3Q4HB

Crystal structure of the mycobacterium smegmatis esxgh complex (msmeg_0620-msmeg_0621)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
b'NYPAMLAHAAEMNTYSGALHAVGADIAAEQHALASAWQGDTGMTYQAWQAQWNQAMEELVRAYRAMATTHEQNTMAMSAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pe family protein
publication title Heterologous expression of mycobacterial Esx complexes in Escherichia coli for structural studies is facilitated by the use of maltose binding protein fusions.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Metal transport
total genus 24
structure length 80
sequence length 80
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3q4hB00
4LWSB 3TXQA 3FAVB 3G80A 2B9ZA 3TXSA 3O9OA 3ZBHA 2AZ2A 2VRZA 4GZRB 3OGIB 3GWKC 2DE0X 3Q4HA 4I0XA 4I0XB 3HR0A 3Q4HB 2KG7A 2VS0A 2AZ0A 1WA8A 1WA8B 2KG7B 4ABMA 3FD9A 3GVMA 3FAVA 4LWSA
chains in the Genus database with same CATH superfamily
1FXKC 3RW0A 1B6QA 5B3SC 3CCQV 2CAZC 1N32B 2M7WA 2X6BA 2YICA 4LF6B 3KG2A 1MOFA 3ABMB 1SC5B 3H9VA 4GT1A 4K35A 1RFYA 1B3QA 2RJZA 1XEQA 2CE4A 2XAHA 3RYCA 2A79B 4ZIBA 4LH6A 4LFAO 1AB3A 4PDVA 4B3MO 4H33A 3K9AA 4JTDB 4LF9O 2UU9B 5JCOA 4O2AA 4DK1A 4KHPB 4X64B 2P6JA 1K3EA 2X7RB 2YIBA 4K8ZA 2YIAA 1Y76A 3A0RA 2VRZA 1PM9A 1NVPB 1KKCA 2QR4A 3JYCA 4L87A 1Y4MA 1PL0A 4GX2A 4DV6O 2H3OA 3RWRD 1YHQV 1DF5A 5ITZB 4X88A 3JATB 3WG7C 1XMQO 5FL7G 2PY5A 2RN9A 2ZR3A 4PA7A 1YF2A 3CJHB 1H8HG 1VQNV 1YJ9V 1BT8A 1N36O 1RSOA 2Y0IA 1J95A 3AG3C 4HZ3A 4F4LA 3S3WA 3P3NA 3QVNA 5JJNB 4X66O 1BQ0A 4X65B 2R9RB 3ABLC 4UB6Z 3K79A 2X6CA 2A3QA 1GKFA 3CRMA 1Q86W 2F1MA 1VQKV 5DEDA 1Y74A 3CWBH 3JASA 1QBZA 5LHGA 5KHKA 2PTMA 2X6AA 1KQSU 1EBOA 4YIPA 2XASA 1ZWIC 2L35A 2ZE8A 3E22B 4CS3A 1KP2A 2ZCEA 3L73H 4JAAA 4ZOLB 2CGOA 1IBMO 3OMIB 4B3SB 3E8HA 4FFKA 1GAXA 1N0JA 4DV0B 3SDLA 3IFXA 4O4HA 4JYBA 3CPWU 1FXKA 3K04A 1YCIA 2X0LA 3DTUB 4O4IA 4J10A 2XAJA 4NXNB 3FX7A 1JJOA 2ZDIC 4JF3A 2F93B 1BHAA 4JI6O 4LF5B 1BMFG 1AILA 1N33O 4DRXA 3BCCH 3BA8A 1I08A 4MW3A 1QVFU 1WPXA 2UXXA 5H6QA 5JVDB 1GO3F 3K0DA 3QNEA 4LNUA 1TA8A 5EK0A 2YDEA 1IXMA 3OEHG 1WJZA 3B77A 4LCUC 5LP6C 1Z2GA 2ZM6B 3JD2A 1SF9A 3GB7C 4JAUA 3LSUA 1F4MA 4B3MB 1IVSA 4WBNB 4YXWG 2Q68A 1SQGA 4F6RB 2DE0X 1WN7A 4IGGA 1SESA 3C3TA 2W0FC 4BWAA 2XHBA 3K5LA 1VF5B 4J7JA 3EFFK 1YI2V 2QSAA 1Q3EA 3FB5C 2EIMC 4H37A 3KKYA 3ZIAG 5IYBO 5C8YB 3CXCU 5H9CA 4NTXA 1FFXA 4J9ZB 4N21A 1BCCH 4E4EA 2DYRC 2E5LO 4DV6B 4X20A 2VWKA 3K03A 3H1HH 3WB0A 1KYOF 4LBEC 1FKAO 3OD4A 3BAAA 4J7ZA 3BA9A 5LGNA 4TV9B 1Q90D 1OCRB 2N05A 4QE9A 1JCHA 4HYOA 1N36B 3LNMB 3ABTA 3SPJA 1BE3H 4UCVA 2KKWA 2ZIOA 1MNGA 4YJ3A 4MTFA 1KMIZ 1GN3A 4TUYA 3QG5A 4JAVA 4FM2A 1FJGB 4GYCB 5FPRA 2DW4A 1P84F 5JQGB 2EZOA 2ZIMA 3HKEB 5B1AB 3JALB 4GX1A 3ZHUA 4CH3A 1KC8W 4R8CA 4JYYA 1R3IC 1KBHA 5J2TA 4XBFA 1VQ5V 4IL6Z 1V9PA 2B1GA 4TV8A 4PA4A 3L9DA 4BIUA 5JWPA 1XNQB 2DYSB 2IH1C 5CB4A 2ZDIA 1AI4A 2QTSA 4TQDA 3CCEV 1NTZH 2FL4A 3WU2Z 3I55V 1NH2B 4I9QA 2RNBA 3EXAA 1QR9A 1GM8A 4BR6A 3OMAB 2N74A 2IJHA 3DC5A 5KHIA 5LP6A 2VQEO 4LFCO 2HHHO 4JI6B 1N33B 3U0ZA 3T1YO 3RN4A 2ODMA 1HNZB 1G1XB 4JZ2A 1GMGA 2WLHA 4UVBA 2B5UA 1IBLB 2JS5A 3QO7A 4JI7B 3JATA 5L3FA 3VBBA 1YXBA 2B1IA 5DECA 4JI1O 2YXHA 3ZMZA 1MG1A 3FB6C 3ZHVA 1THZA 3OE7G 5IJ0B 4FFBB 3N2KB 1YTFB 3SPIA 2FMLA 4ZKIA 4U7OA 2GTAA 1AR4A 4NYKA 2EJ7A 3ML0A 3HKBA 1JX9A 2PZSA 5IE9A 3H1JH 4IIJA 4JYCA 1W2BU 3OUSA 3OTOB 1Y66A 2LW1A 1GRJA 3W7TA 4EB6B 1CEZA 5LA6B 1NT2B 2OIEA 3A0BZ 3UCSC 3RYCB 2YSUB 4QGPA 2OTLV 1RP3B 4LC1A 3J81N 1S5JA 2N04A 2WLLA 4NTYA 4FMTA 3ZHSA 1VARA 4DV5O 5IDJA 4AILC 4NVPA 2LQTA 3ZHRA 4ZOLA 4X1KB 1TUEB 1JJ2U 2F4VB 1Y76B 4JI2O 2R9AA 1NQTA 1GTOA 1K8AW 2OCHA 2VS0A 3EHBB 1J5EB 3GVMA 3ABUA 4RQEA 5CMUA 1HR0O 3ASNC 4OX9B 1NS1A 5L3BA 2HVKC 2LGWA 1IDSA 2WLNA 2BCCH 5EIBD 1S72V 1I5XA 2R72A 2Z3YA 1OZ0A 4GKKB 1RSOB 2E74B 2JEXA 2UUBO 4B3TO 1AROP 4QPKA 1BZKA 3DSQA 1JVMA 4DR2O 4PA3A 4OPHA 4UCTA 3RT3C 1VF6C 1F4NA 3BY6A 3ZHQA 3VOUA 1TAEA 4LF6O 1BSMA 1IX9A 1H2NA 3JASB 3JSNA 2IU0A 2VQEB 2EILC 1UJWB 4NB5A 3OM3B 2JS3A 3NXSA 4MVQA 5IWAB 1X4TA 2V7QG 1BQZA 3ZJZA 1NKDA 2OCCB 4UCOA 1XQ8A 4CS4A 4JI1B 4KHPO 4X64O 5EC2C 2Y4UA 5CA3A 1FXKB 5EBWC 5B3SB 3AK1A 4O4IB 1H2SB 1KP3A 1QNMA 5BR8O 5LGUA 3L74H 2A9HA 4BW9A 2IM9A 4DRXB 4DUZB 2CH7A 2NR5A 1ZAUA 4PA6A 2EJRA 4KL1A 4LNUB 3PJSK 5JQGA 3CP1A 2CGNA 1AP5A 4UV9A 1RPRA 5EYPB 1LUWA 2HJFC 5B1OA 3H1LH 4I5SA 4MVOA 2Y4TA 5GW7A 5KAFZ 4JTCB 1WP7A 4CH5A 1YSCA 2Z5UA 4DV5B 2E3CA 3BVOA 4P9OA 3A0HZ 3CC2V 1K33A 4JI0B 3RYHA 5A2QN 4JI2B 5E79Z 3WG7B 3ZHTA 1WP8A 2ZE6A 1B06A 1XHXA 3KZIZ 1AJNA 2QWOB 3OGIB 1SQFA 2ZD9A 4X20B 1FXHA 5IT9N 3ABLB 4DV0O 2Q0OC 4DO2A 1H8EG 2QWPB 4TOIA 4R6ZA 2AHZA 3B8MA 3IAYA 1Q8IA 3N27A 4N23A 1TUBB 2UUBB 4B3TB 1W0KG 4YJ3B 1VF7A 4UVAA 2Z0AA 3N2KA 4TUYB 3OW2U 1JQ0A 2UXCO 2VQFO 1HNWB 2ITDC 3SYAA 4JASA 2QKCA 1K5SA 3G80A 4JYAO 3SPHA 1SZXA 1L1FA 1EM1A 2ARHA 3UM7A 5LMUB 4EB6A 2ZM6O 1ENVA 5LA6A 3J80N 5J2TB 2PGGA 3WB2A 4BIOA 4TV8B 3ZRVA 2Q7GA 3TJTA 2WPDG 5CB4B 4YIOA 3AG2C 5BXZA 3SJCC 3RVZA 1VQ8V 3MD0A 2ZKOA 4W4LA 5LYJA 1JMKC 2ZXWC 3JAMN 2ZNIA 4X1KA 2HKOA 3G71V 4PJ0Z 4EKWA 5BR8B 3H1IH 5LP6B 5LHIA 4DR1B 1WLEA 4AHCA 4LH7A 3OT7A 3E8GA 4H44B 1MZEA 4ZBMA 3THOA 1VP7A 2P4KA 2JJ1G 2F43G 4AI8A 1SZTA 3QO8A 3ABKC 3A2FA 3P30A 2UUCB 4MS2A 5H5NA 2EIMB 1G8MA 1Y67A 4QPJA 3HKBB 2P22C 4K0KO 1FJGO 3CB2A 2DYRB 1K73W 4IIJB 4GX5A 4K3AA 2Q7HA 2EX3A 1I94B 1QQCA 3CCVV 3KCXA 1XI1A 4WF9V 2EIJC 2K9PA 3L70H 3SJBC 1H2LA 2HFEC 2P67A 2C2AA 3SYCA 2UXDB 5LHHA 2EZPA 2WLLB 4WFFA 4MTOA 4ASUG 3TXSA 2F95B 3CHXA 4DR6B 1WAZA 4MVUA 1XNQO 4PELA 1WPBA 1GN4A 4NXMO 3W7SA 3QF7A 1NVPD 5FNVA 3X2QC 1Q5OA 3G67A 3ZMVA 2IH3C 2GUZA 3RYIB 3G6BA 4MTXA 1M9NA 2ILMA 5J9PC 3R66A 2UXCB 2VQFB 2CTWA 1HW7A 3OMNB 1L0NH 3M99B 4AQYB 1HNZO 3E83A 1D5NA 1IBLO 4JI7O 4JYAB 4MVSA 4GKJO 4UCRA 1DK1A 3B2EE 1Q43A 1SQVH 1YITV 2A06H 1GN6A 1DF4A 1K4DC 2W6IG 4UFZA 5EYPA 2ADQB 1S77D 4B7EA 1SQPH 3ASOC 4U3JA 4QIWF 2DN9A 5B5EZ 3LNNA 2UXNA 3ETGA 1K5QA 2QDOA 3ZN0A 1P4RA 2WWWA 5KA5A 3D36C 4XDJA 1M4UA 3FD9A 3OTOO 4LWSB 2QGNA 1PL4A 1OHHG 4PI0A 2XNDG 2B9ZA 2ADPA 1R6NA 4UVCA 2Y48A 2PYLA 1Q81W 5IYZA 1PPJH 2QM4A 1XDCA 1VEWA 3CE2A 1HDJA 2O57A 3HR0A 2JEUA 1A32A 1R6KA 3E89A 1SETA 1M57C 1GH6A 2DMXA 3SPGA 1V55B 1ZLZA 4FIPC 2PI4A 3H1KH 2Q73A 5H2FZ 4UXNA 2F4VO 1K34A 3RVYA 1WB7A 2Y0PA 3JD0A 3T1HO 5B1NA 1J5EO 5GTIZ 1TUBA 2EIKC 1E1RG 1AR5A 1I5YA 1F7YA 2CH7B 4OX9O 4JV5O 2L6LA 4K0KB 4B7KA 1JOYA 1Z5VA 3UO3A 3F5TA 1YDXA 3APOA 4O4JB 3SGIA 1E1QG 4MT8A 2FB5A 2GDSA 4KP4A 3TGUH 2LJ2A 5DM6V 2IBZH 3LDDA 4GKKO 1NR1A 3BHPA 3OR7C 3ZBHA 3MAQA 3SR2C 4X1YA 5EBMC 1N4CA 5L3GA 1QU7A 1M56C 1NTMH 3IC9A 2ZINA 2ITCC 3L75H 5IJ9A 4DK0A 3HPLC 4NXMB 4WFGA 3ASNB 2PI5A 4CS2A 3RYHB 2NN4A 2Q4PA 4DV4O 2HLDG 2QWRB 4PV1B 5CBFA 1HNXB 3HB3B 2DQ0A 1H2GA 2E76B 3STLC 2G38A 5TISZ 2WAMA 1SERA 2WA4A 4FVMA 3CRRA 4DR5O 4UUJC 2RMKB 2YUAA 3ZS8C 1XILA 1XL4A 1EZJA 3CRAA 4F6EA 4I9WA 1JA8A 5C93A 1P49A 3WFVA 5IWAO 4X89A 1JPXA 1S76D 2UXBB 4GKJB 4JTAB 2WLKA 2AXTZ 1RPOA 1O9GA 2MK3A 3D36A 2YXLA 1F23A 3STZC 4O4LA 1ZUQA 5H6RA 3T4DA 3ZRSA 1DTOA 4DUZO 2ZE7A 1V55C 2EILB 4NTWA 3W7UA 1XBLA 5LOVA 3LSSA 2CTQA 3K5OA 3ZRXA 2OYQA 4J11A 2Q9LA 4I4TA 4PD4F 2IU3A 1URFA 2GBOA 2VWJA 2WLIA 3K06A 2FKXA 1JFFA 4MSWC 4ZI7A 4YJ2A 2LP7A 4LP8A 2Y69C 2LFRA 2W6JG 2E75B 5LYJB 1PNKA 2BE3A 4JI0O 3CMEV 3K58A 4RUEA 2CTPA 3B09A 4QE7A 3CXHF 2KG7A 3JARA 3T1HB 1MSDA 3ZMUA 3RYIA 4IT5A 4J41A 4J9YB 1OCZC 4CZZA 4JV5B 1DGSA 5IYDO 1U96A 4DXWA 4TT3G 2YXYA 1H2KA 2YS8A 4R7CA 3K57A 2JGDA 4I55B 5KHHA 5L3CA 3OTFA 5EBLC 3SYPA 4DV1O 1YTFD 2YC0A 4WFEA 3BEHA 1AI6A 3RYFB 4W4KA 2JGUA 3K9SA 3RFRA 1HNWO 3JD3A 5EZYA 4DR7B 4CBCA 1XREA 3H01A 5LMNB 1CPYA 4RWUA 4YY3O 4DV4B 4LFBB 1YVWA 2OTJV 1Q6IA 1NTKH 3K59A 1COWG 4HNAA 1YZBA 3B8NA 4LWSA 5LMUO 4H13B 5B66Z 4DR5B 2KB1A 4HBNA 2LFSA 3OFNG 5CA0B 4CC6A 1TGOA 4KXRA 5EIBC 2HVJC 3KCYA 1N8RW 2Q8VA 4NR1A 4E2LA 2IW5A 2YIBD 3R65A 1XNRB 5JJJB 5FNVB 3HKCA 4TWKA 1ZL8B 1K92A 1R3LC 2GUZB 3F5WC 4PDRA 1VIBA 4JPRA 3T2MA 3QTCA 2MW2B 5BZBA 4DR1O 1Q6UA 4U7NA 2FTKA 1IBKB 5KUMA 2HEPA 1N34O 2XAQA 1SRYA 1S0VA 4LF8O 3AG2B 3L72H 4O4JA 3N2GA 5E1AC 4LF4O 3AG1C 3F7VC 4UB8Z 5KX5A 4GCZA 2ZXWB 4BIZA 4LR3A 3CEIA 2UUCO 1G6UA 4IYIA 4U3JB 4X62B 3GWKC 1QLEC 4BW5A 3CD6V 1YEWA 4RQFA 1KUQA 4Q6GA 1I94O 3F7YC 1OCCC 2GTSA 3DGEA 5F2VO 4FLYA 4MVMA 1YJNV 2HP8A 2AZ2A 1U97A 3E8BA 3O65A 2YI8A 1AI7A 2UXDO 5IYZB 1M90W 4Z2WA 3ABKB 1SKVA 2IJIA 4DR6O 4ABMA 1FFTB 4WFHA 1K7DA 2P4VA 2EINC 2JIZG 4YHHO 1R3JC 4QNHB 5KMGB 2Q67A 4Z1VA 3LDCA 3NR7A 2JVDA 4DV1B 1VF6A 4I50A 1XOUA 2EIJB 3AEIA 4JZGA 4JI5O 1VQ6V 1WB8A 3CRQA 2QTOA 2P5OA 3T1CA 2R70A 1RM1C 4AQYO 1YJWV 1NJIW 3OEEG 4YY3B 3RGBA 2A0LA 2Q69A 5HFLA 3HKDB 1P7GA 3W7XA 5FPOA 1AI5A 5IY5C 4GZRB 2QM8A 1G4YB 1V54C 4JI4O 3X2QB 1MMMA 4X1YB 1H38A 1R73A 2Q6AA 4J42A 3UT5A 1US6A 3FAVA 5IJ9B 3CS5A 2AGAA 3TXQA 3EVKA 3FYIB 2P7TC 1D5AA 4DW1A 4DR3O 2Q0AA 2XOKG 2BTOA 3W7WA 3CCUV 1VQOV 4ICGA 5CA1A 4MVRA 3JSLA 1GK9A 1XUQA 1P7BA 5EC1C 2QM7A 2NLJC 1TVKA 3CC4V 1D2DA 3S3XA 5BY1A 3OAAG 1N34B 1M93A 3ASOB 3K0GA 1SQQH 4LF8B 4DV3B 4FZ1A 3DC6A 3MDSA 1OCOC 4LF4B 4KFMA 5BMVA 4I55A 5FLXN 2EBOA 3SPCA 5LXTA 4O4LB 1PP9H 1GN2A 4P30A 2YI9A 3DXRA 4FM0A 4G28B 1L8DA 1FD9A 3MHHC 3RYFA 5LOVB 1VQ7V 1XL6A 3UKMA 2LO1A 4XDKA 3CMAV 5KLVH 5K1PA 4I4TB 2PUSA 1M57B 4WFAV 2ZQMA 3RBZA 4X1IA 2LW7A 1DLBA 2H8PC 2YEVB 2WLIB 1PNLA 1YIJV 4DUYO 1JFFB 2P90A 4FLXA 4ZI7B 4LF7B 1LUVA 2IJJA 4YJ2B 4OGQB 4RAIA 4OXSA 5CA0A 4UCUA 5JH7A 4FJCC 4FLTA 2KSDA 1MZFA 4QJFB 2LGQA 2EIKB 1VQPV 2ZT9B 4FLVA 4IHJB 3ZRWA 4YHHB 5GONA 4WCEV 3Q4HA 2XT9A 3K3WA 2QKSA 1HNXO 1ZL8A 2KG7B 3JARB 4PHZA 4I7ZB 2XTAA 3FFQA 4JI3B 4JI5B 1AJQA 3JAKB 1ZTEA 2P06A 4J7KA 2RCVA 1NR7A 3ABMC 4EFEA 3T4ZA 1IZ3A 1I0HA 3ICXA 1M56B 1PNMA 2GV9A 2JK5C 4DR4B 2V4DA 2UXBO 1HP8A 5J2UA 2JGDB 2M6YA 2BSKA 1OV9A 3CCLV 4JI4B 5DN6G 4FLZA 1NU1H 3JAWA 3AG4B 5KAIZ 5EZYB 1EZVH 3ZX6A 3MHSC 1JR9A 4DR3B 5HFMA 2AW9A 1LR1A 4HNAB 3APQA 3FKSG 4LFAB 4Z1MG 3SJAC 4CH4A 4DV2O 3K5NA 1FXVA 3SJQC 4LF9B 1KD1W 5JJEB 2OT5A 1FAFA 1BHBA 2QE7G 4EEQA 2XUMA 4UCSA 1MSWD 1WA8B 1Z5WA 1BGYH 1EN5A 4PDMA 3HKCB 5KMGA 4U3FH 3IJ4A 3CRCA 2ETNA 3ZMSA 2JJ2G 3OGCC 5CN0A 1LNQA 5KUKA 3IC7A 1XMQB 4P9PA 1HWYA 1SA0A 1W0JG 1KB9F 2F23A 1VQMV 4GX0A 2BOBC 2UUAO 1IXBA 3N2GB 2Y69B 3G4SV 3HKDA 3VQVA 5KX5B 4X66B 5AG2A 4RUFA 4DUYB 1VQLV 1KU9A 4CC5A 1VQ9V 2R9IA 4P2ZA 1ZSPA 2D2CB 3AK3A 4O2BA 1CP9A 1SQXH 2QWQB 2WSSG 1OCZB 4DR7O 2RQ6A 1BS3A 5LMNO 3FB7C 3CYOA 4LFBO 5LBQA 4NKGB 1M5IA 2K1EA 3ZEDA 5D5PA 3AG4C 3TCUA 2GSMB 3C90A 4B3RO 3UO2A 2KQXA 4JI8O 3K5MA 1E79G 1H2MA 2H94A 1IBMB 1EFRG 2DWEC 3FYEB 4FLUA 3SYQA 1MA1A 1SS3A 5IYCO 2BTQB 2ZNJA 1EN4A 1XNRO 4MW8A 1FYJA 1Y6XA 2DWDC 1EN6A 4H0LB 2ATKC 3PN1A 4I50B 1X59A 3CSXA 4G2KA 3CC7V 1GM9A 4I0XB 1Q82W 5D5QA 4ZHQB 1NZ6A 2EULA 4K8XA 4WFBV 1I7FA 3VQWA 2OIGA 1ZX3A 5L3DA 5ITZA 1ORQC 3ETEA 1S3JA 1IBKO 5K1XA 3ZCCA 2QA4V 1PV0A 1T5EA 3O9OA 3CJHA 1IURA 2NNUA 1VMGA 3M7MX 4DV2B 1N0NA 3CCMV 3G6EV 2YEVA 4MTGA 2DOSA 1AVMA 3UT5B 2WLJA 3FAVB 4EFBA 4X62O 1OCRC 1FPOA 1XHZA 3SYOA 3TK1A 4GLXA 1NH2D 4IHJA 3ETQA 3BFRA 4FLWA 2GHYA 1QHTA 3QO5A 5CA1B 3BPZA 5A9GA 3P32A 2E5LB 1SQBH 4G27B 5B1BB 3E22A 1TVKB 2Q7EA 3AG1B 1NBMG 5B1AC 3I56V 1QR8A 5LL6Y 3JAKA 2RDCA 2HJDA 1W59A 4O2AB 4KUMA 4TSFG 1K97A 3LDEA 2UUAB 1ROPA 1QLEB 1MABG 4RO2A 3D3IA 2DJVA 1PD3A 3IGAC 5BMVB 2W0XA 2JRIA 2DYSC 3L71H 1QVGU 1OCCB 3I5DA 5LXTB 3ZMTA 3B40A 4DV7O 2CDYA 2CK3G 2XAFA 3DXRB 1XMOO 4UV8A 1KKDA 2WA3A 1K4CC 1AR1B 1FS0G 2D3OW 3E86A 5GTHZ 2FYUH 4X9QA 5JVDA 3BRCA 3OR6C 1M1KW 3E35A 4JGSA 3CCRV 2AZ0A 3CCJV 2ZE5A 4B08A 3BABA 4X1IB 2EINB 1AP6A 3A8TA 4B3RB 3UQ8A 1B04A 2XAGA 3JCZA 4JI8B 1F51A 2AHYA 4X8AA 4WBNA 2IJKA 5KHJA 4D7SA 5JH7B 2QKAA 1R1BA 2F66C 2V1DA 4F6RA 4FZ0A 1Q6HA 3ZRWB 5GONB 3Q4HB 1N32O 1Y74B 1WA8A 1R3KC 4TQFA 3K08A 3E8FA 3JD4A 3D3QA 1RM1B 4FK5C 2HR3A 4LFCB 5C8YA 2HHHB 5KHGA 2Q5ZA 3T1YB 2PF4E 5IY5B 1K9MW 1V54B 4Q20A 2UU9O 4DYLA 4PDLA 3C3SA 3M8AA 4PI2A 4O4HB 3FB8C 4TV9A 5J2UB 1QCEA 4XDLA 4DV3O 2QWNB 4L8JA 3U10A 3U11A 5B1BC 2BSKB 5JCOC 4BAYA 3JAWB 3TETA 2QEXV 2CTRA 4IYHA 3LSQA 4C7UA 2JDIG 3WB1A 3HKEA 1NI8A 3JALA 1L0LH 1OJHA 3B4SA 3JD1A 3CX5F 1KECA 2WLMA 3GWOA 1S5LZ 1OCOB 3AG7A 4FM1A 4R50A 4J80A 3JCUZ 2CUGA 4X65O 1VQ4V 3LUTB 4D7TA 3J7AU 1S5HC 4LF7O 3ZN1A 4HAMA 4MVZA 3VQYA 3OUFA 3P3PA 1QLNA 4DW0A 3VQXA 2BTQA 5CBHA 2A7WA 1GM7A 1PKXA 1FFXB 1AJPA 5LGTA 3D8CA 4CH6A 3ETDA 4DV7B 1HR0B 4A5UB 3E2EA 5L3EA 5CBGA 4I0XA 1XMOB 1O9HA 4ZHQA 4JI3O 1BL8A 3AG3B 5KA6A 1CXZB 2BOCC 1UPGA 2QJ1A 3AK2A 1SA0B 4PA9A 4B3SO 1UFIA 1R6TA 4OPAA 2DQ3A 4DR4O 1Q7YW 1WNSA 4FPPA 2OWOA 4NXNO 2YIDA 5IJ0A 4FFBA 4D6TH 2HG5C 4LF5O 2OCCC 2PYJA 2ZR2A 4GUNA 4DR2B 4O2BB 3CCSV
chains in the Genus database with same CATH topology
4LWSB 3TXQA 3FAVB 3G80A 2B9ZA 3TXSA 3O9OA 3ZBHA 2AZ2A 2VRZA 4GZRB 3OGIB 3GWKC 2DE0X 3Q4HA 4I0XA 4I0XB 3HR0A 3Q4HB 2KG7A 2VS0A 2AZ0A 1WA8A 1WA8B 2KG7B 4ABMA 3FD9A 3GVMA 3FAVA 4LWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LWS B;  3TXQ A;  3FAV B;  3G80 A;  2B9Z A;  3TXS A;  3O9O A;  3ZBH A;  2AZ2 A;  2VRZ A;  4GZR B;  3OGI B;  3GWK C;  2DE0 X;  3Q4H A;  4I0X A;  4I0X B;  3HR0 A;  3Q4H B;  2KG7 A;  2VS0 A;  2AZ0 A;  1WA8 A;  1WA8 B;  2KG7 B;  4ABM A;  3FD9 A;  3GVM A;  3FAV A;  4LWS A; 
#chains in the Genus database with same CATH topology
 1FXK C;  3RW0 A;  1B6Q A;  5B3S C;  3CCQ V;  2CAZ C;  1N32 B;  2M7W A;  2X6B A;  2YIC A;  4LF6 B;  3KG2 A;  1MOF A;  3ABM B;  1SC5 B;  3H9V A;  4GT1 A;  4K35 A;  1RFY A;  1B3Q A;  2RJZ A;  1XEQ A;  2CE4 A;  2XAH A;  3RYC A;  2A79 B;  4ZIB A;  4LH6 A;  4LFA O;  1AB3 A;  4PDV A;  4B3M O;  4H33 A;  3K9A A;  4JTD B;  4LF9 O;  2UU9 B;  5JCO A;  4O2A A;  4DK1 A;  4KHP B;  4X64 B;  2P6J A;  1K3E A;  2X7R B;  2YIB A;  4K8Z A;  2YIA A;  1Y76 A;  3A0R A;  2VRZ A;  1PM9 A;  1NVP B;  1KKC A;  2QR4 A;  3JYC A;  4L87 A;  1Y4M A;  1PL0 A;  4GX2 A;  4DV6 O;  2H3O A;  3RWR D;  1YHQ V;  1DF5 A;  5ITZ B;  4X88 A;  3JAT B;  3WG7 C;  1XMQ O;  5FL7 G;  2PY5 A;  2RN9 A;  2ZR3 A;  4PA7 A;  1YF2 A;  3CJH B;  1H8H G;  1VQN V;  1YJ9 V;  1BT8 A;  1N36 O;  1RSO A;  2Y0I A;  1J95 A;  3AG3 C;  4HZ3 A;  4F4L A;  3S3W A;  3P3N A;  3QVN A;  5JJN B;  4X66 O;  1BQ0 A;  4X65 B;  2R9R B;  3ABL C;  4UB6 Z;  3K79 A;  2X6C A;  2A3Q A;  1GKF A;  3CRM A;  1Q86 W;  2F1M A;  1VQK V;  5DED A;  1Y74 A;  3CWB H;  3JAS A;  1QBZ A;  5LHG A;  5KHK A;  2PTM A;  2X6A A;  1KQS U;  1EBO A;  4YIP A;  2XAS A;  1ZWI C;  2L35 A;  2ZE8 A;  3E22 B;  4CS3 A;  1KP2 A;  2ZCE A;  3L73 H;  4JAA A;  4ZOL B;  2CGO A;  1IBM O;  3OMI B;  4B3S B;  3E8H A;  4FFK A;  1GAX A;  1N0J A;  4DV0 B;  3SDL A;  3IFX A;  4O4H A;  4JYB A;  3CPW U;  1FXK A;  3K04 A;  1YCI A;  2X0L A;  3DTU B;  4O4I A;  4J10 A;  2XAJ A;  4NXN B;  3FX7 A;  1JJO A;  2ZDI C;  4JF3 A;  2F93 B;  1BHA A;  4JI6 O;  4LF5 B;  1BMF G;  1AIL A;  1N33 O;  4DRX A;  3BCC H;  3BA8 A;  1I08 A;  4MW3 A;  1QVF U;  1WPX A;  2UXX A;  5H6Q A;  5JVD B;  1GO3 F;  3K0D A;  3QNE A;  4LNU A;  1TA8 A;  5EK0 A;  2YDE A;  1IXM A;  3OEH G;  1WJZ A;  3B77 A;  4LCU C;  5LP6 C;  1Z2G A;  2ZM6 B;  3JD2 A;  1SF9 A;  3GB7 C;  4JAU A;  3LSU A;  1F4M A;  4B3M B;  1IVS A;  4WBN B;  4YXW G;  2Q68 A;  1SQG A;  4F6R B;  2DE0 X;  1WN7 A;  4IGG A;  1SES A;  3C3T A;  2W0F C;  4BWA A;  2XHB A;  3K5L A;  1VF5 B;  4J7J A;  3EFF K;  1YI2 V;  2QSA A;  1Q3E A;  3FB5 C;  2EIM C;  4H37 A;  3KKY A;  3ZIA G;  5IYB O;  5C8Y B;  3CXC U;  5H9C A;  4NTX A;  1FFX A;  4J9Z B;  4N21 A;  1BCC H;  4E4E A;  2DYR C;  2E5L O;  4DV6 B;  4X20 A;  2VWK A;  3K03 A;  3H1H H;  3WB0 A;  1KYO F;  4LBE C;  1FKA O;  3OD4 A;  3BAA A;  4J7Z A;  3BA9 A;  5LGN A;  4TV9 B;  1Q90 D;  1OCR B;  2N05 A;  4QE9 A;  1JCH A;  4HYO A;  1N36 B;  3LNM B;  3ABT A;  3SPJ A;  1BE3 H;  4UCV A;  2KKW A;  2ZIO A;  1MNG A;  4YJ3 A;  4MTF A;  1KMI Z;  1GN3 A;  4TUY A;  3QG5 A;  4JAV A;  4FM2 A;  1FJG B;  4GYC B;  5FPR A;  2DW4 A;  1P84 F;  5JQG B;  2EZO A;  2ZIM A;  3HKE B;  5B1A B;  3JAL B;  4GX1 A;  3ZHU A;  4CH3 A;  1KC8 W;  4R8C A;  4JYY A;  1R3I C;  1KBH A;  5J2T A;  4XBF A;  1VQ5 V;  4IL6 Z;  1V9P A;  2B1G A;  4TV8 A;  4PA4 A;  3L9D A;  4BIU A;  5JWP A;  1XNQ B;  2DYS B;  2IH1 C;  5CB4 A;  2ZDI A;  1AI4 A;  2QTS A;  4TQD A;  3CCE V;  1NTZ H;  2FL4 A;  3WU2 Z;  3I55 V;  1NH2 B;  4I9Q A;  2RNB A;  3EXA A;  1QR9 A;  1GM8 A;  4BR6 A;  3OMA B;  2N74 A;  2IJH A;  3DC5 A;  5KHI A;  5LP6 A;  2VQE O;  4LFC O;  2HHH O;  4JI6 B;  1N33 B;  3U0Z A;  3T1Y O;  3RN4 A;  2ODM A;  1HNZ B;  1G1X B;  4JZ2 A;  1GMG A;  2WLH A;  4UVB A;  2B5U A;  1IBL B;  2JS5 A;  3QO7 A;  4JI7 B;  3JAT A;  5L3F A;  3VBB A;  1YXB A;  2B1I A;  5DEC A;  4JI1 O;  2YXH A;  3ZMZ A;  1MG1 A;  3FB6 C;  3ZHV A;  1THZ A;  3OE7 G;  5IJ0 B;  4FFB B;  3N2K B;  1YTF B;  3SPI A;  2FML A;  4ZKI A;  4U7O A;  2GTA A;  1AR4 A;  4NYK A;  2EJ7 A;  3ML0 A;  3HKB A;  1JX9 A;  2PZS A;  5IE9 A;  3H1J H;  4IIJ A;  4JYC A;  1W2B U;  3OUS A;  3OTO B;  1Y66 A;  2LW1 A;  1GRJ A;  3W7T A;  4EB6 B;  1CEZ A;  5LA6 B;  1NT2 B;  2OIE A;  3A0B Z;  3UCS C;  3RYC B;  2YSU B;  4QGP A;  2OTL V;  1RP3 B;  4LC1 A;  3J81 N;  1S5J A;  2N04 A;  2WLL A;  4NTY A;  4FMT A;  3ZHS A;  1VAR A;  4DV5 O;  5IDJ A;  4AIL C;  4NVP A;  2LQT A;  3ZHR A;  4ZOL A;  4X1K B;  1TUE B;  1JJ2 U;  2F4V B;  1Y76 B;  4JI2 O;  2R9A A;  1NQT A;  1GTO A;  1K8A W;  2OCH A;  2VS0 A;  3EHB B;  1J5E B;  3GVM A;  3ABU A;  4RQE A;  5CMU A;  1HR0 O;  3ASN C;  4OX9 B;  1NS1 A;  5L3B A;  2HVK C;  2LGW A;  1IDS A;  2WLN A;  2BCC H;  5EIB D;  1S72 V;  1I5X A;  2R72 A;  2Z3Y A;  1OZ0 A;  4GKK B;  1RSO B;  2E74 B;  2JEX A;  2UUB O;  4B3T O;  1ARO P;  4QPK A;  1BZK A;  3DSQ A;  1JVM A;  4DR2 O;  4PA3 A;  4OPH A;  4UCT A;  3RT3 C;  1VF6 C;  1F4N A;  3BY6 A;  3ZHQ A;  3VOU A;  1TAE A;  4LF6 O;  1BSM A;  1IX9 A;  1H2N A;  3JAS B;  3JSN A;  2IU0 A;  2VQE B;  2EIL C;  1UJW B;  4NB5 A;  3OM3 B;  2JS3 A;  3NXS A;  4MVQ A;  5IWA B;  1X4T A;  2V7Q G;  1BQZ A;  3ZJZ A;  1NKD A;  2OCC B;  4UCO A;  1XQ8 A;  4CS4 A;  4JI1 B;  4KHP O;  4X64 O;  5EC2 C;  2Y4U A;  5CA3 A;  1FXK B;  5EBW C;  5B3S B;  3AK1 A;  4O4I B;  1H2S B;  1KP3 A;  1QNM A;  5BR8 O;  5LGU A;  3L74 H;  2A9H A;  4BW9 A;  2IM9 A;  4DRX B;  4DUZ B;  2CH7 A;  2NR5 A;  1ZAU A;  4PA6 A;  2EJR A;  4KL1 A;  4LNU B;  3PJS K;  5JQG A;  3CP1 A;  2CGN A;  1AP5 A;  4UV9 A;  1RPR A;  5EYP B;  1LUW A;  2HJF C;  5B1O A;  3H1L H;  4I5S A;  4MVO A;  2Y4T A;  5GW7 A;  5KAF Z;  4JTC B;  1WP7 A;  4CH5 A;  1YSC A;  2Z5U A;  4DV5 B;  2E3C A;  3BVO A;  4P9O A;  3A0H Z;  3CC2 V;  1K33 A;  4JI0 B;  3RYH A;  5A2Q N;  4JI2 B;  5E79 Z;  3WG7 B;  3ZHT A;  1WP8 A;  2ZE6 A;  1B06 A;  1XHX A;  3KZI Z;  1AJN A;  2QWO B;  3OGI B;  1SQF A;  2ZD9 A;  4X20 B;  1FXH A;  5IT9 N;  3ABL B;  4DV0 O;  2Q0O C;  4DO2 A;  1H8E G;  2QWP B;  4TOI A;  4R6Z A;  2AHZ A;  3B8M A;  3IAY A;  1Q8I A;  3N27 A;  4N23 A;  1TUB B;  2UUB B;  4B3T B;  1W0K G;  4YJ3 B;  1VF7 A;  4UVA A;  2Z0A A;  3N2K A;  4TUY B;  3OW2 U;  1JQ0 A;  2UXC O;  2VQF O;  1HNW B;  2ITD C;  3SYA A;  4JAS A;  2QKC A;  1K5S A;  3G80 A;  4JYA O;  3SPH A;  1SZX A;  1L1F A;  1EM1 A;  2ARH A;  3UM7 A;  5LMU B;  4EB6 A;  2ZM6 O;  1ENV A;  5LA6 A;  3J80 N;  5J2T B;  2PGG A;  3WB2 A;  4BIO A;  4TV8 B;  3ZRV A;  2Q7G A;  3TJT A;  2WPD G;  5CB4 B;  4YIO A;  3AG2 C;  5BXZ A;  3SJC C;  3RVZ A;  1VQ8 V;  3MD0 A;  2ZKO A;  4W4L A;  5LYJ A;  1JMK C;  2ZXW C;  3JAM N;  2ZNI A;  4X1K A;  2HKO A;  3G71 V;  4PJ0 Z;  4EKW A;  5BR8 B;  3H1I H;  5LP6 B;  5LHI A;  4DR1 B;  1WLE A;  4AHC A;  4LH7 A;  3OT7 A;  3E8G A;  4H44 B;  1MZE A;  4ZBM A;  3THO A;  1VP7 A;  2P4K A;  2JJ1 G;  2F43 G;  4AI8 A;  1SZT A;  3QO8 A;  3ABK C;  3A2F A;  3P30 A;  2UUC B;  4MS2 A;  5H5N A;  2EIM B;  1G8M A;  1Y67 A;  4QPJ A;  3HKB B;  2P22 C;  4K0K O;  1FJG O;  3CB2 A;  2DYR B;  1K73 W;  4IIJ B;  4GX5 A;  4K3A A;  2Q7H A;  2EX3 A;  1I94 B;  1QQC A;  3CCV V;  3KCX A;  1XI1 A;  4WF9 V;  2EIJ C;  2K9P A;  3L70 H;  3SJB C;  1H2L A;  2HFE C;  2P67 A;  2C2A A;  3SYC A;  2UXD B;  5LHH A;  2EZP A;  2WLL B;  4WFF A;  4MTO A;  4ASU G;  3TXS A;  2F95 B;  3CHX A;  4DR6 B;  1WAZ A;  4MVU A;  1XNQ O;  4PEL A;  1WPB A;  1GN4 A;  4NXM O;  3W7S A;  3QF7 A;  1NVP D;  5FNV A;  3X2Q C;  1Q5O A;  3G67 A;  3ZMV A;  2IH3 C;  2GUZ A;  3RYI B;  3G6B A;  4MTX A;  1M9N A;  2ILM A;  5J9P C;  3R66 A;  2UXC B;  2VQF B;  2CTW A;  1HW7 A;  3OMN B;  1L0N H;  3M99 B;  4AQY B;  1HNZ O;  3E83 A;  1D5N A;  1IBL O;  4JI7 O;  4JYA B;  4MVS A;  4GKJ O;  4UCR A;  1DK1 A;  3B2E E;  1Q43 A;  1SQV H;  1YIT V;  2A06 H;  1GN6 A;  1DF4 A;  1K4D C;  2W6I G;  4UFZ A;  5EYP A;  2ADQ B;  1S77 D;  4B7E A;  1SQP H;  3ASO C;  4U3J A;  4QIW F;  2DN9 A;  5B5E Z;  3LNN A;  2UXN A;  3ETG A;  1K5Q A;  2QDO A;  3ZN0 A;  1P4R A;  2WWW A;  5KA5 A;  3D36 C;  4XDJ A;  1M4U A;  3FD9 A;  3OTO O;  4LWS B;  2QGN A;  1PL4 A;  1OHH G;  4PI0 A;  2XND G;  2B9Z A;  2ADP A;  1R6N A;  4UVC A;  2Y48 A;  2PYL A;  1Q81 W;  5IYZ A;  1PPJ H;  2QM4 A;  1XDC A;  1VEW A;  3CE2 A;  1HDJ A;  2O57 A;  3HR0 A;  2JEU A;  1A32 A;  1R6K A;  3E89 A;  1SET A;  1M57 C;  1GH6 A;  2DMX A;  3SPG A;  1V55 B;  1ZLZ A;  4FIP C;  2PI4 A;  3H1K H;  2Q73 A;  5H2F Z;  4UXN A;  2F4V O;  1K34 A;  3RVY A;  1WB7 A;  2Y0P A;  3JD0 A;  3T1H O;  5B1N A;  1J5E O;  5GTI Z;  1TUB A;  2EIK C;  1E1R G;  1AR5 A;  1I5Y A;  1F7Y A;  2CH7 B;  4OX9 O;  4JV5 O;  2L6L A;  4K0K B;  4B7K A;  1JOY A;  1Z5V A;  3UO3 A;  3F5T A;  1YDX A;  3APO A;  4O4J B;  3SGI A;  1E1Q G;  4MT8 A;  2FB5 A;  2GDS A;  4KP4 A;  3TGU H;  2LJ2 A;  5DM6 V;  2IBZ H;  3LDD A;  4GKK O;  1NR1 A;  3BHP A;  3OR7 C;  3ZBH A;  3MAQ A;  3SR2 C;  4X1Y A;  5EBM C;  1N4C A;  5L3G A;  1QU7 A;  1M56 C;  1NTM H;  3IC9 A;  2ZIN A;  2ITC C;  3L75 H;  5IJ9 A;  4DK0 A;  3HPL C;  4NXM B;  4WFG A;  3ASN B;  2PI5 A;  4CS2 A;  3RYH B;  2NN4 A;  2Q4P A;  4DV4 O;  2HLD G;  2QWR B;  4PV1 B;  5CBF A;  1HNX B;  3HB3 B;  2DQ0 A;  1H2G A;  2E76 B;  3STL C;  2G38 A;  5TIS Z;  2WAM A;  1SER A;  2WA4 A;  4FVM A;  3CRR A;  4DR5 O;  4UUJ C;  2RMK B;  2YUA A;  3ZS8 C;  1XIL A;  1XL4 A;  1EZJ A;  3CRA A;  4F6E A;  4I9W A;  1JA8 A;  5C93 A;  1P49 A;  3WFV A;  5IWA O;  4X89 A;  1JPX A;  1S76 D;  2UXB B;  4GKJ B;  4JTA B;  2WLK A;  2AXT Z;  1RPO A;  1O9G A;  2MK3 A;  3D36 A;  2YXL A;  1F23 A;  3STZ C;  4O4L A;  1ZUQ A;  5H6R A;  3T4D A;  3ZRS A;  1DTO A;  4DUZ O;  2ZE7 A;  1V55 C;  2EIL B;  4NTW A;  3W7U A;  1XBL A;  5LOV A;  3LSS A;  2CTQ A;  3K5O A;  3ZRX A;  2OYQ A;  4J11 A;  2Q9L A;  4I4T A;  4PD4 F;  2IU3 A;  1URF A;  2GBO A;  2VWJ A;  2WLI A;  3K06 A;  2FKX A;  1JFF A;  4MSW C;  4ZI7 A;  4YJ2 A;  2LP7 A;  4LP8 A;  2Y69 C;  2LFR A;  2W6J G;  2E75 B;  5LYJ B;  1PNK A;  2BE3 A;  4JI0 O;  3CME V;  3K58 A;  4RUE A;  2CTP A;  3B09 A;  4QE7 A;  3CXH F;  2KG7 A;  3JAR A;  3T1H B;  1MSD A;  3ZMU A;  3RYI A;  4IT5 A;  4J41 A;  4J9Y B;  1OCZ C;  4CZZ A;  4JV5 B;  1DGS A;  5IYD O;  1U96 A;  4DXW A;  4TT3 G;  2YXY A;  1H2K A;  2YS8 A;  4R7C A;  3K57 A;  2JGD A;  4I55 B;  5KHH A;  5L3C A;  3OTF A;  5EBL C;  3SYP A;  4DV1 O;  1YTF D;  2YC0 A;  4WFE A;  3BEH A;  1AI6 A;  3RYF B;  4W4K A;  2JGU A;  3K9S A;  3RFR A;  1HNW O;  3JD3 A;  5EZY A;  4DR7 B;  4CBC A;  1XRE A;  3H01 A;  5LMN B;  1CPY A;  4RWU A;  4YY3 O;  4DV4 B;  4LFB B;  1YVW A;  2OTJ V;  1Q6I A;  1NTK H;  3K59 A;  1COW G;  4HNA A;  1YZB A;  3B8N A;  4LWS A;  5LMU O;  4H13 B;  5B66 Z;  4DR5 B;  2KB1 A;  4HBN A;  2LFS A;  3OFN G;  5CA0 B;  4CC6 A;  1TGO A;  4KXR A;  5EIB C;  2HVJ C;  3KCY A;  1N8R W;  2Q8V A;  4NR1 A;  4E2L A;  2IW5 A;  2YIB D;  3R65 A;  1XNR B;  5JJJ B;  5FNV B;  3HKC A;  4TWK A;  1ZL8 B;  1K92 A;  1R3L C;  2GUZ B;  3F5W C;  4PDR A;  1VIB A;  4JPR A;  3T2M A;  3QTC A;  2MW2 B;  5BZB A;  4DR1 O;  1Q6U A;  4U7N A;  2FTK A;  1IBK B;  5KUM A;  2HEP A;  1N34 O;  2XAQ A;  1SRY A;  1S0V A;  4LF8 O;  3AG2 B;  3L72 H;  4O4J A;  3N2G A;  5E1A C;  4LF4 O;  3AG1 C;  3F7V C;  4UB8 Z;  5KX5 A;  4GCZ A;  2ZXW B;  4BIZ A;  4LR3 A;  3CEI A;  2UUC O;  1G6U A;  4IYI A;  4U3J B;  4X62 B;  3GWK C;  1QLE C;  4BW5 A;  3CD6 V;  1YEW A;  4RQF A;  1KUQ A;  4Q6G A;  1I94 O;  3F7Y C;  1OCC C;  2GTS A;  3DGE A;  5F2V O;  4FLY A;  4MVM A;  1YJN V;  2HP8 A;  2AZ2 A;  1U97 A;  3E8B A;  3O65 A;  2YI8 A;  1AI7 A;  2UXD O;  5IYZ B;  1M90 W;  4Z2W A;  3ABK B;  1SKV A;  2IJI A;  4DR6 O;  4ABM A;  1FFT B;  4WFH A;  1K7D A;  2P4V A;  2EIN C;  2JIZ G;  4YHH O;  1R3J C;  4QNH B;  5KMG B;  2Q67 A;  4Z1V A;  3LDC A;  3NR7 A;  2JVD A;  4DV1 B;  1VF6 A;  4I50 A;  1XOU A;  2EIJ B;  3AEI A;  4JZG A;  4JI5 O;  1VQ6 V;  1WB8 A;  3CRQ A;  2QTO A;  2P5O A;  3T1C A;  2R70 A;  1RM1 C;  4AQY O;  1YJW V;  1NJI W;  3OEE G;  4YY3 B;  3RGB A;  2A0L A;  2Q69 A;  5HFL A;  3HKD B;  1P7G A;  3W7X A;  5FPO A;  1AI5 A;  5IY5 C;  4GZR B;  2QM8 A;  1G4Y B;  1V54 C;  4JI4 O;  3X2Q B;  1MMM A;  4X1Y B;  1H38 A;  1R73 A;  2Q6A A;  4J42 A;  3UT5 A;  1US6 A;  3FAV A;  5IJ9 B;  3CS5 A;  2AGA A;  3TXQ A;  3EVK A;  3FYI B;  2P7T C;  1D5A A;  4DW1 A;  4DR3 O;  2Q0A A;  2XOK G;  2BTO A;  3W7W A;  3CCU V;  1VQO V;  4ICG A;  5CA1 A;  4MVR A;  3JSL A;  1GK9 A;  1XUQ A;  1P7B A;  5EC1 C;  2QM7 A;  2NLJ C;  1TVK A;  3CC4 V;  1D2D A;  3S3X A;  5BY1 A;  3OAA G;  1N34 B;  1M93 A;  3ASO B;  3K0G A;  1SQQ H;  4LF8 B;  4DV3 B;  4FZ1 A;  3DC6 A;  3MDS A;  1OCO C;  4LF4 B;  4KFM A;  5BMV A;  4I55 A;  5FLX N;  2EBO A;  3SPC A;  5LXT A;  4O4L B;  1PP9 H;  1GN2 A;  4P30 A;  2YI9 A;  3DXR A;  4FM0 A;  4G28 B;  1L8D A;  1FD9 A;  3MHH C;  3RYF A;  5LOV B;  1VQ7 V;  1XL6 A;  3UKM A;  2LO1 A;  4XDK A;  3CMA V;  5KLV H;  5K1P A;  4I4T B;  2PUS A;  1M57 B;  4WFA V;  2ZQM A;  3RBZ A;  4X1I A;  2LW7 A;  1DLB A;  2H8P C;  2YEV B;  2WLI B;  1PNL A;  1YIJ V;  4DUY O;  1JFF B;  2P90 A;  4FLX A;  4ZI7 B;  4LF7 B;  1LUV A;  2IJJ A;  4YJ2 B;  4OGQ B;  4RAI A;  4OXS A;  5CA0 A;  4UCU A;  5JH7 A;  4FJC C;  4FLT A;  2KSD A;  1MZF A;  4QJF B;  2LGQ A;  2EIK B;  1VQP V;  2ZT9 B;  4FLV A;  4IHJ B;  3ZRW A;  4YHH B;  5GON A;  4WCE V;  3Q4H A;  2XT9 A;  3K3W A;  2QKS A;  1HNX O;  1ZL8 A;  2KG7 B;  3JAR B;  4PHZ A;  4I7Z B;  2XTA A;  3FFQ A;  4JI3 B;  4JI5 B;  1AJQ A;  3JAK B;  1ZTE A;  2P06 A;  4J7K A;  2RCV A;  1NR7 A;  3ABM C;  4EFE A;  3T4Z A;  1IZ3 A;  1I0H A;  3ICX A;  1M56 B;  1PNM A;  2GV9 A;  2JK5 C;  4DR4 B;  2V4D A;  2UXB O;  1HP8 A;  5J2U A;  2JGD B;  2M6Y A;  2BSK A;  1OV9 A;  3CCL V;  4JI4 B;  5DN6 G;  4FLZ A;  1NU1 H;  3JAW A;  3AG4 B;  5KAI Z;  5EZY B;  1EZV H;  3ZX6 A;  3MHS C;  1JR9 A;  4DR3 B;  5HFM A;  2AW9 A;  1LR1 A;  4HNA B;  3APQ A;  3FKS G;  4LFA B;  4Z1M G;  3SJA C;  4CH4 A;  4DV2 O;  3K5N A;  1FXV A;  3SJQ C;  4LF9 B;  1KD1 W;  5JJE B;  2OT5 A;  1FAF A;  1BHB A;  2QE7 G;  4EEQ A;  2XUM A;  4UCS A;  1MSW D;  1WA8 B;  1Z5W A;  1BGY H;  1EN5 A;  4PDM A;  3HKC B;  5KMG A;  4U3F H;  3IJ4 A;  3CRC A;  2ETN A;  3ZMS A;  2JJ2 G;  3OGC C;  5CN0 A;  1LNQ A;  5KUK A;  3IC7 A;  1XMQ B;  4P9P A;  1HWY A;  1SA0 A;  1W0J G;  1KB9 F;  2F23 A;  1VQM V;  4GX0 A;  2BOB C;  2UUA O;  1IXB A;  3N2G B;  2Y69 B;  3G4S V;  3HKD A;  3VQV A;  5KX5 B;  4X66 B;  5AG2 A;  4RUF A;  4DUY B;  1VQL V;  1KU9 A;  4CC5 A;  1VQ9 V;  2R9I A;  4P2Z A;  1ZSP A;  2D2C B;  3AK3 A;  4O2B A;  1CP9 A;  1SQX H;  2QWQ B;  2WSS G;  1OCZ B;  4DR7 O;  2RQ6 A;  1BS3 A;  5LMN O;  3FB7 C;  3CYO A;  4LFB O;  5LBQ A;  4NKG B;  1M5I A;  2K1E A;  3ZED A;  5D5P A;  3AG4 C;  3TCU A;  2GSM B;  3C90 A;  4B3R O;  3UO2 A;  2KQX A;  4JI8 O;  3K5M A;  1E79 G;  1H2M A;  2H94 A;  1IBM B;  1EFR G;  2DWE C;  3FYE B;  4FLU A;  3SYQ A;  1MA1 A;  1SS3 A;  5IYC O;  2BTQ B;  2ZNJ A;  1EN4 A;  1XNR O;  4MW8 A;  1FYJ A;  1Y6X A;  2DWD C;  1EN6 A;  4H0L B;  2ATK C;  3PN1 A;  4I50 B;  1X59 A;  3CSX A;  4G2K A;  3CC7 V;  1GM9 A;  4I0X B;  1Q82 W;  5D5Q A;  4ZHQ B;  1NZ6 A;  2EUL A;  4K8X A;  4WFB V;  1I7F A;  3VQW A;  2OIG A;  1ZX3 A;  5L3D A;  5ITZ A;  1ORQ C;  3ETE A;  1S3J A;  1IBK O;  5K1X A;  3ZCC A;  2QA4 V;  1PV0 A;  1T5E A;  3O9O A;  3CJH A;  1IUR A;  2NNU A;  1VMG A;  3M7M X;  4DV2 B;  1N0N A;  3CCM V;  3G6E V;  2YEV A;  4MTG A;  2DOS A;  1AVM A;  3UT5 B;  2WLJ A;  3FAV B;  4EFB A;  4X62 O;  1OCR C;  1FPO A;  1XHZ A;  3SYO A;  3TK1 A;  4GLX A;  1NH2 D;  4IHJ A;  3ETQ A;  3BFR A;  4FLW A;  2GHY A;  1QHT A;  3QO5 A;  5CA1 B;  3BPZ A;  5A9G A;  3P32 A;  2E5L B;  1SQB H;  4G27 B;  5B1B B;  3E22 A;  1TVK B;  2Q7E A;  3AG1 B;  1NBM G;  5B1A C;  3I56 V;  1QR8 A;  5LL6 Y;  3JAK A;  2RDC A;  2HJD A;  1W59 A;  4O2A B;  4KUM A;  4TSF G;  1K97 A;  3LDE A;  2UUA B;  1ROP A;  1QLE B;  1MAB G;  4RO2 A;  3D3I A;  2DJV A;  1PD3 A;  3IGA C;  5BMV B;  2W0X A;  2JRI A;  2DYS C;  3L71 H;  1QVG U;  1OCC B;  3I5D A;  5LXT B;  3ZMT A;  3B40 A;  4DV7 O;  2CDY A;  2CK3 G;  2XAF A;  3DXR B;  1XMO O;  4UV8 A;  1KKD A;  2WA3 A;  1K4C C;  1AR1 B;  1FS0 G;  2D3O W;  3E86 A;  5GTH Z;  2FYU H;  4X9Q A;  5JVD A;  3BRC A;  3OR6 C;  1M1K W;  3E35 A;  4JGS A;  3CCR V;  2AZ0 A;  3CCJ V;  2ZE5 A;  4B08 A;  3BAB A;  4X1I B;  2EIN B;  1AP6 A;  3A8T A;  4B3R B;  3UQ8 A;  1B04 A;  2XAG A;  3JCZ A;  4JI8 B;  1F51 A;  2AHY A;  4X8A A;  4WBN A;  2IJK A;  5KHJ A;  4D7S A;  5JH7 B;  2QKA A;  1R1B A;  2F66 C;  2V1D A;  4F6R A;  4FZ0 A;  1Q6H A;  3ZRW B;  5GON B;  3Q4H B;  1N32 O;  1Y74 B;  1WA8 A;  1R3K C;  4TQF A;  3K08 A;  3E8F A;  3JD4 A;  3D3Q A;  1RM1 B;  4FK5 C;  2HR3 A;  4LFC B;  5C8Y A;  2HHH B;  5KHG A;  2Q5Z A;  3T1Y B;  2PF4 E;  5IY5 B;  1K9M W;  1V54 B;  4Q20 A;  2UU9 O;  4DYL A;  4PDL A;  3C3S A;  3M8A A;  4PI2 A;  4O4H B;  3FB8 C;  4TV9 A;  5J2U B;  1QCE A;  4XDL A;  4DV3 O;  2QWN B;  4L8J A;  3U10 A;  3U11 A;  5B1B C;  2BSK B;  5JCO C;  4BAY A;  3JAW B;  3TET A;  2QEX V;  2CTR A;  4IYH A;  3LSQ A;  4C7U A;  2JDI G;  3WB1 A;  3HKE A;  1NI8 A;  3JAL A;  1L0L H;  1OJH A;  3B4S A;  3JD1 A;  3CX5 F;  1KEC A;  2WLM A;  3GWO A;  1S5L Z;  1OCO B;  3AG7 A;  4FM1 A;  4R50 A;  4J80 A;  3JCU Z;  2CUG A;  4X65 O;  1VQ4 V;  3LUT B;  4D7T A;  3J7A U;  1S5H C;  4LF7 O;  3ZN1 A;  4HAM A;  4MVZ A;  3VQY A;  3OUF A;  3P3P A;  1QLN A;  4DW0 A;  3VQX A;  2BTQ A;  5CBH A;  2A7W A;  1GM7 A;  1PKX A;  1FFX B;  1AJP A;  5LGT A;  3D8C A;  4CH6 A;  3ETD A;  4DV7 B;  1HR0 B;  4A5U B;  3E2E A;  5L3E A;  5CBG A;  4I0X A;  1XMO B;  1O9H A;  4ZHQ A;  4JI3 O;  1BL8 A;  3AG3 B;  5KA6 A;  1CXZ B;  2BOC C;  1UPG A;  2QJ1 A;  3AK2 A;  1SA0 B;  4PA9 A;  4B3S O;  1UFI A;  1R6T A;  4OPA A;  2DQ3 A;  4DR4 O;  1Q7Y W;  1WNS A;  4FPP A;  2OWO A;  4NXN O;  2YID A;  5IJ0 A;  4FFB A;  4D6T H;  2HG5 C;  4LF5 O;  2OCC C;  2PYJ A;  2ZR2 A;  4GUN A;  4DR2 B;  4O2B B;  3CCS V; 
#chains in the Genus database with same CATH homology
 4LWS B;  3TXQ A;  3FAV B;  3G80 A;  2B9Z A;  3TXS A;  3O9O A;  3ZBH A;  2AZ2 A;  2VRZ A;  4GZR B;  3OGI B;  3GWK C;  2DE0 X;  3Q4H A;  4I0X A;  4I0X B;  3HR0 A;  3Q4H B;  2KG7 A;  2VS0 A;  2AZ0 A;  1WA8 A;  1WA8 B;  2KG7 B;  4ABM A;  3FD9 A;  3GVM A;  3FAV A;  4LWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...