3Q4HB

Crystal structure of the mycobacterium smegmatis esxgh complex (msmeg_0620-msmeg_0621)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
NYPAMLAHAAEMNTYSGALHAVGADIAAEQHALASAWQGDTGMTYQAWQAQWNQAMEELVRAYRAMATTHEQNTMAMSAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pe family protein
publication title Heterologous expression of mycobacterial Esx complexes in Escherichia coli for structural studies is facilitated by the use of maltose binding protein fusions.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Metal transport
total genus 24
structure length 80
sequence length 80
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3q4hB00
2DE0X 3G80A 3Q4HA 2VS0A 4LWSA 3TXQA 3Q4HB 4LWSB 3FAVA 2AZ2A 2B9ZA 3O9OA 2KG7A 3ZBHA 4I0XA 3FD9A 1WA8A 3FAVB 2KG7B 4ABMA 4I0XB 1WA8B 3GVMA 3TXSA 2AZ0A 4GZRB 3HR0A 3OGIB 3GWKC 2VRZA
chains in the Genus database with same CATH superfamily
3OEEG 5KMGB 2DYRB 2E5LB 3H1LH 4ZOLB 3ZMSA 2PI4A 1ZLZA 3VBBA 2UUCO 5J2UA 4X20A 3SYCA 1P49A 1OCOC 5IY5C 1Y66A 2AXTZ 1HNZO 4J7JA 1AILA 5FPRA 4DUZB 4LR3A 3JCUZ 2F4VB 4GX1A 3K5NA 1WB7A 1N32O 2F66C 5E79Z 3JD4A 4E4EA 1IDSA 3LDEA 2X0LA 3OUFA 2AZ2A 1HNWB 1SS3A 5JVDA 1RM1B 4BIOA 3VQXA 2EIJB 1MABG 1YJWV 2A3QA 2BOBC 2XNDG 2AW9A 1JQ0A 1S5JA 4DR2O 2DJVA 2Q9LA 1ZWIC 3K5OA 4NKGB 5LBQA 3K3WA 1OCCC 2LGWA 3VQVA 4MVMA 4K0KO 3K0GA 3B8NA 2XT9A 4Z1MG 5L3BA 3OW2U 4XBFA 2ZT9B 5K1XA 4FM1A 2WWWA 3S3WA 1IX9A 1H8HG 1U97A 3ZHVA 3SPCA 2QGNA 1GMGA 5KLVH 4RQFA 1AP5A 1VIBA 3VOUA 2LP7A 4QNHB 2YXLA 1QHTA 5CBGA 1D5AA 3P30A 1K7DA 3FKSG 3CPWU 3H1KH 1SZTA 3U11A 1M9NA 1YF2A 3J7AU 4CC6A 2DOSA 1K5QA 5DN6G 2IM9A 1T5EA 2XTAA 4PHZA 4I55A 1YHQV 1XNRO 1SQVH 3W7WA 3VQWA 3BY6A 5CN0A 3ZIAG 2HHHB 5JVDB 2Q69A 1IBKB 2XAFA 3AK3A 1EZJA 5H6RA 1FAFA 3ZX6A 4FLVA 4MVQA 3G6EV 4ZKIA 1WLEA 3ZRSA 2O57A 2ZXWB 4JYCA 2HLDG 1TA8A 3ASNC 4DV1O 2UU9O 1P7BA 1JX9A 4CH6A 2CH7B 1Q6UA 5CA3A 3CC2V 3K57A 2WLMA 1S3JA 4O4HA 1S72V 4KHPO 4F4LA 4PA4A 3A2FA 3JARB 4GCZA 3C90A 2FL4A 4PJ0Z 1XUQA 2VS0A 3RT3C 4JI7O 5GW7A 1Y74A 4LF9B 4B3SB 2DYRC 1US6A 1OV9A 3AG3B 3BEHA 5LOVA 3RFRA 3JD3A 2ZDIA 3WG7B 2QEXV 3SJBC 2GV9A 4DV5B 1F4NA 2AZ0A 2DMXA 4DR1B 3ZHSA 3K5MA 1WPXA 2UXDB 4UCVA 1QVFU 3M8AA 4J10A 2YC0A 2JS3A 2Q68A 5B5EZ 3CCVV 2PTMA 1R3KC 1XEQA 2HR3A 2E75B 2P4VA 1GTOA 5LGUA 1BQZA 4UV9A 3EHBB 2WLLA 4MVSA 3OR7C 5IWAO 4IIJA 2ZE6A 2UUCB 4NTXA 1MSDA 3EVKA 2ZIOA 2ZM6O 5GTHZ 2ARHA 1SQGA 3SYAA 1Q82W 1V54B 3UT5A 1AI6A 3DSQA 2GBOA 3JATA 5B1BB 1MSWD 3K59A 1HNZB 2FB5A 1YZBA 1TVKA 2P22C 1N32B 1NBMG 1G6UA 3AG1B 3OFNG 4MS2A 2Q4PA 2ZINA 2BOCC 4O4HB 2QR4A 1YEWA 1M5IA 2VWKA 1SQQH 3K58A 4K8XA 4FLWA 1H2LA 2LFSA 1AI4A 3ABMB 3NR7A 4DR2B 4FZ1A 5L3CA 2Y69B 2DW4A 3D8CA 1WP8A 1VQ6V 3FB6C 3C3TA 4K0KB 3EFFK 3R66A 1I5XA 4Z2WA 1BT8A 3RW0A 5L3EA 5JJEB 1KP2A 1Q5OA 4DK0A 1RPRA 2DWDC 1AJPA 4DR3B 4OX9O 3QO8A 1YSCA 2ZE8A 2LO1A 2X6AA 2QTOA 3DC5A 1V9PA 1IZ3A 1OCRB 1QCEA 1L1FA 5KUKA 5CMUA 2WLLB 1KQSU 4CC5A 4O4LB 3W7XA 3ZHTA 4EEQA 3QO7A 3STLC 4AHCA 1KB9F 1KKCA 3UT5B 1VF5B 2IU3A 3JATB 1MZEA 4G2KA 4LF7O 2HEPA 2OT5A 4DO2A 1XNRB 1S0VA 4P2ZA 1TVKB 2ZCEA 4K35A 1FS0G 2ZE7A 4X66O 3MHHC 1JCHA 1MNGA 1RFYA 3SJCC 1WPBA 3L9DA 4GKJO 3RVZA 4E2LA 5JH7A 4PA9A 1RPOA 2CGOA 1N33O 1Q3EA 2EIKC 4UV8A 2OCCB 4DV1B 2L6LA 3L75H 4UFZA 4W4KA 4FK5C 4DV3O 4J9YB 3E35A 4U7NA 3E8GA 1NVPD 3E8FA 1YITV 4B3RO 3T1YO 3N2KB 2CGNA 2D2CB 1S76D 1WNSA 3Q4HA 2QKCA 3ZRVA 4KHPB 2EINB 3ABKC 1SQBH 3NXSA 4BWAA 5JCOA 4I7ZB 2Y48A 1H38A 3SR2C 4AILC 3UO3A 5B3SB 3LDDA 1M93A 4H44B 3T4DA 3AG2B 1M57B 1IXMA 2EJ7A 2F23A 3WB1A 2R9AA 1NU1H 1W0JG 2B5UA 1JMKC 4XDJA 4LBEC 4UVBA 4NTYA 2F4VO 2UXXA 2M7WA 2HJDA 3FYEB 4DR4O 1PL0A 4O4IA 3JCZA 5IWAB 2RMKB 3BA9A 2JIZG 4LH6A 5JH7B 1PNMA 2HP8A 4X64B 2ZM6B 2WLKA 4HAMA 2PF4E 5C93A 1KYOF 2ZDIC 1FFXA 3ABLC 2BE3A 2V4DA 2YDEA 4IYHA 2DE0X 3L72H 2A06H 4AQYO 2M6YA 4PELA 3LNMB 1R6KA 2W6IG 4YXWG 2B9ZA 4TQDA 4UCOA 1VF6A 1SQPH 3OD4A 4WFGA 3RWRD 1XHZA 1AR4A 5LHIA 1QLNA 4JTDB 1I5YA 5IJ9A 3F7YC 5IE9A 1BHBA 1K92A 1FJGO 4FM0A 1OCCB 3FX7A 3CCJV 4PDMA 3R65A 4X1KB 2PY5A 3CCQV 2YSUB 1E79G 5BMVA 1ZTEA 2N04A 3K04A 2Q0AA 4OX9B 5IYZA 2R70A 1KKDA 1RSOB 1XHXA 2B1IA 1XI1A 1M90W 4O4IB 3QG5A 3CD6V 3QTCA 2YUAA 3ETQA 5IDJA 1THZA 3UO2A 5LGTA 4P9OA 4F6RB 5H6QA 4RO2A 4LF7B 1FFXB 1JJ2U 3BFRA 3THOA 4K8ZA 2ADPA 2EZPA 3H1HH 2QA4V 4U3JA 3S3XA 2HFEC 2WSSG 3J80N 2EINC 4GX5A 3GWOA 4NXMB 4XDLA 4PDVA 4GKJB 1SERA 5LL6Y 1AJQA 3N27A 3CYOA 3AG2C 1N33B 1M57C 4B3SO 4FFBA 3CCMV 3K03A 3ETEA 2DN9A 4DV3B 5B1OA 4U7OA 2JGUA 4JI5O 4FZ0A 3O9OA 4CH3A 3K06A 1GM7A 4B3RB 1BMFG 1ZUQA 2UXDO 2V7QG 3CC7V 3SPJA 2QTSA 2XAGA 2BTQA 5IYDO 1AR1B 3LDCA 4LH7A 1HWYA 2EULA 5IYZB 1SRYA 1N36O 2LW1A 3L70H 1I94O 2YXYA 2Q7HA 4JI4O 1I08A 1XNQO 1NQTA 4CZZA 2LFRA 1JA8A 4PI2A 2QDOA 3M99B 3OM3B 5LXTA 4U3JB 3E89A 3ZRWB 3HKCA 4DR4B 3WB2A 3HKBA 1IVSA 2LJ2A 3E8HA 2LW7A 5JCOC 3W7TA 1M56C 3P3PA 2YIBD 1XREA 1PNKA 4MTGA 2G38A 4WFAV 3CMAV 3QNEA 2UUAO 3JD0A 4JTCB 2N05A 5EIBD 4CH5A 5B66Z 4BAYA 1H2NA 1YTFD 2CE4A 1UFIA 1PD3A 3FAVB 1PL4A 4JZ2A 1RP3B 5B1AB 4AQYB 1PV0A 4X1IB 4YJ3A 2NNUA 1EFRG 3D3QA 5GTIZ 5LYJA 2E3CA 2JRIA 4DR3O 1HNXO 4D6TH 3SYQA 3VQYA 1VMGA 1XILA 1LNQA 3ABUA 1Z2GA 1COWG 4X1YA 4BW5A 5K1PA 2VWJA 1TGOA 4PD4F 5J2TA 1FJGB 5J2UB 1FXKA 4X20B 3SPGA 3IC7A 1Q6HA 5EIBC 1BQ0A 2HVJC 4IGGA 3CCRV 4LF5O 4JAVA 5CBFA 5LA6A 5E1AC 1I7FA 4JYYA 3JD1A 1GK9A 4PA3A 2QE7G 1AJNA 5LGNA 5BR8B 3HKCB 1WA8A 3G6BA 5J9PC 1VF6C 3B09A 1R3IC 1F51A 1TAEA 2YIAA 1H2SB 3GB7C 4H37A 1FPOA 4KFMA 4CS3A 5JJNB 2XOKG 3CJHA 3RBZA 2ZD9A 5LHGA 1VQ8V 3CHXA 4HNAA 1Z5WA 3H1IH 1QLEB 4MVOA 3STZC 2IJIA 2FKXA 2IW5A 2PI5A 2PGGA 3UQ8A 2DWEC 1DGSA 2IJHA 4X9QA 1R6NA 4A5UB 1NH2D 4OPHA 1OZ0A 2P7TC 5LYJB 4DR5O 2PUSA 4O2BA 4HYOA 1QVGU 3BA8A 4B3TO 1IBLO 3FB7C 4FPPA 2A9HA 2EIKB 2QKAA 4UB8Z 1R6TA 2EIMC 2ZQMA 4X1YB 4NR1A 1WAZA 2JJ2G 2YI9A 1ZAUA 3FB8C 4JI5B 2E74B 4LNUA 3L73H 1DF4A 1FXKB 1VEWA 2CUGA 4RUEA 1EN5A 2AHYA 3MAQA 4I55B 4MVUA 3ABKB 4DYLA 1G8MA 1ORQC 5LMUO 4ABMA 1K4DC 3DGEA 1WA8B 4RUFA 4F6EA 2YS8A 4B3MO 1N36B 4DR7O 1VP7A 5BZBA 1WB8A 2EBOA 1I94B 4NVPA 1ZL8A 4X64O 3L71H 4JI4B 1BCCH 2JVDA 1XNQB 4FIPC 3ZMZA 3CRMA 3CJHB 4NYKA 5EZYA 4HNAB 5HFMA 1VQ5V 3P32A 1NVPB 5EC2C 4O4JA 5B1AC 4RQEA 4QPKA 2BSKA 1YVWA 4OPAA 2Q5ZA 3MD0A 5JQGA 2JEUA 2XHBA 1G1XB 3OMIB 2IU0A 4KL1A 1O9GA 4O2BB 1ROPA 1Q86W 1Y74B 1NS1A 2UUAB 1ENVA 3DXRA 5LOVB 1D2DA 3ABLB 2HJFC 1WP7A 4FVMA 1KC8W 3K08A 4X89A 4JI3O 2JEXA 1GN4A 3TJTA 4G27B 1GRJA 1IXBA 1S5LZ 3TGUH 2PYJA 2CTQA 2FMLA 1HP8A 4ZHQA 3SJAC 2CDYA 2P67A 5KX5A 1P7GA 1HNXB 3CCSV 1GN6A 1I0HA 1JR9A 3SYPA 4UVAA 5L3DA 4IIJB 4Q20A 2AHZA 3BABA 2A7WA 1ZL8B 2Z3YA 1JFFA 1F7YA 3B77A 2UXBO 4LWSA 1P4RA 4MW3A 3I55V 4LF5B 2RDCA 4I0XA 5EYPA 1QLEC 5LHHA 2Q6AA 2CAZC 4J41A 4J42A 2UXNA 1L0LH 4HBNA 3EXAA 3I56V 4H13B 4N23A 4O4JB 4P9PA 4WFEA 4WFBV 2DQ3A 1HW7A 3OE7G 4DUYO 1QBZA 5JQGB 3P3NA 2GHYA 5FPOA 1DK1A 4NXMO 1KBHA 3T2MA 1VF7A 3G67A 4QPJA 3UCSC 1AI5A 4JF3A 3DXRB 2OTLV 4L87A 1GN2A 3QF7A 4OGQB 3CSXA 5KA5A 3CWBH 1FXKC 1XOUA 3AG7A 2RQ6A 3AG4B 4DW1A 4TSFG 2C2AA 1L0NH 3OMNB 3SPIA 4FJCC 4DR5B 4ZHQB 5CB4A 2F95B 5KX5B 4B3TB 1IBLB 3TK1A 1BGYH 3CEIA 4J7ZA 3BRCA 1O9HA 1A32A 1WN7A 1F4MA 4LF4O 4LF8O 5DEDA 1PP9H 3JAKA 4LWSB 2KG7A 4JYBA 2Q67A 1URFA 4I0XB 4KP4A 4EB6A 4DRXA 1UPGA 5HFLA 5LMUB 5H2FZ 1K5SA 5H9CA 2QWOB 4B3MB 2QWPB 4DR7B 1KU9A 2YIBA 2L35A 1NT2B 3SYOA 4YHHO 3N2GA 4DW0A 1DTOA 1XMOO 4GX2A 5LP6A 4TUYA 3KCYA 4RAIA 2ATKC 4DV4O 5JWPA 1VQ4V 2BTOA 3QO5A 1PKXA 3A0HZ 3TCUA 2F1MA 1YI2V 3RYIA 3Q4HB 2UXCB 4YJ2A 3ZBHA 4CS4A 2Y4UA 3BPZA 4TV9A 5CB4B 1VQNV 1M56B 3ASOC 3F5TA 4RWUA 1X59A 4DV2O 2H8PC 1Q81W 3O65A 4K3AA 3RYFA 3LSQA 5EBLC 1XMQO 4NXNO 2KQXA 3M7MX 4YIPA 3JAKB 1MMMA 4JI3B 3G71V 2EJRA 2UUBO 2KG7B 4TQFA 3T4ZA 4L8JA 1VQLV 4JI2B 1IURA 4D7SA 2LGQA 2XAQA 4WCEV 1QR8A 1SETA 2OIGA 4HZ3A 3RGBA 3KKYA 5BR8O 2NR5A 3B4SA 2P6JA 4FLUA 1GM8A 2N74A 3HKEA 3RVYA 3K79A 1R3LC 3N2GB 2UXBB 5JJJB 2F43G 1YCIA 5LP6B 1NR7A 4TUYB 1YTFB 1Y4MA 3IJ4A 5IT9N 2ZNIA 3CS5A 3TXQA 4MTFA 4WFHA 2F93B 3AG4C 3RYIB 4DUYB 1AVMA 4YJ2B 2DQ0A 4LCUC 3LSUA 4TV9B 4U3FH 4W4LA 2Q7EA 3ZMVA 1EN6A 4NTWA 1E1QG 4UCRA 2ILMA 4J80A 3ETDA 3OMAB 1J95A 4FLYA 4JI6O 1D5NA 3CCUV 2XAJA 3RYFB 2ZKOA 2E76B 4DV7O 5IJ9B 3CRRA 4Z1VA 3A8TA 4MSWC 3BVOA 1SESA 2ADQB 2JK5C 1NR1A 4FLXA 1KECA 4PV1B 2W0FC 3K5LA 1SA0A 1NKDA 1JOYA 1K9MW 3ETGA 2XASA 1VQMV 3B40A 2IJKA 2R9IA 5BMVB 3K9SA 5H5NA 2RJZA 4ZI7A 1M4UA 1BS3A 1OHHG 4PI0A 3ZMUA 2EIMB 1JPXA 4MW8A 1BE3H 3HKEB 1OCZC 4LF4B 4LF8B 3ABTA 2AGAA 1VARA 1M1KW 3SGIA 1K97A 3CCEV 2JGDA 2MK3A 3ZCCA 3CP1A 1Q6IA 4MTOA 3ICXA 4XDKA 2PYLA 3ZS8C 1J5EB 3MHSC 2IH3C 4BR6A 1K34A 3K0DA 1KUQA 1NH2B 3ML0A 3X2QB 1DF5A 3E86A 1R3JC 3IAYA 4P30A 2PZSA 2Z0AA 4PDRA 4BW9A 5CA1A 5KA6A 4YHHB 4GX0A 1XMOB 1MA1A 4GLXA 2B1GA 4FFBB 2NN4A 1F23A 3TETA 3H1JH 2X6CA 4DV4B 2DYSB 2WLNA 5EK0A 1K33A 4BIZA 1N8RW 1PNLA 4JAUA 4EFEA 3D36A 1K3EA 4X8AA 2CTWA 4UUJC 1TUBA 4R6ZA 1SA0B 2R9RB 1CXZB 4X65O 5L3FA 2BTQB 4OXSA 4ZI7B 3RN4A 4DV2B 4X88A 2CH7A 4JTAB 5B1NA 1XMQB 4NXNB 5EBWC 2KSDA 2QWQB 4IYIA 4O2AA 3JARA 2IH1C 3GWKC 2HVKC 2UUBB 2A0LA 5LP6C 1VQKV 2JGDB 1N4CA 3SJQC 3HB3B 1NI8A 4EKWA 1K73W 1NZ6A 2A79B 5LXTB 1CEZA 1N34O 2ZE5A 4QGPA 4X62O 4R8CA 2ETNA 3KG2A 3HKBB 1HDJA 1QQCA 1YJ9V 1HR0O 5CA1B 4GT1A 2QM7A 1VQ9V 2ITCC 1KD1W 3OGCC 3KZIZ 4FMTA 4JV5O 2QJ1A 1B3QA 1AB3A 1R73A 1NJIW 3W7SA 4JI8O 2WAMA 4YJ3B 4LP8A 2YEVA 1TUBB 4B7KA 5FLXN 3HPLC 3G4SV 2QM8A 2OWOA 3U10A 4PA6A 3ZHUA 4DR6B 3OTFA 4TWKA 2P06A 2WPDG 1NTZH 1PM9A 2GDSA 4IL6Z 4JI6B 3F5WC 1K4CC 1ZX3A 4J9ZB 3ZHRA 3GVMA 2Q8VA 4DV7B 5F2VO 4GZRB 4QIWF 1MG1A 5J2TB 4O2AB 3PJSK 2VRZA 4DV6O 2HG5C 2LQTA 4MTXA 4JPRA 4LFCO 3JASA 5LA6B 1KMIZ 4JI0O 3CMEV 4KXRA 3LSSA 3CRCA 2QWRB 3IC9A 4JZGA 3X2QC 3APQA 1LUVA 2X6BA 2XAHA 2VQEB 4QE7A 3JSNA 3OGIB 3HKDA 3CCLV 3CXHF 4JASA 4UXNA 1FKAO 4DXWA 4JYAO 4GUNA 1Q43A 3B2EE 4DV0O 3A0BZ 4MVRA 1CPYA 3WFVA 2VQFO 2DYSC 1FFTB 1XBLA 2BCCH 2FYUH 4UB6Z 4DK1A 2QM4A 1RM1C 2EIJC 4LF6O 2JS5A 3B8MA 4O4LA 4N21A 3SDLA 3OTOO 2UXCO 2ZIMA 2YEVB 3ZHQA 1Y6XA 4IHJA 1DLBA 4PA7A 3FB5C 1AR5A 3RYHA 1WJZA 4LC1A 4FLTA 4FM2A 3H01A 3AK1A 4H0LB 1XDCA 1YJNV 4BIUA 1B04A 4G28B 5A2QN 1BSMA 3OEHG 3ZJZA 4D7TA 2K1EA 2W6JG 1IBMO 2Q0OC 5CBHA 1GO3F 3ZRXA 4LNUB 2EILB 2WLJA 3CRAA 2CTRA 2QWNB 1W2BU 1FD9A 3JASB 4I50A 4JI2O 3K9AA 4MVZA 4QE9A 1LUWA 4GKKO 4X65B 1VQ7V 4JI1O 3RYCA 3FFQA 4I4TA 3ASOB 5D5PA 2P4KA 3N2KA 3HKDB 3QVNA 4WBNA 3CE2A 2YI8A 5KAFZ 5BY1A 3BHPA 3E8BA 2H94A 5EZYB 2ZR3A 4I9QA 1YXBA 2KB1A 4AI8A 1FXVA 1XL4A 3AK2A 3D36C 1N34B 2XUMA 3LNNA 4X62B 2WLHA 3F7VC 2R72A 2BSKB 2ZXWC 1Q90D 5EBMC 4MT8A 3E83A 4IHJB 1HR0B 4TT3G 3AEIA 4FLZA 1L8DA 3RYHB 4J7KA 2X7RB 5DECA 5KHKA 4JV5B 1BZKA 3MDSA 4LFAO 1N0JA 2CTPA 2RCVA 5IYBO 3JD2A 3JYCA 4JI8B 3J81N 5DM6V 4WF9V 1V55B 1Y67A 4FFKA 3AG3C 1W59A 4I50B 3ZN1A 4LFBO 1E1RG 5ITZA 3WG7C 2UU9B 3UM7A 1QNMA 3RYCB 1Z5VA 4UCUA 4KUMA 2GTAA 4I4TB 3ZEDA 1BHAA 3BCCH 2D3OW 3JAMN 5IJ0A 1EN4A 1JJOA 2K9PA 3DC6A 2OTJV 4YY3O 4WBNB 1Q7YW 1JFFB 4DV6B 3T1HO 5LMNO 2HKOA 3OUSA 3FD9A 4JI7B 5KHJA 1CP9A 4LFCB 2RNBA 3APOA 4JI0B 1VQOV 5EYPB 1UJWB 3CB2A 4UCSA 5A9GA 1J5EO 3A0RA 2E5LO 2EZOA 5D5QA 1EZVH 2P5OA 3JALA 1QU7A 3G80A 2GSMB 4JGSA 1V54C 5B1BC 2P90A 4IT5A 3BAAA 3E22A 3T1CA 3ZN0A 5C8YA 1P84F 4JYAB 4X1KA 2Y0IA 2Y0PA 1OCZB 4DUZO 1NTKH 2FTKA 1GM9A 2CK3G 4ZBMA 4DV0B 3AG1C 3KCXA 2VQFB 2RN9A 2WLIA 5FL7G 1TUEB 4CH4A 2W0XA 3CXCU 1HNWO 4J11A 4LF6B 2WA4A 1RSOA 3L74H 4UVCA 2EILC 5GONA 2Q7GA 1FYJA 3OTOB 4TV8A 1MOFA 3ABMC 4ICGA 2EX3A 2Y69C 4F6RA 2JDIG 1QR9A 1OCOB 5IY5B 2JJ1G 3IGAC 3JSLA 3U0ZA 5ITZB 1X4TA 4UCTA 1FXHA 1GAXA 4PDLA 4C7UA 2OIEA 1JVMA 1N0NA 1SQFA 3WB0A 2OCHA 2GUZA 5IJ0B 1YIJV 4ZIBA 1IBMB 2YXHA 2GTSA 2NLJC 1S77D 1GKFA 5CA0A 1BL8A 1XQ8A 2H3OA 2YICA 1GN3A 4CBCA 1XL6A 4I9WA 1YDXA 3ZMTA 1SF9A 1U96A 1OCRC 3JAWA 4GKKB 1SZXA 5KUMA 4EB6B 1Y76A 4JI1B 4DRXB 1AROP 3DTUB 3JALB 3H9VA 4B7EA 4R7CA 2IJJA 2QSAA 1SKVA 2YIDA 2Y4TA 3E22B 5IYCO 5C8YB 2ZNJA 5FNVA 2OYQA 1H2KA 1H8EG 1EBOA 1S5HC 1R1BA 2ZR2A 2WLIB 3PN1A 1VQPV 2IBZH 5KMGA 3OR6C 3SPHA 4I5SA 1B6QA 3C3SA 2HHHO 2ODMA 4YIOA 3OAAG 1ZSPA 4ZOLA 1IBKO 2Z5UA 3LUTB 2KKWA 5GONB 1SQXH 4Q6GA 1K8AW 5KHHA 1V55C 4TV8B 1EM1A 4NB5A 2OCCC 3W7UA 3TXSA 4EFBA 1MZFA 1Q8IA 1AP6A 3FYIB 5KAIZ 4B08A 4DR6O 1LR1A 4JAAA 3D3IA 4QJFB 2MW2B 5KHGA 4X66B 1H2MA 3ZRWA 3CRQA 2GUZB 1NTMH 4LFAB 1KP3A 1H2GA 3CX5F 1AI7A 3OT7A 1OJHA 3UKMA 5B3SC 1PPJH 1B06A 2WA3A 5CA0B 1SC5B 4H33A 1W0KG 5AG2A 4ASUG 4LF9O 5KHIA 4LFBB 2Q73A 3JAWB 2QKSA 3ASNB 1Y76B 4DV5O 3E2EA 3WU2Z 5EC1C 1G4YB 3I5DA 4DR1O 3IFXA 5L3GA 2VQEO 3FAVA 5BXZA 4R50A 3T1YB 2V1DA 4X1IA 3CC4V 1GH6A 2ITDC 4GYCB 5TISZ 4YY3B 3HR0A 4WFFA 5FNVB 4TOIA 3T1HB 5LMNB 4CS2A
chains in the Genus database with same CATH topology
2DE0X 3G80A 3Q4HA 2VS0A 4LWSA 3TXQA 3Q4HB 4LWSB 3FAVA 2AZ2A 2B9ZA 3O9OA 2KG7A 3ZBHA 4I0XA 3FD9A 1WA8A 3FAVB 2KG7B 4ABMA 4I0XB 1WA8B 3GVMA 3TXSA 2AZ0A 4GZRB 3HR0A 3OGIB 3GWKC 2VRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE0 X;  3G80 A;  3Q4H A;  2VS0 A;  4LWS A;  3TXQ A;  3Q4H B;  4LWS B;  3FAV A;  2AZ2 A;  2B9Z A;  3O9O A;  2KG7 A;  3ZBH A;  4I0X A;  3FD9 A;  1WA8 A;  3FAV B;  2KG7 B;  4ABM A;  4I0X B;  1WA8 B;  3GVM A;  3TXS A;  2AZ0 A;  4GZR B;  3HR0 A;  3OGI B;  3GWK C;  2VRZ A; 
#chains in the Genus database with same CATH topology
 3OEE G;  5KMG B;  2DYR B;  2E5L B;  3H1L H;  4ZOL B;  3ZMS A;  2PI4 A;  1ZLZ A;  3VBB A;  2UUC O;  5J2U A;  4X20 A;  3SYC A;  1P49 A;  1OCO C;  5IY5 C;  1Y66 A;  2AXT Z;  1HNZ O;  4J7J A;  1AIL A;  5FPR A;  4DUZ B;  4LR3 A;  3JCU Z;  2F4V B;  4GX1 A;  3K5N A;  1WB7 A;  1N32 O;  2F66 C;  5E79 Z;  3JD4 A;  4E4E A;  1IDS A;  3LDE A;  2X0L A;  3OUF A;  2AZ2 A;  1HNW B;  1SS3 A;  5JVD A;  1RM1 B;  4BIO A;  3VQX A;  2EIJ B;  1MAB G;  1YJW V;  2A3Q A;  2BOB C;  2XND G;  2AW9 A;  1JQ0 A;  1S5J A;  4DR2 O;  2DJV A;  2Q9L A;  1ZWI C;  3K5O A;  4NKG B;  5LBQ A;  3K3W A;  1OCC C;  2LGW A;  3VQV A;  4MVM A;  4K0K O;  3K0G A;  3B8N A;  2XT9 A;  4Z1M G;  5L3B A;  3OW2 U;  4XBF A;  2ZT9 B;  5K1X A;  4FM1 A;  2WWW A;  3S3W A;  1IX9 A;  1H8H G;  1U97 A;  3ZHV A;  3SPC A;  2QGN A;  1GMG A;  5KLV H;  4RQF A;  1AP5 A;  1VIB A;  3VOU A;  2LP7 A;  4QNH B;  2YXL A;  1QHT A;  5CBG A;  1D5A A;  3P30 A;  1K7D A;  3FKS G;  3CPW U;  3H1K H;  1SZT A;  3U11 A;  1M9N A;  1YF2 A;  3J7A U;  4CC6 A;  2DOS A;  1K5Q A;  5DN6 G;  2IM9 A;  1T5E A;  2XTA A;  4PHZ A;  4I55 A;  1YHQ V;  1XNR O;  1SQV H;  3W7W A;  3VQW A;  3BY6 A;  5CN0 A;  3ZIA G;  2HHH B;  5JVD B;  2Q69 A;  1IBK B;  2XAF A;  3AK3 A;  1EZJ A;  5H6R A;  1FAF A;  3ZX6 A;  4FLV A;  4MVQ A;  3G6E V;  4ZKI A;  1WLE A;  3ZRS A;  2O57 A;  2ZXW B;  4JYC A;  2HLD G;  1TA8 A;  3ASN C;  4DV1 O;  2UU9 O;  1P7B A;  1JX9 A;  4CH6 A;  2CH7 B;  1Q6U A;  5CA3 A;  3CC2 V;  3K57 A;  2WLM A;  1S3J A;  4O4H A;  1S72 V;  4KHP O;  4F4L A;  4PA4 A;  3A2F A;  3JAR B;  4GCZ A;  3C90 A;  2FL4 A;  4PJ0 Z;  1XUQ A;  2VS0 A;  3RT3 C;  4JI7 O;  5GW7 A;  1Y74 A;  4LF9 B;  4B3S B;  2DYR C;  1US6 A;  1OV9 A;  3AG3 B;  3BEH A;  5LOV A;  3RFR A;  3JD3 A;  2ZDI A;  3WG7 B;  2QEX V;  3SJB C;  2GV9 A;  4DV5 B;  1F4N A;  2AZ0 A;  2DMX A;  4DR1 B;  3ZHS A;  3K5M A;  1WPX A;  2UXD B;  4UCV A;  1QVF U;  3M8A A;  4J10 A;  2YC0 A;  2JS3 A;  2Q68 A;  5B5E Z;  3CCV V;  2PTM A;  1R3K C;  1XEQ A;  2HR3 A;  2E75 B;  2P4V A;  1GTO A;  5LGU A;  1BQZ A;  4UV9 A;  3EHB B;  2WLL A;  4MVS A;  3OR7 C;  5IWA O;  4IIJ A;  2ZE6 A;  2UUC B;  4NTX A;  1MSD A;  3EVK A;  2ZIO A;  2ZM6 O;  5GTH Z;  2ARH A;  1SQG A;  3SYA A;  1Q82 W;  1V54 B;  3UT5 A;  1AI6 A;  3DSQ A;  2GBO A;  3JAT A;  5B1B B;  1MSW D;  3K59 A;  1HNZ B;  2FB5 A;  1YZB A;  1TVK A;  2P22 C;  1N32 B;  1NBM G;  1G6U A;  3AG1 B;  3OFN G;  4MS2 A;  2Q4P A;  2ZIN A;  2BOC C;  4O4H B;  2QR4 A;  1YEW A;  1M5I A;  2VWK A;  1SQQ H;  3K58 A;  4K8X A;  4FLW A;  1H2L A;  2LFS A;  1AI4 A;  3ABM B;  3NR7 A;  4DR2 B;  4FZ1 A;  5L3C A;  2Y69 B;  2DW4 A;  3D8C A;  1WP8 A;  1VQ6 V;  3FB6 C;  3C3T A;  4K0K B;  3EFF K;  3R66 A;  1I5X A;  4Z2W A;  1BT8 A;  3RW0 A;  5L3E A;  5JJE B;  1KP2 A;  1Q5O A;  4DK0 A;  1RPR A;  2DWD C;  1AJP A;  4DR3 B;  4OX9 O;  3QO8 A;  1YSC A;  2ZE8 A;  2LO1 A;  2X6A A;  2QTO A;  3DC5 A;  1V9P A;  1IZ3 A;  1OCR B;  1QCE A;  1L1F A;  5KUK A;  5CMU A;  2WLL B;  1KQS U;  4CC5 A;  4O4L B;  3W7X A;  3ZHT A;  4EEQ A;  3QO7 A;  3STL C;  4AHC A;  1KB9 F;  1KKC A;  3UT5 B;  1VF5 B;  2IU3 A;  3JAT B;  1MZE A;  4G2K A;  4LF7 O;  2HEP A;  2OT5 A;  4DO2 A;  1XNR B;  1S0V A;  4P2Z A;  1TVK B;  2ZCE A;  4K35 A;  1FS0 G;  2ZE7 A;  4X66 O;  3MHH C;  1JCH A;  1MNG A;  1RFY A;  3SJC C;  1WPB A;  3L9D A;  4GKJ O;  3RVZ A;  4E2L A;  5JH7 A;  4PA9 A;  1RPO A;  2CGO A;  1N33 O;  1Q3E A;  2EIK C;  4UV8 A;  2OCC B;  4DV1 B;  2L6L A;  3L75 H;  4UFZ A;  4W4K A;  4FK5 C;  4DV3 O;  4J9Y B;  3E35 A;  4U7N A;  3E8G A;  1NVP D;  3E8F A;  1YIT V;  4B3R O;  3T1Y O;  3N2K B;  2CGN A;  2D2C B;  1S76 D;  1WNS A;  3Q4H A;  2QKC A;  3ZRV A;  4KHP B;  2EIN B;  3ABK C;  1SQB H;  3NXS A;  4BWA A;  5JCO A;  4I7Z B;  2Y48 A;  1H38 A;  3SR2 C;  4AIL C;  3UO3 A;  5B3S B;  3LDD A;  1M93 A;  4H44 B;  3T4D A;  3AG2 B;  1M57 B;  1IXM A;  2EJ7 A;  2F23 A;  3WB1 A;  2R9A A;  1NU1 H;  1W0J G;  2B5U A;  1JMK C;  4XDJ A;  4LBE C;  4UVB A;  4NTY A;  2F4V O;  2UXX A;  2M7W A;  2HJD A;  3FYE B;  4DR4 O;  1PL0 A;  4O4I A;  3JCZ A;  5IWA B;  2RMK B;  3BA9 A;  2JIZ G;  4LH6 A;  5JH7 B;  1PNM A;  2HP8 A;  4X64 B;  2ZM6 B;  2WLK A;  4HAM A;  2PF4 E;  5C93 A;  1KYO F;  2ZDI C;  1FFX A;  3ABL C;  2BE3 A;  2V4D A;  2YDE A;  4IYH A;  2DE0 X;  3L72 H;  2A06 H;  4AQY O;  2M6Y A;  4PEL A;  3LNM B;  1R6K A;  2W6I G;  4YXW G;  2B9Z A;  4TQD A;  4UCO A;  1VF6 A;  1SQP H;  3OD4 A;  4WFG A;  3RWR D;  1XHZ A;  1AR4 A;  5LHI A;  1QLN A;  4JTD B;  1I5Y A;  5IJ9 A;  3F7Y C;  5IE9 A;  1BHB A;  1K92 A;  1FJG O;  4FM0 A;  1OCC B;  3FX7 A;  3CCJ V;  4PDM A;  3R65 A;  4X1K B;  2PY5 A;  3CCQ V;  2YSU B;  1E79 G;  5BMV A;  1ZTE A;  2N04 A;  3K04 A;  2Q0A A;  4OX9 B;  5IYZ A;  2R70 A;  1KKD A;  1RSO B;  1XHX A;  2B1I A;  1XI1 A;  1M90 W;  4O4I B;  3QG5 A;  3CD6 V;  3QTC A;  2YUA A;  3ETQ A;  5IDJ A;  1THZ A;  3UO2 A;  5LGT A;  4P9O A;  4F6R B;  5H6Q A;  4RO2 A;  4LF7 B;  1FFX B;  1JJ2 U;  3BFR A;  3THO A;  4K8Z A;  2ADP A;  2EZP A;  3H1H H;  2QA4 V;  4U3J A;  3S3X A;  2HFE C;  2WSS G;  3J80 N;  2EIN C;  4GX5 A;  3GWO A;  4NXM B;  4XDL A;  4PDV A;  4GKJ B;  1SER A;  5LL6 Y;  1AJQ A;  3N27 A;  3CYO A;  3AG2 C;  1N33 B;  1M57 C;  4B3S O;  4FFB A;  3CCM V;  3K03 A;  3ETE A;  2DN9 A;  4DV3 B;  5B1O A;  4U7O A;  2JGU A;  4JI5 O;  4FZ0 A;  3O9O A;  4CH3 A;  3K06 A;  1GM7 A;  4B3R B;  1BMF G;  1ZUQ A;  2UXD O;  2V7Q G;  3CC7 V;  3SPJ A;  2QTS A;  2XAG A;  2BTQ A;  5IYD O;  1AR1 B;  3LDC A;  4LH7 A;  1HWY A;  2EUL A;  5IYZ B;  1SRY A;  1N36 O;  2LW1 A;  3L70 H;  1I94 O;  2YXY A;  2Q7H A;  4JI4 O;  1I08 A;  1XNQ O;  1NQT A;  4CZZ A;  2LFR A;  1JA8 A;  4PI2 A;  2QDO A;  3M99 B;  3OM3 B;  5LXT A;  4U3J B;  3E89 A;  3ZRW B;  3HKC A;  4DR4 B;  3WB2 A;  3HKB A;  1IVS A;  2LJ2 A;  3E8H A;  2LW7 A;  5JCO C;  3W7T A;  1M56 C;  3P3P A;  2YIB D;  1XRE A;  1PNK A;  4MTG A;  2G38 A;  4WFA V;  3CMA V;  3QNE A;  2UUA O;  3JD0 A;  4JTC B;  2N05 A;  5EIB D;  4CH5 A;  5B66 Z;  4BAY A;  1H2N A;  1YTF D;  2CE4 A;  1UFI A;  1PD3 A;  3FAV B;  1PL4 A;  4JZ2 A;  1RP3 B;  5B1A B;  4AQY B;  1PV0 A;  4X1I B;  4YJ3 A;  2NNU A;  1EFR G;  3D3Q A;  5GTI Z;  5LYJ A;  2E3C A;  2JRI A;  4DR3 O;  1HNX O;  4D6T H;  3SYQ A;  3VQY A;  1VMG A;  1XIL A;  1LNQ A;  3ABU A;  1Z2G A;  1COW G;  4X1Y A;  4BW5 A;  5K1P A;  2VWJ A;  1TGO A;  4PD4 F;  5J2T A;  1FJG B;  5J2U B;  1FXK A;  4X20 B;  3SPG A;  3IC7 A;  1Q6H A;  5EIB C;  1BQ0 A;  2HVJ C;  4IGG A;  3CCR V;  4LF5 O;  4JAV A;  5CBF A;  5LA6 A;  5E1A C;  1I7F A;  4JYY A;  3JD1 A;  1GK9 A;  4PA3 A;  2QE7 G;  1AJN A;  5LGN A;  5BR8 B;  3HKC B;  1WA8 A;  3G6B A;  5J9P C;  1VF6 C;  3B09 A;  1R3I C;  1F51 A;  1TAE A;  2YIA A;  1H2S B;  3GB7 C;  4H37 A;  1FPO A;  4KFM A;  4CS3 A;  5JJN B;  2XOK G;  3CJH A;  3RBZ A;  2ZD9 A;  5LHG A;  1VQ8 V;  3CHX A;  4HNA A;  1Z5W A;  3H1I H;  1QLE B;  4MVO A;  3STZ C;  2IJI A;  2FKX A;  2IW5 A;  2PI5 A;  2PGG A;  3UQ8 A;  2DWE C;  1DGS A;  2IJH A;  4X9Q A;  1R6N A;  4A5U B;  1NH2 D;  4OPH A;  1OZ0 A;  2P7T C;  5LYJ B;  4DR5 O;  2PUS A;  4O2B A;  4HYO A;  1QVG U;  3BA8 A;  4B3T O;  1IBL O;  3FB7 C;  4FPP A;  2A9H A;  2EIK B;  2QKA A;  4UB8 Z;  1R6T A;  2EIM C;  2ZQM A;  4X1Y B;  4NR1 A;  1WAZ A;  2JJ2 G;  2YI9 A;  1ZAU A;  3FB8 C;  4JI5 B;  2E74 B;  4LNU A;  3L73 H;  1DF4 A;  1FXK B;  1VEW A;  2CUG A;  4RUE A;  1EN5 A;  2AHY A;  3MAQ A;  4I55 B;  4MVU A;  3ABK B;  4DYL A;  1G8M A;  1ORQ C;  5LMU O;  4ABM A;  1K4D C;  3DGE A;  1WA8 B;  4RUF A;  4F6E A;  2YS8 A;  4B3M O;  1N36 B;  4DR7 O;  1VP7 A;  5BZB A;  1WB8 A;  2EBO A;  1I94 B;  4NVP A;  1ZL8 A;  4X64 O;  3L71 H;  4JI4 B;  1BCC H;  2JVD A;  1XNQ B;  4FIP C;  3ZMZ A;  3CRM A;  3CJH B;  4NYK A;  5EZY A;  4HNA B;  5HFM A;  1VQ5 V;  3P32 A;  1NVP B;  5EC2 C;  4O4J A;  5B1A C;  4RQE A;  4QPK A;  2BSK A;  1YVW A;  4OPA A;  2Q5Z A;  3MD0 A;  5JQG A;  2JEU A;  2XHB A;  1G1X B;  3OMI B;  2IU0 A;  4KL1 A;  1O9G A;  4O2B B;  1ROP A;  1Q86 W;  1Y74 B;  1NS1 A;  2UUA B;  1ENV A;  3DXR A;  5LOV B;  1D2D A;  3ABL B;  2HJF C;  1WP7 A;  4FVM A;  1KC8 W;  3K08 A;  4X89 A;  4JI3 O;  2JEX A;  1GN4 A;  3TJT A;  4G27 B;  1GRJ A;  1IXB A;  1S5L Z;  3TGU H;  2PYJ A;  2CTQ A;  2FML A;  1HP8 A;  4ZHQ A;  3SJA C;  2CDY A;  2P67 A;  5KX5 A;  1P7G A;  1HNX B;  3CCS V;  1GN6 A;  1I0H A;  1JR9 A;  3SYP A;  4UVA A;  5L3D A;  4IIJ B;  4Q20 A;  2AHZ A;  3BAB A;  2A7W A;  1ZL8 B;  2Z3Y A;  1JFF A;  1F7Y A;  3B77 A;  2UXB O;  4LWS A;  1P4R A;  4MW3 A;  3I55 V;  4LF5 B;  2RDC A;  4I0X A;  5EYP A;  1QLE C;  5LHH A;  2Q6A A;  2CAZ C;  4J41 A;  4J42 A;  2UXN A;  1L0L H;  4HBN A;  3EXA A;  3I56 V;  4H13 B;  4N23 A;  4O4J B;  4P9P A;  4WFE A;  4WFB V;  2DQ3 A;  1HW7 A;  3OE7 G;  4DUY O;  1QBZ A;  5JQG B;  3P3N A;  2GHY A;  5FPO A;  1DK1 A;  4NXM O;  1KBH A;  3T2M A;  1VF7 A;  3G67 A;  4QPJ A;  3UCS C;  1AI5 A;  4JF3 A;  3DXR B;  2OTL V;  4L87 A;  1GN2 A;  3QF7 A;  4OGQ B;  3CSX A;  5KA5 A;  3CWB H;  1FXK C;  1XOU A;  3AG7 A;  2RQ6 A;  3AG4 B;  4DW1 A;  4TSF G;  2C2A A;  1L0N H;  3OMN B;  3SPI A;  4FJC C;  4DR5 B;  4ZHQ B;  5CB4 A;  2F95 B;  5KX5 B;  4B3T B;  1IBL B;  3TK1 A;  1BGY H;  3CEI A;  4J7Z A;  3BRC A;  1O9H A;  1A32 A;  1WN7 A;  1F4M A;  4LF4 O;  4LF8 O;  5DED A;  1PP9 H;  3JAK A;  4LWS B;  2KG7 A;  4JYB A;  2Q67 A;  1URF A;  4I0X B;  4KP4 A;  4EB6 A;  4DRX A;  1UPG A;  5HFL A;  5LMU B;  5H2F Z;  1K5S A;  5H9C A;  2QWO B;  4B3M B;  2QWP B;  4DR7 B;  1KU9 A;  2YIB A;  2L35 A;  1NT2 B;  3SYO A;  4YHH O;  3N2G A;  4DW0 A;  1DTO A;  1XMO O;  4GX2 A;  5LP6 A;  4TUY A;  3KCY A;  4RAI A;  2ATK C;  4DV4 O;  5JWP A;  1VQ4 V;  2BTO A;  3QO5 A;  1PKX A;  3A0H Z;  3TCU A;  2F1M A;  1YI2 V;  3RYI A;  3Q4H B;  2UXC B;  4YJ2 A;  3ZBH A;  4CS4 A;  2Y4U A;  3BPZ A;  4TV9 A;  5CB4 B;  1VQN V;  1M56 B;  3ASO C;  3F5T A;  4RWU A;  1X59 A;  4DV2 O;  2H8P C;  1Q81 W;  3O65 A;  4K3A A;  3RYF A;  3LSQ A;  5EBL C;  1XMQ O;  4NXN O;  2KQX A;  3M7M X;  4YIP A;  3JAK B;  1MMM A;  4JI3 B;  3G71 V;  2EJR A;  2UUB O;  2KG7 B;  4TQF A;  3T4Z A;  4L8J A;  1VQL V;  4JI2 B;  1IUR A;  4D7S A;  2LGQ A;  2XAQ A;  4WCE V;  1QR8 A;  1SET A;  2OIG A;  4HZ3 A;  3RGB A;  3KKY A;  5BR8 O;  2NR5 A;  3B4S A;  2P6J A;  4FLU A;  1GM8 A;  2N74 A;  3HKE A;  3RVY A;  3K79 A;  1R3L C;  3N2G B;  2UXB B;  5JJJ B;  2F43 G;  1YCI A;  5LP6 B;  1NR7 A;  4TUY B;  1YTF B;  1Y4M A;  3IJ4 A;  5IT9 N;  2ZNI A;  3CS5 A;  3TXQ A;  4MTF A;  4WFH A;  2F93 B;  3AG4 C;  3RYI B;  4DUY B;  1AVM A;  4YJ2 B;  2DQ0 A;  4LCU C;  3LSU A;  4TV9 B;  4U3F H;  4W4L A;  2Q7E A;  3ZMV A;  1EN6 A;  4NTW A;  1E1Q G;  4UCR A;  2ILM A;  4J80 A;  3ETD A;  3OMA B;  1J95 A;  4FLY A;  4JI6 O;  1D5N A;  3CCU V;  2XAJ A;  3RYF B;  2ZKO A;  2E76 B;  4DV7 O;  5IJ9 B;  3CRR A;  4Z1V A;  3A8T A;  4MSW C;  3BVO A;  1SES A;  2ADQ B;  2JK5 C;  1NR1 A;  4FLX A;  1KEC A;  4PV1 B;  2W0F C;  3K5L A;  1SA0 A;  1NKD A;  1JOY A;  1K9M W;  3ETG A;  2XAS A;  1VQM V;  3B40 A;  2IJK A;  2R9I A;  5BMV B;  3K9S A;  5H5N A;  2RJZ A;  4ZI7 A;  1M4U A;  1BS3 A;  1OHH G;  4PI0 A;  3ZMU A;  2EIM B;  1JPX A;  4MW8 A;  1BE3 H;  3HKE B;  1OCZ C;  4LF4 B;  4LF8 B;  3ABT A;  2AGA A;  1VAR A;  1M1K W;  3SGI A;  1K97 A;  3CCE V;  2JGD A;  2MK3 A;  3ZCC A;  3CP1 A;  1Q6I A;  4MTO A;  3ICX A;  4XDK A;  2PYL A;  3ZS8 C;  1J5E B;  3MHS C;  2IH3 C;  4BR6 A;  1K34 A;  3K0D A;  1KUQ A;  1NH2 B;  3ML0 A;  3X2Q B;  1DF5 A;  3E86 A;  1R3J C;  3IAY A;  4P30 A;  2PZS A;  2Z0A A;  4PDR A;  4BW9 A;  5CA1 A;  5KA6 A;  4YHH B;  4GX0 A;  1XMO B;  1MA1 A;  4GLX A;  2B1G A;  4FFB B;  2NN4 A;  1F23 A;  3TET A;  3H1J H;  2X6C A;  4DV4 B;  2DYS B;  2WLN A;  5EK0 A;  1K33 A;  4BIZ A;  1N8R W;  1PNL A;  4JAU A;  4EFE A;  3D36 A;  1K3E A;  4X8A A;  2CTW A;  4UUJ C;  1TUB A;  4R6Z A;  1SA0 B;  2R9R B;  1CXZ B;  4X65 O;  5L3F A;  2BTQ B;  4OXS A;  4ZI7 B;  3RN4 A;  4DV2 B;  4X88 A;  2CH7 A;  4JTA B;  5B1N A;  1XMQ B;  4NXN B;  5EBW C;  2KSD A;  2QWQ B;  4IYI A;  4O2A A;  3JAR A;  2IH1 C;  3GWK C;  2HVK C;  2UUB B;  2A0L A;  5LP6 C;  1VQK V;  2JGD B;  1N4C A;  3SJQ C;  3HB3 B;  1NI8 A;  4EKW A;  1K73 W;  1NZ6 A;  2A79 B;  5LXT B;  1CEZ A;  1N34 O;  2ZE5 A;  4QGP A;  4X62 O;  4R8C A;  2ETN A;  3KG2 A;  3HKB B;  1HDJ A;  1QQC A;  1YJ9 V;  1HR0 O;  5CA1 B;  4GT1 A;  2QM7 A;  1VQ9 V;  2ITC C;  1KD1 W;  3OGC C;  3KZI Z;  4FMT A;  4JV5 O;  2QJ1 A;  1B3Q A;  1AB3 A;  1R73 A;  1NJI W;  3W7S A;  4JI8 O;  2WAM A;  4YJ3 B;  4LP8 A;  2YEV A;  1TUB B;  4B7K A;  5FLX N;  3HPL C;  3G4S V;  2QM8 A;  2OWO A;  3U10 A;  4PA6 A;  3ZHU A;  4DR6 B;  3OTF A;  4TWK A;  2P06 A;  2WPD G;  1NTZ H;  1PM9 A;  2GDS A;  4IL6 Z;  4JI6 B;  3F5W C;  1K4C C;  1ZX3 A;  4J9Z B;  3ZHR A;  3GVM A;  2Q8V A;  4DV7 B;  5F2V O;  4GZR B;  4QIW F;  1MG1 A;  5J2T B;  4O2A B;  3PJS K;  2VRZ A;  4DV6 O;  2HG5 C;  2LQT A;  4MTX A;  4JPR A;  4LFC O;  3JAS A;  5LA6 B;  1KMI Z;  4JI0 O;  3CME V;  4KXR A;  3LSS A;  3CRC A;  2QWR B;  3IC9 A;  4JZG A;  3X2Q C;  3APQ A;  1LUV A;  2X6B A;  2XAH A;  2VQE B;  4QE7 A;  3JSN A;  3OGI B;  3HKD A;  3CCL V;  3CXH F;  4JAS A;  4UXN A;  1FKA O;  4DXW A;  4JYA O;  4GUN A;  1Q43 A;  3B2E E;  4DV0 O;  3A0B Z;  4MVR A;  1CPY A;  3WFV A;  2VQF O;  2DYS C;  1FFT B;  1XBL A;  2BCC H;  2FYU H;  4UB6 Z;  4DK1 A;  2QM4 A;  1RM1 C;  2EIJ C;  4LF6 O;  2JS5 A;  3B8M A;  4O4L A;  4N21 A;  3SDL A;  3OTO O;  2UXC O;  2ZIM A;  2YEV B;  3ZHQ A;  1Y6X A;  4IHJ A;  1DLB A;  4PA7 A;  3FB5 C;  1AR5 A;  3RYH A;  1WJZ A;  4LC1 A;  4FLT A;  4FM2 A;  3H01 A;  3AK1 A;  4H0L B;  1XDC A;  1YJN V;  4BIU A;  1B04 A;  4G28 B;  5A2Q N;  1BSM A;  3OEH G;  3ZJZ A;  4D7T A;  2K1E A;  2W6J G;  1IBM O;  2Q0O C;  5CBH A;  1GO3 F;  3ZRX A;  4LNU B;  2EIL B;  2WLJ A;  3CRA A;  2CTR A;  2QWN B;  1W2B U;  1FD9 A;  3JAS B;  4I50 A;  4JI2 O;  3K9A A;  4MVZ A;  4QE9 A;  1LUW A;  4GKK O;  4X65 B;  1VQ7 V;  4JI1 O;  3RYC A;  3FFQ A;  4I4T A;  3ASO B;  5D5P A;  2P4K A;  3N2K A;  3HKD B;  3QVN A;  4WBN A;  3CE2 A;  2YI8 A;  5KAF Z;  5BY1 A;  3BHP A;  3E8B A;  2H94 A;  5EZY B;  2ZR3 A;  4I9Q A;  1YXB A;  2KB1 A;  4AI8 A;  1FXV A;  1XL4 A;  3AK2 A;  3D36 C;  1N34 B;  2XUM A;  3LNN A;  4X62 B;  2WLH A;  3F7V C;  2R72 A;  2BSK B;  2ZXW C;  1Q90 D;  5EBM C;  4MT8 A;  3E83 A;  4IHJ B;  1HR0 B;  4TT3 G;  3AEI A;  4FLZ A;  1L8D A;  3RYH B;  4J7K A;  2X7R B;  5DEC A;  5KHK A;  4JV5 B;  1BZK A;  3MDS A;  4LFA O;  1N0J A;  2CTP A;  2RCV A;  5IYB O;  3JD2 A;  3JYC A;  4JI8 B;  3J81 N;  5DM6 V;  4WF9 V;  1V55 B;  1Y67 A;  4FFK A;  3AG3 C;  1W59 A;  4I50 B;  3ZN1 A;  4LFB O;  1E1R G;  5ITZ A;  3WG7 C;  2UU9 B;  3UM7 A;  1QNM A;  3RYC B;  1Z5V A;  4UCU A;  4KUM A;  2GTA A;  4I4T B;  3ZED A;  1BHA A;  3BCC H;  2D3O W;  3JAM N;  5IJ0 A;  1EN4 A;  1JJO A;  2K9P A;  3DC6 A;  2OTJ V;  4YY3 O;  4WBN B;  1Q7Y W;  1JFF B;  4DV6 B;  3T1H O;  5LMN O;  2HKO A;  3OUS A;  3FD9 A;  4JI7 B;  5KHJ A;  1CP9 A;  4LFC B;  2RNB A;  3APO A;  4JI0 B;  1VQO V;  5EYP B;  1UJW B;  3CB2 A;  4UCS A;  5A9G A;  1J5E O;  3A0R A;  2E5L O;  2EZO A;  5D5Q A;  1EZV H;  2P5O A;  3JAL A;  1QU7 A;  3G80 A;  2GSM B;  4JGS A;  1V54 C;  5B1B C;  2P90 A;  4IT5 A;  3BAA A;  3E22 A;  3T1C A;  3ZN0 A;  5C8Y A;  1P84 F;  4JYA B;  4X1K A;  2Y0I A;  2Y0P A;  1OCZ B;  4DUZ O;  1NTK H;  2FTK A;  1GM9 A;  2CK3 G;  4ZBM A;  4DV0 B;  3AG1 C;  3KCX A;  2VQF B;  2RN9 A;  2WLI A;  5FL7 G;  1TUE B;  4CH4 A;  2W0X A;  3CXC U;  1HNW O;  4J11 A;  4LF6 B;  2WA4 A;  1RSO A;  3L74 H;  4UVC A;  2EIL C;  5GON A;  2Q7G A;  1FYJ A;  3OTO B;  4TV8 A;  1MOF A;  3ABM C;  4ICG A;  2EX3 A;  2Y69 C;  4F6R A;  2JDI G;  1QR9 A;  1OCO B;  5IY5 B;  2JJ1 G;  3IGA C;  3JSL A;  3U0Z A;  5ITZ B;  1X4T A;  4UCT A;  1FXH A;  1GAX A;  4PDL A;  4C7U A;  2OIE A;  1JVM A;  1N0N A;  1SQF A;  3WB0 A;  2OCH A;  2GUZ A;  5IJ0 B;  1YIJ V;  4ZIB A;  1IBM B;  2YXH A;  2GTS A;  2NLJ C;  1S77 D;  1GKF A;  5CA0 A;  1BL8 A;  1XQ8 A;  2H3O A;  2YIC A;  1GN3 A;  4CBC A;  1XL6 A;  4I9W A;  1YDX A;  3ZMT A;  1SF9 A;  1U96 A;  1OCR C;  3JAW A;  4GKK B;  1SZX A;  5KUM A;  4EB6 B;  1Y76 A;  4JI1 B;  4DRX B;  1ARO P;  3DTU B;  3JAL B;  3H9V A;  4B7E A;  4R7C A;  2IJJ A;  2QSA A;  1SKV A;  2YID A;  2Y4T A;  3E22 B;  5IYC O;  5C8Y B;  2ZNJ A;  5FNV A;  2OYQ A;  1H2K A;  1H8E G;  1EBO A;  1S5H C;  1R1B A;  2ZR2 A;  2WLI B;  3PN1 A;  1VQP V;  2IBZ H;  5KMG A;  3OR6 C;  3SPH A;  4I5S A;  1B6Q A;  3C3S A;  2HHH O;  2ODM A;  4YIO A;  3OAA G;  1ZSP A;  4ZOL A;  1IBK O;  2Z5U A;  3LUT B;  2KKW A;  5GON B;  1SQX H;  4Q6G A;  1K8A W;  5KHH A;  1V55 C;  4TV8 B;  1EM1 A;  4NB5 A;  2OCC C;  3W7U A;  3TXS A;  4EFB A;  1MZF A;  1Q8I A;  1AP6 A;  3FYI B;  5KAI Z;  4B08 A;  4DR6 O;  1LR1 A;  4JAA A;  3D3I A;  4QJF B;  2MW2 B;  5KHG A;  4X66 B;  1H2M A;  3ZRW A;  3CRQ A;  2GUZ B;  1NTM H;  4LFA B;  1KP3 A;  1H2G A;  3CX5 F;  1AI7 A;  3OT7 A;  1OJH A;  3UKM A;  5B3S C;  1PPJ H;  1B06 A;  2WA3 A;  5CA0 B;  1SC5 B;  4H33 A;  1W0K G;  5AG2 A;  4ASU G;  4LF9 O;  5KHI A;  4LFB B;  2Q73 A;  3JAW B;  2QKS A;  3ASN B;  1Y76 B;  4DV5 O;  3E2E A;  3WU2 Z;  5EC1 C;  1G4Y B;  3I5D A;  4DR1 O;  3IFX A;  5L3G A;  2VQE O;  3FAV A;  5BXZ A;  4R50 A;  3T1Y B;  2V1D A;  4X1I A;  3CC4 V;  1GH6 A;  2ITD C;  4GYC B;  5TIS Z;  4YY3 B;  3HR0 A;  4WFF A;  5FNV B;  4TOI A;  3T1H B;  5LMN B;  4CS2 A; 
#chains in the Genus database with same CATH homology
 2DE0 X;  3G80 A;  3Q4H A;  2VS0 A;  4LWS A;  3TXQ A;  3Q4H B;  4LWS B;  3FAV A;  2AZ2 A;  2B9Z A;  3O9O A;  2KG7 A;  3ZBH A;  4I0X A;  3FD9 A;  1WA8 A;  3FAV B;  2KG7 B;  4ABM A;  4I0X B;  1WA8 B;  3GVM A;  3TXS A;  2AZ0 A;  4GZR B;  3HR0 A;  3OGI B;  3GWK C;  2VRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...