3Q4CA

Crystal structure of wild type braf kinase domain in complex with organometallic inhibitor cns292
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
264
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of BRAF in complex with an organoruthenium inhibitor reveals a mechanism for inhibition of an active form of BRAF kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
total genus 68
structure length 264
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3q4cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3q4cA01
4JBOA 5L6OA 5GIPE 5IA0A 2WTCA 1YI3A 3UNZA 3VBWA 2IW8A 3S1HA 5KMKA 1T45A 4KSQA 2ZJWA 3TUDA 3RPYA 3W8LA 4CKJA 4RWIA 4L6QA 4O22A 3ZO2A 5IA4A 2JIIA 3VS0A 4I4EA 1GY3A 4EZ3A 4IVBA 2EUFB 1UU3A 4TWOA 1PXLA 3UQGA 3EFKA 3MW1A 4D2PA 5A4TA 5KUPA 3V5TA 5AFVA 3F6XA 4FT0A 2QU5A 4OTHA 4Z55A 3VAPA 5JZJA 3KCFA 3TM0A 1CTPE 1Y6AA 3LOKA 4NW6A 1J1CA 3W2CA 4UMRA 2YJRA 2XBAA 1PXIA 2PVJA 2R3HA 3JVSA 1JLUE 1Q3WA 1UKIA 3O7LB 4EK4A 5FP5A 3QTZA 5FBOA 3U55A 2P33A 4EQCA 2X39A 5AR2A 3DT1A 2KULA 4LL0A 4QMYA 1YDTE 1ZMVA 4IFGA 3FLNC 4GVJA 4WNOA 2BDFA 3I4BA 3K2LA 4M15A 2YIQA 4PMMA 4V0GA 4YJRA 5H3QA 2GTNA 2OJ9A 1OL6A 2QODA 2YN8A 2OH0E 2UW5A 2BKZA 2OJFE 4H3BA 5G1XA 3SQQA 3LM0A 3Q60A 4L00A 4XRJA 3WF7A 2OXXA 3OY3A 3SAYA 4ALWA 4ZLYA 3TJCA 2PVNA 4UMPA 5HGIA 3R1SA 3HGKA 3LFSA 2OWBA 1G5SA 3ZOSA 3MVLA 3SA0A 3QZIA 4RX7A 4B8MA 3PXZA 2B53A 2UVZA 5D1JA 3BGQA 3DFCB 1H1WA 3AG9A 5H8EA 4FSQA 2CN5A 3UYSA 1LUFA 1UU9A 4CFMA 5M57A 1OMWA 2A27A 3QA0A 4JG8A 3F2NA 4NH1A 2OJJA 4PY1A 1PXKA 4QMZA 4TYIA 4W4XA 4Y5QA 4YC3A 5EQEA 4QYYA 3I0QA 4G34A 4HPUE 4MWHA 4BCJA 3FLZA 3KY2A 2RFEA 3VUTA 4UZDA 4RVKA 1ZOHA 3DJ7A 2RKUA 3VRYA 1MRUA 2IVTA 1NVRA 2O5KA 1XH9A 4FTTA 2Y4IC 3IO7A 3JS2A 4TYEA 4FK3A 2G2HA 4QQJA 1KE7A 4U80A 2EU9A 4U9AA 5EW9A 5AAFA 2DUVA 4PWNA 2I0YA 3P23A 3NSZA 4AZWA 3BBTB 4ZLZA 1PHKA 5JFSA 3DKCA 3PXQA 4G17A 4ID7A 2OXDA 1SNXA 2PHKA 4IAZA 4DGNA 3R7YA 3GC7A 5D11A 4UMTA 4ZJJA 3TV6A 4YLKA 5JFXA 2WTKC 3C4CA 3EN4A 4S31A 4E6CA 5A9UA 4BKYA 2BPMA 2XKEA 2FVDA 3Q4TA 2QG5A 2R64A 2OZOA 4UYNA 3HV4A 3OWKA 4C36A 3I1AA 1QL6A 2OSCA 2QOFA 2R9SA 4FUXA 1PXJA 5E8XA 4RIWB 3TZ9A 4ACHA 4CFUA 4MXXA 4CCUA 2WMAA 4RVLA 4V05A 5FRIA 3MY0A 4J96A 4IVDA 3GCUA 4GEOA 5IA1A 3UNKA 2QD9A 4PNKA 4MCVA 4MHAA 4MXCA 3RJCA 1KE5A 3TZMA 4DTBA 4C61A 3AC1A 4EBWA 1YOLA 4YTHA 3Q3BA 3LXLA 2ONLC 4CQEA 4C4IA 1ZXEA 2WO6A 3ZLXA 3ACJA 2X81A 2YDKA 1K3AA 3HUCA 4RLKA 4U3ZA 3UIXA 3R30A 1FOTA 3LCDA 3VS1A 1Q24A 2CNUA 4TYGA 4DBNA 4XG3A 2HOGA 5AP7A 3VHKA 3JVRA 1B38A 3HUBA 2GNJA 3NNXA 1Q99A 3QQKA 4PPBA 5CWZA 4WG5A 4ZXTA 5HO6A 3AT4A 3VUGA 1YHWA 4O27B 4UALA 4YJPA 5CSHA 3UIBA 4UWCA 3TDWA 5EI8A 3U54A 2CLXA 3F3UA 2CGUA 4N57A 3R9RA 4IWOA 3UZTA 3QWJA 4I6QA 4FIGA 1J91A 4KD1A 3HA8A 1WCCA 4UWBA 4EUUA 4QTEA 2X7GA 4PDSA 5IMXA 4JXFA 4R1YA 4C3FA 1U5QA 2ACXA 5KMMA 3UMXA 4ZMFA 3QRUA 4GG7A 2A2AA 2C6OA 3EYGA 2ETRA 2JKKA 2YIYA 5CTPA 3ZBFA 2OZAA 1R0EA 2G2FA 4AOIA 4O7SA 4D1XA 3CTQA 2X4ZA 4ACDA 3P1AA 4K0YA 4RT7A 1DI8A 2YEXA 3P4KA 5FEQA 1GIIA 4U97A 3IK3A 4BCQA 4BCHA 4D2VA 1V0OA 2PE2A 3KB7A 3ZS5A 5CSXA 4DFNA 2QOLA 4Y8DA 1FINA 2XH5A 2QHMA 3LFDA 5IEVA 4RIYA 4NM5A 4O0SA 5ETAA 2G9XA 1Q61A 3KU2A 5A54A 1QPEA 3IOPA 4J8MA 3UQCA 3HMIA 4C35A 5CALA 1H07A 3TIZA 3QU0A 2BR1A 4Z3VA 4KWPA 1KE8A 1SMHA 3WF5A 4NL0A 2YAAA 1I09A 3ZONA 2PVKA 2A19B 4AWIA 3VF8A 2XUUA 2IVUA 5EDPA 4IC8A 3D5XA 3REPA 2RL5A 3DBDA 4K18A 5CU4A 2C5XA 3ELJA 2WMUA 4H36A 4YO6A 1Q5KA 4YLJA 3A7FA 2C0OA 3KULB 3V3VA 4DITA 3NUAA 3IW4A 3RPVA 2WU6A 5AV1A 4P90A 2XVDA 3HDNA 1H0VA 3WOWA 1H08A 3GCVA 3GCQA 3MB7A 5K9IA 4XG7A 5BVNA 3KXHA 5BX0A 4XP3A 5FEEA 4IIRA 4NFMA 3R83A 4FYNA 4FV4A 4ZSGA 2VX1A 1H8FA 1OL1A 2R4BA 3P5KA 2WMTA 4YPDA 4AGWA 3RNIA 4C7TA 2WIHA 2GSFA 4WNPA 5BYYA 3A4PA 2X0GA 4FTRA 4DTAA 3NX8A 2PZPA 2XRUA 4EL9A 3SXRA 1Q8WA 4QP3A 3V5LA 5DR6A 2OK1A 5HCXA 2C1AA 3QD3A 2CKPA 4AP7A 4P2KA 5HQ0A 3VUIA 2C6KA 4FBXA 4RFYA 4I20A 4FGRA 4FV5A 1SVGA 4DTKA 2O3PA 4CZYB 4FL1A 5GHVA 3FV8A 2XBJA 3CLYA 4I0RA 3V5WA 3AC8A 1FVTA 3QD2B 4ASDA 3QL8A 4CMUA 3MFSA 3VUKA 3UGCA 1QPDA 2R3LA 4ZIMA 3Q9YA 5EHOA 4EK3A 4A7CA 4IJ9A 1U4DA 4P5QA 3DB6A 3QTWA 5HEZA 5TF9A 2F4JA 3V04A 4G9CA 3EN7A 1YHVA 3N4UA 5KMOA 1JKLA 4FKWA 4A4LA 5IPJA 3ORPA 3BLHA 4Y5HA 5HVKA 4BCOA 3F7ZA 2X7OA 2W1DA 3C0IA 4FZ7A 2Y7JA 3UOJA 3Q53A 4FKUA 2VTRA 5K0KA 4GFGA 5TO8A 3UC4A 1OGUA 4XCUA 4IB1A 3P86A 3W2QA 1OIRA 2H34A 3WIGA 2PZ5A 3CP9A 4M0ZA 4WO5A 4B4LA 5M4UA 3NUXA 1XH7A 1FGKA 3TV7A 3ZSGA 5KKRB 2P2IA 4WIHA 3BGPA 3TT0A 3LMGA 2OFVA 2PUIA 3FY0A 2FH9A 3QD0A 2Y0AA 4XV9A 3CBLA 3E63A 3GB2A 3PVGA 4OW8A 5AAEA 4Y73A 3JUHA 4FSWA 4AGUA 4PQNA 4U81A 2E2BA 5M51A 5EG3A 3HDMA 5AIRA 4DH8A 1B6CB 1KOAA 3VIDA 3QRKA 4ITJA 4ZZMA 2FA2A 3IGOA 5DR9A 5M4IA 3TWJA 4FX3A 1ZYLA 3BV2A 3LIJA 4JX3A 4ITHA 2GQSA 3GC9A 2CSNA 3AD4A 4J1RA 5HHWA 3DK3A 2C6LA 3LVPA 4WRSA 3QXOA 3FMDA 4LRJA 4HGTA 2GQGA 2VWYA 4V04A 4ZP5A 4C33A 5M56A 3FEGA 3LKMA 2VWBA 5HNBA 3GP0A 4RX9A 3FLSA 2V0DA 1YXVA 2PYWA 4FICA 4JT3A 5HO8A 5IQDA 4Q9SA 2VTNA 5FXSA 3NNWA 1KWPA 3UBDA 2HZIA 2UZDA 4BI2A 4CV9A 5DHJA 1NXKA 4DG0E 3ZLSA 1OITA 1M52A 3DJ6A 1XBAA 3KVWA 1PMEA 3PDTA 1PXMA 2R5TA 3QALE 1VYWA 3MJ1A 3R1YA 2UZUE 5GJGA 2QOKA 1YI4A 2YM7A 3LM5A 5EKNA 5IQCA 1XQZA 1JSUA 1UU8A 2WEVA 1UKHA 4ZY4A 4ZSJA 4C37A 4IM0A 3QFVA 5FDPA 4UWYA 3ENMA 4HGLA 2B55A 2IZTA 2HY81 3OHTA 4G3EA 3TNQB 2F2CB 2IZRA 4F7NA 4IB5A 2X2MA 3NCGA 1FVRA 3BE2A 3R2YA 4LQMA 2ITTA 4LOOA 3PLSA 4L68A 3V01A 2GQRA 4V01A 5E1EA 3CSVA 4IW0A 4XRLA 3PE2A 4I5CA 5CSVA 4NWMA 2IW6A 3UOLA 3KMWA 4FIHA 3TTJA 4RA4A 3LLTA 1ZWSA 1V0BA 3R8MA 5JMSA 5LWNA 3QUEA 5L2SA 5AP2A 4TTHB 3F82A 2ITNA 3ZZWA 3IW6A 4X2FA 5DT0A 4D2RA 3NYXA 4E4LA 5J7HA 1H1PA 3S2PA 2R0IA 1UNLA 1WVWA 2XIKA 3SLSA 3ZXZA 1GOLA 4YC8A 4E5BA 3EJ1A 4BDCA 4RJ5A 5AV0A 4XG8A 3HV6A 2IN6A 4O6LA 3U9NA 2VWZA 2XNPA 3MI9A 4R8QA 5CVGA 4D9TA 5LVMA 1ND4A 5ANIA 4EOLA 3D2KA 4ZAUA 4IEBA 4EQUA 2W9FB 3KVXA 3P7CA 5CSPA 1OL5A 3NYVA 5HBEA 4FNWA 4XX9A 3FZSA 3E87A 3WF6A 4UY9A 1H24A 1PXOA 4R7IA 2XCHA 2ZMDA 3R7IA 4LGDA 3C9WA 4TXCA 1BI8A 3I79A 3NIEA 4ZTSA 3NW6A 3W8QA 4E6AA 4M97A 3OCBA 5A6NA 1H4LA 4A9RA 3MPTA 4GMYA 2AYPA 2GU8A 2OBJA 4O0XA 3G90X 3CR0A 2QU6A 4K8AA 2R3FA 4O1PA 1S9IA 3VO3A 2BZHB 3GOKA 4FKOA 5HX8A 3OWPA 5I9VA 4MKCA 4ZSEA 3UG2A 1KE9A 5IMEA 2WQOA 4Y95A 5J95A 3RALA 3QYWA 4IH8A 3RZBA 3E64A 4EH7A 3RM7A 3GT8A 2JFLA 3MJ2A 4I23A 2VTLA 3C0HA 3VNTA 4DGGA 4E26A 5KMLA 2PK9A 4O0UA 2YZLA 4I5MA 5C27A 3IOKA 2PVRA 3FXZA 4QYGA 3ZC6A 3E8CA 4X2KA 3ZO3A 3OTUA 4ASEA 2XM9A 4F1TA 1YVJA 5IZFA 2GTMA 3COHA 5HORA 4N0SA 3MY5A 4FIFA 4RGJA 2YIXA 4FKIA 4X2JA 2WMSA 4NK9A 3FUPA 2W4JA 4K6ZA 4CG8A 4FT5A 3BU6A 4WSQA 3WF9A 4AGDA 5IH6A 2I0HA 2J51A 4XJ0A 1JAMA 5L2QA 1U5RA 5AUTA 3ZFXA 4BDHA 1AGWA 3CGOA 4DEEA 4I0SA 4FIIA 4QTCA 5IH5A 5GJFA 4PTEA 2YHVA 3DB8A 5DRBA 3LFQA 1WBPA 2GFCA 3BWFA 4XOZA 3GCPA 3V5JA 5IQHA 3QQGA 2X6DA 1XO2B 4U43A 2QLQA 3K5UA 1WMKA 2Y4IB 3VUMA 1UNGA 4X3JA 3HYHA 3BHVA 2X8EA 3TV4A 4YHJA 4WBBB 2BCJA 2B9FA 4II5A 3PVWA 4O0YA 3OROA 4LV8A 4DFUA 3CKWA 5E1SA 4BIDA 5K4JA 4OGRA 4KS8A 5M53A 4NUSA 3DTCA 5B2MA 3LCSA 4L7FA 4IZ7A 1CDKA 2HELA 4Z7GA 3L8XA 4HVHA 5CU2A 5FLFA 4IBMA 4C58A 2E9OA 2Q83A 3FI3A 5CU0A 4DG3E 4K2RA 4YZBA 4EYJA 5CF4A 4TWPA 5DFPA 5AEPA 2I0EA 3DA6A 5IKWA 3P79A 3PP1A 2ZVAA 2XRWA 4ZEGA 3HAVA 2SRCA 2GFSA 3GU5A 5GJDA 2WEIA 4O7NA 4BYIA 4V0GB 2J0MB 5E91A 4BY9E 3CIKA 3NVMB 4NTSA 2CHLA 2GDOA 2F49A 4UYAA 1BX6A 3LQ8A 5ETFA 4R5YA 2NNWB 5EM7A 4W9WA 1YXTA 2BFXA 2ITXA 4RJ3A 3MFTA 4DT8A 3PJ3A 5ACKA 5EYDA 4MQ1A 3MH2A 4M0YA 1GJOA 5AP4A 4K9YA 3WZJA 4AE6A 3ALNA 3BYUA 2C69A 4XUFA 4CXAA 3HZTA 3W10A 1Q97A 3PE1A 3TACA 2ZM4A 3L8SA 3I6UA 4PDPA 4EWQA 4Q2AA 3OC1A 3H10A 3TL8A 4IQ6A 2VZ6A 4QP1A 5GZ9A 5HO7A 3PWDA 4FV6A 5BVDA 3MSSA 3PRFA 5DR2A 3UC3A 2AC5A 3DZOA 3BHTA 2OH4A 3SV0A 4JRNA 5I9UA 2BZIB 4NCTA 4D0XA 4AW2A 4G31A 4DFLA 3D0EA 4YBKA 5EHLA 1NA7A 4L8MA 4E8AA 4I4FA 4HNIA 3KF7A 4FEXA 3SXSA 2W1CA 3COKA 5HE2A 4EUTA 2ERKA 5CAQA 2X8DA 2REIA 1H01A 1PMUA 1PY5A 1HCKA 3DDPA 2VTPA 3A7JA 4MQ2A 1XH4A 3R73A 4XEYA 3R7UA 4E6DA 3C4XA 4YNOA 4I6HA 4XP2A 2B7AA 4AXAA 4E1ZA 2VTQA 2C5NA 2EB3A 2X9FA 4J8NA 4FTIA 4Y46A 3UMWA 5AUUA 2O8YA 3VS3A 3VUDA 3U6HA 3HRFA 3BPRA 4IMYA 5HLPA 4DFBA 4D2WA 5L8JA 3S3IA 2XNEA 4QMMA 4M12A 4KIPA 4FKSA 4EHGA 5KMJA 1ZY4A 2X9EA 1IASA 2WB8A 3A8XA 2KTYA 1U59A 4RSSA 3W55A 3EQDA 4L43A 4TYJA 4YU2A 3FZPA 2WTIA 5I9WA 3RPSA 5IEYA 5HE0A 2I1MA 2IJMA 4LG4A 4AAAA 5FUTA 4S34A 1L8TA 1BMKA 2PVHA 2RF9A 4ANNA 3B2TA 3QD4A 4C4FA 4BC6A 4P4CA 3AQVA 4GSBA 4YJVA 1NT2A 1WZYA 3AMYA 2A4LA 2XKFA 2RG6A 3WIKA 1PXNA 2CN8A 4QMXA 3C4ZA 5CF5A 2VTMA 1GZNA 1OM1A 4MNEB 2OIBA 1GAGA 2UZTA 3NPCA 1BUHA 4HYHA 2UV2A 4I24A 1OKVA 2YM4A 4BICA 4EOSA 1WBWA 5HI2A 5A4CA 1FMOE 3PG3A 3IDBA 5DIAA 4QQCA 3W2OA 2IPXA 5JEBA 5DT4A 4O7WA 3KN6A 3WZDA 2HW6A 4AU8A 5M06A 4OTIA 2OXYA 4XMOA 4ANBA 3I5NA 5HESA 1OPLA 5LJJA 2WMBA 4BTJA 3RWPA 4F64A 4Z16A 2IG7A 4AZTA 4G5PA 5HTIA 5JQ5A 2QI8A 4JI9A 4BDIA 3HMOA 1KE6A 2VTTA 1R39A 1YXUA 2W7XA 3THBA 3QHRA 4FNXA 4X2NA 3RK9A 2QOOA 4OBOA 4F7LA 3AOXA 3PRIA 5B2KA 2LGCA 3EFJA 5CAOA 2A0CX 3ORZA 3R01A 3II5A 1PYEA 3PPZA 4X6RA 3RKBA 3BQRA 1DI9A 3FQSA 3QZFA 4APPA 4F9WA 3U4UA 2OJIA 3W2SA 4O81A 3BX5A 5HTBA 3LFEA 3L8VA 4DBXA 3MIYA 4FSUA 5ACBC 1OIQA 3A4OX 4XNEA 2VTJA 5B7VA 2B1PA 2XIZA 2CLQA 3QQUA 3TEIA 2W4KA 2EXCX 3ZZEA 3DTWA 4BCGA 1R3CA 3DBFA 4YTIA 4BHNA 4NZWB 4IDTA 4EBVA 4CFFA 5J9YA 4QPMA 5KZ0A 3F5UA 2JIVA 4NIFB 2YIRA 3QCSA 4Q5EA 3A2CA 4L42A 2I7QA 3G0FA 2XIYA 3PG1A 3C13A 5AV4A 3Q6WA 5DEWA 3GNIB 4CFXA 1MQBA 3BQCA 1VYZA 3MY1A 4FTLA 3COMA 3ITZA 3O23A 4JBQA 4L3PA 5JSMA 4QMQA 1XHAA 2XS0A 3CQUA 4U41A 4XV3A 4ASZA 4AT4A 3WARA 1IEPA 2WHBA 4G2FA 1IAJA 3R8LA 2XNGA 1Q4LA 3F3VA 2Y6MA 2VV9A 3GFWA 1VJYA 4WRGA 5I3OA 2GS2A 4EI4A 5JGDA 4KKGA 3HKOA 3R7EA 2DWBA 4I0TA 2VO0A 3QZGA 3TG1A 4JAJA 3HMNA 4UBAA 4C2VA 5C1QB 4R6VA 4OR5A 4CG9A 3POOA 4M66A 3R00A 1UU7A 3ZH8A 4EZ7A 4RBLA 4W8DA 2YCSA 4ANQA 4C4EA 5CQUA 4QP4A 3R0TA 1URCA 5C03A 4C57A 5A14A 1U54A 4OTGA 3CXWA 5K0XA 4FSRA 4AA5A 3CCNA 3QBNA 2JKQA 2YABA 3QA8A 2RG5A 5BVEA 3FE3A 2ZV7A 4AFJA 5M08A 1W98A 3EHAA 4XLIA 3V51A 3DKGA 4L3JA 4CFWA 2WPAA 3NNUA 4RC4A 3NS9A 5J5SA 4WHZA 3HMPA 2J9MA 1YDSE 3ZRMA 3C1XA 4H3PA 5JK3A 2FO0A 4DA5A 1ZLTA 3QUDA 4MBIA 4F70A 3U6JA 1F0QA 3C50A 4DH3A 5AP6A 4FTNA 3E93A 4J53A 4O2PA 3GU4A 4BCNA 4BIEA 2OLCA 4QTAA 5AUXA 2BHHA 4OBQA 4M7IA 4EH2A 3A60A 1LPUA 4YBJA 5A4EA 4MF1A 5L4QA 3O51A 4Y85A 1ZYDA 1FPUA 2PL0A 5AIKA 4BBEA 3HVCA 3Q96A 5A4LA 5HU3A 5EYCA 4C62A 5CANA 4KIKA 5C8KA 2R3IA 5CLPA 5EI2A 2EB2A 3F69A 5K5NA 2XMYA 4DCEA 1KV1A 3H9RA 4BGGA 2FSTX 5JFWA 2GCDA 3AC5A 4YJTA 1SZMA 3OEZA 3JXWA 4IWDA 3G5DA 3WBLA 1WBSA 4YZMA 4CTCA 3ZRLA 1EH4A 4O91A 4RWJA 3OTVA 3EKNA 1PRYA 1FGIA 5EQYA 4BGQA 4KIKB 1RJBA 3OEFX 4FG9A 3R8PA 2VTHA 4EOPA 3BBWA 1DAWA 5FTGA 1LEZA 4D4YA 4ENXA 5M07A 5CX9A 3NZ0A 4R7BA 3AGMA 1O6LA 4PL5A 4BCKA 4L67A 4E5WA 4PP7A 4KAOA 3QAME 3W16A 4C02A 5IQGA 4XG6A 3CKXA 4KNBA 2J50A 5AUYA 5FTOA 4AW5A 3QQHA 3TN8A 4ONAA 3WZUA 1ZAOA 1GIHA 5HVYA 4WUAA 1ZZLA 4CMOA 5EHYA 3K3IA 3L1SA 5GNKA 3HAMA 1JKSA 3G15A 3H9OA 2WU7A 2JITA 5HVJA 4Y72A 4O0RA 3PY0A 2Z02A 2V5QA 4DLIA 4JQ8A 1B39A 4CKIA 4R5SA 1ZOEA 2WTDA 2FYSA 4S33A 4F08A 3DJ5A 4ORKA 2V62A 2C1BA 2XIXA 1XBCA 3R22A 1WBOA 2CGVA 4L44A 2HZ4A 3C4EA 4W4WA 2JGZA 3VWAA 4EQMA 3PWYA 4BZDA 4QYFA 3CJFA 3KL8A 3VHEA 2J5EA 4YPSA 3G9NA 4FV3A 3SRVA 2ERZE 4GFOA 5HE3A 3ZTXA 4EHVA 5IQBA 4ZS4A 4U7ZA 3O17A 5E8SA 2FSMX 2XK3A 4KBCA 3VC4A 5IQEA 4CTBA 1L3RE 2XF0A 2HCKA 3M11A 4QP6A 3SVVA 3OXTA 4ERKA 5KX8A 3CS9A 4YUQA 2GNHA 2W1HA 3ZU7A 2ZV8A 4EJ7A 2BZJA 2V7AA 3E7VA 4ZSLA 4DC2A 3RM6A 1DM2A 3GQLA 4OT5A 2EXEA 1JBPE 5FDXA 5ITAA 5AR8A 3C5UA 3KRWA 1E9HA 4GW8A 3W2PA 2J0JA 3SG8A 2BROA 5CEPA 2CGXA 4FT9A 4RZVA 5DG5A 5LVOA 2F7EE 2W5AA 3AT2A 4HVSA 2NO3A 5A4QA 3MTFA 5D12A 4C59A 3TUBA 3IONA 5C26A 5J5TA 5J87A 3MH3A 3EQCA 4EJNA 4W4VA 5I9YA 4JQEA 1CSNA 3KEXA 3W32A 4FG7A 3FLQA 3QYZA 4WBOA 4FKVA 1OB3A 3RPRA 5FG8A 3LCTA 3W33A 3KRJA 4IAIA 4C34A 3RCJA 5CU3A 4G9RA 4W4YA 4FUYA 4MVFA 3BHHA 1AD5A 3DBEA 3MPMA 3CD8A 1OI9A 3OG7A 4MWIA 5AJQA 4OTRA 3U4WA 2ZOQA 1W0XC 3NR9A 2W9ZB 3HV7A 2GHMA 1URWA 2JDSA 5FBNC 2ITOA 4MNFA 4AZFA 3AD6A 1UWJA 2QOQA 4EORA 2CKQA 5IA3A 3TDVA 2QR7A 2QO7A 2JKMA 2VTSA 4FIEA 4FK6A 4IDVA 2CDZA 2VU3A 5KBQA 2YWVA 5JGBA 2GHGA 5ANGA 5F94A 3D83A 3JR1A 4OTFA 1P5EA 3NDMA 5FGKA 4FNZA 4ALVA 3WI6A 4TWCA 5T68A 5LVPA 4PP9A 2VWVA 3C7QA 3WE4A 5EYMA 4L9IA 4HGSA 3ZDUA 2WMQA 3ZSHA 2BAKA 5AP3A 3CTHA 3C5IA 2XZSA 4OLIA 4YTFA 2C3LA 3BEAA 3SKCA 4TYHB 3DCVA 1OKZA 4IX5A 4Q5HA 2YITA 4IX3A 4DEIA 3ACKA 4BWKA 5JKGA 1X8BA 2PVFA 4GFMA 5BMMA 5AA8A 5IH4A 1PF8A 4WA9A 2HYYA 3UOKA 3OOGA 4DT9A 2XJ0A 3UOHA 5BQ0A 2WKMA 1OECA 2WQBA 4JG7A 4NTTA 4G3FA 2JKOA 4PMSA 2NP8A 3ODZX 3UO6A 4IVAA 5HBHA 3KXNA 4BCIA 1APME 3SDJA 4RFMA 4ANOA 3WYYA 4F63A 2NRYA 5L8KA 2YIWA 3EQFA 3VVHA 3FC1X 3NMUF 3DS6A 4RIOA 2E9PA 2HZ0A 3HV5A 4H39A 4EYMA 3H4JA 5CVFA 2Q0NA 4CMTA 4U45A 2GNGA 2QG7A 2C5VA 4AT5A 5IUIA 2O63A 4R78A 5BPYA 2BIKB 2PE0A 2E9NA 2IZUA 2UW3A 3D14A 2YM5A 2QO2A 1IG1A 5FP6A 3EQRA 5AWMA 1MUOA 2W1FA 4IX6A 4AX8A 3C0GA 3JY0A 4UN0C 3BI6A 4F99A 3UTOA 4ACCA 3BYOA 5AP5A 2ITWA 1UVRA 4HOKA 5FD2A 4XH6A 4O7TA 3JPVA 5H9BA 3FKOA 4APCA 4FYOA 4RG0A 3ZUVA 5CZHA 4PDOA 2VO3A 4GG5A 3RNYA 4ZMEA 4TPTA 3Q32A 1HOWA 2PMIA 1O9UA 4JLCA 1WVYA 4YP8A 3S0OA 2PU8A 3EYHA 2W17A 4R3PA 2C6EA 2YM6A 3LXPA 3NGAA 3DXQA 3I5ZA 3DU8A 4L01A 4XOYA 1PYXA 2VO6A 5JRSA 3ZEPA 1OKYA 4X3FB 3ZYAA 2BILB 4C3PA 1PKDA 3BELA 2J2IB 2XKDA 4JBPA 4D0WA 4HYUA 4XV1A 3G6HA 4XHKB 4G5JA 4NT4A 4FMQA 4DGOA 1JNKA 3FMHA 3HNGA 2WZJA 4IAKA 3HL7A 4DEBA 3PLAE 2OKRA 3L9NA 3BLRA 3N51A 5CAPA 2NPQA 4LV5A 3FXXA 4KS7A 5AX3A 4O38A 3V6RA 5BUIA 4YLLA 1AQ1A 2B4SB 4FTCA 3LJ2A 4IB0A 4RVMA 2CGWA 3NLBA 4AA0A 4BHZA 5EYKA 5CEKA 2OF2A 3R8VA 3L9MA 5JH6A 4IE9A 4MD9E 3EOCA 4ZTQA 4BKZA 4XBUA 2J0LA 3QRJA 3DFAA 5LCJA 4BR3A 1QPJA 3DQXA 5HIEA 3FMKA 1W82A 2Y4PA 2XYNA 1YW2A 3E7OA 2QKWB 3FXWA 2JDVA 3KXGA 3PIXA 3BZ3A 4FOBA 4X2GA 3HLLA 4E73A 3OT8A 5K4IA 4RRVA 4FV8A 4S30A 4CNHA 1CKIA 2FSLX 4D1ZA 3GU7A 4GT3A 4OAVB 3VS4A 3DNEA 2CCIA 4G6OA 4QMWA 1A9UA 4FEQA 2P3GX 3QKMA 3R2BA 3AGLA 5AR3A 3D2IA 5HZNA 5EM6A 2J0KA 3BKBA 2XA4A 3PYYA 2BRBA 2YJSA 4ANMA 4KUJA 4C3RA 4MXAA 4YGAA 3P08A 4OT6A 1W7HA 5D9HA 2E9UA 4PTGA 3UYTA 2VX3A 3KRLA 3KGAA 4GJ2A 3OD6X 4KRDA 5FM3A 2BTRA 4JRVA 5D7AA 1XH5A 2UUEA 3G0EA 3UODA 3OW3A 2H9VA 1PXPA 2BDJA 4KABA 1OL7A 4USDA 5KBRA 3G33A 5EK7A 3GC0A 4IXPA 3EKKA 4GS6A 3VN9A 5TKDA 4FV1A 4M67A 5CNNA 3SW7A 5AV2A 3IW8A 2J6MA 3LJ0A 5IQAA 2OZAB 4BDJA 2QOCA 4FT3A 4TN6A 1P4OA 3ZO4A 4FR4A 3FJQE 3EB0A 3R9NA 3UPZA 4JDIA 5L8LA 3IDCA 3OXIA 4AW1A 4X0MA 3QGYA 3MFUA 3PFQA 2QCSA 4QMTA 4ZLOA 5HTCA 3SW4A 5BYLA 4HNFA 3GGFA 3Q4ZA 2GHLA 4HYSA 3O50A 4CKRA 2XJ2A 3IG7A 3NWWA 1UA2A 4FNYA 2ITUA 3UG1A 1S9JA 2HXQA 4O96A 3R21A 3GVUA 3GCSA 3VBXA 3ORLA 2YWPA 3DNDA 2FSOX 3L9PA 4EH5A 2OI4X 2WOTA 4H58A 3RMFA 1CMKE 2B52A 4J7BA 4BZNA 2WMXA 3Q5ZA 4FGBA 4WUNA 1XH6A 4EH4A 5E4HA 3ODYX 1OVEA 4GKHA 3DKFA 3G6GA 3PSCA 2C6DA 3OCSA 5LCKA 3FI2A 4IZYA 3V8SA 5IQFA 4FL2A 4O7RA 2JEDA 5BUEA 3I7CA 3F5PA 4E4MA 2QC6A 4TY1A 4BL1A 3F61A 1H25A 3D9VA 4OTQA 2JAVA 2PTKA 2UW8A 1OBGA 4F7SA 4EHEA 3LJ1A 3ZLYA 3MBLA 1ZRZA 4QTDA 4GK4A 4J52A 5CXHA 3COIA 5AUVA 4O0TA 5FXQA 4LGGA 4EWHA 4F9YA 4EOQA 1G3NA 1LEWA 4O7LA 3JY9A 4N6ZA 1H1QA 4S32A 2V7OA 3VF9A 4O83A 4XG4A 2PSQA 3A7HA 3LXKA 3DOGA 3OS3A 3DBQA 4FVPA 4TRLA 5HD7A 2CKEA 3VRZA 3D5VA 3P78A 4GJ3A 4P7EA 3FQEA 3VBTA 3NAYA 4KBAA 3E3BX 4GVAA 5DWRA 3F2RA 4FKQA 3QF9A 1YQJA 3OW4A 3PUPA 5AR4A 5J1WA 4HCTA 2C5OA 2ZDUA 1FBNA 3TNWA 2PVYA 3FYKX 4ZSAA 3BU3A 4RQVA 3ORKA 4JOAA 3ET7A 5HLWA 3A61A 4IAAA 1H1RA 4EK6A 2PPQA 3ZO1A 4FVRA 2Z7RA 5IUGA 3VJOA 2YA9A 2ZAZA 4YMJA 5JQ8A 5C8MA 4IZAA 2JBOA 4ANLA 3BE9A 5IISA 3ETAA 4XV2A 1E1XA 2W1EA 4FZAB 2GNFA 4RA5A 5H8BA 1U46A 2RFNA 3FSFA 3B8RA 2BIYA 5LVNA 2UZVA 2VGPA 5AP1A 3H9FA 3MFRA 4OTWA 1M7QA 3TNHA 2BRMA 3NUPA 4L46A 4MYGA 1FVVA 4RX8A 3OBJA 4TL0A 3QC4A 1GNGA 1GZ8A 2R2PA 4GUEA 4JIKA 4LMUA 4MBLA 4K77A 2C47A 4YC6A 4RJ4A 2P0CA 3DAJA 3DLZA 3B8QA 3OT3A 5DEYA 3ANQA 5TR6A 3RK7A 3EQPA 4XG2A 4QMNA 4BI0A 3C51A 4M68A 3ORXA 1LR4A 4P5ZA 3FLYA 3BWJA 5KMNA 2J5FA 2QKRA 2XEYA 4GCJA 5E8ZA 4LUEA 4RC3A 1DS5A 5D7VA 2UW9A 5B0XA 4IADA 2CCHA 4KSPA 2O2UA 3BGZA 2VUWA 5BMSA 2IWIA 4IVCA 3LAUA 3MIAA 5CENA 4TZRA 2OF4A 2EWAA 5IQIA 2PMLX 2G2IA 2Z7SA 2JD5A 2BFYA 2VD5A 5T3QA 4AACA 5CZIA 4AE9A 4NSTA 3C4FA 3HEGA 3MN3A 3FHIA 1WBVA 1YOMA 1V0PA 3OVVA 4OTPA 3MS9A 4PPAA 4NKSA 3L9LA 2G01A 3UIMA 4AGCA 2O0UA 1Q3DA 4ASXA 3O0GA 4IWPA 1ZYJA 1KV2A 5G6VA 3PA5A 4PX6A 3PY1A 4FTUA 1T46A 4MD8E 4IFCA 2A1AB 3DXPA 5CT7A 2IVVA 5DPVA 5E8TA 2OICA 4OTDA 3RCDA 4BBFA 3LMHA 2PVMA 4JG6A 2OIDA 3RZFA 4JDJA 4FTAA 3D4QA 4AOTA 5K3YA 3GENA 1JOWB 2ZB1A 3MH0A 1F5QA 3MA3A 4YZCA 2GNIA 2AC3A 4LM5A 4OBPA 1PJKA 3O7LD 4A4OA 1P14A 4O82A 2PWLA 1Q8YA 4EC8A 4D5KA 5IUHA 2C3JA 4YZNA 3GQIA 4OAUC 4MNEA 4ACMA 1MRVA 3ENHA 5HCZA 1Y91A 5M4FA 4JR7A 5CT0A 4NJDA 4X7QA 3UZPA 5C8NA 2W96B 3LFBA 5I3RA 3FMNA 3PIZA 3FZ1A 4H1MA 5JZNA 5FM2A 1VZOA 4WSYA 5BNJA 2G15A 2PY3A 4ZJVA 5L2WA 4QMLA 3TJDA 3F5GA 1OIUA 1P4FA 3GC8A 4X3FA 2H8HA 3LLAA 4HPTE 4BZOA 4I5HA 3PJ1A 3NYNA 3EH9A 3KQ7A 5ANOA 4O0WA 4J71A 5KCVA 4A9TA 3MYGA 4YURA 3QXPA 4CVAA 3QWKA 3HECA 4HYIA 2R3MA 2QNJA 3R04A 4IWQA 3RHKA 2WMRA 4PUZA 4FTQA 5A6OA 1IA9A 3PVBA 2WQMA 5E90A 4ZS0A 3KRRA 3UO4A 3PXKA 2LAVA 3RVGA 4FTOA 5I5ZA 4GRBA 2R0UA 3KC3A 3A7IA 3AD5A 4FL3A 3NVKI 4CCBA 1YDRE 4PMTA 5KO1A 1RW8A 4JR3A 4M8TA 3R1QA 4FVQA 4FV2A 2B9JA 5CNOA 3ULIA 2R3NA 3PY3A 4DFYA 1RE8A 2YCFA 3CC6A 4NM3A 5IA5A 3A7GA 4NM0A 2H6DA 4JNWA 2FGIA 2VWUA 4MX9A 5CEIA 4Y83A 4M13A 4XS2A 3E8EA 4YJSA 4D1SA 2RFDA 3QX4A 3F2AA 3V8TA 4NFNA 1SVHA 4PV0A 3DAKA 4JDKA 1PW2A 4RVTA 2CKOA 3RINA 4QP2A 4PPCA 4RLLA 1HCLA 4UXQA 5KZIA 4EH6A 5LQFA 5DYJA 4RC2A 3A8WA 1JPAA 3OBGA 2C68A 2VGOA 5T6KA 3R63A 4CYIA 4B6LA 4B9DA 3D94A 4J95A 5J9LA 3DY7A 3H3CA 1XR1A 1PMNA 1MQ4A 3ZUUA 4A4XA 3QCXA 4EONA 3NYOA 2WMWA 4B99A 5HD4A 1BYGA 3V6SA 2X2KA 4J97A 3PZEA 4HCVA 4DEAA 3FYJX 3VS6A 4E5AX 4ZTNA 1M17A 4X6QC 2HW7A 1XWSA 1WFCA 3FMEA 3PSBA 4QMVA 3FSKA 2NRUA 3CE3A 4NEUA 1R0PA 3EN6A 4NIFA 3KMUA 1JKTA 3QRIA 2XK8A 1A48A 1ZZ2A 4FEWA 3EN5A 3MPAA 4FC0A 2CJMA 3CTJA 5I0BA 4FSMA 1UWHA 4TWNA 5EOLA 3SRVB 3U51A 3NEWA 4RIYB 3UDBA 2UZOA 3KA0A 1BI7A 4ZJIA 2R7IA 4WNKA 2YZAA 3Q5IA 1Y8YA 4O84A 4F6UA 4C4GA 4UX9A 3BIZA 3QC9A 4XP0A 4USEA 4TNDA 3ATTA 3QTQA 2UW6A 1YOJA 2YLEA 2XNOA 3Q9WA 3QQLA 2X6EA 3M1SA 3LW0A 3F3TA 2HWPA 5ANEA 3W18A 2C3KA 4F0FA 3F66A 3ZBXA 3MV5A 4FKRA 2HZNA 3GU6A 4GU6A 5DA3A 3D7ZA 2W99B 4Z9LA 2XK4A 3FZTA 5E8WA 4BWXA 3EIDA 4D58A 4HVGA 4RFZA 5DRDA 3R6XA 4TT7A 5CS6A 1O6KA 4M69B 1REKA 3FI8A 2PZYA 4S2ZA 2F9GA 3QTSA 4IAFA 4AT3A 4BCPA 1XBBA 4WD5A 1Y8GA 2YDIA 4JX7A 3K3JA 4NM7A 2BRHA 5TE0A 2PMNX 4JDHA 4RPVA 3N4TA 4ZTRA 2XEZA 4MAOA 4D2TA 4DFXE 3NNVA 2QOBA 2O64A 3I60A 4FV9A 4KIOA 3TZ7A 3WF8A 2YLFA 3R02A 3ERKA 1UNHA 2XB7A 4BVUA 1ATPE 4CLJA 4QMOA 1XJDA 1JVPP 3FMMA 3QHWA 3RP9A 4UMQA 3TKHA 1U54B 3ZLWA 2BAJA 2G1TA 3I7BA 5CY3A 4FZDB 5AA9A 2W05A 1ZMUA 3FPQA 3SG9A 2R3QA 3V5PA 3CGFA 4HZRA 2YCRA 1PKGA 5GZ8A 1IAHA 2OGVA 3SX9A 3FPMA 2VAGA 5CYIA 4I6FA 4LYNA 4UZHA 4O1OA 4F0GA 2YISA 1CKPA 3MWUA 4R7HA 2FUMA 1BL6A 4DCAA 4BGHA 5FXRA 1R1WA 5EQPA 1IRKA 3HRBA 4C2WA 4TW9A 3TKUA 4L52A 3ZHPC 3NUYA 4IHPA 5DMZA 2QOHA 3AMBA 3RAHA 1J7LA 4EH9A 2VNWA 3FKNA 3HA6A 2VNYA 4DEGA 1SYKA 5LOHA 4CT1A 4DH1A 4U40A 4QYEA 4AN3A 4E20A 3TNIA 4F7JA 2C30A 1ZY5A 1M2QA 4RMZA 4I22A 4FODA 5IDNA 5CF6A 2R3PA 1BKXA 2WIPA 4PRJA 5J8IA 4HVDA 5JGAA 4FKJA 2HK5A 3NRMA 3CQEA 4FKPA 4HZSA 2WFYA 3LXNA 3QX2A 3S4QA 2B0QA 5F1ZA 3DK7A 3NW5A 2H96A 5ANKA 5BUJA 1OUYA 3U6IA 1KOBA 5CXZA 5L2IA 1R78A 3R7VA 3PXFA 5EM5A 4RQKA 5HKMA 2DS1A 3VW6A 3D7TB 5EH0A 1MP8A 1YI6A 3I0OA 2YDJA 4BI1A 3LFCA 4E3CA 4G1WA 4KIQA 3R7OA 2BMCA 2JFMA 4BBMA 4EZ5A 3Q2MA 4E4NA 4EKKA 2Q0BA 2FB8A 2HAKA 3RAWA 4DINA 4YO4A 4YSJA 5IG1A 2UZNA 2HIWA 5AUWA 2OG8A 3FL4A 2ZYBA 4YZDA 3P7AA 3OOMA 3T9TA 2WTJA 3QLGA 3QQJA 5LMAA 4ACGA 2YERA 3RK5A 1J3HA 2OIQA 3MVJA 5FQDC 4ALUA 3PTGA 3N4VA 4EOKA 2OFUA 2R3KA 4HGEA 3S00A 3ZM9A 1GZKA 4ZTHA 4A9SA 4CRSA 4ITIA 1A06A 5CAUA 1OZ1A 2J0IA 3QUPA 1REJA 3D5UA 4GV1A 4FA2A 1VR2A 3ZRKA 3ULZA 2F7XE 2HXLA 5HNIX 4DN5A 2CNQA 2PMOX 4LRKA 3TI1A 2YACA 2Z8CA 4RJ8A 4BDEA 1K2PA 4ARKA 5CEQA 4F6WA 5E9EA 4DH5A 3EZRA 3WYXA 3OZ6A 3NAXA 3Q4CA 1NY3A 3P7BA 3FMLA 3CQWA 3SOAA 3GEQA 2WQEA 2VO7A 3I81A 3EL8A 2R7BA 4BF2A 4H1JA 4EOMA 3PIYA 3O8TA 2PUUA 3R1NA 4QYHA 4EHZA 4F0IA 3N9XA 4C4HA 4D5HA 3PA4A 2RGPA 1LP4A 2WTKB 4X3FC 3FDNA 3MH1A 3OUNB 1YKRA 4I94A 3MTLA 3MDYA 2XM8A 3FWQA 4WKQA 5EDQA 1J7UA 5AM6A 1TQIA 3TIYA 5JT2A 2WD1A 3UQFA 1P2AA 4RWKA 4O86A 3TXOA 4QRCA 2QR8A 1ERKA 4XG9A 4FSTA 4LOQA 3ATSA 1WBTA 4PNIA 2V22A 4FKTA 2YFXA 5C01A 4JL9A 3ZMMA 3SGCA 4DHFA 3ZC5A 5J79A 3SOCA 4F65A 4FSYA 3RPOA 1SM2A 2I40A 4PL3A 4Z7HA 3KMMA 4J98A 5LMBA 2VTIA 3BYMA 3ZFYA 3OMVA 2IVSA 3U8WA 2EVAA 5GZAA 1KSWA 4JBVA 2WQNA 3R9HA 3UP2A 1JSTA 4AF3A 4OUCA 5A3XA 3VUHA 4NKAA 4DGMA 3Q9ZA 3PXYA 4YNEA 5I9ZA 4O21A 5AR5A 3EZVA 4U44A 3EQGA 1I44A 1F3MC 3OP5A 1NVSA 4U79A 5LARA 3T9IA 4F6SA 5M44A 4PDYA 2HENA 3W1FA 1OKWA 2B54A 1E1VA 2ESMA 3E92A 3E62A 2ITZA 4U6RA 3V5QA 4GIHA 4WG4A 3Q4UA 4C0TA 3QKLA 4AUAA 4CV8A 4EEVA 4NU1A 3ZM4A 4NYEA 1FMKA 3QTIA 3QCYA 5FTQA 4KINA 3U87A 4AS0A 4NJ3A 5AMNA 3TNPC 3RAIA 4FKGA 3VULA 3TKIA 2AUHA 1YXSA 3P0MA 3SHEA 3EQBA 5CAVA 5BVOA 3LMIA 4IX4A 1RQQA 1PMVA 3LHJA 3VBQA 4E4XA 4MXOA 4G3GA 1TKIA 5EFQA 2BRNA 5E8VA 1IA8A 1V1KA 4EOJA 4QPAA 3AT3A 2R3GA 4CFNA 3DXNA 5HE1A 4F9AA 1YWVA 2ZDTA 3PJ8A 1OIYA 2JC6A 3LFAA 5LVLA 2B9IA 4NCTC 4ZOGA 5F9EA 4YZ9A 4FTKA 4CZTA 1YRPA 4BDBA 4ZZNA 1CM8A 5KMIA 2X1NA 4L7SA 5AADA 3O2MA 3UPXA 5M4CA 4AN9A 5EW3A 5B2LA 4I93A 4DLJA 4DYMA 1CKJA 4RZWA 3LE6A 1M2PA 2VN9A 3KCKA 5DLSA 1OBDA 2C5YA 3ORIA 4M3QA 4IM3A 4CSVA 4O7ZA 5L6PA 4KRCA 3F7WA 2W1ZA 3POZA 4F09A 3IS5A 1Z5MA 4AN2A 3EFWA 4FTMA 3FL5A 4WG3A 4BDGA 3T8OA 3KREA 5KNJA 2PZIA 2J90A 3GXLA 3MVMA 4QO9A 4IAYA 2PVLA 1GZOA 4MEDA 1Z9XA 5GINE 4YJQA 2DQ7X 2JDOA 4U5JA 1K9AA 5IDPA 4AOJA 3HX4A 4AZSA 4DEHA 3PPJA 2XP2A 4L45A 4F1OA 5HU9A 2W06A 4LMNA 3NUNA 4PL4A 5DOSA 2BDWA 4GT4A 3ZEWA 2Y9QA 3SXFA 1QPCA 3MGYA 2UW0A 4FZFB 4NW5A 4G6NA 4KA3A 5E7RA 1TQPA 4I3ZA 4IJPA 2EXMA 4ZY6A 3ROYA 3Q52A 3R8UA 4BTFA 4EKLA 5LWMA 2ITYA 5J7BA 1J1BA 3NIZA 4EK5A 3H0ZA 1XH8A 3DV3A 3IKAA 1NVQA 3UP7A 3ORTA 4JIAA 2VTAA 4GK2A 5DBXA 5EI6A 3DK6A 4ANSA 2P2HA 3FMJA 2QHNA 3BHYA 4GYIA 5BYZA 3VBVA 1M2RA 4QMPA 3ORMA 5KHWA 3Q9XA 2ZV2A 2HY0A 4O0VA 2WGJA 3L8PA 3GFEA 3KKVA 3O71A 3ZFMA 3T3VA 4BYJA 4ZTMA 2J4ZA 3ZDIA 2ETKA 3P9JA 4JAIA 3QTUA 2GS7A 4EH3A 4XBRA 4QMUA 2F57A 4QOXA 2ZB0A 5ICPA 4CGAA 4N4SA 5A46A 3DKOA 4B0GA 2VRXA 4BFMA 2XYUA 4YJNA 5C4LA 5E92A 2WOUA 3UVRA 4GL9A 4CT2A 3T3UA 5K5XA 3R71A 3F88A 3FLWA 4BKJA 4QP8A 2F2UA 4RJ7A 5HBJA 5F20A 4EOOA 3MA6A 2PUPA 4A9YA 2VWIA 1OUKA 4D4VA 1WBNA 3OXZA 4RX5A 3R8ZA 5CF8A 3PJ2A 4E7WA 2P4IA 3RTPA 4M84A 4QPSA 2XK6A 3QLFA 4BTKA 2XK9A 2WXVA 2C0TA 2QLUA 4QP7A 2PULA 4BIBA 3OWJA 3FBVA 5DT3A 5CEOA 2W4OA 4IACA 5ETCA 4BCFA 2CNVA 2CPKE 2UZLA 4CYJA 1QCFA 3GUBA 3O8UA 2PE1A 3FAAA 5BVKA 4E6QA 4IC7A 4QNAA 2W1IA 4DAWA 1Q8ZA 3DBCA 3PA3A 2VTOA 4L53A 5EW8A 1WVXA 4TYHA 3ROCA 3TZ8A 4U8ZA 3BU5A 4QMSA 4FF8A 1RDQE 3BEGA 3OUKA 4TNBA 1FQ1B 3DAEA 1BL7A 3E88A 5AP0A 4B7TA 3O96A 3CJGA 4CEGA 1W83A 3AC3A 1YWNA 5TT7A 4GUBA 4BB4A 2C4GA 1ZOGA 3DGKA 3OF0A 2O65A 3M42A 3QQFA 1JWHA 4FOCA 1QMZA 2BZKB 1W84A 4LOPA 1Y6BA 4QNYA 4GIIA 3VW8A 4C38A 3FKLA 1Q62A 3CY3A 2WTVA 2VX0A 4K11A 3PVUA 4J99A 3KXZA 5H2UA 2P55A 1OPKA 1IR3A 3EWHA 4AA4A 4I6BA 3CD3A 3SD0A 4UEUA 3BLQA 2DYLA 2C6MA 3PPKA 1Y57A 3RWQA 2OW3A 3IPHA 3VBYA 5EOBA 4FG8A 2I6LA 3G51A 3TTIA 2BRGA 3DLSA 5GIOE 3KRXA 2I0VA 2ZV9A 4KKHA 4XLVA 4KKEA 4RIWA 2ZM3A 3LQ5A 3V8WA 4FZ6A 5DN3A 2UZWE 1VEBA 3NW7A 5CU6A 1ZMWA 4D55A 4BCMA 3GOPA 1DAYA 3LFNA 2X8IA 3HP2A 3FHRA 3QCQA 1UV5A 3K54A 4GH2A 1XKKA 3KF4A 3E8NA 3KXXA 5DI1A 2Y8OA 4QTBA 2ETMA 2UZBA 2R3RA 5EKOA 4PMPA 2JAMA 4YR8A 4N70A 4IB3A 2BAQA 4F9CA 3A99A 1H28A 2OU7A 2V55A 3EQIA 3G2FA 3MB6A 5M55A 3UE4A 4JQ7A 2WELA 3UNJA 1BLXA 3E8DA 2BALA 5HOAA 4ZK5A 5DVRA 2Z60A 4XYFA 5I9XA 1H1SA 2WTWA 1JQHA 4R1VA 1YXXA 2C0IA 5IA2A 4BN1A 5C9CA 1M14A 4RJ6A 4DG2E 3OY1A 3LZBA 3DQWA 2UW4A 4CLIA 5ETIA 2IW9A 4AZVA 4R3CA 2C3IB 3IDPA 4FV0A 4B8LA 2ITVA 1W8CA 2JIUA 4X21A 3MVHA 3WE8A 4AQCA 4BDFA 5JRQA 4H05A 3LCKA 3D15A 5CASA 5DE2A 1M7NA 2GPHA 2UVXA 4RIXA 3CPBA 3F9NA 3VJNA 3Q6UA 4FSNA 5EDRA 3WZKA 4QQ5A 2GNLA 4H3QA 5JFVA 3IW7A 4MF0A 3MESA 4U3YA 4CD0A 4FSZA 4YHFA 2IZSA 1OL2A 3H0YA 3FC2A 2QOIA 4I5PA 5HG9A 1JSVA 3I6WA 5CSWA 4BTMA 5M09A 2R3JA 3BRBA 5D10A 4I92A 2YAKA 5HLNA 3ALOA 3H30A 3F3ZA 1ZARA 3RGFA 3KN5A 3LCOA 3OCGA 3ZCLA 1H26A 2X2LA 4G3DA 3KK8A 4A06A 3CY2A 5FEDA 3VQHA 4BDKA 4DF3A 2ONLA 4O2ZA 5ANDA 5KKRC 4USFA 4GK3A 4MBJA 1G8SA 4MTAA 4DH7A 3KK9A 4I21A 5CEMA 3CPCA 4K1BA 3IGGA 3IECA 1JKKA 4QT1A 3HP5A 2QVSE 4A07A 3GU8A 3R9OA 2X4FA 3M2WA 1TVOA 5AV3A 5F95A 4FKLA 3BYSA 2JDTA 4GU9A 3F3WA 1YWRA 2UVYA 4O6EA 4U42A 4W8EA 4AW0A 4D4RA 5TOZA 4UMUA 4FTJA 3E3PA 3LQ3A 3D7TA 3QTRA 4L3LA 4M14A 1WAKA 4RWLA 5ANJA 3GI3A 4DE4A 2ZM1A 3U9CA 4UXLA 5L2TA 1KUTA 2GMXA 4F1MA 4HVIA 2VWXA 2XCKA 3PZHA 3LPBA 1STCE 4G16A 1ZYSA 3AC4A 5AR7A 2J7TA 2OO8X 4UV0A 4FEUA 4EH8A 3C4WA 4IM2A 4LUDA 3VS2A 4FIJA 4PTCA 2W1GA 3EN9A 1J7IA 4BWPA 1Q8UA 3HV3A 5CI6A 3HRCA 4MD7E 3UIUA 2C6TA 4MH7A 4R3RA 3BYVA 4C8BA 3AC2A 3DZQA 4I41A 4UB7A 5L3AA 2ITPA 3R9DA 4F4PA 2QO9A 5HG8A 3LFFA 3QRTA 2XJ1A 1NW1A 4MK0A 3SC1A 3CEKA 2PZRA 3RBWA 4HCUA 4O7YA 2UW7A 5HNGA 5FWKK 2RSVA 4EC9A 4WOVA 5DH3A 4GT5A 4YJOA 4KBKA 4MXZA 2XK7A 4CZUA 3B2WA 3FY2A 1OPJA 2WAJA 3O8PA 4FV7A 5F4NA 5C4KA 4D4SA 2GS6A 2BUJA 4D28A 2Y6OA 5HG7A 5CVHA 4W9XA 1TQMA 4U0IA 1GIJA 2F7ZE 2RIOA 3JYAA 2BTSA 5KHXA 5CQWA 4G6LA 3A62A 4QP9A 4ENYA 2W5HA 3PJCA 4G3CA 3FQHA 5L6WL 3NUUA 3ZSIA 2IO6A 5KE0A 2Z2WA 4FEVA 2QQ7A 3G9LX 3OWLA 5HICA 3R28A 2W5BA 3FI4A 4BDDA 3AMAA 4FE2A 4AZEA 3BCEA 3ZXTA 5IEXA 3EMGA 1SNUA 2E9VA 3VQUA 5CI7A 3BHUA 3QZHA 1MRYA 1YHSA 3BV3A 2YM8A 4LFIA 4N6YA 3VS7A 4M69A 4C4JA 4DFZE 4A9UA 5DGZA 4D2SA 2WNTA 1Q8TA 3PP0A 4PF4A 3OFMA 3DPKA 3EQHA 1Z57A 4FI1A 4WNMA 3UVPA 4EK8A 4EOIA 2BKKA 4Q9ZA 4CQGA 3IQ7A 5D41A 2VWWA 4GYGA 2QONA 4YJUA 1G8AA 2Z7QA 3QGWA 2PUNA 3S95A 5LXMA 4MXYA 1H27A 4FT7A 4YSMA 3D5WA 4ZZOA 5J1VA 4WT6A 5AUZA 4DEDA 3EL7A 5EM8A 5AAGA 2ZMCA 3IW5A 2Z7LA 4QQTA 2JDRA 3F5XA 4GKIA 3AXWA 4BDAA 3RHXA 1ZYCA 5AX9A 4I1ZA 2ITQA 2XKCA 4LI5A 5LMKA 4YTCA 2YM3A 5HG5A 3PXRA 2UZEA 3OCTA 1H0WA 2W0JA 1SVEA 5E8UA 4BRXA 1H00A 3QKKA 3TUCA 3NCZA 4R77A 3RAKA 5HIBA 3Q04A 3ANRA 4D9UA 4ERWA 4IZ5A 3RI1A 5E8YA 2XIRA 2JBPA 3PSDA 4ZY5A 3W2RA 4E93A 3ID6C 3KFAA 5H8GA 3K5VA 3E5AA 3WILA 4CRLA 2XNBA 4AFEA 4O7VA 5HX6A 2C6IA 1O6YA 3UJGA 4RIXB 3GBZA 3KXMA 4LL5A 4AG8A 3FZRA 4KB8A 5BVFA 3UO5A 3QTXA 3ZUTA 5I4NA 2OJGA 2BVAA 2RFSA 5J9ZA 3EFLA 4JJRA 4CFVA 4LGHA 2XNMA 5DNRA 3Q2JA 2CMWA 3NUSA 4QD6A 2B9HA 5IU2A 2JLDA 3UVQA 3DDQA 2YCQA 3FZOA 3KULA 2X7FA 2HWOA 4LRMA 4F9BA 3UZRA 4YHTA 3VS5A 4HW7A 4HJOA 5HIDA 3HMMA 5LMKC 2QURA 3R7GA 1Q41A 5JN2A 2WMVA 4JVGA 4DGLC 2XNNA 4JS8A 4IANA 3ORNA 5BVWA 2BHEA 2R3OA 4K33A 5IF1A 4ZTLA 5HCYA 3WZEA 5AM7A 4TKSA 3TCPA
chains in the Genus database with same CATH superfamily
4JBOA 5L6OA 5GIPE 5IA0A 2WTCA 1YI3A 3UNZA 3VBWA 2IW8A 3S1HA 5KMKA 1T45A 4KSQA 2ZJWA 1OGYA 3TUDA 3RPYA 3W8LA 4CKJA 4RWIA 4L6QA 4O22A 3ZO2A 5IA4A 2JIIA 3VS0A 4I4EA 1GY3A 4EZ3A 4IVBA 2EUFB 1UU3A 4TWOA 1PXLA 3UQGA 3EFKA 3MW1A 4D2PA 5A4TA 5KUPA 3V5TA 5AFVA 3F6XA 4FT0A 2QU5A 4OTHA 4Z55A 3VAPA 5JZJA 3KCFA 3TM0A 1CTPE 1Y6AA 3LOKA 4NW6A 1J1CA 3W2CA 4UMRA 1G8KA 2YJRA 2XBAA 1PXIA 2PVJA 2R3HA 3JVSA 1JLUE 1Q3WA 1UKIA 3O7LB 4EK4A 5FP5A 3QTZA 5FBOA 3U55A 2P33A 4EQCA 2X39A 5AR2A 3DT1A 2KULA 4LL0A 4QMYA 1YDTE 1ZMVA 4IFGA 3FLNC 4GVJA 4WNOA 2BDFA 3I4BA 3K2LA 4M15A 2YIQA 4PMMA 4V0GA 4YJRA 5H3QA 4LDTA 2GTNA 2OJ9A 1OL6A 2QODA 2YN8A 2OH0E 2UW5A 2BKZA 2OJFE 4H3BA 5G1XA 3SQQA 3LM0A 3Q60A 4L00A 4XRJA 3WF7A 2OXXA 3OY3A 3SAYA 4ALWA 4ZLYA 3TJCA 2PVNA 4UMPA 5HGIA 3R1SA 3HGKA 3LFSA 2OWBA 1G5SA 3ZOSA 3MVLA 3SA0A 3QZIA 4RX7A 4B8MA 3PXZA 2B53A 2UVZA 5D1JA 3BGQA 3DFCB 1H1WA 3AG9A 5H8EA 4FSQA 2CN5A 3UYSA 1LUFA 1UU9A 4CFMA 5M57A 1OMWA 2A27A 3QA0A 4JG8A 3F2NA 4NH1A 2OJJA 4PY1A 1PXKA 4QMZA 4TYIA 4W4XA 4Y5QA 4YC3A 5EQEA 4QYYA 3I0QA 2X0QA 4G34A 4HPUE 4MWHA 3FLZA 3KY2A 2RFEA 4BCJA 3VUTA 4UZDA 2IEWA 1ZOHA 3DJ7A 2RKUA 4RVKA 3VRYA 1MRUA 4AXCA 2NYAA 2IVTA 1NVRA 2O5KA 1XH9A 4FTTA 2Y4IC 3IO7A 3JS2A 4TYEA 4FK3A 2G2HA 4QQJA 1KE7A 4U80A 2EU9A 4U9AA 5EW9A 5AAFA 2DUVA 4PWNA 2I0YA 3P23A 3NSZA 4AZWA 3BBTB 4ZLZA 1PHKA 5JFSA 3DKCA 3PXQA 4G17A 4ID7A 2OXDA 1SNXA 2PHKA 4IAZA 4DGNA 3R7YA 3GC7A 5D11A 4UMTA 4ZJJA 3TV6A 4YLKA 5JFXA 2WTKC 3C4CA 3EN4A 4S31A 4E6CA 5A9UA 4BKYA 2BPMA 2XKEA 2FVDA 3Q4TA 2QG5A 2R64A 2OZOA 4UYNA 3HV4A 3OWKA 4C36A 3I1AA 1QL6A 2OSCA 2QOFA 2R9SA 4FUXA 1PXJA 5E8XA 4RIWB 3TZ9A 4ACHA 4CFUA 4MXXA 4CCUA 2WMAA 4RVLA 4V05A 5FRIA 3MY0A 4J96A 4IVDA 3GCUA 4GEOA 5IA1A 3UNKA 2QD9A 4PNKA 4MCVA 4MHAA 4MXCA 3RJCA 1KE5A 3TZMA 4DTBA 4C61A 3AC1A 4EBWA 1YOLA 4YTHA 3Q3BA 3LXLA 2ONLC 4CQEA 4C4IA 1ZXEA 2WO6A 3ZLXA 3ACJA 2X81A 2YDKA 1K3AA 3HUCA 4RLKA 4U3ZA 3UIXA 3R30A 1FOTA 3O5AA 4QDVA 3LCDA 3VS1A 1Q24A 2CNUA 4TYGA 4DBNA 4XG3A 2HOGA 5AP7A 3VHKA 3JVRA 1B38A 3HUBA 2GNJA 3NNXA 1Q99A 3QQKA 4PPBA 5CWZA 4WG5A 4ZXTA 5HO6A 3AT4A 3VUGA 1YHWA 4O27B 4UALA 4YJPA 5CSHA 3UIBA 4UWCA 3TDWA 5EI8A 3U54A 2CLXA 3F3UA 2CGUA 4N57A 3R9RA 4IWOA 3UZTA 3QWJA 4I6QA 4FIGA 1J91A 4KD1A 4FRFA 3HA8A 1WCCA 4UWBA 4EUUA 4QTEA 2X7GA 4PDSA 5IMXA 4JXFA 4R1YA 4C3FA 1U5QA 2ACXA 5KMMA 3UMXA 4ZMFA 3QRUA 4GG7A 2A2AA 2C6OA 3EYGA 2ETRA 2JKKA 2YIYA 5CTPA 3ZBFA 2OZAA 1R0EA 2G2FA 4AOIA 4O7SA 4D1XA 3CTQA 2X4ZA 4ACDA 3P1AA 4K0YA 4RT7A 1DI8A 2YEXA 3P4KA 5FEQA 1GIIA 4U97A 3IK3A 4BCQA 4BCHA 4D2VA 1V0OA 2PE2A 3KB7A 3ZS5A 5CSXA 4DFNA 2QOLA 3W0SA 4Y8DA 1FINA 2XH5A 2QHMA 3LFDA 5IEVA 4RIYA 4NM5A 4O0SA 5ETAA 2G9XA 1Q61A 3KU2A 5A54A 1QPEA 3IOPA 4J8MA 3UQCA 3HMIA 4C35A 5CALA 1ST0A 1H07A 3TIZA 3QU0A 2BR1A 4Z3VA 4KWPA 1KE8A 1SMHA 3WF5A 4NL0A 2YAAA 1I09A 3ZONA 2PVKA 2A19B 4AWIA 3VF8A 2XUUA 2IVUA 5EDPA 4IC8A 3D5XA 3REPA 2RL5A 3DBDA 4K18A 5CU4A 2C5XA 3ELJA 2WMUA 4H36A 4YO6A 1Q5KA 4YLJA 3A7FA 2C0OA 3KULB 3V3VA 4DITA 3NUAA 3IW4A 3RPVA 2WU6A 5AV1A 4P90A 2XVDA 3HDNA 1H0VA 3WOWA 1H08A 3GCVA 3GCQA 3MB7A 5K9IA 4XG7A 5BVNA 3KXHA 5BX0A 4XP3A 5FEEA 4IIRA 4NFMA 3R83A 4FYNA 4FV4A 4ZSGA 2VX1A 1H8FA 1OL1A 2R4BA 3P5KA 2WMTA 4YPDA 4AGWA 3RNIA 4C7TA 2WIHA 2GSFA 4WNPA 5BYYA 3A4PA 2X0GA 4FTRA 4DTAA 3NX8A 2PZPA 2XRUA 4EL9A 3SXRA 1Q8WA 4QP3A 3V5LA 5DR6A 2OK1A 5HCXA 2C1AA 3QD3A 2CKPA 4AP7A 4P2KA 5HQ0A 3VUIA 2C6KA 4FBXA 4RFYA 4I20A 4FGRA 4FV5A 1SVGA 4DTKA 2O3PA 4CZYB 4FL1A 5GHVA 3FV8A 2XBJA 3CLYA 3W0PA 4I0RA 3V5WA 3AC8A 1FVTA 3QD2B 4ASDA 3QL8A 4CMUA 4DHZA 3MFSA 3VUKA 3UGCA 1QPDA 2R3LA 4ZIMA 3Q9YA 5EHOA 4EK3A 4A7CA 4IJ9A 1U4DA 4P5QA 3DB6A 3QTWA 5HEZA 5TF9A 2F4JA 3V04A 4G9CA 3EN7A 1YHVA 3N4UA 5KMOA 1JKLA 4FKWA 4A4LA 5IPJA 3ORPA 3BLHA 4Y5HA 5HVKA 4BCOA 3F7ZA 2X7OA 2W1DA 3C0IA 4FZ7A 2Y7JA 3UOJA 3Q53A 4FKUA 2VTRA 5K0KA 4GFGA 5TO8A 3UC4A 1OGUA 4XCUA 4IB1A 3P86A 3W2QA 1OIRA 2H34A 3WIGA 2PZ5A 3CP9A 4M0ZA 4WO5A 4B4LA 5M4UA 3NUXA 1XH7A 1FGKA 3TV7A 3ZSGA 3KIOC 5KKRB 2P2IA 4AQKA 4WIHA 3BGPA 3TT0A 3LMGA 2OFVA 2PUIA 3FY0A 2FH9A 3QD0A 4O4DA 2Y0AA 4XV9A 3CBLA 3E63A 3GB2A 3PVGA 4OW8A 5AAEA 4Y73A 3JUHA 4FSWA 4AGUA 4PQNA 4U81A 2E2BA 5M51A 5EG3A 3HDMA 4O4EA 5AIRA 1B6CB 1KOAA 4DH8A 3VIDA 3QRKA 4ITJA 4ZZMA 2FA2A 3IGOA 5DR9A 5M4IA 3TWJA 4FX3A 1ZYLA 3BV2A 3LIJA 4JX3A 4ITHA 2GQSA 3GC9A 2CSNA 3AD4A 4J1RA 5HHWA 3DK3A 2C6LA 3LVPA 4WRSA 3QXOA 3FMDA 4LRJA 4HGTA 2GQGA 2VWYA 4V04A 4ZP5A 4C33A 5M56A 3FEGA 3LKMA 2VWBA 5HNBA 3GP0A 4RX9A 3FLSA 2V0DA 1YXVA 2PYWA 4FICA 4JT3A 5HO8A 5IQDA 4Q9SA 2VTNA 5FXSA 3NNWA 1KWPA 3UBDA 2HZIA 2UZDA 4BI2A 4CV9A 5DHJA 1NXKA 4DG0E 3ZLSA 1OITA 1M52A 3DJ6A 1XBAA 3KVWA 1PMEA 3PDTA 1PXMA 2R5TA 3QALE 1VYWA 3MJ1A 3R1YA 2UZUE 5GJGA 2QOKA 1YI4A 2YM7A 3LM5A 5EKNA 5IQCA 1XQZA 1JSUA 1UU8A 2WEVA 1UKHA 4ZY4A 4ZSJA 4C37A 4IM0A 3QFVA 5FDPA 4UWYA 3ENMA 4HGLA 2B55A 2IZTA 2HY81 3OHTA 4G3EA 3TNQB 2F2CB 2IZRA 4F7NA 4IB5A 2X2MA 3NCGA 1FVRA 3BE2A 3R2YA 4LQMA 2ITTA 4LOOA 3PLSA 4L68A 3V01A 2GQRA 4V01A 5E1EA 3CSVA 4IW0A 4XRLA 3PE2A 4I5CA 5CSVA 4NWMA 2IW6A 3UOLA 3KMWA 4FIHA 3TTJA 4RA4A 3LLTA 1ZWSA 1V0BA 3R8MA 5JMSA 5LWNA 3QUEA 5L2SA 5AP2A 4TTHB 1VLRA 3F82A 2ITNA 3ZZWA 3IW6A 4X2FA 5DT0A 4D2RA 3NYXA 4E4LA 5J7HA 1H1PA 3S2PA 2R0IA 1UNLA 1WVWA 2XIKA 3SLSA 3ZXZA 1GOLA 4YC8A 4E5BA 3EJ1A 4BDCA 4RJ5A 5AV0A 4XG8A 2XANA 3HV6A 2IN6A 4O6LA 3U9NA 2VWZA 2XNPA 3MI9A 4R8QA 5CVGA 4D9TA 5LVMA 1ND4A 5ANIA 4EOLA 3D2KA 4ZAUA 4IEBA 4EQUA 2W9FB 3KVXA 3P7CA 5CSPA 1OL5A 3NYVA 5HBEA 4FNWA 4XX9A 3FZSA 3E87A 3WF6A 4UY9A 1H24A 1PXOA 4R7IA 2XCHA 2ZMDA 3R7IA 4LGDA 3C9WA 4TXCA 1BI8A 3I79A 3NIEA 4ZTSA 3NW6A 3W8QA 4E6AA 4M97A 3OCBA 5A6NA 1H4LA 4A9RA 3MPTA 4GMYA 2AYPA 2GU8A 2OBJA 4O0XA 3G90X 3CR0A 2QU6A 4K8AA 2XAMA 2R3FA 4O1PA 1S9IA 3VO3A 2BZHB 3GOKA 4FKOA 5HX8A 3OWPA 5I9VA 4MKCA 4ZSEA 3UG2A 1KE9A 5IMEA 2WQOA 4Y95A 5J95A 3RALA 3NFGB 3QYWA 4IH8A 3RZBA 3E64A 4EH7A 3RM7A 3GT8A 2JFLA 3MJ2A 4I23A 2VTLA 3C0HA 3VNTA 4DGGA 4E26A 5KMLA 2PK9A 4O0UA 2YZLA 4I5MA 5C27A 3IOKA 2PVRA 3FXZA 4QYGA 3ZC6A 3E8CA 4X2KA 3ZO3A 3OTUA 4ASEA 2XM9A 4F1TA 1YVJA 5IZFA 2GTMA 3COHA 5HORA 4N0SA 3MY5A 4FIFA 4RGJA 2YIXA 4FKIA 4X2JA 2WMSA 4NK9A 3FUPA 2W4JA 4K6ZA 4CG8A 4FT5A 4QEBA 3BU6A 4WSQA 3WF9A 4AGDA 5IH6A 2I0HA 2J51A 4XJ0A 1JAMA 5L2QA 1U5RA 5AUTA 3ZFXA 4BDHA 1AGWA 3CGOA 4DEEA 4I0SA 4FIIA 4QTCA 5IH5A 5GJFA 4PTEA 2YHVA 3DB8A 5DRBA 3LFQA 1WBPA 2GFCA 3BWFA 4XOZA 3GCPA 3V5JA 5IQHA 3QQGA 2X6DA 1XO2B 4U43A 2QLQA 3K5UA 1WMKA 2Y4IB 3VUMA 1UNGA 4X3JA 3HYHA 3BHVA 2X8EA 3TV4A 4YHJA 4WBBB 2BCJA 2B9FA 4II5A 3PVWA 4O0YA 2IPXA 3OROA 4LV8A 4DFUA 3CKWA 5E1SA 4BIDA 5K4JA 4OGRA 4KS8A 5M53A 4NUSA 3DTCA 5B2MA 3LCSA 4L7FA 4IZ7A 1CDKA 2HELA 4Z7GA 3L8XA 4HVHA 5CU2A 5FLFA 4IBMA 4C58A 2E9OA 2Q83A 4DDIA 3FI3A 5CU0A 4DG3E 4K2RA 4YZBA 4EYJA 5CF4A 4TWPA 2XARA 5DFPA 5AEPA 2I0EA 3DA6A 5IKWA 3P79A 3PP1A 2ZVAA 2XRWA 4ZEGA 3HAVA 2SRCA 2GFSA 3GU5A 5GJDA 2WEIA 4O7NA 4BYIA 4V0GB 2J0MB 5E91A 4BY9E 3CIKA 3NVMB 4NTSA 2CHLA 2GDOA 2F49A 4UYAA 1BX6A 3LQ8A 5ETFA 4R5YA 2NNWB 5EM7A 4W9WA 1YXTA 2BFXA 2ITXA 4RJ3A 3MFTA 4DT8A 3PJ3A 5ACKA 5EYDA 4MQ1A 3MH2A 4M0YA 1GJOA 5AP4A 4K9YA 3WZJA 4AE6A 3ALNA 3BYUA 2C69A 4XUFA 4CXAA 3HZTA 4AXDA 3W10A 1Q97A 3PE1A 3TACA 2ZM4A 3L8SA 3I6UA 4PDPA 4EWQA 4Q2AA 3OC1A 3H10A 3TL8A 4IQ6A 2VZ6A 4QP1A 5GZ9A 5HO7A 3PWDA 4FV6A 5BVDA 3MSSA 3PRFA 5DR2A 3UC3A 2AC5A 3DZOA 3BHTA 2OH4A 3SV0A 4JRNA 5I9UA 2BZIB 4NCTA 4D0XA 4AW2A 4G31A 4DFLA 3D0EA 4YBKA 5EHLA 1NA7A 4L8MA 4E8AA 4I4FA 4HNIA 3KF7A 4FEXA 3SXSA 2W1CA 3COKA 5HE2A 4EUTA 2ERKA 5CAQA 2X8DA 2REIA 1H01A 1PMUA 1PY5A 1HCKA 3DDPA 2VTPA 3A7JA 4MQ2A 1XH4A 3R73A 4XEYA 3R7UA 4E6DA 3C4XA 4YNOA 4I6HA 4XP2A 2B7AA 4AXAA 4E1ZA 2VTQA 2C5NA 2EB3A 2X9FA 4J8NA 4FTIA 4Y46A 3UMWA 5AUUA 2O8YA 3VS3A 3VUDA 3U6HA 3HRFA 3BPRA 4IMYA 5HLPA 4DFBA 4D2WA 5L8JA 3S3IA 2XNEA 4QMMA 4M12A 4KIPA 4FKSA 4EHGA 5KMJA 1ZY4A 2X9EA 1IASA 2WB8A 3A8XA 2KTYA 1U59A 4RSSA 3W55A 3EQDA 4L43A 4TYJA 4YU2A 3FZPA 2WTIA 5I9WA 3RPSA 5IEYA 5HE0A 2I1MA 2IJMA 4LG4A 4AAAA 5FUTA 4S34A 1L8TA 1BMKA 2PVHA 2RF9A 4ANNA 3B2TA 3QD4A 4C4FA 4BC6A 4P4CA 3AQVA 4GSBA 4YJVA 1NT2A 1WZYA 3AMYA 2A4LA 2XKFA 2RG6A 3WIKA 1PXNA 2CN8A 4QMXA 3C4ZA 5CF5A 2VTMA 1GZNA 1OM1A 4MNEB 2OIBA 1GAGA 2UZTA 3NPCA 1BUHA 1TZDA 4HYHA 2UV2A 4I24A 1OKVA 2YM4A 4BICA 4EOSA 1WBWA 5HI2A 5A4CA 1FMOE 3PG3A 3IDBA 2X0OA 4QQCA 5DIAA 3W2OA 5JEBA 5DT4A 4O7WA 3KN6A 3WZDA 2HW6A 4AU8A 5M06A 4OTIA 2OXYA 4XMOA 4ANBA 3I5NA 5HESA 1OPLA 3BL7A 5LJJA 2WMBA 4BTJA 3RWPA 4F64A 4Z16A 2IG7A 4AZTA 4G5PA 5HTIA 5JQ5A 2QI8A 4JI9A 4BDIA 3HMOA 1KE6A 1W2FA 2VTTA 1R39A 1YXUA 2W7XA 3THBA 3QHRA 4FNXA 4X2NA 3RK9A 2XALA 2QOOA 4OBOA 4F7LA 3AOXA 3PRIA 5B2KA 2LGCA 3EFJA 5CAOA 2A0CX 3ORZA 3R01A 3II5A 4O4BB 3UDSA 1PYEA 3PPZA 4X6RA 3RKBA 3BQRA 1DI9A 3FQSA 3QZFA 4APPA 4F9WA 3U4UA 2OJIA 3W2SA 4O81A 3BX5A 5HTBA 3LFEA 3L8VA 4DBXA 3MIYA 4FSUA 5ACBC 1OIQA 3A4OX 4XNEA 2VTJA 5B7VA 2B1PA 2XIZA 2CLQA 3QQUA 3TEIA 2W4KA 2EXCX 3ZZEA 3DTWA 4BCGA 1R3CA 3DBFA 4YTIA 4BHNA 4NZWB 4IDTA 4EBVA 4CFFA 5J9YA 4QPMA 5KZ0A 3F5UA 2JIVA 4NIFB 2YIRA 3QCSA 4Q5EA 3A2CA 4L42A 2I7QA 3G0FA 2XIYA 3PG1A 3C13A 5AV4A 3Q6WA 5DEWA 3GNIB 4CFXA 1MQBA 3BQCA 1VYZA 3MY1A 4FTLA 3COMA 3ITZA 3O23A 4JBQA 4L3PA 5JSMA 4QMQA 1XHAA 2XS0A 3CQUA 4U41A 4XV3A 4ASZA 4AT4A 3WARA 1IEPA 2WHBA 4G2FA 1IAJA 3R8LA 2XNGA 1Q4LA 3F3VA 2Y6MA 2VV9A 3GFWA 1VJYA 4WRGA 5I3OA 2GS2A 4EI4A 5JGDA 4KKGA 3HKOA 3R7EA 2DWBA 4I0TA 2VO0A 3QZGA 3TG1A 3W0OA 4JAJA 3HMNA 4UBAA 4C2VA 5C1QB 4R6VA 4OR5A 4CG9A 3POOA 4M66A 3R00A 1UU7A 3ZH8A 4EZ7A 4RBLA 4W8DA 2YCSA 4ANQA 4C4EA 5CQUA 4QP4A 3R0TA 1URCA 5C03A 4C57A 5A14A 1U54A 4OTGA 3CXWA 5K0XA 4FSRA 4AA5A 3CCNA 3QBNA 2JKQA 2YABA 3QA8A 2RG5A 5BVEA 3FE3A 2ZV7A 4AFJA 5M08A 1W98A 3EHAA 4XLIA 3V51A 3DKGA 4L3JA 4CFWA 4DDGA 2WPAA 3NNUA 4RC4A 3NS9A 5J5SA 4WHZA 3HMPA 2J9MA 1YDSE 3ZRMA 3C1XA 4H3PA 5JK3A 2FO0A 4DA5A 1ZLTA 3QUDA 4MBIA 4F70A 3U6JA 1F0QA 3C50A 4DH3A 5AP6A 4FTNA 3E93A 4J53A 4O2PA 3GU4A 4BCNA 4BIEA 2OLCA 4QTAA 5AUXA 2BHHA 4OBQA 4M7IA 4EH2A 3A60A 1LPUA 4YBJA 5A4EA 4MF1A 5L4QA 3O51A 4Y85A 1ZYDA 1FPUA 2PL0A 5AIKA 4BBEA 3HVCA 3Q96A 5A4LA 5HU3A 5EYCA 4C62A 5CANA 4BJJB 4KIKA 5C8KA 2R3IA 5CLPA 5EI2A 2EB2A 3F69A 5K5NA 2XMYA 4DCEA 1KV1A 3H9RA 4BGGA 2FSTX 5JFWA 2GCDA 3AC5A 4YJTA 1SZMA 3OEZA 3JXWA 4IWDA 3G5DA 3WBLA 1WBSA 4YZMA 4CTCA 3ZRLA 1EH4A 4O91A 4RWJA 3OTVA 3EKNA 1PRYA 1FGIA 5EQYA 4BGQA 4KIKB 3PUFC 1RJBA 3OEFX 4FG9A 3R8PA 2VTHA 4EOPA 3BBWA 1DAWA 1G8JA 5FTGA 1LEZA 4D4YA 4ENXA 4JMQA 5M07A 5CX9A 3NZ0A 4R7BA 3AGMA 1O6LA 4PL5A 4BCKA 4L67A 4E5WA 4PP7A 4KAOA 3QAME 3W16A 4C02A 5IQGA 4XG6A 3CKXA 4KNBA 2J50A 5AUYA 5FTOA 4AW5A 3QQHA 3TN8A 4ONAA 3WZUA 1ZAOA 1GIHA 5HVYA 4WUAA 1ZZLA 4CMOA 5EHYA 3K3IA 3L1SA 5GNKA 2AEGA 3HAMA 1JKSA 3G15A 3H9OA 2WU7A 2JITA 5HVJA 4Y72A 4O0RA 3PY0A 2Z02A 2V5QA 4DLIA 4JQ8A 1B39A 4CKIA 4R5SA 1ZOEA 2WTDA 2FYSA 4S33A 4F08A 3DJ5A 4ORKA 2V62A 2C1BA 2XIXA 1XBCA 3R22A 1WBOA 2CGVA 4L44A 2HZ4A 3C4EA 4W4WA 2JGZA 3VWAA 4EQMA 3PWYA 4BZDA 4QYFA 3CJFA 3KL8A 3VHEA 2J5EA 4YPSA 3G9NA 4FV3A 3SRVA 2ERZE 4GFOA 5HE3A 3ZTXA 4EHVA 5IQBA 4ZS4A 4U7ZA 3O17A 5E8SA 2FSMX 2XK3A 4KBCA 3VC4A 5IQEA 1TFFA 4CTBA 1L3RE 2XF0A 2HCKA 3M11A 3AKJA 4QP6A 3SVVA 3OXTA 4ERKA 5KX8A 3CS9A 4YUQA 2GNHA 2W1HA 3ZU7A 2ZV8A 4EJ7A 2BZJA 2V7AA 3E7VA 4ZSLA 4DC2A 3RM6A 1DM2A 3GQLA 4OT5A 2EXEA 1JBPE 5FDXA 5ITAA 5AR8A 3C5UA 3KRWA 1E9HA 4GW8A 3W2PA 2J0JA 3SG8A 2BROA 5CEPA 2CGXA 4FT9A 4RZVA 5DG5A 5LVOA 2F7EE 2W5AA 3AT2A 4HVSA 2NO3A 5A4QA 3MTFA 5D12A 4C59A 3TUBA 3IONA 5C26A 5J5TA 5J87A 3MH3A 3EQCA 4EJNA 4W4VA 5I9YA 4JQEA 1CSNA 3KEXA 3W32A 4FG7A 3FLQA 3QYZA 4WBOA 4FKVA 1OB3A 3RPRA 5FG8A 3LCTA 3W33A 3KRJA 4IAIA 4C34A 3RCJA 5CU3A 4G9RA 4W4YA 4FUYA 4MVFA 3BHHA 1AD5A 3DBEA 3MPMA 3CD8A 1OI9A 3OG7A 4MWIA 5AJQA 4OTRA 3U4WA 2ZOQA 1W0XC 3NR9A 2W9ZB 3HV7A 2GHMA 1URWA 2JDSA 5FBNC 2ITOA 4MNFA 4AZFA 3AD6A 1UWJA 2QOQA 4EORA 2CKQA 5IA3A 3TDVA 2QR7A 2QO7A 2JKMA 2VTSA 4FIEA 4FK6A 4IDVA 2CDZA 2VU3A 4F78A 5KBQA 2YWVA 5JGBA 2GHGA 5ANGA 5F94A 3D83A 3JR1A 4OTFA 1P5EA 3TMOA 3NDMA 5FGKA 4FNZA 4ALVA 3WI6A 4TWCA 5T68A 5LVPA 4PP9A 2VWVA 3C7QA 3WE4A 5EYMA 4L9IA 4HGSA 3ZDUA 2WMQA 3ZSHA 2BAKA 5AP3A 3CTHA 3C5IA 2XZSA 4OLIA 4YTFA 2C3LA 3BEAA 3SKCA 4TYHB 3DCVA 1OKZA 4IX5A 4Q5HA 1XMMA 2YITA 4IX3A 4DEIA 3ACKA 4BWKA 5JKGA 1X8BA 2PVFA 4GFMA 5BMMA 5AA8A 5IH4A 1PF8A 4O4FA 2HYYA 4WA9A 3UOKA 3OOGA 3W0MA 4DT9A 2XJ0A 3UOHA 5BQ0A 2WKMA 1OECA 2WQBA 4JG7A 4NTTA 4G3FA 2JKOA 4PMSA 2NP8A 3ODZX 3UO6A 4IVAA 5HBHA 3KXNA 4BCIA 1APME 3SDJA 4RFMA 4ANOA 3WYYA 4F63A 2NRYA 5L8KA 2YIWA 3EQFA 3VVHA 3FC1X 3NMUF 3DS6A 4RIOA 2E9PA 2HZ0A 3HV5A 4H39A 4EYMA 3H4JA 5CVFA 2Q0NA 4CMTA 4U45A 2GNGA 2QG7A 2C5VA 4AT5A 5IUIA 2O63A 4R78A 5BPYA 2BIKB 2PE0A 2E9NA 2IZUA 2UW3A 2X0PA 2YM5A 2QO2A 1IG1A 3D14A 3EQRA 5FP6A 1MUOA 2W1FA 4IX6A 5AWMA 3C0GA 3JY0A 4AX8A 3BI6A 4UN0C 4F99A 3UTOA 4ACCA 3BYOA 5AP5A 2ITWA 1UVRA 4HOKA 5FD2A 4XH6A 4MUQA 4O7TA 3JPVA 5H9BA 3FKOA 4APCA 4FYOA 4RG0A 3ZUVA 5CZHA 4PDOA 2VO3A 4GG5A 3RNYA 4ZMEA 4TPTA 3Q32A 1HOWA 2PMIA 1O9UA 4JLCA 1WVYA 4YP8A 3S0OA 2PU8A 3EYHA 2W17A 4R3PA 2C6EA 2YM6A 3LXPA 3NGAA 3DXQA 3I5ZA 3DU8A 4L01A 4XOYA 1PYXA 2VO6A 5JRSA 3ZEPA 1OKYA 4X3FB 3ZYAA 2BILB 4C3PA 1PKDA 3BELA 2J2IB 2XKDA 4JBPA 4D0WA 4HYUA 4XV1A 3G6HA 4XHKB 4G5JA 4NT4A 4FMQA 3W0RA 4DGOA 1JNKA 3FMHA 3HNGA 2WZJA 4IAKA 3HL7A 4DEBA 3PLAE 2OKRA 3L9NA 3BLRA 3N51A 5CAPA 2NPQA 4LV5A 3FXXA 4KS7A 5AX3A 4O38A 3V6RA 5BUIA 4YLLA 1AQ1A 2B4SB 4FTCA 3LJ2A 4IB0A 4RVMA 2CGWA 3NLBA 4AA0A 4BHZA 5EYKA 5CEKA 2OF2A 3R8VA 3L9MA 5JH6A 4IE9A 4MD9E 3EOCA 4ZTQA 4BKZA 4XBUA 2J0LA 3QRJA 3DFAA 5LCJA 4BR3A 1QPJA 3DQXA 5HIEA 3FMKA 1W82A 2Y4PA 2XYNA 1YW2A 3E7OA 2QKWB 3FXWA 2JDVA 3KXGA 3PIXA 3BZ3A 4FOBA 4X2GA 3HLLA 4E73A 3OT8A 5K4IA 4RRVA 4FV8A 4S30A 4CNHA 1CKIA 2FSLX 4D1ZA 3GU7A 4GT3A 4OAVB 3VS4A 3DNEA 2CCIA 4G6OA 4QMWA 1A9UA 4FEQA 2P3GX 3QKMA