3Q4HA

Crystal structure of the mycobacterium smegmatis esxgh complex (msmeg_0620-msmeg_0621)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
90
structure length
90
Chain Sequence
DAHIPQLIASEANFGAKAALMRSTIAQAEQAAMSSQAFHMGEASAAFQAAHARFVEVSAKVNALLDIAQLNIGDAASSYVAQDAAAASTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterologous expression of mycobacterial Esx complexes in Escherichia coli for structural studies is facilitated by the use of maltose binding protein fusions.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Metal transport
molecule keywords Pe family protein
total genus 38
structure length 90
sequence length 90
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3q4hA00
2KG7B 3HR0A 3TXQA 3ZBHA 3G80A 3TXSA 3GWKC 2B9ZA 2VS0A 3FD9A 3FAVA 4ABMA 3OGIB 4I0XA 3Q4HA 2AZ2A 3GVMA 3Q4HB 4I0XB 3FAVB 1WA8A 4LWSA 2VRZA 4GZRB 2DE0X 2AZ0A 1WA8B 2KG7A 3O9OA 4LWSB
chains in the Genus database with same CATH superfamily
4CZZA 2IU0A 3VQWA 1AJNA 2WLJA 4N21A 1GN3A 1RPRA 1U97A 2PI5A 4OXSA 4W4LA 3ZS8C 1RSOB 1YITV 3ZJZA 3HKBA 2ITCC 2NLJC 3ASOC 1Q86W 2EJRA 3K3WA 5LMUB 1YHQV 2QSAA 1D5NA 2EIKC 1SQVH 1R1BA 1X4TA 3ZEDA 4JI8B 4K8XA 3OR7C 4BAYA 5AG2A 1QQCA 4ZBMA 2Y0IA 1N33B 2N04A 2BCCH 2HP8A 4JYYA 1IXMA 1BHAA 5EIBC 2YIBD 3D36A 2GBOA 4XDLA 4MVQA 2WLHA 4Z1MG 2P90A 2CK3G 4YJ3A 3JAKA 2Q0AA 1I5YA 1YDXA 4PA4A 3GVMA 4I5SA 4J10A 3ZMZA 1K8AW 1ORQC 3B8NA 4CC5A 4ASUG 4RWUA 1RFYA 5IJ0B 4BIZA 5BR8B 3SPHA 2Q7EA 1I94O 2Z0AA 4JYBA 4O4IB 3SYCA 4W4KA 4FFBB 1M90W 2UUAB 3OE7G 1RM1B 3WG7C 4I0XA 4I4TA 3H01A 1HR0O 4EFEA 5KUKA 1RPOA 2UUBB 4JI8O 5H9CA 1SQXH 1THZA 3IC7A 4LFAB 1VQ7V 3HKCB 4X1KA 1K5SA 2DWEC 2YIAA 2P22C 4CH6A 1H2SB 3W7TA 3JD0A 5B1NA 1XNRO 3I55V 3D36C 2E5LB 1WB8A 1DK1A 3W7XA 2BTOA 3ABUA 1R3JC 2YXHA 1GRJA 1B6QA 3UO2A 1PNMA 2PGGA 3W7SA 4TQDA 3F5WC 2Y4TA 3ABLB 3JATB 2UUCO 1ZX3A 3ASOB 1KUQA 4LFBO 3E2EA 2QM4A 1QBZA 3UT5A 4ZOLA 1HNZO 4BR6A 1SC5B 5E79Z 1V55C 4TV9B 1XNQO 3E8HA 1KMIZ 3AG2B 3FX7A 3LDCA 3E86A 4J80A 1EN4A 3KG2A 4J42A 3RYFA 2W0FC 1TAEA 2XHBA 5LGTA 1K34A 3ABKB 2IBZH 3OEHG 1N0NA 1HR0B 3ABMB 1EFRG 4WBNB 2ATKC 4DV7O 5KUMA 4LFAO 2WLLB 1P49A 5K1PA 4RQFA 1JJ2U 4LFCO 4GKJO 1JVMA 3CYOA 4AHCA 1SS3A 2AZ0A 1JFFA 4O2AB 3FB7C 1AI6A 2X6CA 5H5NA 1G8MA 2P67A 2JS3A 3ZBHA 5LA6A 3CXHF 5CMUA 3JAWA 4X64B 1YJWV 1WB7A 3AK3A 4DV1O 4I0XB 4JI7O 3DXRA 4X1YB 5GONA 1U96A 4QE7A 3H1HH 4LBEC 1TA8A 1F7YA 1Y74A 2IW5A 4NXNO 2WA4A 2LFRA 2E74B 3P32A 3VBBA 3OUFA 1VP7A 1QVFU 2YS8A 2ZE6A 2QWPB 2FL4A 4HNAB 5K1XA 4J9ZB 3WU2Z 3UM7A 4PA7A 1CXZB 1S76D 3NXSA 1E1QG 4MTFA 4CC6A 4AQYO 1BQ0A 3SR2C 1Y4MA 3CCUV 2HJFC 4BW9A 1WNSA 2ADQB 1P4RA 4CS2A 4JTAB 3ZRWB 4C7UA 5ITZB 5JJEB 1OV9A 2KKWA 4HYOA 3A8TA 3O65A 5CA1B 2DQ3A 1VF7A 3WFVA 5EBWC 1WA8A 2QM8A 5IJ9A 3G6BA 3SYOA 3ZHQA 1Z5VA 3JAKB 5L3EA 2DYSB 2QWNB 2Y4UA 5LYJA 3ETQA 3M8AA 3J7AU 4DR1O 4FMTA 2EIMB 3CRRA 4D6TH 4DXWA 1Q7YW 4GLXA 4WFEA 2GSMB 4H37A 2VWJA 3CRMA 2RDCA 1ZTEA 1D2DA 2Q9LA 1BHBA 1FYJA 1NTZH 2KG7A 3BABA 2QTSA 4UCRA 3JCZA 5CN0A 3UO3A 3X2QB 4EB6B 3CEIA 5IYCO 1BGYH 2HG5C 4ZI7B 3ZCCA 5DECA 5CA0A 4I7ZB 3OMAB 3MAQA 3IAYA 3HKCA 4MVOA 4DW1A 2AGAA 5LBQA 3CC2V 3K5NA 1S72V 4DYLA 1OCZB 3E83A 1H2MA 3RW0A 2QWOB 4YHHO 2ZR2A 3CMEV 1WLEA 3DC5A 2M7WA 3SPCA 4MVRA 1HDJA 1TGOA 5CB4A 5DM6V 5IYDO 1ZL8A 1Q43A 3T1YB 4GKJB 2KG7B 3BAAA 3JSLA 4LF6O 3OTOB 3CCRV 2F95B 4TV9A 2UXBO 1MABG 2BE3A 5KLVH 2W6JG 4I4TB 4LF8B 1EZVH 4DV4B 1NTMH 1DF5A 2GTAA 2ZIOA 1AR5A 2QA4V 1W2BU 2UU9B 2EX3A 5EBLC 4BW5A 4HAMA 1FXKB 1Z5WA 4X20A 2EBOA 3N2GA 4PV1B 3U11A 2EIJB 2P5OA 4OX9O 2UUAO 1YJNV 5C93A 3ABMC 1RSOA 2BOBC 4P9OA 3KCYA 2YUAA 5L3DA 4R8CA 2Q4PA 4KHPO 2EIKB 3ZHTA 3HKDA 3H1IH 3M99B 2PY5A 2DYRC 4DV3O 4J41A 2R70A 4EKWA 5JH7A 3JASB 1Q82W 5LP6B 3L70H 2ZNIA 4DV6B 3ZMUA 1MNGA 3G67A 4U7OA 2A9HA 3E8GA 2JGUA 4JV5B 2JEXA 5KA6A 2A06H 1AJPA 2UU9O 3DC6A 2UXDO 4JI0B 3K08A 4MT8A 1R6TA 1Q90D 4X89A 3H1LH 3GWKC 4B3TB 2QTOA 1YI2V 2KB1A 4GX2A 5FPRA 4IYIA 4B3SO 3JAWB 3AG4B 1LR1A 4DV6O 1K73W 1VF6C 5KX5A 4RQEA 3C3TA 4JI3O 5EBMC 1XMOO 4PA3A 1PL0A 4LR3A 2PUSA 2UUCB 3SPJA 3G80A 4DRXA 1F51A 3P30A 2JDIG 2WLIA 1GO3F 3FYEB 5JVDA 5L3FA 1AVMA 5IY5C 4JYCA 1K9MW 1O9GA 2CE4A 2YIBA 3Q4HA 3ZRVA 4FM2A 1XQ8A 2Q8VA 3CCMV 2QM7A 2BOCC 3H9VA 2FTKA 1HNWB 5LMUO 1NQTA 2WSSG 3JSNA 2H94A 3THOA 4J11A 1PPJH 4JI6O 5H6RA 1MZFA 4B3RO 1R73A 3K0GA 3RYHA 5JQGA 4X1IB 5EYPA 3D3QA 5J2UB 5B1AB 1PL4A 3OEEG 1H2GA 3UT5B 1K3EA 1AB3A 3SYPA 3NR7A 3AG4C 2JRIA 2YI8A 4EEQA 1IZ3A 2GTSA 5LMNO 2ZE8A 2LGQA 2UXCO 1YZBA 2JEUA 4LWSB 1VQPV 4IHJB 4FLYA 2ZE7A 3QO8A 2ZE5A 2K9PA 3HKEA 2F43G 3L75H 2MK3A 3CCEV 1M57B 3BY6A 1KU9A 2FB5A 4MSWC 4HBNA 2HHHO 3N2GB 1VQ8V 1YTFD 2LFSA 3K58A 1KKCA 4TV8A 4L87A 2WAMA 5B1BC 1IVSA 1UFIA 3SPIA 2Q7HA 1Y67A 3X2QC 1M9NA 3N2KA 3F5TA 1N32O 4LFCB 3D8CA 2N74A 3WB0A 5LP6C 5KAFZ 4X62B 1R3IC 1R6NA 3FKSG 1XMQB 2DYRB 1XUQA 4XDKA 5GTIZ 1MSWD 3SYAA 4JI5B 2GDSA 2PZSA 4CS4A 4DR6B 4DV5B 5LGUA 5DEDA 3ZRSA 3CJHA 1NZ6A 2DW4A 4AILC 2LQTA 4MVZA 1NT2B 2D2CB 4UCOA 4Z2WA 2MW2B 1FPOA 4LF5B 3ETGA 1S3JA 3CC4V 3H1KH 1MOFA 3PJSK 2P7TC 2OTLV 1SQPH 3K03A 3PN1A 4PJ0Z 1FD9A 2DN9A 1M56C 2B5UA 4B7KA 3JARA 1ZUQA 3FFQA 4FZ0A 4QIWF 3RWRD 1M4UA 2HJDA 4B7EA 1YJ9V 4YIPA 5BXZA 5EYPB 2HLDG 3CRAA 2B1IA 4D7SA 1COWG 3CRCA 1TUEB 1I5XA 5LHGA 1NKDA 5FLXN 1BCCH 3SJAC 1AI5A 3E22A 4CH3A 2OTJV 1VQ9V 2V1DA 3DSQA 4DRXB 2R9IA 3CC7V 5DN6G 5FNVA 4RUFA 1URFA 2YDEA 3T4DA 1AP5A 3CCSV 3Q4HB 1YCIA 2AXTZ 3FB6C 4RAIA 3AK1A 3OW2U 2IJJA 4KL1A 2WLIB 1M56B 4UV8A 4MVSA 3B40A 4J7ZA 2WLNA 1GAXA 2IM9A 4UFZA 2E5LO 1KECA 3IGAC 4G2KA 2NNUA 4FFBA 3HKDB 1L0LH 1Q3EA 5JWPA 2VRZA 3OD4A 4DV1B 2XAHA 3OMNB 5C8YA 3ZHVA 2VQEO 2Z5UA 3RT3C 3VOUA 4LH7A 1M1KW 2P4VA 1K5QA 4F6RA 1I94B 4UB8Z 1BQZA 3OGCC 2ZM6B 4G27B 1WP8A 4U3JA 4X1KB 5HFMA 2UXBB 2CTWA 5J2TA 2XAQA 3AG3B 3E8FA 1AROP 4QPKA 4UXNA 2GHYA 2XAGA 3AG2C 4ICGA 2IJIA 2DYSC 5BMVB 1BS3A 1EN5A 1KP2A 4YXWG 2ZNJA 4O4LA 1GM7A 3I56V 5ITZA 4DV7B 4GKKB 3ZMTA 2HVJC 1SERA 4JAVA 4ZIBA 3AEIA 4UCTA 5L3BA 4EFBA 4K35A 3VQXA 4PA9A 4O2AA 1H2LA 4FM1A 4X64O 4UUJC 4IHJA 5KMGB 2W0XA 2FKXA 1XILA 4NKGB 1M93A 1OCOB 4PDLA 3JD2A 1EZJA 1K7DA 4LF4O 2QKCA 1S77D 2E76B 3STZC 4I50B 2PI4A 4A5UB 4R6ZA 1ZWIC 1KQSU 4OPHA 2EJ7A 2Q69A 1SF9A 1XMOB 3BA8A 1BSMA 1T5EA 2B9ZA 4F4LA 2X7RB 2LGWA 2X6BA 2Q5ZA 1WN7A 4R7CA 1YVWA 4FLVA 1X59A 1FXHA 2LW1A 1H2KA 3KCXA 3T2MA 1QLEB 3CB2A 3CD6V 1AR1B 3CCJV 4FLZA 1B3QA 4LC1A 1AILA 1IDSA 3LUTB 2M6YA 4G28B 1I7FA 3P3NA 3ZMVA 1B06A 1NU1H 3CRQA 5IYZB 4TUYB 5FPOA 1NS1A 3J81N 5F2VO 4KFMA 1Y66A 1YEWA 4UVAA 3ZN0A 1H8EG 3B8MA 3UCSC 2YSUB 3WB2A 1K4CC 3SYQA 5LOVB 4J9YB 1TVKB 4P2ZA 2AW9A 1H38A 3CE2A 3K5OA 3CP1A 3TETA 2L35A 1IBMO 2UXDB 4IL6Z 4DW0A 3G6EV 2B1GA 1AI7A 4HZ3A 1US6A 1WPBA 3APOA 5A2QN 1HNXO 4ZHQA 3E22B 2PYJA 1JX9A 4UV9A 3SPGA 1XI1A 1NVPB 4GX5A 3VQYA 1YSCA 1HNZB 1QCEA 3A0BZ 4JI7B 1N33O 5IYZA 2F23A 1K4DC 3CJHB 2PYLA 4DR7B 1K92A 2KQXA 4B3MO 4I55B 4LF7B 1FJGO 5KAIZ 2DE0X 3T1CA 3K5LA 3RVZA 1QU7A 4FLWA 3OTFA 3OR6C 3C3SA 4YY3B 1VEWA 1BMFG 1PD3A 5J9PC 1NR7A 2AZ2A 4WFHA 5IJ0A 1Q6UA 3EVKA 5H2FZ 1OCCC 4JZGA 1G6UA 1SESA 1BZKA 2C2AA 1Y76B 4NTXA 2HHHB 4MVMA 1FFTB 3ZHUA 4IYHA 3MD0A 3B2EE 3HKEB 2JGDB 2X6AA 3SJCC 2EZPA 2XNDG 3JASA 1GK9A 3OM3B 4IIJA 2W6IG 4JI1O 3BRCA 4DR1B 3QVNA 4JAAA 1K97A 1J5EO 3ZHRA 4TSFG 4QGPA 1DTOA 3HPLC 4DUYO 3T1YO 2EILC 2ZKOA 2Q67A 2Y48A 3BEHA 4PDMA 3E8BA 1KC8W 4DR3B 1SA0B 1SRYA 4GCZA 1DF4A 2ARHA 3LSSA 1W59A 2O57A 4CBCA 2ZD9A 4O4JB 1W0JG 4I9WA 3RYFB 2V7QG 2ZCEA 3BCCH 1IBLB 3JD4A 2OIGA 5D5PA 2JIZG 1A32A 2Y69C 1HNWO 1FFXA 5IT9N 2NN4A 1KB9F 5B5EZ 1VQLV 2XAJA 1L1FA 4ZOLB 3TGUH 4DR5B 1IBKB 2QE7G 3GB7C 2ZDIA 2BSKA 4K0KO 2YXLA 3CSXA 1NR1A 2ODMA 3ABTA 4KP4A 3WB1A 1P7BA 5B66Z 1VQNV 5IE9A 4JI4B 4I9QA 3TXSA 1QNMA 1TUBB 1XEQA 3T1HB 2YC0A 1RP3B 4TQFA 4BIOA 1UPGA 3J80N 2DQ0A 1I0HA 3A0RA 3AG3C 3JAMN 3RGBA 3TCUA 5LL6Y 3SDLA 2F93B 2NR5A 3QG5A 2V4DA 2XASA 2ZM6O 5B1OA 2EIMC 3OFNG 4Q20A 4Z1VA 2D3OW 5JCOC 1SQQH 3LNNA 1F4MA 2G38A 3P3PA 2BTQB 4WFGA 4WFAV 3DGEA 5CA1A 1DLBA 3AG1B 2HFEC 1WA8B 4DR6O 1R3LC 2PTMA 5EC1C 1TUBA 4X65B 5LGNA 1EN6A 3OGIB 3ZX6A 2HR3A 1QLEC 1MSDA 3CMAV 4H13B 5B3SC 3L9DA 4QPJA 2P6JA 1VQMV 2XUMA 4JI3B 3N2KB 5HFLA 5E1AC 2F4VO 3MHSC 5JJNB 1VQ6V 1N34B 2IH3C 3L73H 2WLMA 2RNBA 1OZ0A 2QWQB 1NBMG 2Q0OC 4I55A 4K3AA 1CP9A 3DXRB 4F6EA 5CBFA 1Y74B 3B4SA 3SJQC 1SZTA 1OCZC 3MHHC 4GX1A 4DR4O 2UXCB 2RCVA 3K0DA 3QO5A 4DV4O 1OHHG 1F4NA 4NTYA 1BT8A 1HWYA 1JCHA 1LUVA 3AG1C 1QVGU 5EK0A 5JQGB 3CCQV 2JK5C 4IIJB 4DK0A 2ITDC 4PDVA 2QJ1A 4GZRB 1GM8A 1N4CA 3G4SV 2E75B 2F1MA 4P30A 4JI4O 3S3WA 2FYUH 2BTQA 4X1IA 5BR8O 4YHHB 1JFFB 1Y76A 4GT1A 3LSQA 3E35A 2QKSA 1HP8A 3K79A 4JYAO 3EFFK 4X1YA 2QEXV 4OGQB 5CBHA 1V54B 4PD4F 2AHYA 4L8JA 1N36O 4X8AA 2EINB 2HEPA 2K1EA 4LWSA 3RN4A 5C8YB 5TISZ 2UUBO 2XTAA 2EULA 2ZXWC 3KKYA 2JJ2G 1R6KA 4TV8B 2VQEB 2RMKB 1Q8IA 4NVPA 3ZRXA 5LOVA 1WAZA 1ROPA 1N32B 1B04A 5JCOA 1EM1A 3CCVV 4FIPC 4X66B 4UVCA 1YXBA 3JARB 3ETEA 2VQFB 4JI6B 5FL7G 3T4ZA 4FJCC 3ML0A 3F7YC 3M7MX 1OCRB 4LFBB 2QGNA 3BA9A 4JGSA 1PKXA 4O2BA 3K59A 3IJ4A 4MW8A 1PV0A 2Y69B 4I50A 5H6QA 1SQGA 5LMNB 3K9SA 1SKVA 1E79G 1J95A 4LNUB 2BSKB 4YIOA 2CH7A 4LF5O 2A0LA 1RM1C 4D7TA 1N8RW 3ZN1A 4IGGA 4KHPB 5KHHA 1AJQA 5EZYB 3FD9A 1N36B 4ABMA 4DV3B 1L0NH 5LYJB 4O4HB 1IXBA 2VWKA 4LF4B 4KXRA 1MA1A 2XAFA 1XHXA 3CCLV 5EC2C 3K04A 4TUYA 1VF5B 4UB6Z 5IY5B 3HR0A 2OT5A 4JV5O 4R50A 1XOUA 4X66O 4LF7O 4PDRA 2VS0A 4JTCB 3FAVA 3ASNC 3JALB 1VQKV 1F23A 1S5LZ 3CHXA 2Q6AA 2WPDG 1DGSA 1SQFA 5KA5A 1ZLZA 2JJ1G 3FAVB 4DK1A 2L6LA 4OPAA 1XHZA 2R9RB 3K06A 5LXTA 1FXKA 3CXCU 2YICA 3AK2A 5JH7B 2OCHA 1R3KC 3H1JH 3HB3B 2YI9A 1VARA 5JJJB 1CPYA 1GN2A 1XNRB 4X20B 3ICXA 3BFRA 4CS3A 4DO2A 1VIBA 4QJFB 2QKAA 3I5DA 4UVBA 4JYAB 1ZAUA 3APQA 4NTWA 1QLNA 4U3JB 3BVOA 4O4LB 4JI0O 3QF7A 4MS2A 3DTUB 5IDJA 5BMVA 1CEZA 4LF9O 3BHPA 2OYQA 4YJ3B 1V55B 1I08A 2WLLA 4TOIA 4CH5A 1PNKA 2XT9A 3ZHSA 3ABLC 4NXNB 4PELA 4BIUA 4NB5A 1M57C 3D3IA 4JPRA 2CTQA 5LA6B 1YTFB 5JVDB 4DR2O 2OCCB 1GMGA 2RN9A 4JI5O 4O4HA 1IBLO 4RO2A 1S5HC 2KSDA 4LF9B 4DR7O 3OAAG 5KHGA 3LSUA 4GKKO 2EIJC 1FS0G 3UQ8A 3WG7B 4Q6GA 3L71H 4XBFA 1XL6A 3ASNB 3O9OA 4BWAA 3CX5F 2WWWA 1FXKC 1K33A 2LW7A 1SA0A 1E1RG 3GWOA 4B08A 4B3TO 1Q6IA 2F66C 2A79B 1LUWA 1G4YB 1Z2GA 1AI4A 1NJIW 1JJOA 4ZHQB 1FFXB 1AR4A 1NVPD 3STLC 1FJGB 4P9PA 2JGDA 3QTCA 1SETA 4O4JA 1JMKC 5KMGA 4FM0A 2CAZC 2N05A 2ZIMA 5A9GA 3ZMSA 2CUGA 2UXXA 5KHJA 4H0LB 1N34O 1JOYA 1KP3A 4MVUA 1OCCB 4O4IA 1UJWB 4JZ2A 1QR9A 2YIDA 4AQYB 3CPWU 3TJTA 2AHZA 2QR4A 2XOKG 3JD3A 1L8DA 2IU3A 1J5EB 2OWOA 2OCCC 1GM9A 1VQ4V 5IWAO 4JI2O 1OCRC 4WCEV 2H3OA 4TWKA 3RVYA 1IBMB 3RBZA 3ZIAG 1VF6A 1GN6A 4X65O 1N0JA 4NXMO 2GUZB 5IJ9B 4HNAA 3EHBB 3TK1A 3RYCA 1D5AA 5CA3A 4WF9V 1S0VA 1Q5OA 4DR5O 2F4VB 2ZR3A 4FLXA 2EINC 1Q6HA 3G71V 1G1XB 2DMXA 4MTGA 2JS5A 3FYIB 1V54C 1JPXA 4LH6A 1WPXA 1H2NA 4DUZO 5IYBO 2JVDA 4QE9A 5BY1A 5GTHZ 2Q68A 3SJBC 3R66A 1XDCA 1O9HA 2OIEA 4CH4A 2EZOA 2YEVB 5KHKA 2Y0PA 5CB4B 4X62O 1XNQB 5L3GA 4X9QA 5GW7A 1HW7A 2IH1C 4WFBV 2WA3A 1KYOF 4DV0B 3RFRA 1S5JA 2LO1A 4KUMA 3A0HZ 4DV5O 3JCUZ 2PF4E 5FNVB 5LXTB 4DR2B 3RYCB 1QHTA 1P84F 3RYIB 4U7NA 3L72H 5EZYA 1ZL8B 4DR4B 4WBNA 3F7VC 2R72A 3AG7A 4DV2B 1H8HG 2H8PC 3SGIA 2CTPA 1XL4A 3OT7A 4JTDB 4UCSA 1GTOA 5GONB 4LF6B 4FLTA 3CS5A 4WFFA 2FMLA 1WJZA 4O2BB 5BZBA 4YY3O 5B3SB 1OCOC 3K57A 5CA0B 2DJVA 2RQ6A 1GN4A 2ZINA 3TXQA 2E3CA 3LNMB 4LP8A 3KZIZ 4EB6A 1P7GA 2LP7A 3ETDA 4B3MB 3OMIB 4E4EA 4ZI7A 1XBLA 3BPZA 2A3QA 4MW3A 4DR3O 3N27A 4ZKIA 3U0ZA 4FPPA 4K8ZA 4NXMB 1W0KG 4PA6A 1Q81W 3K5MA 3IFXA 1EBOA 2ZDIC 3S3XA 4B3SB 4J7JA 4MTOA 2QDOA 4JI1B 2A7WA 2ZXWB 3IC9A 4RUEA 4DV2O 4DUYB 3ABKC 2GV9A 2ETNA 1IBKO 5LP6A 5CBGA 4FVMA 4X88A 2WLKA 4FFKA 2YEVA 1OJHA 3JALA 1GH6A 2R9AA 2UXNA 4DUZB 2P06A 4N23A 3RYIA 4FK5C 3W7WA 1V9PA 2IJHA 3OTOO 2YXYA 3ZRWA 1ZSPA 1BL8A 3LDEA 3FB5C 3E89A 1FXVA 2X0LA 3U10A 1NI8A 5B1BB 1SZXA 4PHZA 3T1HO 2CDYA 3FB8C 1NH2D 1NTKH 2GUZA 4GYCB 1PP9H 4FZ1A 4J7KA 1JR9A 1YIJV 4B3RB 2HKOA 2LJ2A 3W7UA 1VMGA 4LCUC 1VQOV 1AP6A 4MTXA 4QNHB 2DOSA 1ENVA 1NH2B 3K9AA 2CGNA 2RJZA 4OX9B 4JF3A 2CTRA 4LF8O 2VQFO 1PNLA 3JYCA 5B1AC 4AI8A 5KHIA 2DWDC 4PI2A 1KKDA 5D5QA 4DV0O 4K0KB 2EILB 4F6RB 3L74H 4GUNA 3VQVA 5J2UA 4UCUA 5L3CA 3C90A 1JA8A 2ILMA 1JQ0A 2Q7GA 2ADPA 1MG1A 1SQBH 3QO7A 2P4KA 5J2TB 4LNUA 3LDDA 3A2FA 1Y6XA 4E2LA 1KD1W 1FAFA 4JASA 1MZEA 3RYHB 3EXAA 4TT3G 3UKMA 5LHIA 1TVKA 4FLUA 3OUSA 1LNQA 4YJ2B 2CGOA 4U3FH 1MMMA 1PM9A 3HKBB 3MDSA 3R65A 3QNEA 4YJ2A 1KBHA 1GKFA 1BE3H 3CWBH 1HNXB 1QR8A 2ZT9B 3JD1A 2Q73A 2HVKC 5EIBD 4GX0A 4UCVA 1IURA 2Z3YA 4IT5A 1XREA 2QWRB 1WP7A 4PI0A 3B09A 4NYKA 1XMQO 4XDJA 2ZQMA 5IWAB 4JI2B 5KX5B 2IJKA 2CH7B 1YF2A 4JAUA 5LHHA 3B77A 4H44B 3JATA 1VQ5V 1FKAO 4H33A 4NR1A 1M5IA 1IX9A
chains in the Genus database with same CATH topology
2KG7B 3HR0A 3TXQA 3ZBHA 3G80A 3TXSA 3GWKC 2B9ZA 2VS0A 3FD9A 3FAVA 4ABMA 3OGIB 4I0XA 3Q4HA 2AZ2A 3GVMA 3Q4HB 4I0XB 3FAVB 1WA8A 4LWSA 2VRZA 4GZRB 2DE0X 2AZ0A 1WA8B 2KG7A 3O9OA 4LWSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG7 B;  3HR0 A;  3TXQ A;  3ZBH A;  3G80 A;  3TXS A;  3GWK C;  2B9Z A;  2VS0 A;  3FD9 A;  3FAV A;  4ABM A;  3OGI B;  4I0X A;  3Q4H A;  2AZ2 A;  3GVM A;  3Q4H B;  4I0X B;  3FAV B;  1WA8 A;  4LWS A;  2VRZ A;  4GZR B;  2DE0 X;  2AZ0 A;  1WA8 B;  2KG7 A;  3O9O A;  4LWS B; 
#chains in the Genus database with same CATH topology
 4CZZ A;  2IU0 A;  3VQW A;  1AJN A;  2WLJ A;  4N21 A;  1GN3 A;  1RPR A;  1U97 A;  2PI5 A;  4OXS A;  4W4L A;  3ZS8 C;  1RSO B;  1YIT V;  3ZJZ A;  3HKB A;  2ITC C;  2NLJ C;  3ASO C;  1Q86 W;  2EJR A;  3K3W A;  5LMU B;  1YHQ V;  2QSA A;  1D5N A;  2EIK C;  1SQV H;  1R1B A;  1X4T A;  3ZED A;  4JI8 B;  4K8X A;  3OR7 C;  4BAY A;  5AG2 A;  1QQC A;  4ZBM A;  2Y0I A;  1N33 B;  2N04 A;  2BCC H;  2HP8 A;  4JYY A;  1IXM A;  1BHA A;  5EIB C;  2YIB D;  3D36 A;  2GBO A;  4XDL A;  4MVQ A;  2WLH A;  4Z1M G;  2P90 A;  2CK3 G;  4YJ3 A;  3JAK A;  2Q0A A;  1I5Y A;  1YDX A;  4PA4 A;  3GVM A;  4I5S A;  4J10 A;  3ZMZ A;  1K8A W;  1ORQ C;  3B8N A;  4CC5 A;  4ASU G;  4RWU A;  1RFY A;  5IJ0 B;  4BIZ A;  5BR8 B;  3SPH A;  2Q7E A;  1I94 O;  2Z0A A;  4JYB A;  4O4I B;  3SYC A;  4W4K A;  4FFB B;  1M90 W;  2UUA B;  3OE7 G;  1RM1 B;  3WG7 C;  4I0X A;  4I4T A;  3H01 A;  1HR0 O;  4EFE A;  5KUK A;  1RPO A;  2UUB B;  4JI8 O;  5H9C A;  1SQX H;  1THZ A;  3IC7 A;  4LFA B;  1VQ7 V;  3HKC B;  4X1K A;  1K5S A;  2DWE C;  2YIA A;  2P22 C;  4CH6 A;  1H2S B;  3W7T A;  3JD0 A;  5B1N A;  1XNR O;  3I55 V;  3D36 C;  2E5L B;  1WB8 A;  1DK1 A;  3W7X A;  2BTO A;  3ABU A;  1R3J C;  2YXH A;  1GRJ A;  1B6Q A;  3UO2 A;  1PNM A;  2PGG A;  3W7S A;  4TQD A;  3F5W C;  2Y4T A;  3ABL B;  3JAT B;  2UUC O;  1ZX3 A;  3ASO B;  1KUQ A;  4LFB O;  3E2E A;  2QM4 A;  1QBZ A;  3UT5 A;  4ZOL A;  1HNZ O;  4BR6 A;  1SC5 B;  5E79 Z;  1V55 C;  4TV9 B;  1XNQ O;  3E8H A;  1KMI Z;  3AG2 B;  3FX7 A;  3LDC A;  3E86 A;  4J80 A;  1EN4 A;  3KG2 A;  4J42 A;  3RYF A;  2W0F C;  1TAE A;  2XHB A;  5LGT A;  1K34 A;  3ABK B;  2IBZ H;  3OEH G;  1N0N A;  1HR0 B;  3ABM B;  1EFR G;  4WBN B;  2ATK C;  4DV7 O;  5KUM A;  4LFA O;  2WLL B;  1P49 A;  5K1P A;  4RQF A;  1JJ2 U;  4LFC O;  4GKJ O;  1JVM A;  3CYO A;  4AHC A;  1SS3 A;  2AZ0 A;  1JFF A;  4O2A B;  3FB7 C;  1AI6 A;  2X6C A;  5H5N A;  1G8M A;  2P67 A;  2JS3 A;  3ZBH A;  5LA6 A;  3CXH F;  5CMU A;  3JAW A;  4X64 B;  1YJW V;  1WB7 A;  3AK3 A;  4DV1 O;  4I0X B;  4JI7 O;  3DXR A;  4X1Y B;  5GON A;  1U96 A;  4QE7 A;  3H1H H;  4LBE C;  1TA8 A;  1F7Y A;  1Y74 A;  2IW5 A;  4NXN O;  2WA4 A;  2LFR A;  2E74 B;  3P32 A;  3VBB A;  3OUF A;  1VP7 A;  1QVF U;  2YS8 A;  2ZE6 A;  2QWP B;  2FL4 A;  4HNA B;  5K1X A;  4J9Z B;  3WU2 Z;  3UM7 A;  4PA7 A;  1CXZ B;  1S76 D;  3NXS A;  1E1Q G;  4MTF A;  4CC6 A;  4AQY O;  1BQ0 A;  3SR2 C;  1Y4M A;  3CCU V;  2HJF C;  4BW9 A;  1WNS A;  2ADQ B;  1P4R A;  4CS2 A;  4JTA B;  3ZRW B;  4C7U A;  5ITZ B;  5JJE B;  1OV9 A;  2KKW A;  4HYO A;  3A8T A;  3O65 A;  5CA1 B;  2DQ3 A;  1VF7 A;  3WFV A;  5EBW C;  1WA8 A;  2QM8 A;  5IJ9 A;  3G6B A;  3SYO A;  3ZHQ A;  1Z5V A;  3JAK B;  5L3E A;  2DYS B;  2QWN B;  2Y4U A;  5LYJ A;  3ETQ A;  3M8A A;  3J7A U;  4DR1 O;  4FMT A;  2EIM B;  3CRR A;  4D6T H;  4DXW A;  1Q7Y W;  4GLX A;  4WFE A;  2GSM B;  4H37 A;  2VWJ A;  3CRM A;  2RDC A;  1ZTE A;  1D2D A;  2Q9L A;  1BHB A;  1FYJ A;  1NTZ H;  2KG7 A;  3BAB A;  2QTS A;  4UCR A;  3JCZ A;  5CN0 A;  3UO3 A;  3X2Q B;  4EB6 B;  3CEI A;  5IYC O;  1BGY H;  2HG5 C;  4ZI7 B;  3ZCC A;  5DEC A;  5CA0 A;  4I7Z B;  3OMA B;  3MAQ A;  3IAY A;  3HKC A;  4MVO A;  4DW1 A;  2AGA A;  5LBQ A;  3CC2 V;  3K5N A;  1S72 V;  4DYL A;  1OCZ B;  3E83 A;  1H2M A;  3RW0 A;  2QWO B;  4YHH O;  2ZR2 A;  3CME V;  1WLE A;  3DC5 A;  2M7W A;  3SPC A;  4MVR A;  1HDJ A;  1TGO A;  5CB4 A;  5DM6 V;  5IYD O;  1ZL8 A;  1Q43 A;  3T1Y B;  4GKJ B;  2KG7 B;  3BAA A;  3JSL A;  4LF6 O;  3OTO B;  3CCR V;  2F95 B;  4TV9 A;  2UXB O;  1MAB G;  2BE3 A;  5KLV H;  2W6J G;  4I4T B;  4LF8 B;  1EZV H;  4DV4 B;  1NTM H;  1DF5 A;  2GTA A;  2ZIO A;  1AR5 A;  2QA4 V;  1W2B U;  2UU9 B;  2EX3 A;  5EBL C;  4BW5 A;  4HAM A;  1FXK B;  1Z5W A;  4X20 A;  2EBO A;  3N2G A;  4PV1 B;  3U11 A;  2EIJ B;  2P5O A;  4OX9 O;  2UUA O;  1YJN V;  5C93 A;  3ABM C;  1RSO A;  2BOB C;  4P9O A;  3KCY A;  2YUA A;  5L3D A;  4R8C A;  2Q4P A;  4KHP O;  2EIK B;  3ZHT A;  3HKD A;  3H1I H;  3M99 B;  2PY5 A;  2DYR C;  4DV3 O;  4J41 A;  2R70 A;  4EKW A;  5JH7 A;  3JAS B;  1Q82 W;  5LP6 B;  3L70 H;  2ZNI A;  4DV6 B;  3ZMU A;  1MNG A;  3G67 A;  4U7O A;  2A9H A;  3E8G A;  2JGU A;  4JV5 B;  2JEX A;  5KA6 A;  2A06 H;  1AJP A;  2UU9 O;  3DC6 A;  2UXD O;  4JI0 B;  3K08 A;  4MT8 A;  1R6T A;  1Q90 D;  4X89 A;  3H1L H;  3GWK C;  4B3T B;  2QTO A;  1YI2 V;  2KB1 A;  4GX2 A;  5FPR A;  4IYI A;  4B3S O;  3JAW B;  3AG4 B;  1LR1 A;  4DV6 O;  1K73 W;  1VF6 C;  5KX5 A;  4RQE A;  3C3T A;  4JI3 O;  5EBM C;  1XMO O;  4PA3 A;  1PL0 A;  4LR3 A;  2PUS A;  2UUC B;  3SPJ A;  3G80 A;  4DRX A;  1F51 A;  3P30 A;  2JDI G;  2WLI A;  1GO3 F;  3FYE B;  5JVD A;  5L3F A;  1AVM A;  5IY5 C;  4JYC A;  1K9M W;  1O9G A;  2CE4 A;  2YIB A;  3Q4H A;  3ZRV A;  4FM2 A;  1XQ8 A;  2Q8V A;  3CCM V;  2QM7 A;  2BOC C;  3H9V A;  2FTK A;  1HNW B;  5LMU O;  1NQT A;  2WSS G;  3JSN A;  2H94 A;  3THO A;  4J11 A;  1PPJ H;  4JI6 O;  5H6R A;  1MZF A;  4B3R O;  1R73 A;  3K0G A;  3RYH A;  5JQG A;  4X1I B;  5EYP A;  3D3Q A;  5J2U B;  5B1A B;  1PL4 A;  3OEE G;  1H2G A;  3UT5 B;  1K3E A;  1AB3 A;  3SYP A;  3NR7 A;  3AG4 C;  2JRI A;  2YI8 A;  4EEQ A;  1IZ3 A;  2GTS A;  5LMN O;  2ZE8 A;  2LGQ A;  2UXC O;  1YZB A;  2JEU A;  4LWS B;  1VQP V;  4IHJ B;  4FLY A;  2ZE7 A;  3QO8 A;  2ZE5 A;  2K9P A;  3HKE A;  2F43 G;  3L75 H;  2MK3 A;  3CCE V;  1M57 B;  3BY6 A;  1KU9 A;  2FB5 A;  4MSW C;  4HBN A;  2HHH O;  3N2G B;  1VQ8 V;  1YTF D;  2LFS A;  3K58 A;  1KKC A;  4TV8 A;  4L87 A;  2WAM A;  5B1B C;  1IVS A;  1UFI A;  3SPI A;  2Q7H A;  1Y67 A;  3X2Q C;  1M9N A;  3N2K A;  3F5T A;  1N32 O;  4LFC B;  3D8C A;  2N74 A;  3WB0 A;  5LP6 C;  5KAF Z;  4X62 B;  1R3I C;  1R6N A;  3FKS G;  1XMQ B;  2DYR B;  1XUQ A;  4XDK A;  5GTI Z;  1MSW D;  3SYA A;  4JI5 B;  2GDS A;  2PZS A;  4CS4 A;  4DR6 B;  4DV5 B;  5LGU A;  5DED A;  3ZRS A;  3CJH A;  1NZ6 A;  2DW4 A;  4AIL C;  2LQT A;  4MVZ A;  1NT2 B;  2D2C B;  4UCO A;  4Z2W A;  2MW2 B;  1FPO A;  4LF5 B;  3ETG A;  1S3J A;  3CC4 V;  3H1K H;  1MOF A;  3PJS K;  2P7T C;  2OTL V;  1SQP H;  3K03 A;  3PN1 A;  4PJ0 Z;  1FD9 A;  2DN9 A;  1M56 C;  2B5U A;  4B7K A;  3JAR A;  1ZUQ A;  3FFQ A;  4FZ0 A;  4QIW F;  3RWR D;  1M4U A;  2HJD A;  4B7E A;  1YJ9 V;  4YIP A;  5BXZ A;  5EYP B;  2HLD G;  3CRA A;  2B1I A;  4D7S A;  1COW G;  3CRC A;  1TUE B;  1I5X A;  5LHG A;  1NKD A;  5FLX N;  1BCC H;  3SJA C;  1AI5 A;  3E22 A;  4CH3 A;  2OTJ V;  1VQ9 V;  2V1D A;  3DSQ A;  4DRX B;  2R9I A;  3CC7 V;  5DN6 G;  5FNV A;  4RUF A;  1URF A;  2YDE A;  3T4D A;  1AP5 A;  3CCS V;  3Q4H B;  1YCI A;  2AXT Z;  3FB6 C;  4RAI A;  3AK1 A;  3OW2 U;  2IJJ A;  4KL1 A;  2WLI B;  1M56 B;  4UV8 A;  4MVS A;  3B40 A;  4J7Z A;  2WLN A;  1GAX A;  2IM9 A;  4UFZ A;  2E5L O;  1KEC A;  3IGA C;  4G2K A;  2NNU A;  4FFB A;  3HKD B;  1L0L H;  1Q3E A;  5JWP A;  2VRZ A;  3OD4 A;  4DV1 B;  2XAH A;  3OMN B;  5C8Y A;  3ZHV A;  2VQE O;  2Z5U A;  3RT3 C;  3VOU A;  4LH7 A;  1M1K W;  2P4V A;  1K5Q A;  4F6R A;  1I94 B;  4UB8 Z;  1BQZ A;  3OGC C;  2ZM6 B;  4G27 B;  1WP8 A;  4U3J A;  4X1K B;  5HFM A;  2UXB B;  2CTW A;  5J2T A;  2XAQ A;  3AG3 B;  3E8F A;  1ARO P;  4QPK A;  4UXN A;  2GHY A;  2XAG A;  3AG2 C;  4ICG A;  2IJI A;  2DYS C;  5BMV B;  1BS3 A;  1EN5 A;  1KP2 A;  4YXW G;  2ZNJ A;  4O4L A;  1GM7 A;  3I56 V;  5ITZ A;  4DV7 B;  4GKK B;  3ZMT A;  2HVJ C;  1SER A;  4JAV A;  4ZIB A;  3AEI A;  4UCT A;  5L3B A;  4EFB A;  4K35 A;  3VQX A;  4PA9 A;  4O2A A;  1H2L A;  4FM1 A;  4X64 O;  4UUJ C;  4IHJ A;  5KMG B;  2W0X A;  2FKX A;  1XIL A;  4NKG B;  1M93 A;  1OCO B;  4PDL A;  3JD2 A;  1EZJ A;  1K7D A;  4LF4 O;  2QKC A;  1S77 D;  2E76 B;  3STZ C;  4I50 B;  2PI4 A;  4A5U B;  4R6Z A;  1ZWI C;  1KQS U;  4OPH A;  2EJ7 A;  2Q69 A;  1SF9 A;  1XMO B;  3BA8 A;  1BSM A;  1T5E A;  2B9Z A;  4F4L A;  2X7R B;  2LGW A;  2X6B A;  2Q5Z A;  1WN7 A;  4R7C A;  1YVW A;  4FLV A;  1X59 A;  1FXH A;  2LW1 A;  1H2K A;  3KCX A;  3T2M A;  1QLE B;  3CB2 A;  3CD6 V;  1AR1 B;  3CCJ V;  4FLZ A;  1B3Q A;  4LC1 A;  1AIL A;  1IDS A;  3LUT B;  2M6Y A;  4G28 B;  1I7F A;  3P3N A;  3ZMV A;  1B06 A;  1NU1 H;  3CRQ A;  5IYZ B;  4TUY B;  5FPO A;  1NS1 A;  3J81 N;  5F2V O;  4KFM A;  1Y66 A;  1YEW A;  4UVA A;  3ZN0 A;  1H8E G;  3B8M A;  3UCS C;  2YSU B;  3WB2 A;  1K4C C;  3SYQ A;  5LOV B;  4J9Y B;  1TVK B;  4P2Z A;  2AW9 A;  1H38 A;  3CE2 A;  3K5O A;  3CP1 A;  3TET A;  2L35 A;  1IBM O;  2UXD B;  4IL6 Z;  4DW0 A;  3G6E V;  2B1G A;  1AI7 A;  4HZ3 A;  1US6 A;  1WPB A;  3APO A;  5A2Q N;  1HNX O;  4ZHQ A;  3E22 B;  2PYJ A;  1JX9 A;  4UV9 A;  3SPG A;  1XI1 A;  1NVP B;  4GX5 A;  3VQY A;  1YSC A;  1HNZ B;  1QCE A;  3A0B Z;  4JI7 B;  1N33 O;  5IYZ A;  2F23 A;  1K4D C;  3CJH B;  2PYL A;  4DR7 B;  1K92 A;  2KQX A;  4B3M O;  4I55 B;  4LF7 B;  1FJG O;  5KAI Z;  2DE0 X;  3T1C A;  3K5L A;  3RVZ A;  1QU7 A;  4FLW A;  3OTF A;  3OR6 C;  3C3S A;  4YY3 B;  1VEW A;  1BMF G;  1PD3 A;  5J9P C;  1NR7 A;  2AZ2 A;  4WFH A;  5IJ0 A;  1Q6U A;  3EVK A;  5H2F Z;  1OCC C;  4JZG A;  1G6U A;  1SES A;  1BZK A;  2C2A A;  1Y76 B;  4NTX A;  2HHH B;  4MVM A;  1FFT B;  3ZHU A;  4IYH A;  3MD0 A;  3B2E E;  3HKE B;  2JGD B;  2X6A A;  3SJC C;  2EZP A;  2XND G;  3JAS A;  1GK9 A;  3OM3 B;  4IIJ A;  2W6I G;  4JI1 O;  3BRC A;  4DR1 B;  3QVN A;  4JAA A;  1K97 A;  1J5E O;  3ZHR A;  4TSF G;  4QGP A;  1DTO A;  3HPL C;  4DUY O;  3T1Y O;  2EIL C;  2ZKO A;  2Q67 A;  2Y48 A;  3BEH A;  4PDM A;  3E8B A;  1KC8 W;  4DR3 B;  1SA0 B;  1SRY A;  4GCZ A;  1DF4 A;  2ARH A;  3LSS A;  1W59 A;  2O57 A;  4CBC A;  2ZD9 A;  4O4J B;  1W0J G;  4I9W A;  3RYF B;  2V7Q G;  2ZCE A;  3BCC H;  1IBL B;  3JD4 A;  2OIG A;  5D5P A;  2JIZ G;  1A32 A;  2Y69 C;  1HNW O;  1FFX A;  5IT9 N;  2NN4 A;  1KB9 F;  5B5E Z;  1VQL V;  2XAJ A;  1L1F A;  4ZOL B;  3TGU H;  4DR5 B;  1IBK B;  2QE7 G;  3GB7 C;  2ZDI A;  2BSK A;  4K0K O;  2YXL A;  3CSX A;  1NR1 A;  2ODM A;  3ABT A;  4KP4 A;  3WB1 A;  1P7B A;  5B66 Z;  1VQN V;  5IE9 A;  4JI4 B;  4I9Q A;  3TXS A;  1QNM A;  1TUB B;  1XEQ A;  3T1H B;  2YC0 A;  1RP3 B;  4TQF A;  4BIO A;  1UPG A;  3J80 N;  2DQ0 A;  1I0H A;  3A0R A;  3AG3 C;  3JAM N;  3RGB A;  3TCU A;  5LL6 Y;  3SDL A;  2F93 B;  2NR5 A;  3QG5 A;  2V4D A;  2XAS A;  2ZM6 O;  5B1O A;  2EIM C;  3OFN G;  4Q20 A;  4Z1V A;  2D3O W;  5JCO C;  1SQQ H;  3LNN A;  1F4M A;  2G38 A;  3P3P A;  2BTQ B;  4WFG A;  4WFA V;  3DGE A;  5CA1 A;  1DLB A;  3AG1 B;  2HFE C;  1WA8 B;  4DR6 O;  1R3L C;  2PTM A;  5EC1 C;  1TUB A;  4X65 B;  5LGN A;  1EN6 A;  3OGI B;  3ZX6 A;  2HR3 A;  1QLE C;  1MSD A;  3CMA V;  4H13 B;  5B3S C;  3L9D A;  4QPJ A;  2P6J A;  1VQM V;  2XUM A;  4JI3 B;  3N2K B;  5HFL A;  5E1A C;  2F4V O;  3MHS C;  5JJN B;  1VQ6 V;  1N34 B;  2IH3 C;  3L73 H;  2WLM A;  2RNB A;  1OZ0 A;  2QWQ B;  1NBM G;  2Q0O C;  4I55 A;  4K3A A;  1CP9 A;  3DXR B;  4F6E A;  5CBF A;  1Y74 B;  3B4S A;  3SJQ C;  1SZT A;  1OCZ C;  3MHH C;  4GX1 A;  4DR4 O;  2UXC B;  2RCV A;  3K0D A;  3QO5 A;  4DV4 O;  1OHH G;  1F4N A;  4NTY A;  1BT8 A;  1HWY A;  1JCH A;  1LUV A;  3AG1 C;  1QVG U;  5EK0 A;  5JQG B;  3CCQ V;  2JK5 C;  4IIJ B;  4DK0 A;  2ITD C;  4PDV A;  2QJ1 A;  4GZR B;  1GM8 A;  1N4C A;  3G4S V;  2E75 B;  2F1M A;  4P30 A;  4JI4 O;  3S3W A;  2FYU H;  2BTQ A;  4X1I A;  5BR8 O;  4YHH B;  1JFF B;  1Y76 A;  4GT1 A;  3LSQ A;  3E35 A;  2QKS A;  1HP8 A;  3K79 A;  4JYA O;  3EFF K;  4X1Y A;  2QEX V;  4OGQ B;  5CBH A;  1V54 B;  4PD4 F;  2AHY A;  4L8J A;  1N36 O;  4X8A A;  2EIN B;  2HEP A;  2K1E A;  4LWS A;  3RN4 A;  5C8Y B;  5TIS Z;  2UUB O;  2XTA A;  2EUL A;  2ZXW C;  3KKY A;  2JJ2 G;  1R6K A;  4TV8 B;  2VQE B;  2RMK B;  1Q8I A;  4NVP A;  3ZRX A;  5LOV A;  1WAZ A;  1ROP A;  1N32 B;  1B04 A;  5JCO A;  1EM1 A;  3CCV V;  4FIP C;  4X66 B;  4UVC A;  1YXB A;  3JAR B;  3ETE A;  2VQF B;  4JI6 B;  5FL7 G;  3T4Z A;  4FJC C;  3ML0 A;  3F7Y C;  3M7M X;  1OCR B;  4LFB B;  2QGN A;  3BA9 A;  4JGS A;  1PKX A;  4O2B A;  3K59 A;  3IJ4 A;  4MW8 A;  1PV0 A;  2Y69 B;  4I50 A;  5H6Q A;  1SQG A;  5LMN B;  3K9S A;  1SKV A;  1E79 G;  1J95 A;  4LNU B;  2BSK B;  4YIO A;  2CH7 A;  4LF5 O;  2A0L A;  1RM1 C;  4D7T A;  1N8R W;  3ZN1 A;  4IGG A;  4KHP B;  5KHH A;  1AJQ A;  5EZY B;  3FD9 A;  1N36 B;  4ABM A;  4DV3 B;  1L0N H;  5LYJ B;  4O4H B;  1IXB A;  2VWK A;  4LF4 B;  4KXR A;  1MA1 A;  2XAF A;  1XHX A;  3CCL V;  5EC2 C;  3K04 A;  4TUY A;  1VF5 B;  4UB6 Z;  5IY5 B;  3HR0 A;  2OT5 A;  4JV5 O;  4R50 A;  1XOU A;  4X66 O;  4LF7 O;  4PDR A;  2VS0 A;  4JTC B;  3FAV A;  3ASN C;  3JAL B;  1VQK V;  1F23 A;  1S5L Z;  3CHX A;  2Q6A A;  2WPD G;  1DGS A;  1SQF A;  5KA5 A;  1ZLZ A;  2JJ1 G;  3FAV B;  4DK1 A;  2L6L A;  4OPA A;  1XHZ A;  2R9R B;  3K06 A;  5LXT A;  1FXK A;  3CXC U;  2YIC A;  3AK2 A;  5JH7 B;  2OCH A;  1R3K C;  3H1J H;  3HB3 B;  2YI9 A;  1VAR A;  5JJJ B;  1CPY A;  1GN2 A;  1XNR B;  4X20 B;  3ICX A;  3BFR A;  4CS3 A;  4DO2 A;  1VIB A;  4QJF B;  2QKA A;  3I5D A;  4UVB A;  4JYA B;  1ZAU A;  3APQ A;  4NTW A;  1QLN A;  4U3J B;  3BVO A;  4O4L B;  4JI0 O;  3QF7 A;  4MS2 A;  3DTU B;  5IDJ A;  5BMV A;  1CEZ A;  4LF9 O;  3BHP A;  2OYQ A;  4YJ3 B;  1V55 B;  1I08 A;  2WLL A;  4TOI A;  4CH5 A;  1PNK A;  2XT9 A;  3ZHS A;  3ABL C;  4NXN B;  4PEL A;  4BIU A;  4NB5 A;  1M57 C;  3D3I A;  4JPR A;  2CTQ A;  5LA6 B;  1YTF B;  5JVD B;  4DR2 O;  2OCC B;  1GMG A;  2RN9 A;  4JI5 O;  4O4H A;  1IBL O;  4RO2 A;  1S5H C;  2KSD A;  4LF9 B;  4DR7 O;  3OAA G;  5KHG A;  3LSU A;  4GKK O;  2EIJ C;  1FS0 G;  3UQ8 A;  3WG7 B;  4Q6G A;  3L71 H;  4XBF A;  1XL6 A;  3ASN B;  3O9O A;  4BWA A;  3CX5 F;  2WWW A;  1FXK C;  1K33 A;  2LW7 A;  1SA0 A;  1E1R G;  3GWO A;  4B08 A;  4B3T O;  1Q6I A;  2F66 C;  2A79 B;  1LUW A;  1G4Y B;  1Z2G A;  1AI4 A;  1NJI W;  1JJO A;  4ZHQ B;  1FFX B;  1AR4 A;  1NVP D;  3STL C;  1FJG B;  4P9P A;  2JGD A;  3QTC A;  1SET A;  4O4J A;  1JMK C;  5KMG A;  4FM0 A;  2CAZ C;  2N05 A;  2ZIM A;  5A9G A;  3ZMS A;  2CUG A;  2UXX A;  5KHJ A;  4H0L B;  1N34 O;  1JOY A;  1KP3 A;  4MVU A;  1OCC B;  4O4I A;  1UJW B;  4JZ2 A;  1QR9 A;  2YID A;  4AQY B;  3CPW U;  3TJT A;  2AHZ A;  2QR4 A;  2XOK G;  3JD3 A;  1L8D A;  2IU3 A;  1J5E B;  2OWO A;  2OCC C;  1GM9 A;  1VQ4 V;  5IWA O;  4JI2 O;  1OCR C;  4WCE V;  2H3O A;  4TWK A;  3RVY A;  1IBM B;  3RBZ A;  3ZIA G;  1VF6 A;  1GN6 A;  4X65 O;  1N0J A;  4NXM O;  2GUZ B;  5IJ9 B;  4HNA A;  3EHB B;  3TK1 A;  3RYC A;  1D5A A;  5CA3 A;  4WF9 V;  1S0V A;  1Q5O A;  4DR5 O;  2F4V B;  2ZR3 A;  4FLX A;  2EIN C;  1Q6H A;  3G71 V;  1G1X B;  2DMX A;  4MTG A;  2JS5 A;  3FYI B;  1V54 C;  1JPX A;  4LH6 A;  1WPX A;  1H2N A;  4DUZ O;  5IYB O;  2JVD A;  4QE9 A;  5BY1 A;  5GTH Z;  2Q68 A;  3SJB C;  3R66 A;  1XDC A;  1O9H A;  2OIE A;  4CH4 A;  2EZO A;  2YEV B;  5KHK A;  2Y0P A;  5CB4 B;  4X62 O;  1XNQ B;  5L3G A;  4X9Q A;  5GW7 A;  1HW7 A;  2IH1 C;  4WFB V;  2WA3 A;  1KYO F;  4DV0 B;  3RFR A;  1S5J A;  2LO1 A;  4KUM A;  3A0H Z;  4DV5 O;  3JCU Z;  2PF4 E;  5FNV B;  5LXT B;  4DR2 B;  3RYC B;  1QHT A;  1P84 F;  3RYI B;  4U7N A;  3L72 H;  5EZY A;  1ZL8 B;  4DR4 B;  4WBN A;  3F7V C;  2R72 A;  3AG7 A;  4DV2 B;  1H8H G;  2H8P C;  3SGI A;  2CTP A;  1XL4 A;  3OT7 A;  4JTD B;  4UCS A;  1GTO A;  5GON B;  4LF6 B;  4FLT A;  3CS5 A;  4WFF A;  2FML A;  1WJZ A;  4O2B B;  5BZB A;  4YY3 O;  5B3S B;  1OCO C;  3K57 A;  5CA0 B;  2DJV A;  2RQ6 A;  1GN4 A;  2ZIN A;  3TXQ A;  2E3C A;  3LNM B;  4LP8 A;  3KZI Z;  4EB6 A;  1P7G A;  2LP7 A;  3ETD A;  4B3M B;  3OMI B;  4E4E A;  4ZI7 A;  1XBL A;  3BPZ A;  2A3Q A;  4MW3 A;  4DR3 O;  3N27 A;  4ZKI A;  3U0Z A;  4FPP A;  4K8Z A;  4NXM B;  1W0K G;  4PA6 A;  1Q81 W;  3K5M A;  3IFX A;  1EBO A;  2ZDI C;  3S3X A;  4B3S B;  4J7J A;  4MTO A;  2QDO A;  4JI1 B;  2A7W A;  2ZXW B;  3IC9 A;  4RUE A;  4DV2 O;  4DUY B;  3ABK C;  2GV9 A;  2ETN A;  1IBK O;  5LP6 A;  5CBG A;  4FVM A;  4X88 A;  2WLK A;  4FFK A;  2YEV A;  1OJH A;  3JAL A;  1GH6 A;  2R9A A;  2UXN A;  4DUZ B;  2P06 A;  4N23 A;  3RYI A;  4FK5 C;  3W7W A;  1V9P A;  2IJH A;  3OTO O;  2YXY A;  3ZRW A;  1ZSP A;  1BL8 A;  3LDE A;  3FB5 C;  3E89 A;  1FXV A;  2X0L A;  3U10 A;  1NI8 A;  5B1B B;  1SZX A;  4PHZ A;  3T1H O;  2CDY A;  3FB8 C;  1NH2 D;  1NTK H;  2GUZ A;  4GYC B;  1PP9 H;  4FZ1 A;  4J7K A;  1JR9 A;  1YIJ V;  4B3R B;  2HKO A;  2LJ2 A;  3W7U A;  1VMG A;  4LCU C;  1VQO V;  1AP6 A;  4MTX A;  4QNH B;  2DOS A;  1ENV A;  1NH2 B;  3K9A A;  2CGN A;  2RJZ A;  4OX9 B;  4JF3 A;  2CTR A;  4LF8 O;  2VQF O;  1PNL A;  3JYC A;  5B1A C;  4AI8 A;  5KHI A;  2DWD C;  4PI2 A;  1KKD A;  5D5Q A;  4DV0 O;  4K0K B;  2EIL B;  4F6R B;  3L74 H;  4GUN A;  3VQV A;  5J2U A;  4UCU A;  5L3C A;  3C90 A;  1JA8 A;  2ILM A;  1JQ0 A;  2Q7G A;  2ADP A;  1MG1 A;  1SQB H;  3QO7 A;  2P4K A;  5J2T B;  4LNU A;  3LDD A;  3A2F A;  1Y6X A;  4E2L A;  1KD1 W;  1FAF A;  4JAS A;  1MZE A;  3RYH B;  3EXA A;  4TT3 G;  3UKM A;  5LHI A;  1TVK A;  4FLU A;  3OUS A;  1LNQ A;  4YJ2 B;  2CGO A;  4U3F H;  1MMM A;  1PM9 A;  3HKB B;  3MDS A;  3R65 A;  3QNE A;  4YJ2 A;  1KBH A;  1GKF A;  1BE3 H;  3CWB H;  1HNX B;  1QR8 A;  2ZT9 B;  3JD1 A;  2Q73 A;  2HVK C;  5EIB D;  4GX0 A;  4UCV A;  1IUR A;  2Z3Y A;  4IT5 A;  1XRE A;  2QWR B;  1WP7 A;  4PI0 A;  3B09 A;  4NYK A;  1XMQ O;  4XDJ A;  2ZQM A;  5IWA B;  4JI2 B;  5KX5 B;  2IJK A;  2CH7 B;  1YF2 A;  4JAU A;  5LHH A;  3B77 A;  4H44 B;  3JAT A;  1VQ5 V;  1FKA O;  4H33 A;  4NR1 A;  1M5I A;  1IX9 A; 
#chains in the Genus database with same CATH homology
 2KG7 B;  3HR0 A;  3TXQ A;  3ZBH A;  3G80 A;  3TXS A;  3GWK C;  2B9Z A;  2VS0 A;  3FD9 A;  3FAV A;  4ABM A;  3OGI B;  4I0X A;  3Q4H A;  2AZ2 A;  3GVM A;  3Q4H B;  4I0X B;  3FAV B;  1WA8 A;  4LWS A;  2VRZ A;  4GZR B;  2DE0 X;  2AZ0 A;  1WA8 B;  2KG7 A;  3O9O A;  4LWS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...