3Q4HA

Crystal structure of the mycobacterium smegmatis esxgh complex (msmeg_0620-msmeg_0621)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
90
structure length
90
Chain Sequence
b'DAHIPQLIASEANFGAKAALMRSTIAQAEQAAMSSQAFHMGEASAAFQAAHARFVEVSAKVNALLDIAQLNIGDAASSYVAQDAAAASTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pe family protein
molecule tags Metal transport
source organism Mycobacterium smegmatis
publication title Heterologous expression of mycobacterial Esx complexes in Escherichia coli for structural studies is facilitated by the use of maltose binding protein fusions.
pubmed doi rcsb
total genus 38
structure length 90
sequence length 90
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3q4hA00
3O9OA 1WA8A 4I0XA 3Q4HB 3G80A 2B9ZA 4GZRB 3FAVA 2AZ0A 4LWSA 3HR0A 2VS0A 3TXSA 4I0XB 3TXQA 3OGIB 3Q4HA 4ABMA 3GVMA 3FD9A 2VRZA 2KG7B 3ZBHA 2DE0X 3GWKC 2KG7A 1WA8B 3FAVB 4LWSB 2AZ2A
chains in the Genus database with same CATH superfamily
4GKKB 1W2BU 5KMGA 3CCUV 3M99B 2E76B 4J11A 3TJTA 1K34A 5L3FA 3FB8C 2YICA 3ZHRA 4GX1A 2IJJA 2DJVA 1GM9A 3BABA 4PA4A 4TQFA 3EFFK 3U0ZA 1G1XB 1IXBA 2P67A 2DE0X 1YIJV 3B40A 4LFAB 2Q9LA 4JI1B 1WA8B 1YVWA 2M7WA 4Z1VA 1N36B 1V55B 3CP1A 4YIOA 1KB9F 5FPRA 1HNWB 2ITCC 2Y69C 1N32O 3LDEA 2WA3A 3RGBA 3RN4A 4J10A 4J41A 2CGOA 4JI3B 1VQKV 2Q6AA 4UCSA 3ABKB 4PDLA 1XUQA 2PTMA 3OMNB 1ENVA 2QWRB 5LA6B 4NXNB 2HVKC 5EZYB 2RMKB 4KHPO 2JGUA 1Z5WA 3RWRD 4LF7O 3E2EA 4O4HA 1JVMA 3DXRB 2LFRA 5KUKA 1LNQA 5A9GA 4JI7B 1MZEA 3JASB 1AR5A 4FLUA 4YHHB 4UCTA 2JS5A 4RWUA 1NTZH 3C90A 5CBFA 1H2SB 4MVMA 1D2DA 2AZ2A 2UXCO 3P30A 4Z1MG 2FB5A 1BHAA 1K92A 3JAKB 4UCVA 2F23A 2HJDA 2ADQB 4FPPA 3CEIA 2UXXA 3B2EE 3X2QB 4LNUB 4JYAB 2ZE6A 4YY3O 2RJZA 3SYAA 1SQPH 1FXKC 1X4TA 4LF4O 4MTGA 3G71V 2A06H 1QVFU 1XNQO 3ASNB 2QTSA 2V7QG 2ZDIC 5EYPA 1KP2A 1WJZA 5JVDB 2ZQMA 3F5WC 1VQ6V 2BSKA 2BTQA 3HR0A 1JFFB 2ADPA 1F4MA 2HFEC 3NR7A 4I55A 3OTFA 2F93B 2X0LA 1TVKA 3L75H 1VQ8V 2B1IA 3OMAB 2R9IA 1VQLV 3T4DA 2QA4V 4FFBB 4R50A 3O9OA 1WPBA 4QPKA 3JSNA 4U7OA 1R3IC 4PI2A 4X1KA 3ZMZA 2EBOA 4LR3A 2LW1A 4RUEA 1QNMA 3EVKA 3RYCB 1VQ4V 1GN6A 3E86A 3ZN1A 1THZA 3CC2V 3LDDA 5KAFZ 3FYIB 2DWEC 2DW4A 2UU9O 2CTWA 5IY5B 1E1RG 4DR5O 3APQA 2VQFB 1V54B 3QF7A 1D5AA 2GUZB 1P7GA 2LJ2A 1KQSU 2UXBO 1NKDA 2H3OA 4RUFA 1MZFA 5IJ9A 2EJ7A 1H38A 1JR9A 4J7JA 4X65B 3ETGA 1SS3A 1VF6A 1NTMH 1VQPV 3C3TA 2K9PA 4GT1A 1FD9A 2QSAA 4IHJB 2YC0A 3T1HO 4FLXA 2CDYA 3ZHTA 4LF7B 1CEZA 1TUBA 2QEXV 3QO5A 4LF8B 4DXWA 4FZ1A 2LO1A 1BQZA 2YI9A 2O57A 1OCRB 2IJHA 5JVDA 4WFEA 2Y4TA 3CCVV 3P32A 1PP9H 1W0JG 1VARA 4IGGA 5GONA 4X1YA 2CUGA 1OZ0A 1Q5OA 3ASOB 2Y48A 3L9DA 3JSLA 2KG7A 3E83A 3ZHQA 4IL6Z 2JJ1G 5L3EA 3CCRV 2IU3A 4LF6O 1R6KA 4JI7O 2K1EA 2ZR2A 1FXKA 3F7YC 1BL8A 3QO8A 3AEIA 2KSDA 4WBNB 4IIJA 1KECA 1LR1A 1BCCH 1YDXA 1VF7A 1Y4MA 3D3IA 1AP6A 4I5SA 1KD1W 5DECA 1BQ0A 2IJKA 4FM0A 4PDVA 1DF4A 4X65O 2YXYA 4JV5B 4DR4B 3ZRWB 3VQWA 3CRQA 4X1YB 3TK1A 2YDEA 4D6TH 2F95B 5H6RA 1M9NA 2DN9A 2B1GA 4JI3O 4JYAO 3IGAC 3ZBHA 1YF2A 4X20B 4X20A 3UQ8A 3VOUA 3ZJZA 3ZHUA 3RYIA 3K9AA 2IU0A 2P4KA 2YIAA 1B6QA 2AGAA 1YCIA 2PYLA 4I0XB 3JAWB 3RFRA 3RW0A 4LC1A 3WU2Z 4ZHQB 4KUMA 3KKYA 5EC2C 1ZAUA 3KZIZ 3S3XA 4H13B 5CB4B 3FAVB 3JARB 2UUAO 3HKCA 4QNHB 2PYJA 2OCHA 2LQTA 4F4LA 4TV9A 3RYFA 5D5PA 4JI8B 2YSUB 1H2GA 4TSFG 4O2AA 1BMFG 3E8FA 2WLLA 1PNKA 2ILMA 3OFNG 4U3JB 5KHIA 3N2KA 2YUAA 4MTOA 4DR7O 1L1FA 1ZWIC 5H9CA 5LHGA 3K5MA 4FM1A 3HKDA 4UCRA 1Q6HA 2UU9B 3TETA 2B9ZA 3JAMN 4DV0B 4F6EA 3ZMUA 1TUBB 3ZN0A 5B1BC 4D7SA 1NJIW 4RQEA 1B04A 3OT7A 5LYJA 1NTKH 3G6EV 2OIGA 3K03A 4EEQA 1XL4A 2HLDG 3GWKC 2ZE5A 2QM8A 4IT5A 1MMMA 1E1QG 4JI0B 4B3RB 5DN6G 4NXNO 4N21A 2Z3YA 3ZMSA 5D5QA 2ARHA 4PELA 1TGOA 4QGPA 1F51A 2H94A 3TCUA 4ZKIA 4LF4B 1SQVH 3W7XA 2N04A 3K08A 3OUSA 1XNRB 5K1PA 3E8HA 3OGIB 3AG3C 4ZOLA 4MSWC 4EB6B 1NU1H 1ZL8A 4X89A 5GTIZ 2QKCA 1F4NA 4JGSA 2UXCB 1IX9A 1AI7A 1PM9A 3SPIA 4HAMA 3AK2A 1H2LA 4HYOA 4PD4F 2BCCH 2IJIA 3DSQA 3FD9A 2ZINA 2Q5ZA 1GN2A 3CSXA 5JH7A 3M7MX 1EN6A 4F6RA 4JI5O 1XI1A 1R3LC 3A0HZ 1HW7A 1CP9A 2YI8A 1G4YB 3ABLB 2UXDO 3BHPA 1AR1B 4O4IA 5KHKA 1J5EB 5CB4A 3UO3A 1M57C 3T2MA 3ZHVA 4BWAA 2GSMB 2N74A 3SJCC 4I0XA 4YXWG 5KHGA 1GK9A 3P3PA 3W7TA 1Q7YW 1OCOC 1RSOB 1S5JA 5LMUO 3E8BA 1XHZA 2EINC 2JK5C 4GX0A 1XNRO 4FLYA 2JS3A 4LP8A 4MVQA 4MVSA 3FB6C 3ETDA 1RPRA 4O4IB 1ZUQA 1EZJA 4G27B 1VQMV 3RYHA 2RCVA 3L70H 1SQXH 5HFMA 4JV5O 4P9OA 5CMUA 4J9YB 2YEVA 4K8XA 2ZNIA 4BIUA 4B3SB 2GBOA 3ZMVA 1K4DC 4WBNA 1XDCA 3UCSC 5L3GA 5J2TA 4MW8A 4BR6A 1BT8A 3CRAA 3HKBA 3SPJA 4JI5B 1FXVA 2NLJC 5FLXN 1NQTA 3DGEA 2FL4A 4X64B 2AXTZ 2WA4A 3RYIB 1Q8IA 2W0FC 3CCLV 4P9PA 2QM4A 1L0LH 2YIBD 1J5EO 2KG7B 1COWG 3BY6A 2EZOA 4A5UB 2OIEA 1P49A 3ETEA 1QHTA 3ABTA 4X1IA 5JJJB 4JYCA 4DRXB 4KP4A 5IT9N 1YXBA 1JA8A 2P6JA 4CS3A 2A3QA 1M56B 3E89A 1QLEB 4WCEV 1V9PA 4CH6A 1VQ7V 3ZX6A 3ETQA 3CRCA 5C8YA 2OTJV 5K1XA 2A79B 3JD2A 4TV9B 2XUMA 1VF6C 5BR8O 4X9QA 4UVBA 3N27A 4RAIA 1DGSA 4FJCC 4U3FH 1T5EA 2MK3A 4XDJA 1HNWO 1N32B 5AG2A 2DYSC 2EIKB 2E74B 1US6A 2EIMC 1GMGA 1AB3A 1IBMO 1K7DA 4O4LA 4GZRB 3W7UA 1M57B 5FPOA 4LNUA 3IC7A 3SDLA 5E1AC 4JI2B 3AG2B 2FYUH 1GO3F 3LSSA 1JOYA 1HNZB 1ZL8B 4CC5A 3SPHA 2GTSA 3WB2A 4K0KB 3L73H 2KKWA 4OPHA 1VF5B 4NYKA 4JI0O 4B3RO 4GKJO 5H6QA 1OCCB 3FKSG 5IJ0A 1I94O 1R1BA 4LCUC 4PV1B 2BOCC 4DW0A 4DR7B 4JI4O 5LXTA 4DYLA 2YXHA 5JJNB 3DXRA 3P3NA 1W59A 4QIWF 5J2UA 3H1KH 1FKAO 5B5EZ 5IE9A 5J9PC 1SESA 4UCOA 3K5LA 5KA5A 4DUYB 4G28B 2JGDB 2XHBA 2NNUA 4XDLA 4TWKA 1R3KC 1EBOA 2FTKA 3H1LH 2WLMA 2N05A 1NT2B 1R6TA 1I5XA 3B8MA 5KA6A 3MHHC 1MSWD 5FL7G 3PJSK 2QWNB 2IBZH 3Q4HB 3OUFA 3H1HH 1ZLZA 4DR3O 5KLVH 4J7ZA 1RPOA 3FB7C 3BPZA 4O4HB 4UVAA 3T1YO 4UUJC 3H1JH 2Q0AA 3RVYA 3CPWU 4MTXA 3HKEA 2Q7EA 4E4EA 4K0KO 2LGQA 2F1MA 3QTCA 2ZE7A 4P30A 2V4DA 3CCJV 3AG4C 4TV8A 1FS0G 1KKDA 5CN0A 4DV5O 5C8YB 4I9WA 1SQGA 1PKXA 3QNEA 3HKCB 2UUBB 5BZBA 4CS4A 3K04A 2HKOA 4X66O 5LMNB 1KC8W 1RSOA 4DR5B 1SERA 2WLIA 4LH6A 4O4LB 5BY1A 1NR7A 3SPCA 4DUZB 2PY5A 2IH3C 1NZ6A 4CH3A 5A2QN 3MAQA 4KXRA 2CE4A 3CCMV 4DUYO 2Q0OC 3CD6V 1RP3B 2XAHA 1H8EG 3TXQA 1P7BA 3ASNC 1QCEA 5LHIA 4NTYA 3J81N 2E3CA 3DC6A 4H37A 4LF5O 1YJNV 2DQ3A 3TGUH 1SQFA 2HVJC 3FX7A 2RNBA 1K5SA 4JASA 5JH7B 1YHQV 1Q81W 2OCCB 3I55V 4DV4O 2KB1A 2VWKA 1ROPA 3UT5A 5IJ9B 4J80A 3R65A 4GCZA 1RFYA 2VQEB 5B1NA 2QGNA 1QLNA 1W0KG 3QG5A 4OXSA 1RM1B 5EBWC 4PA6A 4UCUA 3S3WA 2VS0A 4GX2A 4JI6B 2P22C 1JCHA 3F5TA 5B1BB 5JCOA 1PD3A 2JVDA 2ATKC 1SQQH 1G6UA 4IYIA 2QTOA 1V54C 1UPGA 4CH5A 1EZVH 1HR0O 3EHBB 5B1OA 1Y74B 2YS8A 4LF9O 1XREA 5IYCO 4MVUA 5BXZA 1Y67A 2WSSG 4X62O 1OCRC 2G38A 1EFRG 2QWPB 2XNDG 2QE7G 3UO2A 4D7TA 4DR4O 5B1AB 5CBHA 4MVRA 4TOIA 2VWJA 1PNMA 2A7WA 3ZHSA 5IDJA 2P06A 1IXMA 1KYOF 1QU7A 1SA0B 2EULA 1YEWA 5BMVA 3FYEB 2ZIMA 2R9RB 5CBGA 1DTOA 3ABMC 4MS2A 2E5LB 2QKAA 1Y74A 4ABMA 1YI2V 1Y66A 4DV1O 4HZ3A 3AG1C 4FMTA 4B7EA 1VQ5V 1U96A 4LBEC 2UUBO 5ITZA 1KUQA 3L74H 3JAKA 3A8TA 3JATA 1VQOV 1F23A 4ASUG 5IYZA 3MHSC 3ZEDA 1KP3A 3AG7A 2Q73A 5LOVB 4IHJA 1DLBA 1NS1A 5BR8B 5LP6A 3K0GA 4MVZA 4PDRA 1VMGA 2LFSA 3SYPA 1CXZB 3JARA 3OEEG 2UXBB 4FLWA 3W7WA 3UT5B 3CRRA 4DV5B 3CJHA 3GB7C 4DV2B 4MTFA 3OGCC 2NN4A 5LP6B 2WLHA 5F2VO 4X62B 3BA8A 1H2KA 3JD4A 2DWDC 1OCOB 4LFBB 4DV4B 2QJ1A 4PA7A 4ZI7A 2DYRB 4AHCA 1O9HA 1VP7A 2CAZC 1M93A 4TUYB 3CMAV 1BSMA 5IYZB 4LFCO 2QKSA 2OTLV 3DTUB 3SYQA 3LNMB 4DR2O 1FAFA 3VQXA 3NXSA 4WF9V 1ZX3A 4CH4A 4NTXA 3A2FA 3STLC 1LUVA 4L87A 1NR1A 4FM2A 2XASA 5IYDO 3AK3A 1S5LZ 1IBMB 1N34B 4BAYA 3BFRA 4O2AB 1MNGA 1VQNV 1K9MW 1G8MA 4DR1B 1N33O 4AQYB 4X66B 4LF9B 3J7AU 1XL6A 2ZXWB 5LGTA 1S3JA 4WFAV 4LF6B 3U11A 3G6BA 4TT3G 2R70A 1I94B 3SGIA 2R9AA 2C2AA 4CC6A 4JI4B 3FAVA 4JI1O 1YTFD 1H2MA 2IW5A 1FFXB 3JYCA 2R72A 1D5NA 4LF5B 4I50A 4P2ZA 3ABMB 1HR0B 2BOBC 1NH2D 2F66C 1GH6A 1PPJH 2EILB 1EM1A 2HJFC 4DV1B 1ZTEA 3RYCA 5LL6Y 5KUMA 5JWPA 2WPDG 3T1CA 4TQDA 2X6BA 4NXMO 2WLLB 4FK5C 2GDSA 1DK1A 3LSUA 1AP5A 2XOKG 4DO2A 5GTHZ 1K73W 5IWAO 3RYFB 2VQEO 1HNXO 4NR1A 2WLKA 4B7KA 3E22B 5LMNO 2ZNJA 2AW9A 2JEUA 3CWBH 2PI5A 1AJQA 1BE3H 3D36A 1NBMG 5CA0A 3BVOA 3T1YB 1OJHA 1HP8A 2DQ0A 2BTQB 3K59A 1VQ9V 3EXAA 3AG2C 3G67A 3OE7G 4DR6O 1S72V 1IVSA 3OD4A 1B06A 1M56C 1Q3EA 4ZOLB 1PL0A 3KG2A 4JAVA 5DEDA 1M1KW 2DYRC 4I50B 3OTOO 2XTAA 1QBZA 2B5UA 2PGGA 2PUSA 4LFCB 1RM1C 3ZMTA 2CH7A 2JJ2G 4J9ZB 2CTQA 2Y69B 3CCQV 2EX3A 3ABLC 3JCUZ 4ICGA 4DUZO 4W4KA 1XMQB 3M8AA 4FFKA 2Q7GA 2P4VA 2W6JG 2UUCO 2JGDA 4JTDB 2LW7A 3I5DA 2EIKC 3B8NA 3GWOA 4UFZA 5C93A 4DV2O 1Q82W 2E5LO 1NVPB 1TUEB 5H5NA 2KQXA 3L72H 5CA0B 4W4LA 4PHZA 5E79Z 3IJ4A 4LH7A 1KU9A 1HDJA 1JX9A 4J7KA 4DV6B 3CE2A 5EYPB 4LWSB 1KBHA 1Q43A 2Q67A 1K8AW 1X59A 3SJAC 4JTCB 4JZGA 2CH7B 4UV9A 5LXTB 1ZSPA 2ZXWC 3ZIAG 3H1IH 5B1AC 2GUZA 4DR2B 5CA1B 2ITDC 4FIPC 4AILC 3ML0A 2CGNA 4B3TB 1FPOA 3DC5A 3FFQA 4Z2WA 3SYOA 1EN4A 1IBLO 2XAJA 4NTWA 2VQFO 5EIBC 1AVMA 2V1DA 4OPAA 1QVGU 4WFGA 3PN1A 3UKMA 5FNVB 1IZ3A 2ZCEA 4K35A 3ASOC 3CX5F 3SPGA 2AZ0A 1Q90D 4EFBA 1J95A 2AHZA 2EILC 4EFEA 3WG7C 2W0XA 3K58A 4Q6GA 2EZPA 3OR7C 5CA1A 2XAFA 3H01A 5L3BA 5EZYA 4E2LA 1WPXA 2Z0AA 1UJWB 3WG7B 4DK0A 2HP8A 3H9VA 5LGNA 2DOSA 1FXKB 3KCYA 5IWAB 3ZS8C 2ZD9A 1Y76B 3RBZA 1SQBH 1Z2GA 3J80N 2D2CB 4X1IB 5L3CA 5LGUA 1FJGO 1I0HA 1JMKC 1DF5A 4DV3O 1OCZC 3G4SV 4JI2O 2RDCA 2WAMA 3CS5A 3K9SA 4U7NA 3AG3B 3IC9A 2X7RB 5L3DA 1QLEC 2ODMA 1WN7A 1U97A 3A0RA 3OW2U 4DRXA 2Z5UA 1OCZB 4BW5A 4KFMA 4YJ2A 4B3MO 2EJRA 3BA9A 1M90W 5DM6V 3HB3B 2JDIG 1JPXA 2OCCC 1O9GA 2MW2B 1P4RA 1L0NH 2A0LA 2HR3A 4EKWA 2FMLA 4UB8Z 1AROP 1K5QA 1UFIA 1SKVA 1SC5B 3OM3B 5B3SB 1TVKB 4H0LB 1AI5A 1I08A 4H44B 1H2NA 1XHXA 4R8CA 5KAIZ 5KHHA 3IFXA 3B77A 5CA3A 1WP7A 3AK1A 1PV0A 3E22A 3BAAA 1MABG 1GN3A 1YZBA 4XBFA 4GUNA 3ZRSA 1VIBA 4N23A 4R6ZA 3E8GA 2XAQA 2BE3A 1MA1A 1GN4A 4GYCB 3K0DA 1KKCA 1BHBA 1WNSA 2WLJA 4LFBO 1K3EA 1Q6IA 1FFXA 3UM7A 4K8ZA 3N2GA 3CMEV 3CCEV 1L8DA 1SETA 2L6LA 3W7SA 3C3SA 2CTPA 3JALA 1WP8A 4JI8O 4L8JA 1GM8A 4DR6B 3THOA 4TV8B 1A32A 3SR2C 1YJWV 1M5IA 4X88A 1BGYH 5EBMC 4J42A 4NKGB 3JCZA 3LUTB 3CC7V 4AQYO 2Q4PA 1AILA 1LUWA 2VRZA 1NVPD 5EK0A 5H2FZ 5B66Z 1N4CA 1WAZA 4EB6A 2H8PC 3K79A 2F4VO 1GKFA 3BEHA 1URFA 4YJ2B 4DV0O 5LBQA 1XEQA 4DW1A 4DV3B 4JAAA 3HKDB 3MDSA 2QWQB 2WLIB 1R73A 2YIDA 2Q68A 2CK3G 1XMOO 1TAEA 2QM7A 1Y6XA 1YTFB 2OWOA 3T4ZA 4FFBA 1YITV 3SYCA 2GTAA 1GAXA 5LP6C 2Y0IA 3G80A 3AG1B 4DV7B 3ZRVA 1CPYA 3JALB 4FLZA 3CB2A 3OR6C 4HBNA 4GKJB 4WFFA 1SZXA 2HHHB 5LHHA 1FFTB 4OGQB 4I7ZB 2LP7A 3CYOA 4NXMB 1FXHA 4JTAB 2ZM6O 5IY5C 3ZRXA 4YIPA 4BW9A 1I7FA 1GTOA 1HNXB 3HPLC 3QVNA 5B3SC 3ICXA 3SJBC 1AI4A 3CCSV 4I9QA 3JAWA 1S77D 1JFFA 2ZR3A 2DYSB 3FB5C 3R66A 4B3MB 1B3QA 2EIMB 1HWYA 2DMXA 2M6YA 3LSQA 4I4TA 3D3QA 4I4TB 2PI4A 4WFHA 4UXNA 4YJ3B 1FYJA 4DK1A 1JJ2U 2F4VB 1WA8A 3K3WA 4HNAA 5ITZB 1S76D 3JASA 4LFAO 1Q86W 1BZKA 3D36C 1K33A 2EIJB 5BMVB 1R6NA 1IBKO 4X8AA 3WB0A 1FJGB 4JF3A 3I56V 1AI6A 1IDSA 3RT3C 5LA6A 2Q7HA 1YJ9V 4JAUA 4C7UA 1XMQO 2CTRA 2ETNA 1F7YA 2E75B 2UUCB 5JJEB 1IURA 3APOA 2QWOB 3QO7A 4OX9O 1TA8A 3OAAG 2OT5A 2UUAB 5TISZ 2AHYA 1GRJA 4RQFA 1QR9A 3CRMA 3ABUA 4YY3B 1XOUA 3E35A 4FVMA 3JD1A 5KHJA 5LMUB 1OHHG 4O4JA 4GLXA 3F7VC 4QE9A 1WB8A 3LNNA 4PI0A 4QPJA 5FNVA 1NH2B 1AR4A 1Z5VA 3SJQC 3K06A 1GM7A 4B3TO 3ZCCA 2GV9A 2IM9A 4QE7A 1IBLB 3A0BZ 1PNLA 3VQVA 2F43G 1Y76A 2PZSA 1OV9A 3CXHF 4QJFB 3K5OA 3LDCA 5KX5B 1S5HC 1K97A 4GX5A 3ZRWA 4BIOA 2JEXA 2IH1C 1VEWA 3IAYA 5EBLC 5J2TB 4JYYA 2HEPA 2XT9A 2BTOA 1IBKB 1P84F 2RQ6A 5KMGB 4G2KA 4B08A 3AG4B 3O65A 4DV7O 2ZKOA 3CXCU 3WFVA 5EC1C 4JYBA 4GKKO 1XQ8A 4KHPB 5GONB 1N0JA 3RYHB 5JQGA 4K3AA 2LGWA 2Y0PA 2XAGA 4PJ0Z 5IYBO 2X6CA 4MT8A 3MD0A 3GVMA 3JATB 1E79G 2FKXA 1SF9A 4O2BA 1MOFA 1XILA 4IYHA 4JI6O 4X1KB 1N36O 5JCOC 3JD3A 4MVOA 3OMIB 3CJHB 4UVCA 3STZC 4NVPA 4TUYA 4IIJB 3N2KB 1OCCC 4CS2A 1PL4A 2QDOA 4I55B 3T1HB 5IJ0B 4PDMA 2YEVB 5LYJB 3HKEB 1SZTA 1QR8A 1I5YA 2EIJC 5J2UB 1JJOA 4JZ2A 3BRCA 2NR5A 3KCXA 1BS3A 2RN9A 2ZT9B 3TXSA 1M4UA 1V55C 4ZHQA 3Q4HA 4CBCA 1XMOB 1NI8A 3K5NA 4HNAB 4PA9A 2D3OW 3N2GB 1AJNA 1KMIZ 2P5OA 2Q69A 4CZZA 5HFLA 2YXLA 1N8RW 2UXDB 1HNZO 4MW3A 4NB5A 4O4JB 3ABKC 3BCCH 2W6IG 3L71H 4LF8O 1ORQC 2ZDIA 1MSDA 4U3JA 3CC4V 2QR4A 2UXNA 3JD0A 5JQGB 2OYQA 4ZBMA 2Q8VA 2ZM6B 4UB6Z 2ZIOA 1EN5A 4FLVA 3D8CA 1QQCA 1S0VA 4F6RB 2X6AA 3WB1A 1WB7A 2WWWA 2P7TC 1AJPA 2JIZG 4FZ0A 1Q6UA 4H33A 4KL1A 3RVZA 2HG5C 5GW7A 5EIBD 4RO2A 5LOVA 1JQ0A 5KX5A 1R3JC 4Q20A 3OTOB 3X2QC 4O2BB 3VBBA 4B3SO 2BSKB 3VQYA 3B4SA 4YJ3A 3U10A 4R7CA 4FLTA 1XNQB 1K4CC 1H8HG 2PF4E 4BIZA 1YSCA 2YIBA 1SRYA 4PA3A 2P90A 4DR3B 4X64O 2HHHO 4JPRA 4ZIBA 4DV6O 2ZE8A 2A9HA 4OX9B 4LWSA 2WLNA 2GHYA 2JRIA 3B09A 3CHXA 4ZI7B 1SA0A 2L35A 4UV8A 1XBLA 3K57A 4XDKA 4YHHO 1N34O 1N0NA 1WLEA 2Y4UA 3HKBB 4AI8A 2EINB 4DR1O 1N33B 3OEHG 4WFBV 1MG1A
chains in the Genus database with same CATH topology
3O9OA 1WA8A 4I0XA 3Q4HB 3G80A 2B9ZA 4GZRB 3FAVA 2AZ0A 4LWSA 3HR0A 2VS0A 3TXSA 4I0XB 3TXQA 3OGIB 3Q4HA 4ABMA 3GVMA 3FD9A 2VRZA 2KG7B 3ZBHA 2DE0X 3GWKC 2KG7A 1WA8B 3FAVB 4LWSB 2AZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O9O A;  1WA8 A;  4I0X A;  3Q4H B;  3G80 A;  2B9Z A;  4GZR B;  3FAV A;  2AZ0 A;  4LWS A;  3HR0 A;  2VS0 A;  3TXS A;  4I0X B;  3TXQ A;  3OGI B;  3Q4H A;  4ABM A;  3GVM A;  3FD9 A;  2VRZ A;  2KG7 B;  3ZBH A;  2DE0 X;  3GWK C;  2KG7 A;  1WA8 B;  3FAV B;  4LWS B;  2AZ2 A; 
#chains in the Genus database with same CATH topology
 4GKK B;  1W2B U;  5KMG A;  3CCU V;  3M99 B;  2E76 B;  4J11 A;  3TJT A;  1K34 A;  5L3F A;  3FB8 C;  2YIC A;  3ZHR A;  4GX1 A;  2IJJ A;  2DJV A;  1GM9 A;  3BAB A;  4PA4 A;  4TQF A;  3EFF K;  3U0Z A;  1G1X B;  1IXB A;  2P67 A;  2DE0 X;  1YIJ V;  3B40 A;  4LFA B;  2Q9L A;  4JI1 B;  1WA8 B;  1YVW A;  2M7W A;  4Z1V A;  1N36 B;  1V55 B;  3CP1 A;  4YIO A;  1KB9 F;  5FPR A;  1HNW B;  2ITC C;  2Y69 C;  1N32 O;  3LDE A;  2WA3 A;  3RGB A;  3RN4 A;  4J10 A;  4J41 A;  2CGO A;  4JI3 B;  1VQK V;  2Q6A A;  4UCS A;  3ABK B;  4PDL A;  1XUQ A;  2PTM A;  3OMN B;  1ENV A;  2QWR B;  5LA6 B;  4NXN B;  2HVK C;  5EZY B;  2RMK B;  4KHP O;  2JGU A;  1Z5W A;  3RWR D;  4LF7 O;  3E2E A;  4O4H A;  1JVM A;  3DXR B;  2LFR A;  5KUK A;  1LNQ A;  5A9G A;  4JI7 B;  1MZE A;  3JAS B;  1AR5 A;  4FLU A;  4YHH B;  4UCT A;  2JS5 A;  4RWU A;  1NTZ H;  3C90 A;  5CBF A;  1H2S B;  4MVM A;  1D2D A;  2AZ2 A;  2UXC O;  3P30 A;  4Z1M G;  2FB5 A;  1BHA A;  1K92 A;  3JAK B;  4UCV A;  2F23 A;  2HJD A;  2ADQ B;  4FPP A;  3CEI A;  2UXX A;  3B2E E;  3X2Q B;  4LNU B;  4JYA B;  2ZE6 A;  4YY3 O;  2RJZ A;  3SYA A;  1SQP H;  1FXK C;  1X4T A;  4LF4 O;  4MTG A;  3G71 V;  2A06 H;  1QVF U;  1XNQ O;  3ASN B;  2QTS A;  2V7Q G;  2ZDI C;  5EYP A;  1KP2 A;  1WJZ A;  5JVD B;  2ZQM A;  3F5W C;  1VQ6 V;  2BSK A;  2BTQ A;  3HR0 A;  1JFF B;  2ADP A;  1F4M A;  2HFE C;  3NR7 A;  4I55 A;  3OTF A;  2F93 B;  2X0L A;  1TVK A;  3L75 H;  1VQ8 V;  2B1I A;  3OMA B;  2R9I A;  1VQL V;  3T4D A;  2QA4 V;  4FFB B;  4R50 A;  3O9O A;  1WPB A;  4QPK A;  3JSN A;  4U7O A;  1R3I C;  4PI2 A;  4X1K A;  3ZMZ A;  2EBO A;  4LR3 A;  2LW1 A;  4RUE A;  1QNM A;  3EVK A;  3RYC B;  1VQ4 V;  1GN6 A;  3E86 A;  3ZN1 A;  1THZ A;  3CC2 V;  3LDD A;  5KAF Z;  3FYI B;  2DWE C;  2DW4 A;  2UU9 O;  2CTW A;  5IY5 B;  1E1R G;  4DR5 O;  3APQ A;  2VQF B;  1V54 B;  3QF7 A;  1D5A A;  2GUZ B;  1P7G A;  2LJ2 A;  1KQS U;  2UXB O;  1NKD A;  2H3O A;  4RUF A;  1MZF A;  5IJ9 A;  2EJ7 A;  1H38 A;  1JR9 A;  4J7J A;  4X65 B;  3ETG A;  1SS3 A;  1VF6 A;  1NTM H;  1VQP V;  3C3T A;  2K9P A;  4GT1 A;  1FD9 A;  2QSA A;  4IHJ B;  2YC0 A;  3T1H O;  4FLX A;  2CDY A;  3ZHT A;  4LF7 B;  1CEZ A;  1TUB A;  2QEX V;  3QO5 A;  4LF8 B;  4DXW A;  4FZ1 A;  2LO1 A;  1BQZ A;  2YI9 A;  2O57 A;  1OCR B;  2IJH A;  5JVD A;  4WFE A;  2Y4T A;  3CCV V;  3P32 A;  1PP9 H;  1W0J G;  1VAR A;  4IGG A;  5GON A;  4X1Y A;  2CUG A;  1OZ0 A;  1Q5O A;  3ASO B;  2Y48 A;  3L9D A;  3JSL A;  2KG7 A;  3E83 A;  3ZHQ A;  4IL6 Z;  2JJ1 G;  5L3E A;  3CCR V;  2IU3 A;  4LF6 O;  1R6K A;  4JI7 O;  2K1E A;  2ZR2 A;  1FXK A;  3F7Y C;  1BL8 A;  3QO8 A;  3AEI A;  2KSD A;  4WBN B;  4IIJ A;  1KEC A;  1LR1 A;  1BCC H;  1YDX A;  1VF7 A;  1Y4M A;  3D3I A;  1AP6 A;  4I5S A;  1KD1 W;  5DEC A;  1BQ0 A;  2IJK A;  4FM0 A;  4PDV A;  1DF4 A;  4X65 O;  2YXY A;  4JV5 B;  4DR4 B;  3ZRW B;  3VQW A;  3CRQ A;  4X1Y B;  3TK1 A;  2YDE A;  4D6T H;  2F95 B;  5H6R A;  1M9N A;  2DN9 A;  2B1G A;  4JI3 O;  4JYA O;  3IGA C;  3ZBH A;  1YF2 A;  4X20 B;  4X20 A;  3UQ8 A;  3VOU A;  3ZJZ A;  3ZHU A;  3RYI A;  3K9A A;  2IU0 A;  2P4K A;  2YIA A;  1B6Q A;  2AGA A;  1YCI A;  2PYL A;  4I0X B;  3JAW B;  3RFR A;  3RW0 A;  4LC1 A;  3WU2 Z;  4ZHQ B;  4KUM A;  3KKY A;  5EC2 C;  1ZAU A;  3KZI Z;  3S3X A;  4H13 B;  5CB4 B;  3FAV B;  3JAR B;  2UUA O;  3HKC A;  4QNH B;  2PYJ A;  2OCH A;  2LQT A;  4F4L A;  4TV9 A;  3RYF A;  5D5P A;  4JI8 B;  2YSU B;  1H2G A;  4TSF G;  4O2A A;  1BMF G;  3E8F A;  2WLL A;  1PNK A;  2ILM A;  3OFN G;  4U3J B;  5KHI A;  3N2K A;  2YUA A;  4MTO A;  4DR7 O;  1L1F A;  1ZWI C;  5H9C A;  5LHG A;  3K5M A;  4FM1 A;  3HKD A;  4UCR A;  1Q6H A;  2UU9 B;  3TET A;  2B9Z A;  3JAM N;  4DV0 B;  4F6E A;  3ZMU A;  1TUB B;  3ZN0 A;  5B1B C;  4D7S A;  1NJI W;  4RQE A;  1B04 A;  3OT7 A;  5LYJ A;  1NTK H;  3G6E V;  2OIG A;  3K03 A;  4EEQ A;  1XL4 A;  2HLD G;  3GWK C;  2ZE5 A;  2QM8 A;  4IT5 A;  1MMM A;  1E1Q G;  4JI0 B;  4B3R B;  5DN6 G;  4NXN O;  4N21 A;  2Z3Y A;  3ZMS A;  5D5Q A;  2ARH A;  4PEL A;  1TGO A;  4QGP A;  1F51 A;  2H94 A;  3TCU A;  4ZKI A;  4LF4 B;  1SQV H;  3W7X A;  2N04 A;  3K08 A;  3OUS A;  1XNR B;  5K1P A;  3E8H A;  3OGI B;  3AG3 C;  4ZOL A;  4MSW C;  4EB6 B;  1NU1 H;  1ZL8 A;  4X89 A;  5GTI Z;  2QKC A;  1F4N A;  4JGS A;  2UXC B;  1IX9 A;  1AI7 A;  1PM9 A;  3SPI A;  4HAM A;  3AK2 A;  1H2L A;  4HYO A;  4PD4 F;  2BCC H;  2IJI A;  3DSQ A;  3FD9 A;  2ZIN A;  2Q5Z A;  1GN2 A;  3CSX A;  5JH7 A;  3M7M X;  1EN6 A;  4F6R A;  4JI5 O;  1XI1 A;  1R3L C;  3A0H Z;  1HW7 A;  1CP9 A;  2YI8 A;  1G4Y B;  3ABL B;  2UXD O;  3BHP A;  1AR1 B;  4O4I A;  5KHK A;  1J5E B;  5CB4 A;  3UO3 A;  1M57 C;  3T2M A;  3ZHV A;  4BWA A;  2GSM B;  2N74 A;  3SJC C;  4I0X A;  4YXW G;  5KHG A;  1GK9 A;  3P3P A;  3W7T A;  1Q7Y W;  1OCO C;  1RSO B;  1S5J A;  5LMU O;  3E8B A;  1XHZ A;  2EIN C;  2JK5 C;  4GX0 A;  1XNR O;  4FLY A;  2JS3 A;  4LP8 A;  4MVQ A;  4MVS A;  3FB6 C;  3ETD A;  1RPR A;  4O4I B;  1ZUQ A;  1EZJ A;  4G27 B;  1VQM V;  3RYH A;  2RCV A;  3L70 H;  1SQX H;  5HFM A;  4JV5 O;  4P9O A;  5CMU A;  4J9Y B;  2YEV A;  4K8X A;  2ZNI A;  4BIU A;  4B3S B;  2GBO A;  3ZMV A;  1K4D C;  4WBN A;  1XDC A;  3UCS C;  5L3G A;  5J2T A;  4MW8 A;  4BR6 A;  1BT8 A;  3CRA A;  3HKB A;  3SPJ A;  4JI5 B;  1FXV A;  2NLJ C;  5FLX N;  1NQT A;  3DGE A;  2FL4 A;  4X64 B;  2AXT Z;  2WA4 A;  3RYI B;  1Q8I A;  2W0F C;  3CCL V;  4P9P A;  2QM4 A;  1L0L H;  2YIB D;  1J5E O;  2KG7 B;  1COW G;  3BY6 A;  2EZO A;  4A5U B;  2OIE A;  1P49 A;  3ETE A;  1QHT A;  3ABT A;  4X1I A;  5JJJ B;  4JYC A;  4DRX B;  4KP4 A;  5IT9 N;  1YXB A;  1JA8 A;  2P6J A;  4CS3 A;  2A3Q A;  1M56 B;  3E89 A;  1QLE B;  4WCE V;  1V9P A;  4CH6 A;  1VQ7 V;  3ZX6 A;  3ETQ A;  3CRC A;  5C8Y A;  2OTJ V;  5K1X A;  2A79 B;  3JD2 A;  4TV9 B;  2XUM A;  1VF6 C;  5BR8 O;  4X9Q A;  4UVB A;  3N27 A;  4RAI A;  1DGS A;  4FJC C;  4U3F H;  1T5E A;  2MK3 A;  4XDJ A;  1HNW O;  1N32 B;  5AG2 A;  2DYS C;  2EIK B;  2E74 B;  1US6 A;  2EIM C;  1GMG A;  1AB3 A;  1IBM O;  1K7D A;  4O4L A;  4GZR B;  3W7U A;  1M57 B;  5FPO A;  4LNU A;  3IC7 A;  3SDL A;  5E1A C;  4JI2 B;  3AG2 B;  2FYU H;  1GO3 F;  3LSS A;  1JOY A;  1HNZ B;  1ZL8 B;  4CC5 A;  3SPH A;  2GTS A;  3WB2 A;  4K0K B;  3L73 H;  2KKW A;  4OPH A;  1VF5 B;  4NYK A;  4JI0 O;  4B3R O;  4GKJ O;  5H6Q A;  1OCC B;  3FKS G;  5IJ0 A;  1I94 O;  1R1B A;  4LCU C;  4PV1 B;  2BOC C;  4DW0 A;  4DR7 B;  4JI4 O;  5LXT A;  4DYL A;  2YXH A;  5JJN B;  3DXR A;  3P3N A;  1W59 A;  4QIW F;  5J2U A;  3H1K H;  1FKA O;  5B5E Z;  5IE9 A;  5J9P C;  1SES A;  4UCO A;  3K5L A;  5KA5 A;  4DUY B;  4G28 B;  2JGD B;  2XHB A;  2NNU A;  4XDL A;  4TWK A;  1R3K C;  1EBO A;  2FTK A;  3H1L H;  2WLM A;  2N05 A;  1NT2 B;  1R6T A;  1I5X A;  3B8M A;  5KA6 A;  3MHH C;  1MSW D;  5FL7 G;  3PJS K;  2QWN B;  2IBZ H;  3Q4H B;  3OUF A;  3H1H H;  1ZLZ A;  4DR3 O;  5KLV H;  4J7Z A;  1RPO A;  3FB7 C;  3BPZ A;  4O4H B;  4UVA A;  3T1Y O;  4UUJ C;  3H1J H;  2Q0A A;  3RVY A;  3CPW U;  4MTX A;  3HKE A;  2Q7E A;  4E4E A;  4K0K O;  2LGQ A;  2F1M A;  3QTC A;  2ZE7 A;  4P30 A;  2V4D A;  3CCJ V;  3AG4 C;  4TV8 A;  1FS0 G;  1KKD A;  5CN0 A;  4DV5 O;  5C8Y B;  4I9W A;  1SQG A;  1PKX A;  3QNE A;  3HKC B;  2UUB B;  5BZB A;  4CS4 A;  3K04 A;  2HKO A;  4X66 O;  5LMN B;  1KC8 W;  1RSO A;  4DR5 B;  1SER A;  2WLI A;  4LH6 A;  4O4L B;  5BY1 A;  1NR7 A;  3SPC A;  4DUZ B;  2PY5 A;  2IH3 C;  1NZ6 A;  4CH3 A;  5A2Q N;  3MAQ A;  4KXR A;  2CE4 A;  3CCM V;  4DUY O;  2Q0O C;  3CD6 V;  1RP3 B;  2XAH A;  1H8E G;  3TXQ A;  1P7B A;  3ASN C;  1QCE A;  5LHI A;  4NTY A;  3J81 N;  2E3C A;  3DC6 A;  4H37 A;  4LF5 O;  1YJN V;  2DQ3 A;  3TGU H;  1SQF A;  2HVJ C;  3FX7 A;  2RNB A;  1K5S A;  4JAS A;  5JH7 B;  1YHQ V;  1Q81 W;  2OCC B;  3I55 V;  4DV4 O;  2KB1 A;  2VWK A;  1ROP A;  3UT5 A;  5IJ9 B;  4J80 A;  3R65 A;  4GCZ A;  1RFY A;  2VQE B;  5B1N A;  2QGN A;  1QLN A;  1W0K G;  3QG5 A;  4OXS A;  1RM1 B;  5EBW C;  4PA6 A;  4UCU A;  3S3W A;  2VS0 A;  4GX2 A;  4JI6 B;  2P22 C;  1JCH A;  3F5T A;  5B1B B;  5JCO A;  1PD3 A;  2JVD A;  2ATK C;  1SQQ H;  1G6U A;  4IYI A;  2QTO A;  1V54 C;  1UPG A;  4CH5 A;  1EZV H;  1HR0 O;  3EHB B;  5B1O A;  1Y74 B;  2YS8 A;  4LF9 O;  1XRE A;  5IYC O;  4MVU A;  5BXZ A;  1Y67 A;  2WSS G;  4X62 O;  1OCR C;  2G38 A;  1EFR G;  2QWP B;  2XND G;  2QE7 G;  3UO2 A;  4D7T A;  4DR4 O;  5B1A B;  5CBH A;  4MVR A;  4TOI A;  2VWJ A;  1PNM A;  2A7W A;  3ZHS A;  5IDJ A;  2P06 A;  1IXM A;  1KYO F;  1QU7 A;  1SA0 B;  2EUL A;  1YEW A;  5BMV A;  3FYE B;  2ZIM A;  2R9R B;  5CBG A;  1DTO A;  3ABM C;  4MS2 A;  2E5L B;  2QKA A;  1Y74 A;  4ABM A;  1YI2 V;  1Y66 A;  4DV1 O;  4HZ3 A;  3AG1 C;  4FMT A;  4B7E A;  1VQ5 V;  1U96 A;  4LBE C;  2UUB O;  5ITZ A;  1KUQ A;  3L74 H;  3JAK A;  3A8T A;  3JAT A;  1VQO V;  1F23 A;  4ASU G;  5IYZ A;  3MHS C;  3ZED A;  1KP3 A;  3AG7 A;  2Q73 A;  5LOV B;  4IHJ A;  1DLB A;  1NS1 A;  5BR8 B;  5LP6 A;  3K0G A;  4MVZ A;  4PDR A;  1VMG A;  2LFS A;  3SYP A;  1CXZ B;  3JAR A;  3OEE G;  2UXB B;  4FLW A;  3W7W A;  3UT5 B;  3CRR A;  4DV5 B;  3CJH A;  3GB7 C;  4DV2 B;  4MTF A;  3OGC C;  2NN4 A;  5LP6 B;  2WLH A;  5F2V O;  4X62 B;  3BA8 A;  1H2K A;  3JD4 A;  2DWD C;  1OCO B;  4LFB B;  4DV4 B;  2QJ1 A;  4PA7 A;  4ZI7 A;  2DYR B;  4AHC A;  1O9H A;  1VP7 A;  2CAZ C;  1M93 A;  4TUY B;  3CMA V;  1BSM A;  5IYZ B;  4LFC O;  2QKS A;  2OTL V;  3DTU B;  3SYQ A;  3LNM B;  4DR2 O;  1FAF A;  3VQX A;  3NXS A;  4WF9 V;  1ZX3 A;  4CH4 A;  4NTX A;  3A2F A;  3STL C;  1LUV A;  4L87 A;  1NR1 A;  4FM2 A;  2XAS A;  5IYD O;  3AK3 A;  1S5L Z;  1IBM B;  1N34 B;  4BAY A;  3BFR A;  4O2A B;  1MNG A;  1VQN V;  1K9M W;  1G8M A;  4DR1 B;  1N33 O;  4AQY B;  4X66 B;  4LF9 B;  3J7A U;  1XL6 A;  2ZXW B;  5LGT A;  1S3J A;  4WFA V;  4LF6 B;  3U11 A;  3G6B A;  4TT3 G;  2R70 A;  1I94 B;  3SGI A;  2R9A A;  2C2A A;  4CC6 A;  4JI4 B;  3FAV A;  4JI1 O;  1YTF D;  1H2M A;  2IW5 A;  1FFX B;  3JYC A;  2R72 A;  1D5N A;  4LF5 B;  4I50 A;  4P2Z A;  3ABM B;  1HR0 B;  2BOB C;  1NH2 D;  2F66 C;  1GH6 A;  1PPJ H;  2EIL B;  1EM1 A;  2HJF C;  4DV1 B;  1ZTE A;  3RYC A;  5LL6 Y;  5KUM A;  5JWP A;  2WPD G;  3T1C A;  4TQD A;  2X6B A;  4NXM O;  2WLL B;  4FK5 C;  2GDS A;  1DK1 A;  3LSU A;  1AP5 A;  2XOK G;  4DO2 A;  5GTH Z;  1K73 W;  5IWA O;  3RYF B;  2VQE O;  1HNX O;  4NR1 A;  2WLK A;  4B7K A;  3E22 B;  5LMN O;  2ZNJ A;  2AW9 A;  2JEU A;  3CWB H;  2PI5 A;  1AJQ A;  1BE3 H;  3D36 A;  1NBM G;  5CA0 A;  3BVO A;  3T1Y B;  1OJH A;  1HP8 A;  2DQ0 A;  2BTQ B;  3K59 A;  1VQ9 V;  3EXA A;  3AG2 C;  3G67 A;  3OE7 G;  4DR6 O;  1S72 V;  1IVS A;  3OD4 A;  1B06 A;  1M56 C;  1Q3E A;  4ZOL B;  1PL0 A;  3KG2 A;  4JAV A;  5DED A;  1M1K W;  2DYR C;  4I50 B;  3OTO O;  2XTA A;  1QBZ A;  2B5U A;  2PGG A;  2PUS A;  4LFC B;  1RM1 C;  3ZMT A;  2CH7 A;  2JJ2 G;  4J9Z B;  2CTQ A;  2Y69 B;  3CCQ V;  2EX3 A;  3ABL C;  3JCU Z;  4ICG A;  4DUZ O;  4W4K A;  1XMQ B;  3M8A A;  4FFK A;  2Q7G A;  2P4V A;  2W6J G;  2UUC O;  2JGD A;  4JTD B;  2LW7 A;  3I5D A;  2EIK C;  3B8N A;  3GWO A;  4UFZ A;  5C93 A;  4DV2 O;  1Q82 W;  2E5L O;  1NVP B;  1TUE B;  5H5N A;  2KQX A;  3L72 H;  5CA0 B;  4W4L A;  4PHZ A;  5E79 Z;  3IJ4 A;  4LH7 A;  1KU9 A;  1HDJ A;  1JX9 A;  4J7K A;  4DV6 B;  3CE2 A;  5EYP B;  4LWS B;  1KBH A;  1Q43 A;  2Q67 A;  1K8A W;  1X59 A;  3SJA C;  4JTC B;  4JZG A;  2CH7 B;  4UV9 A;  5LXT B;  1ZSP A;  2ZXW C;  3ZIA G;  3H1I H;  5B1A C;  2GUZ A;  4DR2 B;  5CA1 B;  2ITD C;  4FIP C;  4AIL C;  3ML0 A;  2CGN A;  4B3T B;  1FPO A;  3DC5 A;  3FFQ A;  4Z2W A;  3SYO A;  1EN4 A;  1IBL O;  2XAJ A;  4NTW A;  2VQF O;  5EIB C;  1AVM A;  2V1D A;  4OPA A;  1QVG U;  4WFG A;  3PN1 A;  3UKM A;  5FNV B;  1IZ3 A;  2ZCE A;  4K35 A;  3ASO C;  3CX5 F;  3SPG A;  2AZ0 A;  1Q90 D;  4EFB A;  1J95 A;  2AHZ A;  2EIL C;  4EFE A;  3WG7 C;  2W0X A;  3K58 A;  4Q6G A;  2EZP A;  3OR7 C;  5CA1 A;  2XAF A;  3H01 A;  5L3B A;  5EZY A;  4E2L A;  1WPX A;  2Z0A A;  1UJW B;  3WG7 B;  4DK0 A;  2HP8 A;  3H9V A;  5LGN A;  2DOS A;  1FXK B;  3KCY A;  5IWA B;  3ZS8 C;  2ZD9 A;  1Y76 B;  3RBZ A;  1SQB H;  1Z2G A;  3J80 N;  2D2C B;  4X1I B;  5L3C A;  5LGU A;  1FJG O;  1I0H A;  1JMK C;  1DF5 A;  4DV3 O;  1OCZ C;  3G4S V;  4JI2 O;  2RDC A;  2WAM A;  3CS5 A;  3K9S A;  4U7N A;  3AG3 B;  3IC9 A;  2X7R B;  5L3D A;  1QLE C;  2ODM A;  1WN7 A;  1U97 A;  3A0R A;  3OW2 U;  4DRX A;  2Z5U A;  1OCZ B;  4BW5 A;  4KFM A;  4YJ2 A;  4B3M O;  2EJR A;  3BA9 A;  1M90 W;  5DM6 V;  3HB3 B;  2JDI G;  1JPX A;  2OCC C;  1O9G A;  2MW2 B;  1P4R A;  1L0N H;  2A0L A;  2HR3 A;  4EKW A;  2FML A;  4UB8 Z;  1ARO P;  1K5Q A;  1UFI A;  1SKV A;  1SC5 B;  3OM3 B;  5B3S B;  1TVK B;  4H0L B;  1AI5 A;  1I08 A;  4H44 B;  1H2N A;  1XHX A;  4R8C A;  5KAI Z;  5KHH A;  3IFX A;  3B77 A;  5CA3 A;  1WP7 A;  3AK1 A;  1PV0 A;  3E22 A;  3BAA A;  1MAB G;  1GN3 A;  1YZB A;  4XBF A;  4GUN A;  3ZRS A;  1VIB A;  4N23 A;  4R6Z A;  3E8G A;  2XAQ A;  2BE3 A;  1MA1 A;  1GN4 A;  4GYC B;  3K0D A;  1KKC A;  1BHB A;  1WNS A;  2WLJ A;  4LFB O;  1K3E A;  1Q6I A;  1FFX A;  3UM7 A;  4K8Z A;  3N2G A;  3CME V;  3CCE V;  1L8D A;  1SET A;  2L6L A;  3W7S A;  3C3S A;  2CTP A;  3JAL A;  1WP8 A;  4JI8 O;  4L8J A;  1GM8 A;  4DR6 B;  3THO A;  4TV8 B;  1A32 A;  3SR2 C;  1YJW V;  1M5I A;  4X88 A;  1BGY H;  5EBM C;  4J42 A;  4NKG B;  3JCZ A;  3LUT B;  3CC7 V;  4AQY O;  2Q4P A;  1AIL A;  1LUW A;  2VRZ A;  1NVP D;  5EK0 A;  5H2F Z;  5B66 Z;  1N4C A;  1WAZ A;  4EB6 A;  2H8P C;  3K79 A;  2F4V O;  1GKF A;  3BEH A;  1URF A;  4YJ2 B;  4DV0 O;  5LBQ A;  1XEQ A;  4DW1 A;  4DV3 B;  4JAA A;  3HKD B;  3MDS A;  2QWQ B;  2WLI B;  1R73 A;  2YID A;  2Q68 A;  2CK3 G;  1XMO O;  1TAE A;  2QM7 A;  1Y6X A;  1YTF B;  2OWO A;  3T4Z A;  4FFB A;  1YIT V;  3SYC A;  2GTA A;  1GAX A;  5LP6 C;  2Y0I A;  3G80 A;  3AG1 B;  4DV7 B;  3ZRV A;  1CPY A;  3JAL B;  4FLZ A;  3CB2 A;  3OR6 C;  4HBN A;  4GKJ B;  4WFF A;  1SZX A;  2HHH B;  5LHH A;  1FFT B;  4OGQ B;  4I7Z B;  2LP7 A;  3CYO A;  4NXM B;  1FXH A;  4JTA B;  2ZM6 O;  5IY5 C;  3ZRX A;  4YIP A;  4BW9 A;  1I7F A;  1GTO A;  1HNX B;  3HPL C;  3QVN A;  5B3S C;  3ICX A;  3SJB C;  1AI4 A;  3CCS V;  4I9Q A;  3JAW A;  1S77 D;  1JFF A;  2ZR3 A;  2DYS B;  3FB5 C;  3R66 A;  4B3M B;  1B3Q A;  2EIM B;  1HWY A;  2DMX A;  2M6Y A;  3LSQ A;  4I4T A;  3D3Q A;  4I4T B;  2PI4 A;  4WFH A;  4UXN A;  4YJ3 B;  1FYJ A;  4DK1 A;  1JJ2 U;  2F4V B;  1WA8 A;  3K3W A;  4HNA A;  5ITZ B;  1S76 D;  3JAS A;  4LFA O;  1Q86 W;  1BZK A;  3D36 C;  1K33 A;  2EIJ B;  5BMV B;  1R6N A;  1IBK O;  4X8A A;  3WB0 A;  1FJG B;  4JF3 A;  3I56 V;  1AI6 A;  1IDS A;  3RT3 C;  5LA6 A;  2Q7H A;  1YJ9 V;  4JAU A;  4C7U A;  1XMQ O;  2CTR A;  2ETN A;  1F7Y A;  2E75 B;  2UUC B;  5JJE B;  1IUR A;  3APO A;  2QWO B;  3QO7 A;  4OX9 O;  1TA8 A;  3OAA G;  2OT5 A;  2UUA B;  5TIS Z;  2AHY A;  1GRJ A;  4RQF A;  1QR9 A;  3CRM A;  3ABU A;  4YY3 B;  1XOU A;  3E35 A;  4FVM A;  3JD1 A;  5KHJ A;  5LMU B;  1OHH G;  4O4J A;  4GLX A;  3F7V C;  4QE9 A;  1WB8 A;  3LNN A;  4PI0 A;  4QPJ A;  5FNV A;  1NH2 B;  1AR4 A;  1Z5V A;  3SJQ C;  3K06 A;  1GM7 A;  4B3T O;  3ZCC A;  2GV9 A;  2IM9 A;  4QE7 A;  1IBL B;  3A0B Z;  1PNL A;  3VQV A;  2F43 G;  1Y76 A;  2PZS A;  1OV9 A;  3CXH F;  4QJF B;  3K5O A;  3LDC A;  5KX5 B;  1S5H C;  1K97 A;  4GX5 A;  3ZRW A;  4BIO A;  2JEX A;  2IH1 C;  1VEW A;  3IAY A;  5EBL C;  5J2T B;  4JYY A;  2HEP A;  2XT9 A;  2BTO A;  1IBK B;  1P84 F;  2RQ6 A;  5KMG B;  4G2K A;  4B08 A;  3AG4 B;  3O65 A;  4DV7 O;  2ZKO A;  3CXC U;  3WFV A;  5EC1 C;  4JYB A;  4GKK O;  1XQ8 A;  4KHP B;  5GON B;  1N0J A;  3RYH B;  5JQG A;  4K3A A;  2LGW A;  2Y0P A;  2XAG A;  4PJ0 Z;  5IYB O;  2X6C A;  4MT8 A;  3MD0 A;  3GVM A;  3JAT B;  1E79 G;  2FKX A;  1SF9 A;  4O2B A;  1MOF A;  1XIL A;  4IYH A;  4JI6 O;  4X1K B;  1N36 O;  5JCO C;  3JD3 A;  4MVO A;  3OMI B;  3CJH B;  4UVC A;  3STZ C;  4NVP A;  4TUY A;  4IIJ B;  3N2K B;  1OCC C;  4CS2 A;  1PL4 A;  2QDO A;  4I55 B;  3T1H B;  5IJ0 B;  4PDM A;  2YEV B;  5LYJ B;  3HKE B;  1SZT A;  1QR8 A;  1I5Y A;  2EIJ C;  5J2U B;  1JJO A;  4JZ2 A;  3BRC A;  2NR5 A;  3KCX A;  1BS3 A;  2RN9 A;  2ZT9 B;  3TXS A;  1M4U A;  1V55 C;  4ZHQ A;  3Q4H A;  4CBC A;  1XMO B;  1NI8 A;  3K5N A;  4HNA B;  4PA9 A;  2D3O W;  3N2G B;  1AJN A;  1KMI Z;  2P5O A;  2Q69 A;  4CZZ A;  5HFL A;  2YXL A;  1N8R W;  2UXD B;  1HNZ O;  4MW3 A;  4NB5 A;  4O4J B;  3ABK C;  3BCC H;  2W6I G;  3L71 H;  4LF8 O;  1ORQ C;  2ZDI A;  1MSD A;  4U3J A;  3CC4 V;  2QR4 A;  2UXN A;  3JD0 A;  5JQG B;  2OYQ A;  4ZBM A;  2Q8V A;  2ZM6 B;  4UB6 Z;  2ZIO A;  1EN5 A;  4FLV A;  3D8C A;  1QQC A;  1S0V A;  4F6R B;  2X6A A;  3WB1 A;  1WB7 A;  2WWW A;  2P7T C;  1AJP A;  2JIZ G;  4FZ0 A;  1Q6U A;  4H33 A;  4KL1 A;  3RVZ A;  2HG5 C;  5GW7 A;  5EIB D;  4RO2 A;  5LOV A;  1JQ0 A;  5KX5 A;  1R3J C;  4Q20 A;  3OTO B;  3X2Q C;  4O2B B;  3VBB A;  4B3S O;  2BSK B;  3VQY A;  3B4S A;  4YJ3 A;  3U10 A;  4R7C A;  4FLT A;  1XNQ B;  1K4C C;  1H8H G;  2PF4 E;  4BIZ A;  1YSC A;  2YIB A;  1SRY A;  4PA3 A;  2P90 A;  4DR3 B;  4X64 O;  2HHH O;  4JPR A;  4ZIB A;  4DV6 O;  2ZE8 A;  2A9H A;  4OX9 B;  4LWS A;  2WLN A;  2GHY A;  2JRI A;  3B09 A;  3CHX A;  4ZI7 B;  1SA0 A;  2L35 A;  4UV8 A;  1XBL A;  3K57 A;  4XDK A;  4YHH O;  1N34 O;  1N0N A;  1WLE A;  2Y4U A;  3HKB B;  4AI8 A;  2EIN B;  4DR1 O;  1N33 B;  3OEH G;  4WFB V;  1MG1 A; 
#chains in the Genus database with same CATH homology
 3O9O A;  1WA8 A;  4I0X A;  3Q4H B;  3G80 A;  2B9Z A;  4GZR B;  3FAV A;  2AZ0 A;  4LWS A;  3HR0 A;  2VS0 A;  3TXS A;  4I0X B;  3TXQ A;  3OGI B;  3Q4H A;  4ABM A;  3GVM A;  3FD9 A;  2VRZ A;  2KG7 B;  3ZBH A;  2DE0 X;  3GWK C;  2KG7 A;  1WA8 B;  3FAV B;  4LWS B;  2AZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...