3Q4HB

Crystal structure of the mycobacterium smegmatis esxgh complex (msmeg_0620-msmeg_0621)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
b'NYPAMLAHAAEMNTYSGALHAVGADIAAEQHALASAWQGDTGMTYQAWQAQWNQAMEELVRAYRAMATTHEQNTMAMSAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pe family protein
publication title Heterologous expression of mycobacterial Esx complexes in Escherichia coli for structural studies is facilitated by the use of maltose binding protein fusions.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Metal transport
total genus 24
structure length 80
sequence length 80
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3q4hB00
2VS0A 1WA8A 4GZRB 3TXQA 2AZ0A 3FAVA 4ABMA 3OGIB 4I0XB 4LWSA 2KG7A 3O9OA 1WA8B 3Q4HA 3FD9A 3GVMA 3ZBHA 2AZ2A 3FAVB 3HR0A 4LWSB 2VRZA 2KG7B 3TXSA 2DE0X 3G80A 2B9ZA 4I0XA 3Q4HB 3GWKC
chains in the Genus database with same CATH superfamily
1M56B 4B7EA 3AEIA 2HP8A 2Q67A 4HNAB 4I55A 4P30A 1GN2A 1I94B 1TGOA 1JQ0A 4TQFA 5C8YB 4GYCB 1YEWA 3F5TA 4DV3O 2ZINA 2EIJC 4H0LB 4O4JB 5BZBA 1NH2B 2YEVA 4OX9O 1R6TA 4WBNA 4JYAB 2Y0PA 4QJFB 4MTXA 2OCCB 1QVGU 2M7WA 1JJOA 1SA0B 3N2GB 3W7UA 1H2LA 4QGPA 2E5LO 4X88A 2ATKC 2RN9A 1WNSA 3IC7A 1VF6A 3E8HA 2VRZA 1AR1B 3OW2U 4NTXA 4CH5A 3UT5A 3WG7B 4D7TA 5LOVA 3OEHG 2GV9A 2UUAB 4LF7B 5LYJB 3ETEA 2YIDA 4N23A 2UU9B 3CRAA 2ZIMA 3U0ZA 5B1OA 1U97A 5KUMA 4JI1O 3RYHA 1W2BU 2UXCB 2QTOA 3H1KH 1NS1A 4EEQA 4E2LA 5LXTB 5L3FA 1VEWA 1YCIA 4DV1O 4FFKA 4DR3B 3P3NA 4X20A 3E35A 3H1JH 5LMUO 5C93A 3ZIAG 2Z0AA 5FPOA 4GKKB 3K5NA 2EJ7A 3BEHA 4DR4O 1R3LC 1HNWB 1ROPA 4JI4O 3JSLA 3QF7A 3RYIA 2YC0A 1XILA 1GH6A 3DC5A 1NH2D 1S5HC 4IYHA 2GHYA 4GUNA 2ZE5A 2QE7G 3RGBA 4TUYB 1RP3B 1Q82W 4JGSA 3SYQA 2IH3C 1I0HA 5EC2C 1I7FA 3FYEB 3JASB 3L75H 4ZHQA 2CGNA 3CCQV 3OM3B 5KHGA 2JK5C 1MSDA 1WJZA 4DV0B 3CRRA 2DN9A 3B2EE 4NR1A 5KMGB 2GTAA 3I55V 4DV7B 4CS4A 3CMEV 2B1GA 5CB4B 2EIMC 1MNGA 3CC4V 4EFBA 2EJRA 1JA8A 1OJHA 5FNVA 3J7AU 4R50A 5CA1A 4U3JA 3E89A 4KP4A 4A5UB 1CP9A 4ASUG 4QE7A 5D5QA 5H5NA 5EIBC 4J41A 1KECA 2OIGA 3CEIA 1LR1A 1URFA 2OWOA 5BXZA 3SJBC 4DK1A 5J2UA 1H2SB 2ZDIA 4BAYA 1JMKC 4IHJA 3C3SA 4RQFA 2BOBC 2BOCC 2YXYA 1NR7A 1GM8A 2P5OA 2Q7HA 1AI7A 1F4MA 1FPOA 2QKSA 2Q69A 4ZOLB 2Z3YA 2WLIA 4H37A 1I94O 5LGTA 4DR7O 3T4DA 1GO3F 4K3AA 1JCHA 5H6QA 4LP8A 3CX5F 2RNBA 4AILC 4NYKA 3CRMA 5CA0B 4O4IB 3RVYA 3WB1A 3SPGA 2RMKB 3JYCA 4DR5B 2YSUB 1HDJA 2IJKA 1LUVA 1M4UA 4HNAA 1WLEA 2QWNB 3CD6V 3VQYA 5C8YA 1FAFA 4O2BB 3CE2A 2PF4E 4PV1B 3ASNB 4JI6B 1GTOA 4YIOA 3H9VA 4CS3A 2WA4A 1KQSU 3JARB 1YZBA 3PJSK 4B3MB 2FYUH 4B7KA 2UUAO 2ODMA 2N05A 2LO1A 4U7NA 3BFRA 2X7RB 1SA0A 2DWEC 3N2GA 1IBKB 1VF5B 1GM7A 1Q6UA 4GZRB 2W6IG 3DC6A 2R72A 4QE9A 4JI0B 3K06A 2UXCO 3IJ4A 2EBOA 4UUJC 1QQCA 1R3IC 4NXMB 2H3OA 1YSCA 1KU9A 4KXRA 2AHZA 2AGAA 5LYJA 2KG7B 1KKDA 1B04A 4DW0A 2MK3A 4DR3O 1EBOA 5L3BA 4HYOA 4ICGA 5L3GA 4LH7A 3HKBA 4LNUB 2F4VO 1V55C 4UCOA 4X1YB 5LXTA 4G28B 4BR6A 2QTSA 3ZHSA 4I7ZB 1SZXA 1FFTB 3HB3B 2LQTA 2VQFO 1PKXA 1N0NA 1H38A 2DMXA 1IURA 1KP3A 1XREA 3S3WA 4BW9A 2Q6AA 2P7TC 3KZIZ 5KA5A 5L3EA 1V54B 4JI5O 3OTOO 2NN4A 1QNMA 2OTJV 4DV2O 1N34B 4TUYA 3HKEB 2ZD9A 3ZHVA 1Z5WA 1KUQA 3ZMVA 1HNZB 4PI0A 3JASA 4K0KO 1AI5A 1SKVA 3LUTB 1VF6C 2FKXA 3OE7G 2EINB 4WFFA 2QWPB 4LBEC 1FJGB 3ZHUA 2JGDB 5EBLC 4I5SA 5EYPB 1Q43A 5B66Z 3SPJA 5CB4A 2E75B 5BR8B 4DV6O 2A9HA 1RM1C 2W0FC 4YIPA 4DW1A 3LNMB 1A32A 2DQ0A 3RFRA 2IU3A 2YICA 1XNQB 3K79A 3GWOA 2DYRB 2IJJA 1PNKA 3W7TA 2CK3G 2L6LA 3SPHA 3G6EV 1SS3A 3EVKA 4K8ZA 1MABG 4DUYB 1NZ6A 4J11A 3I5DA 5KLVH 4MW3A 3OAAG 3UO3A 4DR5O 3OMAB 4ZOLA 4MVQA 3D36C 1L8DA 1DK1A 1K3EA 3CCSV 2X6CA 3FX7A 4FIPC 5IYCO 4LCUC 1BMFG 5CA0A 1GN4A 4EFEA 4X62B 2YXHA 4CC6A 1F23A 3T4ZA 3LNNA 4I4TA 5JJNB 2F43G 3T1YB 3JD2A 3X2QC 3SR2C 2PYJA 1W59A 4FLXA 5GONB 2DOSA 4UCUA 2QKAA 4O2BA 3WB0A 2O57A 3SYCA 5B1BC 4JTCB 1TA8A 4LF6O 1XUQA 3D8CA 3TXQA 1J5EB 3JARA 2FMLA 2PI4A 2ITDC 2QEXV 4NXMO 4TOIA 3ABKC 1U96A 4X1KB 1QU7A 2UUBO 4JI3B 1IX9A 1WN7A 5CBHA 2UXBB 2Q4PA 1EN4A 3CCJV 3ETQA 1M1KW 2ZXWC 5LBQA 4MVRA 1OV9A 5IYDO 4UVCA 1YXBA 2GTSA 2Y69C 1GAXA 4O4LB 2KG7A 3ZS8C 2ZDIC 3UO2A 1E1RG 1NJIW 4RAIA 4G2KA 3DXRA 3I56V 4JZ2A 4R8CA 4FLZA 3CCLV 2EIKB 2Y48A 4CH6A 4X1YA 3AG2C 2BE3A 3F7VC 3G71V 2A79B 1BQZA 3JAKB 4TWKA 2UXDB 3LDEA 3SDLA 2ZCEA 2Q7GA 4NTWA 1N34O 3CYOA 1DF5A 4GLXA 5KA6A 1ENVA 3CCRV 3N27A 4DXWA 2ZNIA 1HNZO 4L8JA 5J2TB 3BABA 2DWDC 3E22B 1Z5VA 2DJVA 2GUZA 3R65A 4F4LA 2E76B 2Q8VA 2CTQA 3K08A 2CE4A 5L3DA 5AG2A 2IM9A 3KG2A 5GW7A 1FJGO 4TT3G 1PM9A 3HKEA 4KHPO 4EB6B 5DECA 1HNXB 2DYSC 2N74A 3CC2V 3CB2A 4I50B 4X64B 1R1BA 3ZRVA 3ZHQA 2CUGA 3EXAA 3CCEV 1VQ9V 2JJ2G 2JGDA 3WG7C 2XHBA 1VARA 5EYPA 4DR2B 1K34A 1NBMG 4LWSB 4IYIA 3CXCU 1QLNA 3ZMUA 2UXXA 4DUYO 4Q20A 5EC1C 5IY5B 1FFXB 4H13B 3CC7V 1K7DA 3HKCB 4DK0A 5B5EZ 2WAMA 3D3IA 3BPZA 1XHXA 2AXTZ 4FLUA 3F5WC 2R9RB 3DGEA 1TAEA 4WFHA 4LFAO 5JQGB 2LP7A 4JI8B 3OMIB 3K5MA 1PNLA 3RT3C 4Z1VA 5LA6A 5DN6G 4NXNB 1N36B 1XI1A 3ASOB 3FYIB 4NKGB 5B1NA 2C2AA 5KHIA 2UXNA 5HFLA 2XNDG 3AG4B 1IBLO 1DGSA 1BS3A 1US6A 1FKAO 1PPJH 1J5EO 5CBFA 3ZHTA 3QNEA 2HJFC 3CPWU 3L9DA 3QO5A 1JR9A 1RFYA 3UQ8A 2YUAA 4DRXB 2V4DA 4GKJB 1XMQB 4LFBB 2UXBO 4O4HB 3D3QA 3FD9A 2QM7A 1PV0A 3VBBA 4JI7B 1KC8W 2QR4A 4X65B 2QSAA 1VQLV 1S77D 3APOA 2DE0X 4MT8A 2ZT9B 3OUSA 1VQPV 1EM1A 3G4SV 3H1IH 3B40A 3ZRXA 2DQ3A 4OGQB 3G67A 5HFMA 3IC9A 1M90W 4NTYA 4RQEA 1P4RA 1SQPH 2WLLA 4U3FH 2LJ2A 2ZR2A 1QCEA 2F95B 4MVOA 2VWJA 4DV5B 4B3TB 4ZKIA 1WP7A 1BHAA 3THOA 5LHGA 2EULA 3ETDA 4JAUA 4J7ZA 4F6RA 1NTMH 2EIJB 3QO7A 5KUKA 5KHJA 1Q90D 1Y76B 1SQQH 3OD4A 3RW0A 3F7YC 4UCSA 1ZUQA 1UFIA 3BA9A 4LR3A 3H1LH 4RWUA 1G8MA 3ABUA 4PA3A 3L73H 2F1MA 3JAWB 4JI2O 3OT7A 2ADQB 1NVPB 5CN0A 3TCUA 1XMOB 1VQ6V 1YF2A 4PDVA 5IWAO 1HNXO 1XDCA 5B1AB 5J2TA 4FK5C 1CEZA 2E3CA 1MG1A 1QR8A 4FLYA 3ML0A 4X66B 1H2KA 4ZBMA 1K4DC 3ASNC 4J7KA 1Q3EA 2N04A 1H8EG 1VQ5V 4EB6A 4LF8B 1XL6A 2XUMA 3H01A 3ABLB 2ZR3A 4UCTA 3KCYA 4YJ3B 3OFNG 4H44B 1WPBA 2KKWA 1DLBA 4JYBA 3K9AA 3K0DA 4P9OA 4PA7A 2WLKA 1HW7A 4LWSA 2LW7A 2PTMA 4ZIBA 3L72H 4JI8O 2HVJC 1WA8B 5B3SB 3LDDA 4UFZA 4FLTA 1R6KA 1FFXA 3HKCA 3FKSG 5LP6B 1NTKH 4U7OA 2PI5A 2A7WA 4JYAO 1FXHA 5CBGA 1S76D 4JAAA 3T2MA 1MZFA 3H1HH 4MVSA 2VS0A 4TV9B 4LF4B 5JQGA 4JF3A 4QIWF 4UCRA 4O4JA 4J9ZB 4D7SA 3OEEG 3E8BA 2F23A 5H2FZ 2QM4A 3N2KB 4LF7O 2XAHA 1YIJV 4IT5A 1Y66A 3Q4HB 2LFSA 3K58A 2LGWA 3IAYA 2UU9O 1XMQO 4LFBO 2AW9A 3T1HB 2W6JG 3FB7C 1IVSA 1N33B 1QR9A 2PZSA 2QGNA 1N32B 2EX3A 2OTLV 1JX9A 4FZ0A 3TJTA 2JS3A 4LF5B 3O65A 5KAIZ 1L1FA 4DRXA 1XOUA 2ZQMA 1Z2GA 5EK0A 4AHCA 2P67A 4O4HA 3CJHB 3K03A 2EINC 4QPJA 1H2NA 2CH7B 2EILB 4B3TO 4OPAA 4GKKO 5LHIA 1HNWO 1OCOB 2OYQA 1HR0B 1R6NA 1SQFA 3OMNB 2ZNJA 4MSWC 3MD0A 4FM1A 3RYFB 2BTOA 3ZN0A 1YJWV 2GSMB 3DTUB 1VIBA 2YI9A 3ABMB 5L3CA 3E2EA 1SF9A 4R6ZA 2HVKC 1SQVH 3ZN1A 2BSKB 2NR5A 3RWRD 2FTKA 1Y74B 1FXVA 1KKCA 3CCUV 1Y76A 4DV0O 5BY1A 1XMOO 4JZGA 1OCCB 4XDKA 4DV4B 4DV7O 4G27B 2F93B 1OHHG 1E79G 3JAWA 4PHZA 5EBMC 1L0NH 1VQ8V 4X89A 4KL1A 1XNRB 5KMGA 3MAQA 1IDSA 2YIBD 3HPLC 1LUWA 3KCXA 1SETA 3A2FA 1B6QA 1PD3A 2JJ1G 5IJ9B 3A0HZ 3T1CA 2B5UA 2JGUA 1XL4A 1GKFA 4BW5A 1VMGA 1MZEA 2PGGA 3WFVA 2IH1C 3UKMA 4IL6Z 4KUMA 3B77A 5ITZB 4I0XB 3HKDB 1OCRB 1VQ7V 1TUBB 1WB8A 3JD1A 4I55B 3CSXA 5JJJB 1AVMA 4JV5B 1R3KC 1MA1A 4JASA 1NR1A 2Q73A 3R66A 1BL8A 1WA8A 3NR7A 4XDJA 4JI6O 3SYPA 4O4IA 2MW2B 2VWKA 1VQNV 4MW8A 1R73A 3JD4A 5LP6A 4NVPA 1EZJA 4B3MO 3BCCH 3JALB 1AI4A 2DW4A 3WB2A 2M6YA 1IZ3A 3MHHC 2XAFA 3ZRSA 4TV9A 1IBKO 1S5LZ 2WLMA 2NLJC 4DV3B 5KHHA 1P7BA 2OCHA 1G1XB 1ZL8B 1K73W 2HHHB 1N33O 4JI0O 4RUEA 2XAJA 3UT5B 1NU1H 3FB6C 1I5YA 5LOVB 3Q4HA 1Q5OA 3HR0A 2E5LB 4P2ZA 2HEPA 4BIOA 2BTQB 4K8XA 3B09A 3CS5A 3VQXA 3ZMZA 5GTIZ 5JVDB 2YIBA 4WFEA 1HR0O 4YHHB 3ZHRA 2WA3A 1EZVH 5FLXN 4JPRA 2CTRA 2EZPA 1P7GA 4F6EA 4BIZA 2EZOA 4C7UA 4CC5A 3CJHA 3J81N 1Y6XA 3LSQA 4ZI7B 2CH7A 4PD4F 4JI1B 3RBZA 4LNUA 5CMUA 4UVAA 3K0GA 5TISZ 3RYIB 3FB8C 1NQTA 4H33A 1FXKB 4DV1B 2RCVA 3B4SA 5JJEB 2QA4V 4CZZA 3RYFA 5IT9N 4JYYA 5H9CA 2A0LA 3VOUA 1M56C 1BGYH 1AJQA 2P4VA 3AG3B 1UPGA 4DV4O 4FZ1A 2CDYA 1K5SA 2ZE8A 4IIJB 4DR4B 1BT8A 3ZCCA 4JI4B 2Z5UA 4ZHQB 1TUEB 2HLDG 2IJHA 2BSKA 1K8AW 1VQ4V 1G6UA 2RDCA 2GBOA 4UV9A 1QHTA 3JCZA 4GX5A 1YJNV 3CCMV 1XNRO 4FM2A 2QWQB 2OCCC 1VP7A 2HR3A 1VQKV 5BR8O 3L70H 3LDCA 1BZKA 3ABTA 3MDSA 1K4CC 1N8RW 5IJ0B 1B06A 2K9PA 5EZYB 4AQYB 1XNQO 1YI2V 2ZXWB 1BQ0A 1AB3A 1UJWB 2HKOA 1M93A 1RPRA 1FS0G 3QO8A 3SJQC 5IJ9A 4CS2A 5DM6V 1M57B 1OCZB 4HZ3A 1EN5A 3QVNA 1FD9A 3E8GA 4KFMA 4Z2WA 4DR1B 4PA4A 1GN6A 3QG5A 4MVMA 1H2GA 2NNUA 4JV5O 4FFBB 3GVMA 5A2QN 5ITZA 3SGIA 2LGQA 5K1PA 4I0XA 4OPHA 4X62O 3CMAV 3S3XA 1MOFA 3T1YO 1TUBA 4YJ2B 5KHKA 1S3JA 3SPIA 1G4YB 1H8HG 3ETGA 4DR7B 4JYCA 1VQMV 4FJCC 1O9GA 2CTWA 1ZTEA 2X6BA 2HHHO 3AK2A 4LH6A 2B9ZA 3CWBH 4W4LA 4FM0A 2WWWA 3ZX6A 1OZ0A 3JALA 2DYSB 2ARHA 5GONA 1DF4A 1EN6A 4JI3O 4J80A 1WB7A 1HWYA 1ZL8A 3FAVB 2QDOA 2YIAA 1QLEB 2G38A 2KQXA 1IXBA 3W7SA 4PDMA 4HAMA 5B1AC 3UCSC 4YHHO 2Q7EA 3BA8A 4WF9V 4X1KA 3SJAC 2XAGA 4FLVA 3AG1B 4GCZA 2BTQA 5BMVB 2A3QA 3HKBB 2H94A 4EKWA 2XOKG 2HG5C 3OTFA 5JVDA 4L87A 4UVBA 4O4LA 5CA3A 3ABLC 4FPPA 2UXDO 1VF7A 4LC1A 1AJNA 2JEUA 3BVOA 4O2AB 1JVMA 4PJ0Z 1K33A 3UM7A 4ZI7A 2LFRA 1K5QA 4J42A 4WCEV 1YTFB 2F4VB 4BWAA 1ORQC 3D36A 3OR7C 3TK1A 2P4KA 4W4KA 3JAKA 1Q7YW 1WP8A 5B3SC 2YDEA 1FXKA 3K9SA 4PA9A 1BHBA 4GX2A 1COWG 2VQFB 5EBWC 4WFAV 4PELA 5LP6C 2WPDG 2D2CB 3JCUZ 4LF9B 4IGGA 3K04A 2E74B 3IFXA 4IIJA 4X9QA 3ZBHA 3E22A 1ZX3A 4X64O 1Q8IA 1SZTA 1W0KG 2OIEA 3MHSC 3K5LA 2JDIG 4JI5B 3OTOB 1BSMA 3RYCB 2ZE7A 4AQYO 4DV2B 1IBMB 3ZRWB 1WAZA 4DR2O 5KX5B 1CPYA 3GB7C 3M7MX 4LFCB 4CH3A 5LL6Y 5JH7B 4PDRA 5FPRA 2V7QG 4I50A 4K0KB 3BY6A 4XBFA 5DEDA 3TXSA 4DO2A 3B8MA 1CXZB 1D5NA 5IJ0A 2OT5A 2UUCB 5EZYA 1YHQV 2WSSG 4YY3B 5FL7G 1XBLA 4I9WA 4DR1O 3W7WA 2JVDA 1P84F 3P32A 3BHPA 1WPXA 1JFFB 5IE9A 3STZC 2Q9LA 4DV6B 2Y0IA 1E1QG 4TV8B 1Y4MA 2ZKOA 2R9AA 1AR5A 3SJCC 4NXNO 1Y67A 1N36O 1BCCH 2EILC 3BRCA 3B8NA 3E83A 4B08A 1YTFD 4B3SB 1BE3H 4BIUA 2Q0OC 4J9YB 1GMGA 1S0VA 1OCOC 3M99B 1D5AA 4UCVA 1XEQA 4FFBA 1T5EA 2VQEB 3SPCA 3K57A 4UV8A 4MTOA 1NVPD 1TVKB 4FLWA 1SERA 3K3WA 1NKDA 2AZ2A 4K35A 4I4TB 2K1EA 4GT1A 4XDLA 2JS5A 4YJ2A 4DUZB 3ABMC 2FB5A 2R70A 3QTCA 4J7JA 1YITV 3E86A 4B3RB 1QBZA 1RPOA 2EIMB 5A9GA 5JWPA 3CP1A 4GKJO 5E79Z 5JCOA 1V54C 2QWOB 4JI7O 1SQXH 2JRIA 3O9OA 1JJ2U 4X65O 5IDJA 1ZAUA 1OCCC 3DSQA 2QJ1A 3P30A 4MTGA 3W7XA 2Y4TA 1PL0A 3ZMTA 3LSSA 4OXSA 5D5PA 1SESA 5K1XA 5J9PC 3ZEDA 2QM8A 2KB1A 4Q6GA 1AR4A 3FAVA 3EHBB 1B3QA 4DV5O 4LF6B 3RN4A 1K9MW 4WFBV 3AK1A 1XHZA 1K92A 1MSWD 4WFGA 2F66C 1JPXA 1NT2B 4X1IB 1GN3A 1AI6A 2UUBB 1NTZH 1Q6HA 3CCVV 5LHHA 3DXRB 2Q5ZA 5BMVA 1D2DA 1AILA 2IU0A 2DYRC 5F2VO 3M8AA 5LMNB 4TQDA 2P22C 1SRYA 1P49A 1N4CA 3G80A 1EFRG 1OCRC 2ILMA 4O2AA 1ZLZA 1M5IA 2QKCA 1F7YA 2PY5A 3C90A 1HP8A 4LF9O 1J95A 2AZ0A 5KAFZ 2ZM6B 2JIZG 4X66O 1XQ8A 2GUZB 1MMMA 3L71H 4DR6B 1PL4A 1F51A 2ZIOA 3APQA 2XTAA 3JATB 1IBMO 3ZMSA 3IGAC 2BCCH 4LF8O 5EIBD 4PDLA 3K59A 4LFCO 3VQVA 1NI8A 3C3TA 1JOYA 4PA6A 3OGCC 1ZSPA 1Q6IA 1SC5B 3RVZA 1K97A 4YXWG 3NXSA 1L0LH 4UB6Z 2ETNA 3U11A 2UUCO 1RSOB 4YY3O 4MTFA 3RYCA 1F4NA 3EFFK 2CAZC 2Y4UA 3ZRWA 4KHPB 1H2MA 4CH4A 1KB9F 3TETA 5KX5A 1V55B 5IYZB 3JSNA 5JH7A 3U10A 2WLNA 4TSFG 1GK9A 3OUFA 4RO2A 2YS8A 4UB8Z 4YJ3A 2X0LA 1S5JA 2V1DA 3SYAA 1W0JG 1YDXA 1N0JA 1THZA 2B1IA 3FB5C 4B3SO 2RQ6A 2IJIA 4PI2A 4HBNA 4JAVA 4MVZA 1JFFA 1Q81W 4LF4O 2VQEO 2JEXA 1DTOA 2LW1A 2IW5A 4TV8A 2YEVB 3OGIB 3CRCA 5LA6B 4WBNB 3J80N 1ZWIC 1AP5A 4DUZO 4R7CA 2EIKC 4I9QA 2AHYA 1X4TA 4B3RO 3PN1A 1GRJA 4UXNA 2QWRB 4LFAB 1FXKC 3OR6C 3T1HO 1TVKA 2WLHA 3ICXA 4OX9B 3AG3C 1VQOV 4AI8A 1N32O 2HJDA 4LF5O 1PP9H 3N2KA 1AROP 2X6AA 1IBLB 1AP6A 1RM1B 2H8PC 2Q0AA 3AG7A 4N21A 5LGUA 3KKYA 3ZJZA 3RYHB 4P9PA 5IYBO 2P06A 4X20B 1YJ9V 4JTDB 1IXMA 2ITCC 2WLLB 3BAAA 1V9PA 1R3JC 3E8FA 2P6JA 2Q68A 3G6BA 3VQWA 4CBCA 5LMNO 4X1IA 5GTHZ 3STLC 4QPKA 3CXHF 3A0BZ 4F6RB 5IY5C 5E1AC 1M57C 3AK3A 1OCZC 1Q86W 5LMUB 1I08A 2D3OW 4DYLA 1O9HA 4D6TH 4GX0A 2WLJA 2CTPA 3X2QB 1AJPA 1S72V 2PUSA 2ZM6O 4GX1A 1KD1W 4MS2A 4MVUA 4DR6O 2A06H 1Y74A 3K5OA 2W0XA 4JTAB 5B1BB 1GM9A 3JD0A 4E4EA 3A0RA 3ASOC 1KBHA 1QVFU 4Z1MG 4X8AA 1KYOF 2FL4A 4QNHB 2L35A 3ABKB 2HFEC 2XASA 1LNQA 4FVMA 2ZE6A 2XT9A 3AG4C 2YI8A 1X59A 2P90A 5JCOC 2PYLA 5LGNA 5FNVB 4JI2B 5CA1B 4U3JB 4J10A 3CRQA 3JATA 3JAMN 5IWAB 4RUFA 1I5XA 3LSUA 3L74H 3CHXA 2Y69B 1SQBH 5H6RA 3SYOA 5J2UB 1FYJA 4FMTA 2KSDA 4IHJB 1RSOA 4ABMA 1QLEC 3A8TA 2ADPA 1KP2A 1M9NA 2CGOA 2WLIB 4NB5A 5IYZA 3TGUH 2IBZH 3AG2B 3FFQA 2XAQA 2R9IA 3AG1C 3WU2Z 1PNMA 2RJZA 1YVWA 1KMIZ 2GDSA 3HKDA 3GWKC 3P3PA 1SQGA 3JD3A 2YXLA
chains in the Genus database with same CATH topology
2VS0A 1WA8A 4GZRB 3TXQA 2AZ0A 3FAVA 4ABMA 3OGIB 4I0XB 4LWSA 2KG7A 3O9OA 1WA8B 3Q4HA 3FD9A 3GVMA 3ZBHA 2AZ2A 3FAVB 3HR0A 4LWSB 2VRZA 2KG7B 3TXSA 2DE0X 3G80A 2B9ZA 4I0XA 3Q4HB 3GWKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VS0 A;  1WA8 A;  4GZR B;  3TXQ A;  2AZ0 A;  3FAV A;  4ABM A;  3OGI B;  4I0X B;  4LWS A;  2KG7 A;  3O9O A;  1WA8 B;  3Q4H A;  3FD9 A;  3GVM A;  3ZBH A;  2AZ2 A;  3FAV B;  3HR0 A;  4LWS B;  2VRZ A;  2KG7 B;  3TXS A;  2DE0 X;  3G80 A;  2B9Z A;  4I0X A;  3Q4H B;  3GWK C; 
#chains in the Genus database with same CATH topology
 1M56 B;  4B7E A;  3AEI A;  2HP8 A;  2Q67 A;  4HNA B;  4I55 A;  4P30 A;  1GN2 A;  1I94 B;  1TGO A;  1JQ0 A;  4TQF A;  5C8Y B;  4GYC B;  1YEW A;  3F5T A;  4DV3 O;  2ZIN A;  2EIJ C;  4H0L B;  4O4J B;  5BZB A;  1NH2 B;  2YEV A;  4OX9 O;  1R6T A;  4WBN A;  4JYA B;  2Y0P A;  4QJF B;  4MTX A;  2OCC B;  1QVG U;  2M7W A;  1JJO A;  1SA0 B;  3N2G B;  3W7U A;  1H2L A;  4QGP A;  2E5L O;  4X88 A;  2ATK C;  2RN9 A;  1WNS A;  3IC7 A;  1VF6 A;  3E8H A;  2VRZ A;  1AR1 B;  3OW2 U;  4NTX A;  4CH5 A;  3UT5 A;  3WG7 B;  4D7T A;  5LOV A;  3OEH G;  2GV9 A;  2UUA B;  4LF7 B;  5LYJ B;  3ETE A;  2YID A;  4N23 A;  2UU9 B;  3CRA A;  2ZIM A;  3U0Z A;  5B1O A;  1U97 A;  5KUM A;  4JI1 O;  3RYH A;  1W2B U;  2UXC B;  2QTO A;  3H1K H;  1NS1 A;  4EEQ A;  4E2L A;  5LXT B;  5L3F A;  1VEW A;  1YCI A;  4DV1 O;  4FFK A;  4DR3 B;  3P3N A;  4X20 A;  3E35 A;  3H1J H;  5LMU O;  5C93 A;  3ZIA G;  2Z0A A;  5FPO A;  4GKK B;  3K5N A;  2EJ7 A;  3BEH A;  4DR4 O;  1R3L C;  1HNW B;  1ROP A;  4JI4 O;  3JSL A;  3QF7 A;  3RYI A;  2YC0 A;  1XIL A;  1GH6 A;  3DC5 A;  1NH2 D;  1S5H C;  4IYH A;  2GHY A;  4GUN A;  2ZE5 A;  2QE7 G;  3RGB A;  4TUY B;  1RP3 B;  1Q82 W;  4JGS A;  3SYQ A;  2IH3 C;  1I0H A;  5EC2 C;  1I7F A;  3FYE B;  3JAS B;  3L75 H;  4ZHQ A;  2CGN A;  3CCQ V;  3OM3 B;  5KHG A;  2JK5 C;  1MSD A;  1WJZ A;  4DV0 B;  3CRR A;  2DN9 A;  3B2E E;  4NR1 A;  5KMG B;  2GTA A;  3I55 V;  4DV7 B;  4CS4 A;  3CME V;  2B1G A;  5CB4 B;  2EIM C;  1MNG A;  3CC4 V;  4EFB A;  2EJR A;  1JA8 A;  1OJH A;  5FNV A;  3J7A U;  4R50 A;  5CA1 A;  4U3J A;  3E89 A;  4KP4 A;  4A5U B;  1CP9 A;  4ASU G;  4QE7 A;  5D5Q A;  5H5N A;  5EIB C;  4J41 A;  1KEC A;  2OIG A;  3CEI A;  1LR1 A;  1URF A;  2OWO A;  5BXZ A;  3SJB C;  4DK1 A;  5J2U A;  1H2S B;  2ZDI A;  4BAY A;  1JMK C;  4IHJ A;  3C3S A;  4RQF A;  2BOB C;  2BOC C;  2YXY A;  1NR7 A;  1GM8 A;  2P5O A;  2Q7H A;  1AI7 A;  1F4M A;  1FPO A;  2QKS A;  2Q69 A;  4ZOL B;  2Z3Y A;  2WLI A;  4H37 A;  1I94 O;  5LGT A;  4DR7 O;  3T4D A;  1GO3 F;  4K3A A;  1JCH A;  5H6Q A;  4LP8 A;  3CX5 F;  2RNB A;  4AIL C;  4NYK A;  3CRM A;  5CA0 B;  4O4I B;  3RVY A;  3WB1 A;  3SPG A;  2RMK B;  3JYC A;  4DR5 B;  2YSU B;  1HDJ A;  2IJK A;  1LUV A;  1M4U A;  4HNA A;  1WLE A;  2QWN B;  3CD6 V;  3VQY A;  5C8Y A;  1FAF A;  4O2B B;  3CE2 A;  2PF4 E;  4PV1 B;  3ASN B;  4JI6 B;  1GTO A;  4YIO A;  3H9V A;  4CS3 A;  2WA4 A;  1KQS U;  3JAR B;  1YZB A;  3PJS K;  4B3M B;  2FYU H;  4B7K A;  2UUA O;  2ODM A;  2N05 A;  2LO1 A;  4U7N A;  3BFR A;  2X7R B;  1SA0 A;  2DWE C;  3N2G A;  1IBK B;  1VF5 B;  1GM7 A;  1Q6U A;  4GZR B;  2W6I G;  3DC6 A;  2R72 A;  4QE9 A;  4JI0 B;  3K06 A;  2UXC O;  3IJ4 A;  2EBO A;  4UUJ C;  1QQC A;  1R3I C;  4NXM B;  2H3O A;  1YSC A;  1KU9 A;  4KXR A;  2AHZ A;  2AGA A;  5LYJ A;  2KG7 B;  1KKD A;  1B04 A;  4DW0 A;  2MK3 A;  4DR3 O;  1EBO A;  5L3B A;  4HYO A;  4ICG A;  5L3G A;  4LH7 A;  3HKB A;  4LNU B;  2F4V O;  1V55 C;  4UCO A;  4X1Y B;  5LXT A;  4G28 B;  4BR6 A;  2QTS A;  3ZHS A;  4I7Z B;  1SZX A;  1FFT B;  3HB3 B;  2LQT A;  2VQF O;  1PKX A;  1N0N A;  1H38 A;  2DMX A;  1IUR A;  1KP3 A;  1XRE A;  3S3W A;  4BW9 A;  2Q6A A;  2P7T C;  3KZI Z;  5KA5 A;  5L3E A;  1V54 B;  4JI5 O;  3OTO O;  2NN4 A;  1QNM A;  2OTJ V;  4DV2 O;  1N34 B;  4TUY A;  3HKE B;  2ZD9 A;  3ZHV A;  1Z5W A;  1KUQ A;  3ZMV A;  1HNZ B;  4PI0 A;  3JAS A;  4K0K O;  1AI5 A;  1SKV A;  3LUT B;  1VF6 C;  2FKX A;  3OE7 G;  2EIN B;  4WFF A;  2QWP B;  4LBE C;  1FJG B;  3ZHU A;  2JGD B;  5EBL C;  4I5S A;  5EYP B;  1Q43 A;  5B66 Z;  3SPJ A;  5CB4 A;  2E75 B;  5BR8 B;  4DV6 O;  2A9H A;  1RM1 C;  2W0F C;  4YIP A;  4DW1 A;  3LNM B;  1A32 A;  2DQ0 A;  3RFR A;  2IU3 A;  2YIC A;  1XNQ B;  3K79 A;  3GWO A;  2DYR B;  2IJJ A;  1PNK A;  3W7T A;  2CK3 G;  2L6L A;  3SPH A;  3G6E V;  1SS3 A;  3EVK A;  4K8Z A;  1MAB G;  4DUY B;  1NZ6 A;  4J11 A;  3I5D A;  5KLV H;  4MW3 A;  3OAA G;  3UO3 A;  4DR5 O;  3OMA B;  4ZOL A;  4MVQ A;  3D36 C;  1L8D A;  1DK1 A;  1K3E A;  3CCS V;  2X6C A;  3FX7 A;  4FIP C;  5IYC O;  4LCU C;  1BMF G;  5CA0 A;  1GN4 A;  4EFE A;  4X62 B;  2YXH A;  4CC6 A;  1F23 A;  3T4Z A;  3LNN A;  4I4T A;  5JJN B;  2F43 G;  3T1Y B;  3JD2 A;  3X2Q C;  3SR2 C;  2PYJ A;  1W59 A;  4FLX A;  5GON B;  2DOS A;  4UCU A;  2QKA A;  4O2B A;  3WB0 A;  2O57 A;  3SYC A;  5B1B C;  4JTC B;  1TA8 A;  4LF6 O;  1XUQ A;  3D8C A;  3TXQ A;  1J5E B;  3JAR A;  2FML A;  2PI4 A;  2ITD C;  2QEX V;  4NXM O;  4TOI A;  3ABK C;  1U96 A;  4X1K B;  1QU7 A;  2UUB O;  4JI3 B;  1IX9 A;  1WN7 A;  5CBH A;  2UXB B;  2Q4P A;  1EN4 A;  3CCJ V;  3ETQ A;  1M1K W;  2ZXW C;  5LBQ A;  4MVR A;  1OV9 A;  5IYD O;  4UVC A;  1YXB A;  2GTS A;  2Y69 C;  1GAX A;  4O4L B;  2KG7 A;  3ZS8 C;  2ZDI C;  3UO2 A;  1E1R G;  1NJI W;  4RAI A;  4G2K A;  3DXR A;  3I56 V;  4JZ2 A;  4R8C A;  4FLZ A;  3CCL V;  2EIK B;  2Y48 A;  4CH6 A;  4X1Y A;  3AG2 C;  2BE3 A;  3F7V C;  3G71 V;  2A79 B;  1BQZ A;  3JAK B;  4TWK A;  2UXD B;  3LDE A;  3SDL A;  2ZCE A;  2Q7G A;  4NTW A;  1N34 O;  3CYO A;  1DF5 A;  4GLX A;  5KA6 A;  1ENV A;  3CCR V;  3N27 A;  4DXW A;  2ZNI A;  1HNZ O;  4L8J A;  5J2T B;  3BAB A;  2DWD C;  3E22 B;  1Z5V A;  2DJV A;  2GUZ A;  3R65 A;  4F4L A;  2E76 B;  2Q8V A;  2CTQ A;  3K08 A;  2CE4 A;  5L3D A;  5AG2 A;  2IM9 A;  3KG2 A;  5GW7 A;  1FJG O;  4TT3 G;  1PM9 A;  3HKE A;  4KHP O;  4EB6 B;  5DEC A;  1HNX B;  2DYS C;  2N74 A;  3CC2 V;  3CB2 A;  4I50 B;  4X64 B;  1R1B A;  3ZRV A;  3ZHQ A;  2CUG A;  3EXA A;  3CCE V;  1VQ9 V;  2JJ2 G;  2JGD A;  3WG7 C;  2XHB A;  1VAR A;  5EYP A;  4DR2 B;  1K34 A;  1NBM G;  4LWS B;  4IYI A;  3CXC U;  1QLN A;  3ZMU A;  2UXX A;  4DUY O;  4Q20 A;  5EC1 C;  5IY5 B;  1FFX B;  4H13 B;  3CC7 V;  1K7D A;  3HKC B;  4DK0 A;  5B5E Z;  2WAM A;  3D3I A;  3BPZ A;  1XHX A;  2AXT Z;  4FLU A;  3F5W C;  2R9R B;  3DGE A;  1TAE A;  4WFH A;  4LFA O;  5JQG B;  2LP7 A;  4JI8 B;  3OMI B;  3K5M A;  1PNL A;  3RT3 C;  4Z1V A;  5LA6 A;  5DN6 G;  4NXN B;  1N36 B;  1XI1 A;  3ASO B;  3FYI B;  4NKG B;  5B1N A;  2C2A A;  5KHI A;  2UXN A;  5HFL A;  2XND G;  3AG4 B;  1IBL O;  1DGS A;  1BS3 A;  1US6 A;  1FKA O;  1PPJ H;  1J5E O;  5CBF A;  3ZHT A;  3QNE A;  2HJF C;  3CPW U;  3L9D A;  3QO5 A;  1JR9 A;  1RFY A;  3UQ8 A;  2YUA A;  4DRX B;  2V4D A;  4GKJ B;  1XMQ B;  4LFB B;  2UXB O;  4O4H B;  3D3Q A;  3FD9 A;  2QM7 A;  1PV0 A;  3VBB A;  4JI7 B;  1KC8 W;  2QR4 A;  4X65 B;  2QSA A;  1VQL V;  1S77 D;  3APO A;  2DE0 X;  4MT8 A;  2ZT9 B;  3OUS A;  1VQP V;  1EM1 A;  3G4S V;  3H1I H;  3B40 A;  3ZRX A;  2DQ3 A;  4OGQ B;  3G67 A;  5HFM A;  3IC9 A;  1M90 W;  4NTY A;  4RQE A;  1P4R A;  1SQP H;  2WLL A;  4U3F H;  2LJ2 A;  2ZR2 A;  1QCE A;  2F95 B;  4MVO A;  2VWJ A;  4DV5 B;  4B3T B;  4ZKI A;  1WP7 A;  1BHA A;  3THO A;  5LHG A;  2EUL A;  3ETD A;  4JAU A;  4J7Z A;  4F6R A;  1NTM H;  2EIJ B;  3QO7 A;  5KUK A;  5KHJ A;  1Q90 D;  1Y76 B;  1SQQ H;  3OD4 A;  3RW0 A;  3F7Y C;  4UCS A;  1ZUQ A;  1UFI A;  3BA9 A;  4LR3 A;  3H1L H;  4RWU A;  1G8M A;  3ABU A;  4PA3 A;  3L73 H;  2F1M A;  3JAW B;  4JI2 O;  3OT7 A;  2ADQ B;  1NVP B;  5CN0 A;  3TCU A;  1XMO B;  1VQ6 V;  1YF2 A;  4PDV A;  5IWA O;  1HNX O;  1XDC A;  5B1A B;  5J2T A;  4FK5 C;  1CEZ A;  2E3C A;  1MG1 A;  1QR8 A;  4FLY A;  3ML0 A;  4X66 B;  1H2K A;  4ZBM A;  1K4D C;  3ASN C;  4J7K A;  1Q3E A;  2N04 A;  1H8E G;  1VQ5 V;  4EB6 A;  4LF8 B;  1XL6 A;  2XUM A;  3H01 A;  3ABL B;  2ZR3 A;  4UCT A;  3KCY A;  4YJ3 B;  3OFN G;  4H44 B;  1WPB A;  2KKW A;  1DLB A;  4JYB A;  3K9A A;  3K0D A;  4P9O A;  4PA7 A;  2WLK A;  1HW7 A;  4LWS A;  2LW7 A;  2PTM A;  4ZIB A;  3L72 H;  4JI8 O;  2HVJ C;  1WA8 B;  5B3S B;  3LDD A;  4UFZ A;  4FLT A;  1R6K A;  1FFX A;  3HKC A;  3FKS G;  5LP6 B;  1NTK H;  4U7O A;  2PI5 A;  2A7W A;  4JYA O;  1FXH A;  5CBG A;  1S76 D;  4JAA A;  3T2M A;  1MZF A;  3H1H H;  4MVS A;  2VS0 A;  4TV9 B;  4LF4 B;  5JQG A;  4JF3 A;  4QIW F;  4UCR A;  4O4J A;  4J9Z B;  4D7S A;  3OEE G;  3E8B A;  2F23 A;  5H2F Z;  2QM4 A;  3N2K B;  4LF7 O;  2XAH A;  1YIJ V;  4IT5 A;  1Y66 A;  3Q4H B;  2LFS A;  3K58 A;  2LGW A;  3IAY A;  2UU9 O;  1XMQ O;  4LFB O;  2AW9 A;  3T1H B;  2W6J G;  3FB7 C;  1IVS A;  1N33 B;  1QR9 A;  2PZS A;  2QGN A;  1N32 B;  2EX3 A;  2OTL V;  1JX9 A;  4FZ0 A;  3TJT A;  2JS3 A;  4LF5 B;  3O65 A;  5KAI Z;  1L1F A;  4DRX A;  1XOU A;  2ZQM A;  1Z2G A;  5EK0 A;  4AHC A;  2P67 A;  4O4H A;  3CJH B;  3K03 A;  2EIN C;  4QPJ A;  1H2N A;  2CH7 B;  2EIL B;  4B3T O;  4OPA A;  4GKK O;  5LHI A;  1HNW O;  1OCO B;  2OYQ A;  1HR0 B;  1R6N A;  1SQF A;  3OMN B;  2ZNJ A;  4MSW C;  3MD0 A;  4FM1 A;  3RYF B;  2BTO A;  3ZN0 A;  1YJW V;  2GSM B;  3DTU B;  1VIB A;  2YI9 A;  3ABM B;  5L3C A;  3E2E A;  1SF9 A;  4R6Z A;  2HVK C;  1SQV H;  3ZN1 A;  2BSK B;  2NR5 A;  3RWR D;  2FTK A;  1Y74 B;  1FXV A;  1KKC A;  3CCU V;  1Y76 A;  4DV0 O;  5BY1 A;  1XMO O;  4JZG A;  1OCC B;  4XDK A;  4DV4 B;  4DV7 O;  4G27 B;  2F93 B;  1OHH G;  1E79 G;  3JAW A;  4PHZ A;  5EBM C;  1L0N H;  1VQ8 V;  4X89 A;  4KL1 A;  1XNR B;  5KMG A;  3MAQ A;  1IDS A;  2YIB D;  3HPL C;  1LUW A;  3KCX A;  1SET A;  3A2F A;  1B6Q A;  1PD3 A;  2JJ1 G;  5IJ9 B;  3A0H Z;  3T1C A;  2B5U A;  2JGU A;  1XL4 A;  1GKF A;  4BW5 A;  1VMG A;  1MZE A;  2PGG A;  3WFV A;  2IH1 C;  3UKM A;  4IL6 Z;  4KUM A;  3B77 A;  5ITZ B;  4I0X B;  3HKD B;  1OCR B;  1VQ7 V;  1TUB B;  1WB8 A;  3JD1 A;  4I55 B;  3CSX A;  5JJJ B;  1AVM A;  4JV5 B;  1R3K C;  1MA1 A;  4JAS A;  1NR1 A;  2Q73 A;  3R66 A;  1BL8 A;  1WA8 A;  3NR7 A;  4XDJ A;  4JI6 O;  3SYP A;  4O4I A;  2MW2 B;  2VWK A;  1VQN V;  4MW8 A;  1R73 A;  3JD4 A;  5LP6 A;  4NVP A;  1EZJ A;  4B3M O;  3BCC H;  3JAL B;  1AI4 A;  2DW4 A;  3WB2 A;  2M6Y A;  1IZ3 A;  3MHH C;  2XAF A;  3ZRS A;  4TV9 A;  1IBK O;  1S5L Z;  2WLM A;  2NLJ C;  4DV3 B;  5KHH A;  1P7B A;  2OCH A;  1G1X B;  1ZL8 B;  1K73 W;  2HHH B;  1N33 O;  4JI0 O;  4RUE A;  2XAJ A;  3UT5 B;  1NU1 H;  3FB6 C;  1I5Y A;  5LOV B;  3Q4H A;  1Q5O A;  3HR0 A;  2E5L B;  4P2Z A;  2HEP A;  4BIO A;  2BTQ B;  4K8X A;  3B09 A;  3CS5 A;  3VQX A;  3ZMZ A;  5GTI Z;  5JVD B;  2YIB A;  4WFE A;  1HR0 O;  4YHH B;  3ZHR A;  2WA3 A;  1EZV H;  5FLX N;  4JPR A;  2CTR A;  2EZP A;  1P7G A;  4F6E A;  4BIZ A;  2EZO A;  4C7U A;  4CC5 A;  3CJH A;  3J81 N;  1Y6X A;  3LSQ A;  4ZI7 B;  2CH7 A;  4PD4 F;  4JI1 B;  3RBZ A;  4LNU A;  5CMU A;  4UVA A;  3K0G A;  5TIS Z;  3RYI B;  3FB8 C;  1NQT A;  4H33 A;  1FXK B;  4DV1 B;  2RCV A;  3B4S A;  5JJE B;  2QA4 V;  4CZZ A;  3RYF A;  5IT9 N;  4JYY A;  5H9C A;  2A0L A;  3VOU A;  1M56 C;  1BGY H;  1AJQ A;  2P4V A;  3AG3 B;  1UPG A;  4DV4 O;  4FZ1 A;  2CDY A;  1K5S A;  2ZE8 A;  4IIJ B;  4DR4 B;  1BT8 A;  3ZCC A;  4JI4 B;  2Z5U A;  4ZHQ B;  1TUE B;  2HLD G;  2IJH A;  2BSK A;  1K8A W;  1VQ4 V;  1G6U A;  2RDC A;  2GBO A;  4UV9 A;  1QHT A;  3JCZ A;  4GX5 A;  1YJN V;  3CCM V;  1XNR O;  4FM2 A;  2QWQ B;  2OCC C;  1VP7 A;  2HR3 A;  1VQK V;  5BR8 O;  3L70 H;  3LDC A;  1BZK A;  3ABT A;  3MDS A;  1K4C C;  1N8R W;  5IJ0 B;  1B06 A;  2K9P A;  5EZY B;  4AQY B;  1XNQ O;  1YI2 V;  2ZXW B;  1BQ0 A;  1AB3 A;  1UJW B;  2HKO A;  1M93 A;  1RPR A;  1FS0 G;  3QO8 A;  3SJQ C;  5IJ9 A;  4CS2 A;  5DM6 V;  1M57 B;  1OCZ B;  4HZ3 A;  1EN5 A;  3QVN A;  1FD9 A;  3E8G A;  4KFM A;  4Z2W A;  4DR1 B;  4PA4 A;  1GN6 A;  3QG5 A;  4MVM A;  1H2G A;  2NNU A;  4JV5 O;  4FFB B;  3GVM A;  5A2Q N;  5ITZ A;  3SGI A;  2LGQ A;  5K1P A;  4I0X A;  4OPH A;  4X62 O;  3CMA V;  3S3X A;  1MOF A;  3T1Y O;  1TUB A;  4YJ2 B;  5KHK A;  1S3J A;  3SPI A;  1G4Y B;  1H8H G;  3ETG A;  4DR7 B;  4JYC A;  1VQM V;  4FJC C;  1O9G A;  2CTW A;  1ZTE A;  2X6B A;  2HHH O;  3AK2 A;  4LH6 A;  2B9Z A;  3CWB H;  4W4L A;  4FM0 A;  2WWW A;  3ZX6 A;  1OZ0 A;  3JAL A;  2DYS B;  2ARH A;  5GON A;  1DF4 A;  1EN6 A;  4JI3 O;  4J80 A;  1WB7 A;  1HWY A;  1ZL8 A;  3FAV B;  2QDO A;  2YIA A;  1QLE B;  2G38 A;  2KQX A;  1IXB A;  3W7S A;  4PDM A;  4HAM A;  5B1A C;  3UCS C;  4YHH O;  2Q7E A;  3BA8 A;  4WF9 V;  4X1K A;  3SJA C;  2XAG A;  4FLV A;  3AG1 B;  4GCZ A;  2BTQ A;  5BMV B;  2A3Q A;  3HKB B;  2H94 A;  4EKW A;  2XOK G;  2HG5 C;  3OTF A;  5JVD A;  4L87 A;  4UVB A;  4O4L A;  5CA3 A;  3ABL C;  4FPP A;  2UXD O;  1VF7 A;  4LC1 A;  1AJN A;  2JEU A;  3BVO A;  4O2A B;  1JVM A;  4PJ0 Z;  1K33 A;  3UM7 A;  4ZI7 A;  2LFR A;  1K5Q A;  4J42 A;  4WCE V;  1YTF B;  2F4V B;  4BWA A;  1ORQ C;  3D36 A;  3OR7 C;  3TK1 A;  2P4K A;  4W4K A;  3JAK A;  1Q7Y W;  1WP8 A;  5B3S C;  2YDE A;  1FXK A;  3K9S A;  4PA9 A;  1BHB A;  4GX2 A;  1COW G;  2VQF B;  5EBW C;  4WFA V;  4PEL A;  5LP6 C;  2WPD G;  2D2C B;  3JCU Z;  4LF9 B;  4IGG A;  3K04 A;  2E74 B;  3IFX A;  4IIJ A;  4X9Q A;  3ZBH A;  3E22 A;  1ZX3 A;  4X64 O;  1Q8I A;  1SZT A;  1W0K G;  2OIE A;  3MHS C;  3K5L A;  2JDI G;  4JI5 B;  3OTO B;  1BSM A;  3RYC B;  2ZE7 A;  4AQY O;  4DV2 B;  1IBM B;  3ZRW B;  1WAZ A;  4DR2 O;  5KX5 B;  1CPY A;  3GB7 C;  3M7M X;  4LFC B;  4CH3 A;  5LL6 Y;  5JH7 B;  4PDR A;  5FPR A;  2V7Q G;  4I50 A;  4K0K B;  3BY6 A;  4XBF A;  5DED A;  3TXS A;  4DO2 A;  3B8M A;  1CXZ B;  1D5N A;  5IJ0 A;  2OT5 A;  2UUC B;  5EZY A;  1YHQ V;  2WSS G;  4YY3 B;  5FL7 G;  1XBL A;  4I9W A;  4DR1 O;  3W7W A;  2JVD A;  1P84 F;  3P32 A;  3BHP A;  1WPX A;  1JFF B;  5IE9 A;  3STZ C;  2Q9L A;  4DV6 B;  2Y0I A;  1E1Q G;  4TV8 B;  1Y4M A;  2ZKO A;  2R9A A;  1AR5 A;  3SJC C;  4NXN O;  1Y67 A;  1N36 O;  1BCC H;  2EIL C;  3BRC A;  3B8N A;  3E83 A;  4B08 A;  1YTF D;  4B3S B;  1BE3 H;  4BIU A;  2Q0O C;  4J9Y B;  1GMG A;  1S0V A;  1OCO C;  3M99 B;  1D5A A;  4UCV A;  1XEQ A;  4FFB A;  1T5E A;  2VQE B;  3SPC A;  3K57 A;  4UV8 A;  4MTO A;  1NVP D;  1TVK B;  4FLW A;  1SER A;  3K3W A;  1NKD A;  2AZ2 A;  4K35 A;  4I4T B;  2K1E A;  4GT1 A;  4XDL A;  2JS5 A;  4YJ2 A;  4DUZ B;  3ABM C;  2FB5 A;  2R70 A;  3QTC A;  4J7J A;  1YIT V;  3E86 A;  4B3R B;  1QBZ A;  1RPO A;  2EIM B;  5A9G A;  5JWP A;  3CP1 A;  4GKJ O;  5E79 Z;  5JCO A;  1V54 C;  2QWO B;  4JI7 O;  1SQX H;  2JRI A;  3O9O A;  1JJ2 U;  4X65 O;  5IDJ A;  1ZAU A;  1OCC C;  3DSQ A;  2QJ1 A;  3P30 A;  4MTG A;  3W7X A;  2Y4T A;  1PL0 A;  3ZMT A;  3LSS A;  4OXS A;  5D5P A;  1SES A;  5K1X A;  5J9P C;  3ZED A;  2QM8 A;  2KB1 A;  4Q6G A;  1AR4 A;  3FAV A;  3EHB B;  1B3Q A;  4DV5 O;  4LF6 B;  3RN4 A;  1K9M W;  4WFB V;  3AK1 A;  1XHZ A;  1K92 A;  1MSW D;  4WFG A;  2F66 C;  1JPX A;  1NT2 B;  4X1I B;  1GN3 A;  1AI6 A;  2UUB B;  1NTZ H;  1Q6H A;  3CCV V;  5LHH A;  3DXR B;  2Q5Z A;  5BMV A;  1D2D A;  1AIL A;  2IU0 A;  2DYR C;  5F2V O;  3M8A A;  5LMN B;  4TQD A;  2P22 C;  1SRY A;  1P49 A;  1N4C A;  3G80 A;  1EFR G;  1OCR C;  2ILM A;  4O2A A;  1ZLZ A;  1M5I A;  2QKC A;  1F7Y A;  2PY5 A;  3C90 A;  1HP8 A;  4LF9 O;  1J95 A;  2AZ0 A;  5KAF Z;  2ZM6 B;  2JIZ G;  4X66 O;  1XQ8 A;  2GUZ B;  1MMM A;  3L71 H;  4DR6 B;  1PL4 A;  1F51 A;  2ZIO A;  3APQ A;  2XTA A;  3JAT B;  1IBM O;  3ZMS A;  3IGA C;  2BCC H;  4LF8 O;  5EIB D;  4PDL A;  3K59 A;  4LFC O;  3VQV A;  1NI8 A;  3C3T A;  1JOY A;  4PA6 A;  3OGC C;  1ZSP A;  1Q6I A;  1SC5 B;  3RVZ A;  1K97 A;  4YXW G;  3NXS A;  1L0L H;  4UB6 Z;  2ETN A;  3U11 A;  2UUC O;  1RSO B;  4YY3 O;  4MTF A;  3RYC A;  1F4N A;  3EFF K;  2CAZ C;  2Y4U A;  3ZRW A;  4KHP B;  1H2M A;  4CH4 A;  1KB9 F;  3TET A;  5KX5 A;  1V55 B;  5IYZ B;  3JSN A;  5JH7 A;  3U10 A;  2WLN A;  4TSF G;  1GK9 A;  3OUF A;  4RO2 A;  2YS8 A;  4UB8 Z;  4YJ3 A;  2X0L A;  1S5J A;  2V1D A;  3SYA A;  1W0J G;  1YDX A;  1N0J A;  1THZ A;  2B1I A;  3FB5 C;  4B3S O;  2RQ6 A;  2IJI A;  4PI2 A;  4HBN A;  4JAV A;  4MVZ A;  1JFF A;  1Q81 W;  4LF4 O;  2VQE O;  2JEX A;  1DTO A;  2LW1 A;  2IW5 A;  4TV8 A;  2YEV B;  3OGI B;  3CRC A;  5LA6 B;  4WBN B;  3J80 N;  1ZWI C;  1AP5 A;  4DUZ O;  4R7C A;  2EIK C;  4I9Q A;  2AHY A;  1X4T A;  4B3R O;  3PN1 A;  1GRJ A;  4UXN A;  2QWR B;  4LFA B;  1FXK C;  3OR6 C;  3T1H O;  1TVK A;  2WLH A;  3ICX A;  4OX9 B;  3AG3 C;  1VQO V;  4AI8 A;  1N32 O;  2HJD A;  4LF5 O;  1PP9 H;  3N2K A;  1ARO P;  2X6A A;  1IBL B;  1AP6 A;  1RM1 B;  2H8P C;  2Q0A A;  3AG7 A;  4N21 A;  5LGU A;  3KKY A;  3ZJZ A;  3RYH B;  4P9P A;  5IYB O;  2P06 A;  4X20 B;  1YJ9 V;  4JTD B;  1IXM A;  2ITC C;  2WLL B;  3BAA A;  1V9P A;  1R3J C;  3E8F A;  2P6J A;  2Q68 A;  3G6B A;  3VQW A;  4CBC A;  5LMN O;  4X1I A;  5GTH Z;  3STL C;  4QPK A;  3CXH F;  3A0B Z;  4F6R B;  5IY5 C;  5E1A C;  1M57 C;  3AK3 A;  1OCZ C;  1Q86 W;  5LMU B;  1I08 A;  2D3O W;  4DYL A;  1O9H A;  4D6T H;  4GX0 A;  2WLJ A;  2CTP A;  3X2Q B;  1AJP A;  1S72 V;  2PUS A;  2ZM6 O;  4GX1 A;  1KD1 W;  4MS2 A;  4MVU A;  4DR6 O;  2A06 H;  1Y74 A;  3K5O A;  2W0X A;  4JTA B;  5B1B B;  1GM9 A;  3JD0 A;  4E4E A;  3A0R A;  3ASO C;  1KBH A;  1QVF U;  4Z1M G;  4X8A A;  1KYO F;  2FL4 A;  4QNH B;  2L35 A;  3ABK B;  2HFE C;  2XAS A;  1LNQ A;  4FVM A;  2ZE6 A;  2XT9 A;  3AG4 C;  2YI8 A;  1X59 A;  2P90 A;  5JCO C;  2PYL A;  5LGN A;  5FNV B;  4JI2 B;  5CA1 B;  4U3J B;  4J10 A;  3CRQ A;  3JAT A;  3JAM N;  5IWA B;  4RUF A;  1I5X A;  3LSU A;  3L74 H;  3CHX A;  2Y69 B;  1SQB H;  5H6R A;  3SYO A;  5J2U B;  1FYJ A;  4FMT A;  2KSD A;  4IHJ B;  1RSO A;  4ABM A;  1QLE C;  3A8T A;  2ADP A;  1KP2 A;  1M9N A;  2CGO A;  2WLI B;  4NB5 A;  5IYZ A;  3TGU H;  2IBZ H;  3AG2 B;  3FFQ A;  2XAQ A;  2R9I A;  3AG1 C;  3WU2 Z;  1PNM A;  2RJZ A;  1YVW A;  1KMI Z;  2GDS A;  3HKD A;  3GWK C;  3P3P A;  1SQG A;  3JD3 A;  2YXL A; 
#chains in the Genus database with same CATH homology
 2VS0 A;  1WA8 A;  4GZR B;  3TXQ A;  2AZ0 A;  3FAV A;  4ABM A;  3OGI B;  4I0X B;  4LWS A;  2KG7 A;  3O9O A;  1WA8 B;  3Q4H A;  3FD9 A;  3GVM A;  3ZBH A;  2AZ2 A;  3FAV B;  3HR0 A;  4LWS B;  2VRZ A;  2KG7 B;  3TXS A;  2DE0 X;  3G80 A;  2B9Z A;  4I0X A;  3Q4H B;  3GWK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...