EUTA 4YJVA 3KXHA 4FNXA 2C3IB 4DT9A 4N57A 2WTIA 4GUBA 3LFAA 3TNIA 4BI0A 4FX3A 2CSNA 3CD8A 3AMAA 4GKHA 1OIYA 4I23A 4RIXA 4FT5A 2Y6MA 5TF9A 3F6XA 3VF8A 4C4FA 5DMZA 5IQEA 2WTWA 2J4ZA 4U45A 4EORA 5E8VA 2GFSA 1UWJA 3KMUA 5M44A 5EDRA 3V3VA 4BBFA 5E92A 3PXYA 3OVVA 3OEZA 2X2LA 1H1RA 1QPJA 2CPKE 2HIWA 3DU8A 3NWWA 4O21A 4O1OA 2ZV7A 4XJ0A 3SKCA 4K77A 4JLCA 2J6MA 2OFVA 4QYFA 2XJ1A 4ALVA 5EDPA 4JRNA 1ZMVA 3EOCA 2Y6OA 4R3PA 4M14A 5M53A 4EJ7A 4NH1A 3BHVA 3RWPA 3EQIA 1CKPA 2Y4IC 4P5QA 2BZKB 4XX9A 5HIBA 1XKKA 2J5FA 4A4LA 3R02A 4ANOA 4YTHA 4FIIA 5CNOA 5KCVA 2PYWA 1XWSA 2QOLA 2W96B 3E93A 1NA7A 4D2PA 2REIA 3PPZA 4H3PA 3NUUA 5HORA 2HW7A 3PSDA 3BHYA 1IAJA 4QP1A 3ATSA 2WQNA 2VWYA 3BE9A 3CJFA 2VX3A 3BHTA 3I7CA 4PTGA 3E5AA 1FVRA 4FNZA 5BPYA 4F64A 3V5WA 2XMYA 3RPVA 3U54A 2WD1A 4CG8A 2RG5A 3W2PA 2F57A 4FTMA 4KKEA 5L8JA 2IVVA 3IECA 2VUWA 1JSTA 5DI1A 1GOLA 3PJ2A 3QGYA 3QKMA 1OPLA 4H58A 2C30A 1TQIA 2CDZA 2PMNX 4FT9A 3TV6A 3MIAA 4LOPA 2O0UA 2QR8A 5DH3A 4DEGA 2QLUA 5HTBA 2ZM3A 3HP5A 2ITYA 2XM8A 3QBNA 4E5BA 4C0TA 3CE3A 3L1SA 2XH5A 3HRFA 4HCTA 1IR3A 3IS5A 5EW3A 2VTOA 3KMWA 4CRSA 5EQPA 4LOQA 5HKMA 4USFA 3SVVA 2QI8A 4OTIA 4K1BA 4W8EA 4XBRA 1OZ1A 1VR2A 4B0GA 4EH9A 1PMUA 2RG6A 5I9UA 4J1RA 5HCZA 2X9FA 1KSWA 3GI3A 4C3RA 3BYMA 3PLAE 1ZAOA 3QKLA 2C1AA 1GAGA 3A7JA 3DB8A 3MVMA 4BCMA 5IA0A 2UW6A 1APME 3D9VA 4O91A 3PE1A 5AUVA 3C7QA 3V04A 4HVDA 4ZIMA 1OB3A 4LRJA 2GQGA 3F7WA 3GQIA 3HV7A 3OUKA 3TNQB 4BCIA 4UMRA 4EC8A 1SVGA 2BRBA 2WTJA 3MFUA 3I4BA 4C4HA 3A99A 2EUFB 2YERA 1Q62A 1OUYA 3ENMA 3IK3A 4JT3A 4E4XA 1OIUA 4DEBA 2EXMA 4E4MA 5EFQA 2W1IA 2OKRA 3EKNA 4X2FA 3POOA 3RINA 1Q3DA 3SHEA 4BYJA 4EHVA 4II5A 3R9NA 2PVLA 1CKJA 4O1PA 4ZTSA 5KMMA 5E8WA 5H2UA 3BRBA 5DE2A 3JS2A 4ZSAA 4B8LA 3BGQA 4I5HA 5IEVA 2R3JA 2BALA 4UX9A 4PTEA 4UXLA 4F9BA 5HICA 2YISA 2UW5A 3ZDIA 4DBXA 2PY3A 3NSZA 4HVIA 4QQTA 3OC1A 1URWA 2FUMA 3VQHA 2O65A 3UVRA 4I21A 3R22A 4MBLA 4F6WA 5H8BA 2FSOX 3BEGA 5EHYA 1ZYLA 3FSKA 2VTLA 3LFBA 3DS6A 3FYJX 3KRWA 3P79A 5DR9A 3FV8A 3ZC6A 3ZOSA 4PDPA 3O2MA 2BZIB 3IW6A 3EQPA 4UWCA 3P7BA 3FXZA 5F9EA 5IQAA 4BTJA 5B2MA 1H01A 2X7OA 3O17A 4FTUA 4I93A 4QPSA 5C27A 2C47A 4XOYA 3UIMA 2HXQA 4U97A 2IW8A 4EOMA 5HD7A 2OGVA 4NT4A 3CQWA 4AZVA 1CMKE 4HYIA 4BDDA 2UZNA 2XKCA 1JPAA 1LR4A 4DITA 4XH6A 1E1VA 4IAFA 2XEZA 3C4FA 4DFYA 3A8WA 4MH7A 1WCCA 5LCKA 3OOGA 3FAAA 4AZFA 4F7SA 1JVPP 4I22A 4IDTA 1QPDA 3CXWA 3LJ1A 3EQGA 1KV2A 3II5A 2VTPA 3ZU7A 2BZHB 2GNHA 3GOPA 4RX8A 3DKCA 3DK7A 4RJ6A 4IX3A 3S3IA 1NY3A 3TL8A 5KKRC 4FIFA 1YDRE 4FKQA 4UALA 3HKOA 3TZMA 3ZTXA 3DBEA 4EYJA 5M57A 3HA8A 5K9IA 3FC1X 4IACA 4YHFA 5JFSA 2JKKA 3KXGA 2WXVA 1ZXEA 4Q5HA 3SW4A 4BWPA 4EHEA 3CPCA 2I6LA 3LQ5A 2QURA 3LPBA 5CI7A 3Q4ZA 3DJ6A 3ENHA 4LL5A 2OI4X 5HIEA 2RGPA 1YKRA 3MI9A 3TN8A 5M07A 3Q52A 3WZDA 1PXIA 1ZRZA 3NS9A 4ZS0A 3CBLA 1Q8WA 1XBBA 5CU6A 3P86A 4ZY5A 2WHBA 3EN4A 4FEXA 3G15A 3TZ8A 2WQEA 2VGPA 1OM1A 5JT2A 1BL7A 1SM2A 2C6EA 5AIKA 3EQRA 3O8UA 4F63A 4QMNA 3UP7A 5HOAA 5T68A 2R9SA 3NNUA 5LOHA 4NTTA 4X0MA 2UVYA 4GG7A 3PA3A 4BHZA 5BVDA 1RDQE 5J8IA 2O3PA 1WVXA 2UZLA 1UVRA 2OW3A 2FGIA 3V01A 5EW8A 2VNWA 5HG7A 4D58A 4LUEA 2XIYA 4A9YA 1U59A 4XP0A 3LLAA 3CS9A 5HNIX 2WB8A 4K8AA 3R7OA 2W0JA 2ZDUA 3RK7A 3U4WA 2ACXA 4RX5A 1ZYJA 2C5YA 2VWZA 4FKGA 4FYNA 5CF5A 3QXOA 1AGWA 2WELA 3RPSA 5CSPA 5AEPA 2YCRA 1URCA 2IW9A 4FT0A 5AP7A 4H36A 5KKRB 2PVJA 5LQFA 1P14A 3GC9A 3KF4A 5CYIA 4FK6A 2WU6A 4LGHA 4GMYA 3PTGA 3LZBA 4DH5A 4MK0A 3MPAA 2NO3A 4GS6A 3DBDA 4G6LA 3W2SA 5D12A 2X6EA 2QG7A 2UUEA 3H9FA 3NW7A 4RQKA 3MS9A 5IQHA 5LMAA 4W8DA 4FF8A 5GZ9A 2GS7A 3IPHA 4YGAA 1PJKA 4M0YA 5FP5A 3F66A 4ANQA 4QQJA 3TKHA 3NUPA 3K5VA 3CC6A 3PA4A 2JDOA 4FV1A 5ANOA 1BMKA 3N4VA 2XK8A 3COHA 1YRPA 3ORKA 4M66A 3VBWA 3KREA 2C3JA 4A4XA 2GCDA 2LGCA 3HMNA 4TYEA 4E8AA 2YM4A 5KX8A 4IAZA 5DHJA 1PXOA 5AR8A 4I0SA 5EYMA 2PVHA 4P2KA 3SXRA 3ZUTA 5HBEA 1Q41A 2UW3A 5KMIA 3TZ7A 2VTSA 1W82A 4QPMA 4IMYA 2F49A 2EWAA 4FTQA 3H0ZA 4IVDA 2HZIA 4KSQA 4YZ9A 1MRVA 2HWPA 2R3QA 4I3ZA 2GTMA 2X8EA 4TT7A 4BZNA 2C6TA 2WMVA 3HUCA 3PWDA 3KQ7A 1G8AA 4CG9A 1UKIA 4ONAA 5KE0A 1OL7A 2BKKA 5HG8A 2F2UA 3KEXA 3LFCA 4RVMA 4GG5A 5AAFA 2B53A 3E63A 3GGFA 4FV7A 4FZDB 2VNYA 5BMSA 4K6ZA 4XRJA 3OUNB 5M51A 4V0GA 5CTPA 3FC2A 3OHTA 4ZTHA 2Z7RA 5LVMA 2YM6A 4YHJA 3V5TA 1PY5A 3ETAA 4U81A 2J9MA 3IG7A 3PLSA 4XCUA 4BBEA 3MWUA 3UBDA 3BQCA 3PJ8A 3QWKA 3E3PA 4MXYA 2VTNA 1R1WA 3FZSA 3GU4A 4BDIA 3W18A 5E1EA 4AU8A 4O6EA 4I4FA 5KBRA 4NKSA 2ZB0A 4FSNA 3ZRLA 4YU2A 5FBOA 5A3XA 3GU5A 4FKJA 2YDKA 5FTOA 3RWQA 4ZZMA 3KL8A 4A9TA 3CLYA 2C6OA 1ZY4A 4UV0A 5J5SA 3ZO1A 1EH4A 2BHEA 3D94A 1JKTA 2HXLA 3U6IA 4GFMA 3BHHA 2QOKA 4QTAA 4O0WA 5DT0A 2GTNA 4MD7E 3VUMA 4YSJA 4O7WA 4DN5A 4FKIA 1PXNA 2YN8A 3T3UA 3WF7A 3OBGA 3DOGA 3QX2A 3R9HA 3WF8A 4EUUA 5DLSA 2AC5A 1M2RA 3JVRA 4JX3A 1OKYA 2BILB 2GHMA 2JIVA 2Y8OA 1KWPA 2NPQA 3PXKA 4NSTA 4PPCA 4QP7A 4ZY6A 3OCSA 3FKNA 4G1WA 1BYGA 2YAAA 4JRVA 1M14A 4RWLA 4YZMA 5M56A 5EW9A 4S32A 3DTWA 1RW8A 2G15A 3IONA 3ID6C 4KWPA 2FSLX 3ZSIA 1H00A 3EHAA 3KRXA 2VWUA 2CNUA 3MFSA 4TPTA 2A19B 4DLIA 2OLCA 3VO3A 3PIZA 3GU8A 3V8WA 1B38A 2QODA 3FXWA 4O83A 3Q4CA 3DPKA 4WSQA 2WTDA 1NVQA 4A9UA 4FTNA 2CKQA 4JR7A 5EI8A 4ITJA 4Y5HA 3ORXA 3ALOA 4EZ3A 3TV4A 4O7NA 4F0GA 4M69B 3RAIA 3BU6A 2P4IA 3KY2A 2C3LA 2QU5A 2BR1A 3FQHA 4TYGA 5J9YA 4XUFA 1J7IA 4CFMA 2W1GA 4EK6A 4F0FA 4BGGA 5CEMA 5CU3A 3VS6A 3HAVA 2ZOQA 2YM7A 3GCUA 3UGCA 4U0IA 2R3PA 4CXAA 3QQHA 4QRCA 1KE9A 3Q6UA 3QXPA 3OCBA 1M17A 4F6UA 3ET7A 5LARA 4HGLA 1ZOGA 4YP8A 2XIKA 4EK3A 3KMMA 4YHTA 3LJ0A 2XIXA 1UU8A 5HLPA 3AGLA 2G1TA 2PPQA 5A46A 5AR7A 3TDVA 2BKZA 4JAIA 3MSSA 5CXZA 2ZM1A 5BX0A 4DCAA 2PUNA 3AC4A 1UV5A 5AMNA 2VO7A 5I3RA 3R04A 3QU0A 2C0TA 4EQMA 4F08A 2BTRA 4BZOA 2G2FA 4X2KA 4AFEA 3WARA 3FMDA 3QA8A 4ALWA 2GS6A 4R1YA 3GNIB 3G33A 4ZSGA 2XNPA 5HNGA 3QTWA 4EHZA 4PNIA 4AN2A 3O51A 1GZOA 4MXOA 4LUDA 4L44A 3KVWA 4L6QA 5HIDA 3N9XA 5HVKA 2I0YA 3SW7A 1OPJA 1JSUA 2R3GA 2WMQA 4JIKA 5ACBC 2NRUA 2J0IA 3C5IA 4I94A 4MX9A 4OT6A 3EFLA 4HNFA 2PZIA 2BZJA 3DQXA 2HZ4A 3F5GA 1O6LA 2OXXA 3HUBA 3HV6A 3ODYX 4R5SA 4RJ7A 5AR4A 1QPEA 4FICA 1H26A 5JSMA 4TY1A 4W4XA 2UW4A 1H1QA 2CLXA 5ANKA 5EI2A 3WILA 4E4LA 4PP9A 5TOZA 2VO6A 2ERKA 2R3OA 2XZSA 2Y9QA 3AMBA 2UZWE 3OXTA 3W2QA 3WIKA 3MY5A 3R21A 3RAWA 3EQHA 5EYDA 3TI1A 3O50A 3F82A 2YLEA 4JI9A 3ATTA 1Q4LA 4O0RA 3RK9A 5AIRA 4FV5A 3U9NA 4C8BA 2PK9A 1FOTA 3N4TA 3K5UA 3B8RA 4EZ7A 4PMMA 3R8ZA 3PWYA 1UNLA 2I40A 3P9JA 3RTPA 4A9RA 4AS0A 2E2BA 2QC6A 2ZV2A 1YDSE 3Q4UA 3SG8A 2QOHA 4OAVB 3LQ8A 3G9NA 5FTGA 3KK9A 5BVKA 3DDPA 4I24A 2NRYA 2HELA 3UOKA 5CEOA 4I20A 4G5JA 2OK1A 5C03A 3U87A 3NDMA 1BI7A 3OW4A 3QHWA 4U7ZA 4O0VA 1Q99A 4Z9LA 2VTMA 3KU2A 4LYNA 3P5KA 3VUTA 3GC7A 3EQCA 4ZJIA 3R8VA 4L01A 3PP0A 2BUJA 3ROYA 3NIZA 4FKWA 1M7NA 4OTWA 4BCPA 1YXXA 3UYTA 1H08A 5CU0A 1DAWA 4O0SA 4D5KA 4Y73A 5HU3A 2OF4A 5KHXA 4IBMA 1XH8A 4EZ5A 4O0XA 3QTRA 5K3YA 4FUYA 1OL5A 3TJDA 3GBZA 4GT5A 5JZJA 2OICA 3IOPA 2VTIA 3MH2A 5FRIA 3U6JA 2JKMA 3HMMA 4QO9A 4WRGA 5AP6A 5AR3A 5HO7A 5L6PA 1NVRA 2YA9A 5LXMA 5HZNA 2VWVA 3FWQA 5CU2A 2O2UA 1GIIA 2GMXA 4QNYA 3FPQA 2QOIA 3A7HA 1PKGA 2R3NA 3OTUA 1DS5A 3HEGA 4OW8A 2BDJA 4KRDA 4BIBA 4D9TA 1WZYA 4WSYA 3PG3A 2X8IA 4M69A 3BELA 3POZA 3GCQA 4NL0A 3MA3A 4MF0A 3Q32A 5AX3A 5AAEA 3GEQA 2B4SB 1ZYSA 5AUXA 4WNPA 3FI3A 3DXNA 1PMEA 1STCE 2Y4PA 3QRTA 1U5QA 5EG3A 4QMWA 4QD6A 3A7IA 5GZ8A 5HX8A 5ETCA 5L8KA 2A2AA 3OF0A 4J7BA 3UPZA 4RWJA 2WEIA 3NAYA 3QTQA 5FEEA 1BUHA 4WUAA 3NVKI 5HO6A 5JFWA 3RPRA 4FSQA 4MD9E 3QGWA 2IZSA 3QZIA 3ZO3A 1ZZLA 3ZO2A 3R2BA 3E8DA 4UMPA 3RP9A 5CASA 4QTEA 2XK7A 2OBJA 3UOHA 4DGLC 3S4QA 1GIHA 4JVGA 1MRUA 4R5YA 4X21A 2OIQA 2XB7A 1J7UA 1MUOA 1OKWA 3A7FA 5CI6A 4GU9A 4OR5A 5K4JA 2QO7A 2PE2A 3MH1A 4ZLYA 4J99A 1H25A 4WG5A 2G01A 4L67A 2J7TA 3NW6A 2XRUA 1M2QA 1MQBA 2XK6A 4UYAA 3U55A 3EL8A 3CGOA 3WF6A 2XK3A 3C0HA 2R3RA 4I5PA 2WIPA 3O7LD 1YXVA 1YWNA 5CF4A 3DB6A 2IJMA 4F9WA 4BDEA 1Z9XA 3QRIA 3TTIA 4AA4A 5I4NA 2YACA 2WTCA 4BDFA 2WOUA 4ERWA 3VS7A 3SOCA 1W8CA 3ITZA 2C5OA 3S95A 3UOLA 4H05A 1SMHA 4YZNA 4CKRA 3C5UA 4NM5A 3F2NA 4IZ5A 3W1FA 1XH5A 2PUIA 2PUPA 3EZRA 5CXHA 4O86A 1H07A 2B1PA 4MYGA 3FXXA 5B0XA 5IZFA 3BEAA 3MVJA 4MNEB 3KGAA 3G2FA 3TACA 2IZUA 4ZTLA 4O27B 2C6MA 4IWOA 4NKAA 2R3FA 1GZNA 1WVYA 3HLLA 3WZJA 2H6DA 4IQ6A 2X2MA 4EQUA 2CNQA 3D15A 3LMHA 4X3FB 3DAJA 2F4JA 1KE7A 3GQLA 5CAPA 2VZ6A 2WMWA 4N70A 5IKWA 3VHKA 2Y0AA 2QG5A 5KZIA 5JKGA 3EQBA 5L6WL 3TTJA 2QO2A 5E8ZA 3I6UA 5E8UA 4CKJA 2YDIA 1WFCA 4FR4A 4IWQA 3ZUVA 3VBTA 3L9LA 3MGYA 5CWZA 4Q9SA 3BE2A 5IQCA 5DOSA 3OEFX 3TCPA 3I60A 4GSBA 3LM5A 3F7ZA 3PXZA 4GFOA 2WMXA 1PXLA 4R78A 2XNEA 3QD2B 3CTQA 4O96A 4XV1A 3DKOA 3QFVA 4YBJA 2ITVA 1UU7A 4DTBA 1U54B 4FT3A 4P7EA 1OUKA 2DWBA 3AT4A 1Q5KA 4ZMEA 1TQMA 3VS1A 3W32A 1B39A 4NW6A 3THBA 4BRXA 3R1SA 4GVJA 4X7QA 4CZTA 2WIHA 3RVGA 3EN7A 4LM5A 1RQQA 4PPAA 2RIOA 5AV4A 3BZ3A 3SX9A 3BYOA 4XG4A 2X39A 4ZS4A 5I9YA 4BYIA 4JOAA 5E8TA 3A4OX 4EKKA 3ANQA 3W2RA 4Y46A 5IISA 3ZDUA 4J52A 5IF1A 4KABA 5ANGA 5T6KA 1W98A 4BTKA 4BDKA 4I41A 4OAUC 3R8MA 5ETIA 5C9CA 4YTCA 3FKOA 4YJNA 5I9VA 4I4EA 4Z7GA 1YI3A 3T9TA 5ANEA 3A8XA 4CLJA 1Y6AA 5DFPA 4XG8A 4ZZNA 2XNNA 2JBOA 5IUGA 1WBPA 1M7QA 2BRGA 2QOCA 3D5UA 3FHRA 4IE9A 4DEDA 4EWQA 4CFXA 3S00A 3LKMA 3AG9A 3TJCA 1CKIA 3QAME 3NR9A 1V0PA 2YHVA 3O8PA 4L43A 4DH3A 5A4LA 3CD3A 3Q53A 4XG9A 3TIYA 3ACKA 3F3ZA 4GJ2A 1OECA 4NFNA 4UBAA 5M4UA 3ZM9A 2XYNA 1R39A 2C0IA 5CY3A 4S30A 3VS2A 4OTFA 5AUZA 4ZZOA 4M12A 5HQ0A 4HW7A 3DQWA 3QHRA 4NIFB 2OXYA 2R0IA 5IMXA 3Q9YA 4O22A 3MJ1A 5G6VA 3RNYA 3KXNA 4L68A 3I6WA 4O7RA 5EM6A
chains in the Genus database with same CATH superfamily
3LXPA 2ZV9A 5LVNA 3TUBA 4OTGA 2GU8A 4CD0A 2I1MA 3W0PA 5HE2A 4O0TA 4USEA 3AOXA 3P1AA 3VBYA 4DTKA 2RKUA 3CTJA 4U42A 2J5EA 4YC6A 2AEGA 2E9PA 2PVNA 1I09A 3C4WA 4FEVA 4KSPA 5KO1A 5FP6A 4DG0E 2I0HA 3VBXA 5DN3A 2GNFA 2ZV8A 3G0EA 4U6RA 4IB0A 5M06A 4IW0A 4RZWA 5I3OA 4PV0A 3KXMA 2ITQA 2YM5A 4ACMA 2PE1A 4OLIA 3TV7A 2B9HA 2WQMA 3FMJA 4HGSA 2V7AA 4I0RA 4YLJA 5AP0A 2QLQA 4RLLA 4Q9ZA 3AKJA 2WKMA 4O84A 3UNZA 1PW2A 3M11A 5FQDC 4AE6A 2C69A 4M0ZA 5F1ZA 4WG4A 2WGJA 2A0CX 2Y4IB 3ZSHA 4FKSA 1T46A 3UTOA 5LWMA 4L7FA 3LCKA 3WYYA 4MNEA 4IB5A 4AUAA 4CGAA 5GJFA 4KD1A 4FZ7A 2C3KA 4FNWA 5KMNA 3MB7A 2PULA 4Y95A 3G6GA 1SVEA 5FD2A 4LOOA 3R71A 1ZMUA 2JFLA 4PQNA 2OJ9A 4X3FA 5BYZA 4FIJA 4MHAA 4DFLA 1UKHA 4HZSA 2CJMA 2W1FA 4GL9A 3OT8A 4BCGA 2ZB1A 2YIXA 4BDBA 1Q8TA 5DGZA 2X0QA 3GT8A 2CLQA 3ROCA 5C8KA 5IA4A 1FGKA 4W9XA 4JQ7A 3WE4A 3MW1A 2PWLA 4I1ZA 3JR1A 4JBVA 3CR0A 5DYJA 3G90X 4DG2E 4JDJA 5CVHA 4DEHA 1REKA 4PL3A 1OKVA 2RFSA 3OMVA 2XBAA 3ZEPA 3N51A 5J7HA 1AD5A 1JKSA 2XIRA 4D4YA 2YCQA 3CKWA 5KMJA 2WMUA 5BUIA 1Y8GA 3FPMA 2OFUA 1HCLA 1R3CA 2ZYBA 3IDCA 3DLSA 2OG8A 5EM7A 4BWKA 1U54A 4ERKA 3GFWA 5L2SA 3KK8A 4EOSA 5J9ZA 1H28A 4L45A 5FBNC 4H1MA 5IUIA 4ACGA 2HAKA 2PVRA 3AD5A 1Y91A 4QP8A 2ITWA 4ZJJA 2OJGA 4RA4A 2BFYA 3R8PA 1LP4A 3ZUUA 5CEKA 4UMTA 4XV3A 3SDJA 3HDMA 4BTMA 4M15A 2OZAB 2UVZA 2XS0A 4IC8A 1YWVA 3B2WA 3QCQA 5TKDA 4TWNA 3UZTA 5C26A 4MXCA 2DQ7X 3JXWA 4V0GB 4RJ8A 4EL9A 4F9CA 3AC3A 3O7LB 1G8JA 4DFUA 1PF8A 4RX9A 3R7YA 4MXAA 1TKIA 4D1SA 3FBVA 2CGWA 3BU5A 4RRVA 3DFCB 4IZYA 1I44A 3E7VA 3OWPA 3PVGA 4ZSLA 4TZRA 3OS3A 5HI2A 3H30A 1SYKA 2UZBA 2VGOA 1CDKA 3KC3A 5GJDA 4O7YA 4K9YA 4QMSA 4E3CA 3V6SA 1FPUA 2HK5A 3DZOA 3UJGA 2FVDA 3NYXA 2F7XE 4FOCA 3RJCA 2BVAA 3UDZA 4RT7A 3MV5A 4QMMA 3KRRA 5T3QA 1IG1A 3KXXA 4G2FA 5HO8A 1J7LA 1H0VA 3GOKA 4GVAA 4RJ4A 5CX9A 4U80A 2YAKA 1TFFA 5GIOE 2YIYA 3SXSA 4AZSA 1IA8A 2Z7QA 4NIFA 4HJOA 2DYLA 5L6OA 3FI4A 2R3IA 3PXQA 3QYWA 4M67A 3EFKA 5KNJA 3UQCA 2C5XA 3EWHA 4FK3A 1ZYCA 3MFTA 4FZFB 1YXTA 4E26A 4BBMA 3NNWA 3UIUA 4IAIA 4QMTA 3LFDA 2BHHA 3QQJA 5FM3A 1W2FA 3V5LA 4AZWA 4C59A 3W8LA 3GB2A 3LLTA 2YZLA 3H9OA 4RFYA 1V0OA 4TWPA 3V6RA 5K5NA 1ZARA 5KUPA 3EKKA 5CANA 3W10A 3VUIA 2IEWA 3AC2A 2UZEA 2A98A 4RFMA 3UE4A 1F3MC 2I0EA 1G8KA 4KAOA 3Q9XA 5AP5A 5B2LA 2BPMA 4Y72A 5IMEA 3PYYA 3DBQA 5HCYA 4C3PA 3FY0A 1OKZA 3F2AA 2QQ7A 4ENYA 4XMOA 3MH3A 2Z60A 3Q96A 4YJOA 1YOJA 4F0IA 4YBKA 5LJJA 1R0PA 4FKLA 3V51A 4DH8A 5DIAA 3UYSA 3FQSA 1H1PA 5F95A 3C9WA 3KULB 4HPUE 5FG8A 2IZTA 2J2IB 4ZSEA 4EH3A 3TMOA 3ZZEA 3LHJA 4L3JA 5J79A 4DDIA 5IDPA 2R3LA 3K54A 4M7IA 3CJGA 4OUCA 4A07A 4DFZE 1F0QA 2XYUA 4FVRA 3CY2A 4YZCA 4IFGA 3Q60A 4CLIA 2BRMA 2PTKA 3FE3A 3MY1A 2XNBA 4DLJA 4LMNA 5A6NA 1ND4A 2IVUA 3UZRA 2ETKA 4ZTMA 1QMZA 4RVKA 3BV2A 4MF1A 3CCNA 4N6YA 2UW7A 4LFIA 3Q4TA 3WE8A 2B0QA 3KIOC 2GNLA 3SLSA 4G6OA 2X6DA 2OH4A 2ITUA 3HRBA 2PVFA 2C6LA 3PRFA 3MY0A 4F1TA 3COIA 3UMWA 4EH6A 5BUEA 3VRZA 4YSMA 4AT3A 4BCKA 2CCHA 1E9HA 2A4LA 5ANIA 2UW8A 1HOWA 3ZBFA 2J0JA 3LCSA 3PFQA 4JXFA 4L9IA 4U43A 4EKLA 3QYZA 2JIUA 1MRYA 4PNKA 4XG2A 5K0XA 3EQFA 4NWMA 4R3CA 5L2TA 3I0OA 2XALA 4DEAA 3TNWA 2XNGA 5FM2A 3KB7A 4FVQA 3ZZWA 1E1XA 4FIEA 4XYFA 3T9IA 3IO7A 1TVOA 3VW8A 5JQ5A 3SQQA 3N4UA 4FTTA 3PVBA 1OIRA 4ZK5A 2OZAA 4G6NA 3CIKA 4BI1A 1R78A 1H8FA 4FV3A 2X0PA 5G1XA 4FTKA 3JPVA 4BI2A 5A4EA 5L4QA 3IOKA 2W1DA 3BU3A 3QUEA 5E90A 3WBLA 5HTCA 5FEQA 4RQVA 3FMLA 3DZQA 4ZTQA 3BQRA 4EHGA 3LQ3A 4CFUA 3ELJA 4CV9A 3NYNA 4E93A 2CGXA 4O4EA 3SC1A 1OITA 2JDSA 2X7FA 3BPRA 2PVKA 4FTCA 5D7AA 4EH2A 4KB8A 1ZYDA 2WU7A 3MA6A 3V5PA 2CGUA 2HOGA 3LIJA 2X0OA 3LFNA 4AF3A 4IFCA 5HE3A 3H3CA 1WMKA 2E9OA 4BZDA 5FUTA 5FXSA 1XJDA 2QHMA 4ORKA 5AV0A 4QNAA 3AKKA 1DI9A 2PL0A 2X2KA 3AD4A 4FIGA 5HG9A 4ANNA 4M13A 3CY3A 5A4CA 4IWPA 1OL2A 3BCEA 3BV3A 2YM8A 3E92A 3HA6A 3NRMA 3PPKA 3FLZA 2AYPA 2Z7LA 5TR6A 3DAKA 4FL2A 3NCGA 4RG0A 1PYXA 3R7EA 2JBPA 4HCVA 4ITIA 2GNJA 2V22A 3EJ1A 1VYZA 4UMUA 3VWAA 3EYHA 4N6ZA 3WF5A 3ZBXA 5J7BA 3QTXA 2P55A 3IW4A 4QOXA 2B9FA 3G5DA 3HMOA 3R00A 4KIKB 5KMOA 5DWRA 3FQEA 3ZFMA 2OO8X 4KUJA 3DT1A 5ICPA 3F2RA 2QKRA 1YHWA 3DDQA 2VWIA 3JVSA 1QL6A 4MXZA 3FMHA 4FTAA 3BGZA 5JFVA 4F9YA 1REJA 4R8QA 4ZXTA 3TG1A 4B8MA 3V8SA 4J97A 3NFFB 3U4UA 5CSXA 1BL6A 4EYMA 3A4PA 4IX5A 1YI4A 3AT3A 3Q5IA 4RBLA 4BCQA 4QMVA 3U9CA 5C1QB 5IH5A 4RMZA 4ACDA 2AC3A 2PVMA 5CS6A 5CVFA 1OMWA 5TT7A 1F5QA 5I9WA 1W83A 4MEDA 1UU9A 2YJRA 4CCBA 4TYJA 3KULA 2OH0E 4P4CA 4EOQA 5H3QA 3HMPA 4U3YA 3L9MA 1MQ4A 3TEIA 4KBKA 4C33A 3OFMA 4RIOA 3CTHA 3I81A 4QMPA 3UPXA 2BAJA 3LFQA 3O8TA 4ZTRA 1OGUA 5IQDA 3QCXA 5IG1A 2HW6A 5EKNA 2EB2A 4H3QA 3PUFC 2W9ZB 2H9VA 3IW7A 4QP9A 2UW0A 2WMRA 4IX6A 4EOPA 5DPVA 3W0RA 2J0LA 3MPMA 3NUYA 4NCTC 3Q2MA 2JLDA 3C13A 3HVCA 5M4IA 3LCOA 3R8UA 3ZXZA 1J1CA 3I1AA 2ITZA 4GK2A 4WNKA 2R7BA 4AOIA 2AQXA 2CGVA 3E62A 1OPKA 3O23A 2VTQA 4YTFA 2PSQA 2OZOA 4L52A 1XQZA 4NFMA 3SOAA 5CAUA 3Q6WA 2XVDA 3HAMA 4J8NA 4UZHA 4X2GA 5HD4A 1H4LA 4G3DA 4D2SA 2XBJA 2R7IA 3RNIA 1JKLA 5IQBA 5E4HA 4BKJA 4FG7A 4MNFA 4DF3A 5HGIA 5CNNA 4AW5A 4RC4A 3TKIA 2W7XA 2QOFA 3WZUA 2B54A 3M42A 3RAKA 1W0XC 3NNVA 4YPSA 3TYKA 5E8SA 4M84A 5IA1A 4BKYA 3C4CA 4YURA 4KA3A 3UMXA 3ALNA 2EXCX 1KV1A 4N0SA 3CP9A 2JC6A 4JNWA 4UZDA 5J5TA 4A06A 4XG3A 2W5AA 4TNBA 3EN5A 2GHLA 4GK4A 5CAVA 5M08A 4RGJA 3A2CA 1H1SA 4PWNA 2VTJA 4D2RA 4G31A 4GIHA 4F09A 1UA2A 1L3RE 3E8NA 3HP2A 3ODZX 2V0DA 4EBVA 4JQ8A 1NVSA 4O4DA 3ACJA 5CSWA 4AQCA 1P4OA 2GDOA 4NJ3A 4FKUA 2EVAA 4C4IA 2WZJA 4D1ZA 4OTRA 3G9LX 4JG8A 1H1WA 4EOIA 3AKLA 3VW6A 3ORPA 4BF2A 2XA4A 5FDXA 1GY3A 3NUSA 4FKTA 4CFWA 4QP4A 3A62A 4FKRA 3LOKA 1MP8A 4BN1A 1PMVA 3ORNA 4Q2AA 4LRKA 1RJBA 3MN3A 2I7QA 3BYSA 2W1EA 1OIQA 4MKCA 3FI2A 3VF9A 4HVGA 1FGIA 5DNRA 5AM7A 1OBGA 3NW5A 5ETFA 3IDPA 1Y8YA 5HTIA 4FA2A 2NYAA 1XO2B 2B9IA 4IAYA 3NEWA 4XOZA 2JDTA 4EK5A 2XF0A 4CVAA 4QMOA 5M4CA 1ST4A 4BR3A 2CN5A 4BIDA 5JGAA 4DFXE 3JY0A 3L8SA 4PMTA 1YWRA 3PRIA 2BIYA 4LV5A 3QWJA 4TWCA 5CVGA 3MJ2A 3EN6A 1J1BA 2PE0A 3CPBA 3NNXA 5CZHA 5DEYA 4AW0A 4MCVA 3DNEA 4PY1A 4WD5A 2G2HA 5IPJA 4O6LA 4Z16A 5AUTA 4NZWB 1P5EA 4QTBA 3RCJA 4UXQA 3R9RA 3RCDA 4KIKA 4OTDA 4CTBA 3TDWA 5EK7A 4DBNA 5HE0A 1PKDA 2RFDA 3NZ0A 4G3FA 5DT4A 4X6RA 3A7GA 3NUAA 4PDYA 4LL0A 1M2PA 3DGKA 1UWHA 3VONA 4EOKA 3FZOA 4FG9A 1JSVA 1KE5A 4HYHA 1SNXA 2VD5A 4PPBA 5IQGA 4QMZA 1GJOA 4W4WA 5AUYA 4LGGA 4PL4A 3W2OA 2B9JA 5E8YA 4QMYA 4XP2A 2GSFA 1YQJA 2E9NA 1AQ1A 3V5QA 4BDGA 4IX4A 2VAGA 4KKGA 3BBWA 3I5ZA 3I79A 4IANA 3IW8A 1YOMA 5BMMA 3R9DA 3SRVB 4FVPA 4IEBA 4F6SA 3FZPA 1K9AA 3GXLA 5L2QA 2ITNA 4YR8A 5A9UA 2OSCA 5CALA 4FSMA 4J98A 5LMKC 3LMIA 4KS8A 1H24A 3QTIA 5AR5A 3UZPA 1KE8A 1M52A 2DUVA 4KIQA 1IAHA 2V7OA 3OBJA 4O0YA 4APCA 2XNOA 2ZDTA 4PMPA 3F5XA 4JAJA 1VZOA 2YWPA 4ASXA 4D55A 3QA0A 4QPAA 2IG7A 2CKOA 2J51A 5HLNA 2YIRA 3AC5A 2IO6A 3L8XA 4GV1A 5EOBA 4AAYA 3IQ7A 4MQ1A 4QDVA 3R7IA 2ONLC 3MIYA 4RSSA 5EM8A 3HV3A 1XBCA 3UG1A 4D2TA 3FL5A 5DR6A 3VN9A 2B55A 3QD4A 5J95A 4CCUA 4EQCA 2P2HA 5EQYA 4ENXA 4YNOA 4AT4A 5C01A 4B4LA 1OL6A 4IAKA 3TNHA 3DBCA 1LEWA 4N4SA 3RAHA 3OWKA 4FIHA 4JG7A 4IM2A 3ANRA 1RE8A 3VC4A 3BIZA 5IEYA 4F78A 1PMNA 4WKQA 3RZFA 5HESA 4BC6A 4M3QA 5IU2A 4BB4A 3WZKA 2ZAZA 5EI6A 4G34A 5HX6A 4DFBA 2QVSE 2VX0A 3MVHA 1KOBA 5L8LA 4AOJA 5KZ0A 4BDAA 2PZ5A 4FEUA 4PF4A 4S33A 3NX8A 3FLNC 4JBQA 5F94A 2JAVA 5A14A 2YIWA 4V04A 4GT4A 5J9LA 3D0EA 3D7TB 2XCKA 3TIZA 2XKEA 4EOOA 2FSMX 4BFMA 5BVOA 1SNUA 4FT7A 2WMSA 1NXKA 3PY3A 5EOLA 4EH8A 4FSYA 3D5XA 5F20A 3UG2A 2W1CA 2WTKC 2ZM4A 1PXPA 1YXSA 4NM7A 3ZMMA 2X0GA 4I92A 4C36A 4R7IA 3UVPA 2QO9A 3DV3A 2QKWB 4HCUA 3P7AA 4AXAA 4C2WA 2IVTA 5J1WA 4YC8A 2PU8A 3UQGA 3WIGA 4QYHA 2R3MA 4AZTA 4KIOA 5IQIA 4BGHA 1KE6A 4E6DA 4O2PA 2UZUE 4AN9A 4ANBA 5E9EA 1WBNA 2OF2A 1ZOEA 3OROA 4DFNA 5FWKK 4E5WA 2JEDA 5EYCA 4J53A 4OBOA 3FMEA 4A9SA 4O2ZA 4YZDA 4BCOA 4J71A 1XH7A 4AX8A 4BDJA 4WO5A 2R4BA 4FEWA 2W9FB 4I6QA 1PHKA 4O7SA 4H1JA 4EK8A 3NIEA 4AGUA 3OY1A 5AV1A 2F7ZE 2BRNA 5C8NA 4CEGA 4FZ6A 4L00A 1LUFA 4ZP5A 4AP7A 4P5ZA 1JKKA 3IDBA 2BIKB 3V8TA 4IDVA 3ZONA 3VRYA 5KBQA 3RI1A 4F7JA 5B7VA 5IH4A 4RIYB 4OTPA 4H39A 4ZEGA 4CNHA 3OY3A 3RBWA 3GFEA 1CSNA 2C6KA 4I0TA 4MBIA 4XHKB 2W4KA 4C7TA 4F99A 2GHGA 2WTKB 5I9ZA 3GC8A 2KTYA 4O82A 3BHUA 4RWKA 5I9XA 3Q9WA 4D2WA 4QMXA 3FY2A 1OL1A 3B2TA 3F3TA 4FTJA 2G9XA 5IA5A 1ZOHA 3F3WA 1W84A 5K0KA 1HCKA 3R83A 4X2NA 4U9AA 3ZFXA 3ZRKA 4HVHA 3SRVA 3VHEA 1SZMA 2F7EE 4ZY4A 4C37A 1WAKA 3R30A 3OWLA 3Q5ZA 3D83A 4YNEA 4UWYA 1VYWA 1VJYA 3AT2A 3PUPA 1VLRA 3D5VA 4FSRA 1VEBA 4XV9A 4H3BA 3C0IA 3OWJA 5DVRA 4XV2A 1UNHA 2HY0A 3MESA 4BCNA 4HOKA 2DS1A 4FSTA 2Z7SA 1XH6A 3GCSA 3KF7A 2C4GA 4UB7A 4A7CA 3O71A 3QQGA 3W55A 5JRQA 4LRMA 5AAGA 4DEEA 3R0TA 4LI5A 4RJ5A 4X3JA 4U5JA 4XEYA 5DT3A 3GC0A 3AGMA 2HCKA 4PMSA 4KKHA 1ERKA 5KMKA 4YJUA 3PA5A 4W4YA 3IKAA 4Y8DA 4FSZA 1GIJA 1ZZ2A 2IVSA 3QQFA 2VWBA 2XP2A 3ZLSA 1Z5MA 4DGOA 5H8GA 3DA6A 2XCHA 5M4FA 4E6QA 4YJTA 4ASDA 4YO6A 5IQFA 5DRBA 4XG7A 5AUUA 5JQ8A 5CAQA 4FI1A 4C34A 4OTHA 1U46A 3LXNA 3R1NA 3BWFA 1FVVA 2W99B 3FZ1A 5EKOA 4QMLA 4AA0A 1FQ1B 4D4VA 1YHSA 3QZFA 2BROA 4UWBA 4KBAA 4QMUA 4C61A 5AA9A 5BQ0A 3Q2JA 4FE2A 1GNGA 2WMBA 3QRJA 5ANDA 3R8LA 5GIPE 4FG8A 2OJJA 2HYYA 2P33A 4O4CA 3KVXA 1FVTA 4RVLA 2C68A 3ZEWA 2ERZE 4DE4A 3F88A 4ZLOA 3A60A 4EOJA 4XG6A 5LMKA 3GU7A 1T45A 5BYYA 4QQ5A 3OD6X 4LG4A 3ORIA 2VN9A 3I5NA 2PZRA 4Y83A 1ZMWA 1GZKA 4CT2A 4Y85A 3D7TA 3EH9A 3LW0A 3UVQA 3DLZA 3ZS5A 4FMQA 2WEVA 2W17A 5I5ZA 3OCGA 4NM3A 4AA5A 2X7GA 3QX4A 4PDOA 4UMQA 5CT0A 3FJQE 4RC3A 5CLPA 5DG5A 3FSFA 3OW3A 4G5PA 4USDA 3W16A 3QC4A 2ONLA 2OIBA 1ATPE 2W4JA 4ITHA 4AE9A 3COKA 5LCJA 3FMMA 3QCSA 4MQ2A 4A4OA 4D4RA 2P2IA 3SA0A 3UIXA 5E8XA 2XIZA 3EQDA 4GFGA 3E8CA 1PXJA 2O64A 2JDRA 4HVSA 5JEBA 3BKBA 4YZBA 4Y5QA 4FV2A 5CF8A 2HY81 5C8MA 3QLFA 4MWIA 3FLWA 4AACA 1KOAA 2G2IA 3QD3A 2QONA 3MTFA 2J0KA 3DK6A 3EZVA 2YZAA 2F2CB 3GVUA 5CQUA 2EB3A 1W2CA 1XHAA 4D2VA 3D4QA 3REPA 4D9UA 2C5NA 3RPOA 5ANJA 5JH6A 3E88A 4C58A 1OVEA 2YWVA 4EH7A 4WBBB 2UV2A 5GNKA 4F1MA 2GS2A 2JKOA 2W4OA 4TYHA 4JDHA 3ZCLA 4IVCA 3QKKA 1JQHA 1LPUA 3SD0A 4X2JA 1CTPE 3ZO4A 4AOTA 2CHLA 2QU6A 3BWJA 3WYXA 4WUNA 4QP6A 4EWHA 4GEOA 5M55A 4RIYA 3QUPA 3D2KA 2SRCA 3ERKA 4F7NA 3QRUA 3UDBA 4EEVA 2JKQA 2VWWA 5TO8A 3S1HA 2H8HA 4ASZA 5AUWA 3D14A 3PG1A 4ACCA 3C4ZA 3HL7A 3F69A 5I0BA 3HMIA 4FTRA 4U8ZA 1TQPA 4D1XA 2V5QA 3OCTA 4MUQA 2O8YA 1W7HA 3PSCA 2JAMA 3QQLA 2VTAA 2P3GX 3KRLA 3PJ1A 4XP3A 2XNMA 4TN6A 3LVPA 4QP3A 3D5WA 3QQKA 5CAOA 4BICA 3ORLA 4AW1A 3S2PA 3E3BX 2XKDA 4AXCA 4WRSA 2YCSA 3RM6A 4TKSA 1J91A 3NUNA 2V62A 5JGDA 3UNKA 3FMKA 1XR1A 1A9UA 2VWXA 5EH0A 4QEBA 4WA9A 3VUGA 2XM9A 4E6CA 4JR3A 3HV4A 3Q3BA 3LM0A 3E87A 5BVFA 4IAAA 3CQUA 3L8VA 3PIYA 4FTIA 4ZLZA 4DGNA 2F9GA 3VVHA 2BMCA 4PL5A 4HYSA 3M1SA 4IADA 1GZ8A 3VUDA 2YLFA 2KULA 3FHIA 2W06A 5H9BA 2BRHA 3HYHA 3R1QA 4U79A 3FEGA 4FOBA 2RFNA 2IW6A 1PXKA 3PZHA 1K3AA 4RA5A 5ITAA 2QHNA 4G3EA 4YC3A 4FV4A 3I7BA 3PJCA 5FXQA 4QTDA 3NVMB 4BTFA 4PDSA 4WBOA 5AR2A 1UNGA 2CMWA 4I5CA 4UY9A 3COMA 4GYIA 1KUTA 5JFXA 4IC7A 5K4IA 2HWOA 3DK3A 4TW9A 4HYUA 3VBQA 4AT5A 3BI6A 5GZAA 4L3PA 3R1YA 3ZC5A 4J95A 3BLHA 5HNBA 4CFFA 1BLXA 3F5UA 4E20A 4B99A 3F9NA 3ZRMA 3FLYA 4B6LA 4QYGA 5KMLA 5GINE 2YCFA 2YEXA 2NNWB 1QPCA 3FZTA 4R3RA 1Y6BA 3EYGA 1ZLTA 3P08A 3MPTA 2R2PA 5HLWA 3DTCA 4QYEA 1XBAA 5CEPA 5M09A 2OJFE 1PXMA 1NT2A 5IA3A 2R5TA 3RM7A 3RMFA 3LXLA 3UO6A 3ULZA 2Z8CA 1WVWA 4MBJA 4YJPA 3DXQA 4GRBA 2Z2WA 3JY9A 3SG9A 5BUJA 2QNJA 2ITPA 5CSVA 1ZWSA 3RALA 4PX6A 4EH4A 3E7OA 2WO6A 4KRCA 3A61A 2ZVAA 2ESMA 4JS8A 5FGKA 5HVJA 4BKZA 4ZMFA 4CQEA 4FNYA 3ZXTA 4C35A 4DC2A 4O7TA 3R7UA 5AFVA 5HE1A 4EBWA 2XK4A 4J96A 2IWIA 3NPCA 2BAQA 4HGTA 4L8MA 1J3HA 2ITXA 4AW2A 1QCFA 4C02A 1DI8A 4NYEA 4FEQA 4IZ7A 3F61A 3LCDA 4IXPA 2WTVA 1DM2A 3ZM4A 3UNJA 4IJ9A 4CMTA 5A4TA 3G0FA 3V5JA 2OXDA 4G9RA 4D0XA 3PXFA 4QMQA 2EU9A 3UC3A 2WQBA 3DJ5A 4CYJA 2Y7JA 3DBFA 3DNDA 4RLKA 2B52A 2WFYA 5HVYA 3E8EA 3FI8A 3RHKA 2GQSA 3JYAA 3RGFA 4FYOA 5C4KA 2R64A 2QR7A 4KIPA 4FSUA 4IJPA 5CQWA 5D1JA 3HECA 5ETAA 3OXIA 5JK3A 3UQFA 2VTRA 3QL8A 4C4EA 2XANA 3CQEA 4LGDA 4OT5A 4XNEA 5A6OA 3HZTA 3WOWA 4UYNA 4DEIA 4RPVA 3NGAA 3K3JA 3P78A 3ZLXA 4D0WA 3RHXA 1U5RA 1CM8A 4PTCA 4M8TA 2XAOA 3BGPA 4FGBA 3TNPC 1G5SA 3NMUF 4M97A 4O4FA 3I0QA 2WNTA 5B2KA 1Q8ZA 4TTHB 4L46A 3JUHA 3MFRA 4NK9A 4ANSA 4E1ZA 4DDGA 5C4LA 3LXKA 5GJGA 5AADA 2P0CA 4WOVA 4RX7A 3TXOA 4RZVA 4Z7HA 2Q0BA 2HENA 4IH8A 4ZJVA 2XRWA 3LFFA 3UOJA 4DGMA 2ZJWA 1O6KA 4DG3E 3MBLA 2FA2A 4BCFA 2XK9A 4IHPA 4DGGA 4EI4A 1LEZA 5HU9A 1W2DA 4G3CA 4JBPA 4EH5A 3PIXA 1PRYA 4C4GA 4OTQA 4ZAUA 4AFJA 4ALUA 3GCPA 3KFAA 5D10A 4CMUA 5CEIA 3SV0A 1BI8A 4U40A 1WBWA 4GUEA 4DTAA 4AGDA 5BVWA 5AV3A 3U51A 4IWDA 3OOMA 4F1OA 1YXUA 3UODA 2W5BA 2OJIA 3B8QA 3LMGA 1A06A 4FKPA 4FODA 5HEZA 4Z55A 5CU4A 3NLBA 5CZIA 5HG5A 3KRJA 4MXXA 3UP2A 3FUPA 3TT0A 1FMOE 4C2VA 2C0OA 4CQGA 4GKIA 2J90A 4ZOGA 4L53A 3G51A 5EHLA 2VRXA 4FL1A 5CT7A 5GHVA 3ULIA 3K3IA 4M68A 3VJOA 3NAXA 1ZY5A 2PUUA 4HPTE 5AP3A 2BFXA 4GU6A 4BCHA 5AA8A 2W05A 1TZDA 3S0OA 3VJNA 5FXRA 4DHIB 3QTUA 4Q5EA 4WNOA 4XRLA 1BX6A 3QC9A 5D7VA 4C4JA 3UO5A 4FV8A 3VBVA 3SGCA 5CENA 1X8BA 2E9UA 3AD6A 4FBXA 4MTAA 2JIIA 3O5AA 4WIHA 3VAPA 4CTCA 3BYUA 1H0WA 3GCVA 4YLKA 4ACHA 3MYGA 5BNJA 2ETMA 4AGWA 3R7VA 4NUSA 4B9DA 3EB0A 2VU3A 2QOOA 4R6VA 4U3ZA 3FZRA 3TWJA 4JDKA 2BTSA 4GW8A 2QOQA 5AP2A 4YTIA 4S34A 2JDVA 3ZLYA 4DH7A 1JNKA 2C1BA 2YM3A 2IN6A 2XJ2A 2XJ0A 3PZEA 4HNIA 4ANLA 4G9CA 3AMYA 4DINA 3ORZA 2FH9A 3OT3A 4YUQA 4FZAB 3W2CA 2CCIA 3GP0A 4I5MA 4S2ZA 3WZEA 2WOTA 1BKXA 3DY7A 1DAYA 4CFVA 1JOWB 2XEYA 1OI9A 1XH4A 4YJRA 3HRCA 4XBUA 5EHOA 4LMUA 4BVUA 4CSVA 4PRJA 4CKIA 2FB8A 2V55A 4IM3A 4GCJA 2RFEA 4GJ3A 1OBDA 2ITOA 4QQCA 3M2WA 4NTSA 2R0UA 3P7CA 4O38A 4MVFA 3R7GA 4FV6A 4WT6A 5HBJA 2LAVA 3VIDA 2Z02A 2BAKA 3KN5A 4FKOA 4AZEA 5D9HA 4NW5A 4DYMA 3MB6A 2J50A 4NM0A 4C38A 4TNDA 5L3AA 2R3HA 4F70A 4JJRA 4FC0A 3C1XA 1G3NA 2C6IA 3CKXA