3Q4OA

Crystal structure of a deletion mutant(11-185) of hypothetical protein mj0754 determined to 1.34a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
169
structure length
169
Chain Sequence
b'PISEEEKEGLIEMREEEKLARDVYLTLYNKWKLQIFKNIAESEQTHMDAVKYLLEKYNIPDPVKNDSIGVFSNPKFEELYKKLVEKGDKSEVDALKVGATIEDLDIADLEKWINKTDNEDIKFVYENLMKGSRNHMRAFVRMLNNYGSNYTPQYISKEEYEEIISSSTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0754
publication title Structural insights into the metal binding properties of hypothetical protein MJ0754 from Methanococcus jannaschii DSM 2661
doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Unknown function
total genus 75
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2010-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09968 DUF2202 Uncharacterized protein domain (DUF2202)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3q4oA00
3E1JA 4U3GA 3AJOA 3KA3A 5D8PA 1NF6A 3AJPA 4AM2A 2XJNA 4LQHA 2XKQA 2V2JA 2YW7A 4ZL6A 5E2DA 2V2IA 5D8SA 4TOBA 1Z4AA 1DATA 5GU3X 2V15A 5E1UA 5JACA 3UOIA 5LG2A 4ZKWA 1JKVA 4AM5A 4YKHA 2CHIA 2C41A 2W0OA 1L8IA 2OC5A 5JKLA 2Z6MA 4IWJA 1R03A 4CYBA 3NP2X 4REUA 3PWQA 2FHAA 4CVSA 1Z6OA 1LKMA 1BCFA 4LYXA 4CVTA 4MN9A 1TK6A 5GOUA 3ISFA 3MPSA 1O9IA 1RCEA 4CMYA 1JYBA 1YUXA 2G4HA 1VEIA 3F36A 4P18A 4II4A 5D8XA 5ERKA 2YW6A 4M32A 2JD60 3KA8A 1JTSA 3E2CA 3OGHA 2IU2A 1VEQA 3QHCA 1F33A 2QF9A 3F37A 4M33A 2CHPA 4ERUA 3VNXA 3AK8A 5FEJA 3RGDA 4DYXA 5LBHA 4DE6A 3KA6A 5GN8B 3Q4RA 1FHAA 4CVRA 4R42A 4LPNA 3WVWA 3OJ5A 1DPSA 3PVRB 4KVRA 3R2KA 2IB0A 3EGMA 4LPMA 3ERZA 5CZUA 3AF7X 1NNQA 4LYUA 3F35A 3E1NA 3RD0A 1SOFA 2VXXA 1RYTA 2CN7A 3Q4OA 3QZ3A 4ITTA 4MKUA 3T9JA 4ZL5A 1ZUJA 3R2LA 3PZAA 3GE4A 3KX9A 5J8WA 3PVTB 3KXUA 4TW3A 3R2SA 4MUDA 3WVVA 1H96A 4TODA 5I4JA 2C2UA 2BJYA 1IERA 2Z90A 1JIGA 1TJOA 3PWFA 1JGCA 2ZG8X 3O7SA 2WLAA 4Z3BA 4DYYA 1QYBA 1BG7A 3SIDA 3F38A 3IQ1A 5ERJA 4AM4A 2QQYA 2V2LA 3QD8A 1NFVA 1BFRA 4LQVA 5FFCA 4M34A 2ZG7X 5CMRA 4PG0A 4TOHA 1VJXA 5LG8A 3KA9A 5J93A 2VXIA 3SHXA 4XKUA 3UOFA 1Z6OM 5JKMA 4ETRA 1LB3A 2XJOA 5GN8A 4PGIA 4ML5A 3ISEA 3EZ0A 5D8RA 4A25A 2ZURX 3PVRA 2RBDA 3WVUA 2C2FA 3NOZX 1HRSA 2Z5PA 4DYUA 1NF4A 1OTKA 2FKZA 3FSEA 4ZJKA 3HL1A 4CVPA 3KWOA 1N1QA 5C6FA 4RC8A 3FI6A 1RCGA 5D8QA 4IXKA 4ZLWA 4RC7B 3E6RA 4ZKXA 3IS8A 4EVBA 1RCCA 3PVTA 4EVEA 2GYDA 1JI4A 2CF7A 5J9VA 5AXSA 3PW8A 3H7GA 3BVIA 3BVLA 4CYAA 5GU0X 4ZTTA 4TOGA 2BKCA 1SQ3A 1S30A 2JD80 4Y08A 1GWGA 1B71A 5IX6A 4ZMCA 1YUZA 3R2OA 3F34A 2ZG9X 4OYNA 4ITWA 2FG4A 2CEIA 3HIUA 2ZA6A 4ISMA 5K52A 4DYZA 1UVHA 3E6SA 1JREA 3E1LA 2VZBA 3BT5A 4DZ0A 4RC6A 1S2ZA 1UMNA 3F33A 2ZA8A 4M35A 1ZS3A 1RCDA 5JKLG 4CMYV 3PVYB 2BK6A 3F39A 5JKMG 4PGKA 1DVBA 4RC5A 1L8HA 2PYBA 3U90A 4LPJA 3F32A 2CN6A 2V2SA 4MJYA 2IY4A 2YJKA 4TO9A 5FFBA 1YV1A 2V2RA 5CMQA 2JD70 1F30A 3AF8X 4TOCA 3RAVA 2FZFA 3R2MA 3AJQA 3BVFA 3FVBA 4LQJA 4MY7A 2FJCA 2V2OA 3Q4QA 2GYQA 4RC7A 3BVKA 3E1MA 3SH6A 2FL0A 2C2JA 3GVYA 2V2PA 3QHBA 1KRQA 4KVQA 2Z5QA 4RC6B 1LKPA 2Z5RA 3NP0X 2OH3A 2GS4A 5D8YA 2ITBA 4CY9A 3UNOA 1JKUA 4RC5B 4EVCA 4ZKHA 2CLUA 2F7NA 1EUMA 3PW1B 4TOEA 5D8OA 3TA8A 1J30A 2V2NA 5HQOA 3EZUA 2X170 3PWQC 3KA4A 3R2RA 4TOFA 2FFXJ 4KVSA 1MOJA 1O9RA 4IWKA 2HR5A 3IS7A 2C6RA 2XGWA 2CLBA 3QB9A 1LKOA 3R2HA 3RE7A 3QVDA 5HJHA 4DASA 3PVYA 3AK9A 2BW1A 2UX1A 5FFAA 2CIHA 5FFEA 3BVEA 3AF9X 3BKNA 3ES3A 3GHQA 3E1QA 2D5KA 4XKSA 4DI0A 1MFRA 5J8SA 4XKTA 5FFDA 5HJFA 2WTLA 3SE1A 2XJMA 4EVDA 4PG1A 1VLGA 1QGHA 3PW8C 3Q4NA 1TKOA 3A9QA 3WNWA 2FG8A 1TKPA 1IESA 3RBCA 5K53A 3E1PA 4ISPA 2V2MA 2Y3QA 4II4B 3E1OA 4QUWA 4E6KA 1RCIA 2WLUA 2HTNA 4XGSA 1S3QA 5LS9A 2YJJA 3PW1A 1JI5A 1AEWA 3O7RA 4Z5SA 5GU2X 1VELA 1XZ1A 4TOAA 3A68A 1XZ3A 4LQNA 2ZA7A 5GU1X
chains in the Genus database with same CATH superfamily
3E1JA 4U3GA 3AJOA 3KA3A 5D8PA 1NF6A 3AJPA 4AM2A 2XJNA 4LQHA 2N02A 2XKQA 2V2JA 2YW7A 4ZL6A 5E2DA 2V2IA 5D8SA 5JDOA 4TOBA 1Z4AA 1DATA 3L0MA 5GU3X 2AR0A 2V15A 5E1UA 5JACA 3UOIA 5LG2A 4ZKWA 1JKVA 4AM5A 4YKHA 2CHIA 2C41A 2W0OA 1L8IA 2OC5A 5JKLA 2Z6MA 4IWJA 1R03A 4CYBA 3NP2X 4REUA 3PWQA 2FHAA 4CVSA 1Z6OA 1LKMA 3C21A 1BCFA 4LYXA 4CVTA 4MN9A 2WWXB 1TK6A 5GOUA 3ISFA 3MPSA 1O9IA 1RCEA 4CMYA 1JYBA 1YUXA 2G4HA 1VEIA 3V3KB 3F36A 4P18A 4II4A 5D8XA 5ERKA 2YW6A 2Y44A 4M32A 2JD60 3KA8A 1JTSA 3E2CA 3OGHA 2IU2A 1VEQA 3QHCA 1F33A 2QF9A 3F37A 4M33A 2CHPA 4ERUA 3VNXA 3AK8A 5FEJA 3RGDA 4DYXA 5LBHA 4DE6A 3KA6A 5GN8B 3Q4RA 1FHAA 4CVRA 4R42A 3C23A 4LPNA 3WVWA 3OJ5A 1DPSA 4YXMA 3PVRB 4KVRA 3R2KA 4YXJA 2IB0A 3EGMA 4LPMA 3ERZA 5CZUA 3AF7X 1NNQA 4LYUA 3F35A 3E1NA 3RD0A 1SOFA 2VXXA 1RYTA 2CN7A 3M6JA 3Q4OA 3QZ3A 4ITTA 4MKUA 3T9JA 4ZL5A 1ZUJA 3R2LA 3PZAA 3GE4A 3KX9A 5J8WA 3JZ9A 3PVTB 4W4KB 3KXUA 4TW3A 3R2SA 4MUDA 3WVVA 3GGYA 1H96A 4TODA 5I4JA 2C2UA 2BJYA 1IERA 2Z90A 1JIGA 1TJOA 3PWFA 1JGCA 2ZG8X 3O7SA 2WLAA 4Z3BA 3JZAB 4DYYA 1QYBA 1BG7A 3SIDA 3F38A 3IQ1A 5ERJA 4AM4A 2QQYA 2V2LA 3QD8A 1NFVA 1BFRA 2V8TA 4LQVA 5FFCA 3KHKA 4M34A 2ZG7X 5CMRA 4PG0A 4E40A 4TOHA 4X0JA 2G38B 1VJXA 5LG8A 3KA9A 5J93A 2VXIA 3SHXA 4XKUA 3UOFA 1Z6OM 5JKMA 4ETRA 1LB3A 2XJOA 5GN8A 4PGIA 4KXRB 4ML5A 3ISEA 3EZ0A 5D8RA 4A25A 2ZURX 3PVRA 3D19A 2RBDA 2MGYA 2C2FA 3WVUA 3NOZX 4WJG4 1HRSA 2Z5PA 4DYUA 1NF4A 1OTKA 2FKZA 3FSEA 4ZJKA 3HL1A 4CVPA 3KWOA 1N1QA 5C6FA 4RC8A 3FI6A 1RCGA 5D8QA 2OKCA 4IXKA 3C1YA 4ZLWA 4RC7B 3E6RA 4ZKXA 3IS8A 4EVBA 1RCCA 3PVTA 4EVEA 2GYDA 1JI4A 2CF7A 5J9VA 5AXSA 3PW8A 3H7GA 3BVIA 3BVLA 4CYAA 5GU0X 4ZTTA 4TOGA 2BKCA 1SQ3A 1S30A 2JD80 4Y08A 1GWGA 1B71A 5IX6A 4ZMCA 2V8UA 1YUZA 3R2OA 3F34A 2ZG9X 4OYNA 4ITWA 2FG4A 2CEIA 4W4LB 3HIUA 2ZA6A 4ISMA 5K52A 4DYZA 1UVHA 3E6SA 1JREA 3E1LA 2VZBA 3BT5A 4DZ0A 4RC6A 1S2ZA 1UMNA 3F33A 2ZA8A 4M35A 1ZS3A 1RCDA 5JKLG 4CMYV 3PVYB 2BK6A 3F39A 5JKMG 4PGKA 1DVBA 4RC5A 1L8HA 2PYBA 3U90A 4LPJA 3F32A 2CN6A 2V2SA 4MJYA 2IY4A 2YJKA 4TO9A 5FFBA 1YV1A 2V2RA 5CMQA 2JD70 1F30A 3AF8X 4TOCA 3RAVA 3VV9A 2FZFA 3R2MA 3AJQA 3BVFA 3FRSA 3FVBA 4LQJA 3C1ZA 4MY7A 2FJCA 2V2OA 3Q4QA 2GYQA 4RC7A 3W54A 3LKDA 3BVKA 3E1MA 2FL0A 3SH6A 2C2JA 3GVYA 2V2PA 3QHBA 1KRQA 4KVQA 2Z5QA 4RC6B 1LKPA 2Z5RA 3KDQA 3NP0X 2OH3A 2GS4A 5D8YA 2ITBA 4CY9A 3UNOA 1JKUA 5HU6D 4RC5B 4EVCA 4ZKHA 2CLUA 2F7NA 1EUMA 3PW1B 4TOEA 5D8OA 3TA8A 1J30A 2V2NA 5HQOA 3EZUA 3GGZA 4YVZA 2X170 2CWLA 3PWQC 3KA4A 3R2RA 4TOFA 2FFXJ 4KVSA 1MOJA 1O9RA 4IWKA 2HR5A 5JDOB 3IS7A 2C6RA 2XGWA 2CLBA 3QB9A 1LKOA 3R2HA 3N6OA 3RE7A 3QVDA 5HJHA 4DASA 3PVYA 3AK9A 2BW1A 2UX1A 5FFAA 2CIHA 5FFEA 3BVEA 3AF9X 3BKNA 3ES3A 3GHQA 3E1QA 2D5KA 4XKSA 4DI0A 1MFRA 5J8SA 4XKTA 5FFDA 5HJFA 2WTLA 3SE1A 2XJMA 3DBYA 4EVDA 4PG1A 1VLGA 1QGHA 3PW8C 3Q4NA 1TKOA 3A9QA 3WNWA 2FG8A 1TKPA 1IESA 3RBCA 5K53A 3E1PA 4ISPA 2V2MA 2Y3QA 4II4B 3E1OA 4QUWA 3UFBA 4E6KA 1RCIA 2WLUA 2HTNA 4XGSA 1S3QA 5LS9A 2YJJA 3PW1A 1JI5A 1AEWA 3FRRA 3O7RA 4Z5SA 5GU2X 1VELA 3VVAA 1XZ1A 4TOAA 3A68A 1XZ3A 4MXPA 4LQNA 2ZA7A 5GU1X
chains in the Genus database with same CATH topology
3E1JA 4U3GA 3AJOA 3KA3A 5D8PA 1NF6A 3AJPA 4AM2A 2XJNA 4LQHA 2N02A 2XKQA 2V2JA 2YW7A 4ZL6A 5E2DA 2V2IA 5D8SA 5JDOA 4TOBA 1Z4AA 1DATA 3L0MA 5GU3X 2AR0A 2V15A 5E1UA 5JACA 3UOIA 5LG2A 4ZKWA 1JKVA 4AM5A 4YKHA 2CHIA 2C41A 2W0OA 1L8IA 2OC5A 5JKLA 2Z6MA 4IWJA 1R03A 4CYBA 3NP2X 4REUA 3PWQA 2FHAA 4CVSA 1Z6OA 1LKMA 3C21A 1BCFA 4LYXA 4CVTA 4MN9A 2WWXB 1TK6A 5GOUA 3ISFA 3MPSA 1O9IA 1RCEA 4CMYA 1JYBA 1YUXA 2G4HA 1VEIA 3V3KB 3F36A 4P18A 4II4A 5D8XA 5ERKA 2YW6A 2Y44A 4M32A 2JD60 3KA8A 1JTSA 3E2CA 3OGHA 2IU2A 1VEQA 3QHCA 1F33A 2QF9A 3F37A 4M33A 2CHPA 4ERUA 3VNXA 3AK8A 5FEJA 3RGDA 4DYXA 5LBHA 4DE6A 3KA6A 5GN8B 3Q4RA 1FHAA 4CVRA 4R42A 3C23A 4LPNA 3WVWA 3OJ5A 1DPSA 4YXMA 3PVRB 4KVRA 3R2KA 4YXJA 2IB0A 3EGMA 4LPMA 3ERZA 5CZUA 3AF7X 1NNQA 4LYUA 3F35A 3E1NA 3RD0A 1SOFA 2VXXA 1RYTA 2CN7A 3M6JA 3Q4OA 3QZ3A 4ITTA 4MKUA 3T9JA 4ZL5A 1ZUJA 3R2LA 3PZAA 3GE4A 3KX9A 5J8WA 3JZ9A 3PVTB 4W4KB 3KXUA 4TW3A 3R2SA 4MUDA 3WVVA 3GGYA 1H96A 4TODA 5I4JA 2C2UA 2BJYA 1IERA 2Z90A 1JIGA 1TJOA 3PWFA 1JGCA 2ZG8X 3O7SA 2WLAA 4Z3BA 3JZAB 4DYYA 1QYBA 1BG7A 3SIDA 3F38A 3IQ1A 5ERJA 4AM4A 2QQYA 2V2LA 3QD8A 1NFVA 1BFRA 2V8TA 4LQVA 5FFCA 3KHKA 4M34A 2ZG7X 5CMRA 4PG0A 4E40A 4TOHA 4X0JA 2G38B 1VJXA 5LG8A 3KA9A 5J93A 2VXIA 3SHXA 4XKUA 3UOFA 1Z6OM 5JKMA 4ETRA 1LB3A 2XJOA 5GN8A 4PGIA 4KXRB 4ML5A 3ISEA 3EZ0A 5D8RA 4A25A 2ZURX 3PVRA 3D19A 2RBDA 2MGYA 2C2FA 3WVUA 3NOZX 4WJG4 1HRSA 2Z5PA 4DYUA 1NF4A 1OTKA 2FKZA 3FSEA 4ZJKA 3HL1A 4CVPA 3KWOA 1N1QA 5C6FA 4RC8A 3FI6A 1RCGA 5D8QA 2OKCA 4IXKA 3C1YA 4ZLWA 4RC7B 3E6RA 4ZKXA 3IS8A 4EVBA 1RCCA 3PVTA 4EVEA 2GYDA 1JI4A 2CF7A 5J9VA 5AXSA 3PW8A 3H7GA 3BVIA 3BVLA 4CYAA 5GU0X 4ZTTA 4TOGA 2BKCA 1SQ3A 1S30A 2JD80 4Y08A 1GWGA 1B71A 5IX6A 4ZMCA 2V8UA 1YUZA 3R2OA 3F34A 2ZG9X 4OYNA 4ITWA 2FG4A 2CEIA 4W4LB 3HIUA 2ZA6A 4ISMA 5K52A 4DYZA 1UVHA 3E6SA 1JREA 3E1LA 2VZBA 3BT5A 4DZ0A 4RC6A 1S2ZA 1UMNA 3F33A 2ZA8A 4M35A 1ZS3A 1RCDA 5JKLG 4CMYV 3PVYB 2BK6A 3F39A 5JKMG 4PGKA 1DVBA 4RC5A 1L8HA 2PYBA 3U90A 4LPJA 3F32A 2CN6A 2V2SA 4MJYA 2IY4A 2YJKA 4TO9A 5FFBA 1YV1A 2V2RA 5CMQA 2JD70 1F30A 3AF8X 4TOCA 3RAVA 3VV9A 2FZFA 3R2MA 3AJQA 3BVFA 3FRSA 3FVBA 4LQJA 3C1ZA 4MY7A 2FJCA 2V2OA 3Q4QA 2GYQA 4RC7A 3W54A 3LKDA 3BVKA 3E1MA 2FL0A 3SH6A 2C2JA 3GVYA 2V2PA 3QHBA 1KRQA 4KVQA 2Z5QA 4RC6B 1LKPA 2Z5RA 3KDQA 3NP0X 2OH3A 2GS4A 5D8YA 2ITBA 4CY9A 3UNOA 1JKUA 5HU6D 4RC5B 4EVCA 4ZKHA 2CLUA 2F7NA 1EUMA 3PW1B 4TOEA 5D8OA 3TA8A 1J30A 2V2NA 5HQOA 3EZUA 3GGZA 4YVZA 2X170 2CWLA 3PWQC 3KA4A 3R2RA 4TOFA 2FFXJ 4KVSA 1MOJA 1O9RA 4IWKA 2HR5A 5JDOB 3IS7A 2C6RA 2XGWA 2CLBA 3QB9A 1LKOA 3R2HA 3N6OA 3RE7A 3QVDA 5HJHA 4DASA 3PVYA 3AK9A 2BW1A 2UX1A 5FFAA 2CIHA 5FFEA 3BVEA 3AF9X 3BKNA 3ES3A 3GHQA 3E1QA 2D5KA 4XKSA 4DI0A 1MFRA 5J8SA 4XKTA 5FFDA 5HJFA 2WTLA 3SE1A 2XJMA 3DBYA 4EVDA 4PG1A 1VLGA 1QGHA 3PW8C 3Q4NA 1TKOA 3A9QA 3WNWA 2FG8A 1TKPA 1IESA 3RBCA 5K53A 3E1PA 4ISPA 2V2MA 2Y3QA 4II4B 3E1OA 4QUWA 3UFBA 4E6KA 1RCIA 2WLUA 2HTNA 4XGSA 1S3QA 5LS9A 2YJJA 3PW1A 1JI5A 1AEWA 3FRRA 3O7RA 4Z5SA 5GU2X 1VELA 3VVAA 1XZ1A 4TOAA 3A68A 1XZ3A 4MXPA 4LQNA 2ZA7A 5GU1X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E1J A;  4U3G A;  3AJO A;  3KA3 A;  5D8P A;  1NF6 A;  3AJP A;  4AM2 A;  2XJN A;  4LQH A;  2XKQ A;  2V2J A;  2YW7 A;  4ZL6 A;  5E2D A;  2V2I A;  5D8S A;  4TOB A;  1Z4A A;  1DAT A;  5GU3 X;  2V15 A;  5E1U A;  5JAC A;  3UOI A;  5LG2 A;  4ZKW A;  1JKV A;  4AM5 A;  4YKH A;  2CHI A;  2C41 A;  2W0O A;  1L8I A;  2OC5 A;  5JKL A;  2Z6M A;  4IWJ A;  1R03 A;  4CYB A;  3NP2 X;  4REU A;  3PWQ A;  2FHA A;  4CVS A;  1Z6O A;  1LKM A;  1BCF A;  4LYX A;  4CVT A;  4MN9 A;  1TK6 A;  5GOU A;  3ISF A;  3MPS A;  1O9I A;  1RCE A;  4CMY A;  1JYB A;  1YUX A;  2G4H A;  1VEI A;  3F36 A;  4P18 A;  4II4 A;  5D8X A;  5ERK A;  2YW6 A;  4M32 A;  2JD6 0;  3KA8 A;  1JTS A;  3E2C A;  3OGH A;  2IU2 A;  1VEQ A;  3QHC A;  1F33 A;  2QF9 A;  3F37 A;  4M33 A;  2CHP A;  4ERU A;  3VNX A;  3AK8 A;  5FEJ A;  3RGD A;  4DYX A;  5LBH A;  4DE6 A;  3KA6 A;  5GN8 B;  3Q4R A;  1FHA A;  4CVR A;  4R42 A;  4LPN A;  3WVW A;  3OJ5 A;  1DPS A;  3PVR B;  4KVR A;  3R2K A;  2IB0 A;  3EGM A;  4LPM A;  3ERZ A;  5CZU A;  3AF7 X;  1NNQ A;  4LYU A;  3F35 A;  3E1N A;  3RD0 A;  1SOF A;  2VXX A;  1RYT A;  2CN7 A;  3Q4O A;  3QZ3 A;  4ITT A;  4MKU A;  3T9J A;  4ZL5 A;  1ZUJ A;  3R2L A;  3PZA A;  3GE4 A;  3KX9 A;  5J8W A;  3PVT B;  3KXU A;  4TW3 A;  3R2S A;  4MUD A;  3WVV A;  1H96 A;  4TOD A;  5I4J A;  2C2U A;  2BJY A;  1IER A;  2Z90 A;  1JIG A;  1TJO A;  3PWF A;  1JGC A;  2ZG8 X;  3O7S A;  2WLA A;  4Z3B A;  4DYY A;  1QYB A;  1BG7 A;  3SID A;  3F38 A;  3IQ1 A;  5ERJ A;  4AM4 A;  2QQY A;  2V2L A;  3QD8 A;  1NFV A;  1BFR A;  4LQV A;  5FFC A;  4M34 A;  2ZG7 X;  5CMR A;  4PG0 A;  4TOH A;  1VJX A;  5LG8 A;  3KA9 A;  5J93 A;  2VXI A;  3SHX A;  4XKU A;  3UOF A;  1Z6O M;  5JKM A;  4ETR A;  1LB3 A;  2XJO A;  5GN8 A;  4PGI A;  4ML5 A;  3ISE A;  3EZ0 A;  5D8R A;  4A25 A;  2ZUR X;  3PVR A;  2RBD A;  3WVU A;  2C2F A;  3NOZ X;  1HRS A;  2Z5P A;  4DYU A;  1NF4 A;  1OTK A;  2FKZ A;  3FSE A;  4ZJK A;  3HL1 A;  4CVP A;  3KWO A;  1N1Q A;  5C6F A;  4RC8 A;  3FI6 A;  1RCG A;  5D8Q A;  4IXK A;  4ZLW A;  4RC7 B;  3E6R A;  4ZKX A;  3IS8 A;  4EVB A;  1RCC A;  3PVT A;  4EVE A;  2GYD A;  1JI4 A;  2CF7 A;  5J9V A;  5AXS A;  3PW8 A;  3H7G A;  3BVI A;  3BVL A;  4CYA A;  5GU0 X;  4ZTT A;  4TOG A;  2BKC A;  1SQ3 A;  1S30 A;  2JD8 0;  4Y08 A;  1GWG A;  1B71 A;  5IX6 A;  4ZMC A;  1YUZ A;  3R2O A;  3F34 A;  2ZG9 X;  4OYN A;  4ITW A;  2FG4 A;  2CEI A;  3HIU A;  2ZA6 A;  4ISM A;  5K52 A;  4DYZ A;  1UVH A;  3E6S A;  1JRE A;  3E1L A;  2VZB A;  3BT5 A;  4DZ0 A;  4RC6 A;  1S2Z A;  1UMN A;  3F33 A;  2ZA8 A;  4M35 A;  1ZS3 A;  1RCD A;  5JKL G;  4CMY V;  3PVY B;  2BK6 A;  3F39 A;  5JKM G;  4PGK A;  1DVB A;  4RC5 A;  1L8H A;  2PYB A;  3U90 A;  4LPJ A;  3F32 A;  2CN6 A;  2V2S A;  4MJY A;  2IY4 A;  2YJK A;  4TO9 A;  5FFB A;  1YV1 A;  2V2R A;  5CMQ A;  2JD7 0;  1F30 A;  3AF8 X;  4TOC A;  3RAV A;  2FZF A;  3R2M A;  3AJQ A;  3BVF A;  3FVB A;  4LQJ A;  4MY7 A;  2FJC A;  2V2O A;  3Q4Q A;  2GYQ A;  4RC7 A;  3BVK A;  3E1M A;  3SH6 A;  2FL0 A;  2C2J A;  3GVY A;  2V2P A;  3QHB A;  1KRQ A;  4KVQ A;  2Z5Q A;  4RC6 B;  1LKP A;  2Z5R A;  3NP0 X;  2OH3 A;  2GS4 A;  5D8Y A;  2ITB A;  4CY9 A;  3UNO A;  1JKU A;  4RC5 B;  4EVC A;  4ZKH A;  2CLU A;  2F7N A;  1EUM A;  3PW1 B;  4TOE A;  5D8O A;  3TA8 A;  1J30 A;  2V2N A;  5HQO A;  3EZU A;  2X17 0;  3PWQ C;  3KA4 A;  3R2R A;  4TOF A;  2FFX J;  4KVS A;  1MOJ A;  1O9R A;  4IWK A;  2HR5 A;  3IS7 A;  2C6R A;  2XGW A;  2CLB A;  3QB9 A;  1LKO A;  3R2H A;  3RE7 A;  3QVD A;  5HJH A;  4DAS A;  3PVY A;  3AK9 A;  2BW1 A;  2UX1 A;  5FFA A;  2CIH A;  5FFE A;  3BVE A;  3AF9 X;  3BKN A;  3ES3 A;  3GHQ A;  3E1Q A;  2D5K A;  4XKS A;  4DI0 A;  1MFR A;  5J8S A;  4XKT A;  5FFD A;  5HJF A;  2WTL A;  3SE1 A;  2XJM A;  4EVD A;  4PG1 A;  1VLG A;  1QGH A;  3PW8 C;  3Q4N A;  1TKO A;  3A9Q A;  3WNW A;  2FG8 A;  1TKP A;  1IES A;  3RBC A;  5K53 A;  3E1P A;  4ISP A;  2V2M A;  2Y3Q A;  4II4 B;  3E1O A;  4QUW A;  4E6K A;  1RCI A;  2WLU A;  2HTN A;  4XGS A;  1S3Q A;  5LS9 A;  2YJJ A;  3PW1 A;  1JI5 A;  1AEW A;  3O7R A;  4Z5S A;  5GU2 X;  1VEL A;  1XZ1 A;  4TOA A;  3A68 A;  1XZ3 A;  4LQN A;  2ZA7 A;  5GU1 X; 
#chains in the Genus database with same CATH topology
 3E1J A;  4U3G A;  3AJO A;  3KA3 A;  5D8P A;  1NF6 A;  3AJP A;  4AM2 A;  2XJN A;  4LQH A;  2N02 A;  2XKQ A;  2V2J A;  2YW7 A;  4ZL6 A;  5E2D A;  2V2I A;  5D8S A;  5JDO A;  4TOB A;  1Z4A A;  1DAT A;  3L0M A;  5GU3 X;  2AR0 A;  2V15 A;  5E1U A;  5JAC A;  3UOI A;  5LG2 A;  4ZKW A;  1JKV A;  4AM5 A;  4YKH A;  2CHI A;  2C41 A;  2W0O A;  1L8I A;  2OC5 A;  5JKL A;  2Z6M A;  4IWJ A;  1R03 A;  4CYB A;  3NP2 X;  4REU A;  3PWQ A;  2FHA A;  4CVS A;  1Z6O A;  1LKM A;  3C21 A;  1BCF A;  4LYX A;  4CVT A;  4MN9 A;  2WWX B;  1TK6 A;  5GOU A;  3ISF A;  3MPS A;  1O9I A;  1RCE A;  4CMY A;  1JYB A;  1YUX A;  2G4H A;  1VEI A;  3V3K B;  3F36 A;  4P18 A;  4II4 A;  5D8X A;  5ERK A;  2YW6 A;  2Y44 A;  4M32 A;  2JD6 0;  3KA8 A;  1JTS A;  3E2C A;  3OGH A;  2IU2 A;  1VEQ A;  3QHC A;  1F33 A;  2QF9 A;  3F37 A;  4M33 A;  2CHP A;  4ERU A;  3VNX A;  3AK8 A;  5FEJ A;  3RGD A;  4DYX A;  5LBH A;  4DE6 A;  3KA6 A;  5GN8 B;  3Q4R A;  1FHA A;  4CVR A;  4R42 A;  3C23 A;  4LPN A;  3WVW A;  3OJ5 A;  1DPS A;  4YXM A;  3PVR B;  4KVR A;  3R2K A;  4YXJ A;  2IB0 A;  3EGM A;  4LPM A;  3ERZ A;  5CZU A;  3AF7 X;  1NNQ A;  4LYU A;  3F35 A;  3E1N A;  3RD0 A;  1SOF A;  2VXX A;  1RYT A;  2CN7 A;  3M6J A;  3Q4O A;  3QZ3 A;  4ITT A;  4MKU A;  3T9J A;  4ZL5 A;  1ZUJ A;  3R2L A;  3PZA A;  3GE4 A;  3KX9 A;  5J8W A;  3JZ9 A;  3PVT B;  4W4K B;  3KXU A;  4TW3 A;  3R2S A;  4MUD A;  3WVV A;  3GGY A;  1H96 A;  4TOD A;  5I4J A;  2C2U A;  2BJY A;  1IER A;  2Z90 A;  1JIG A;  1TJO A;  3PWF A;  1JGC A;  2ZG8 X;  3O7S A;  2WLA A;  4Z3B A;  3JZA B;  4DYY A;  1QYB A;  1BG7 A;  3SID A;  3F38 A;  3IQ1 A;  5ERJ A;  4AM4 A;  2QQY A;  2V2L A;  3QD8 A;  1NFV A;  1BFR A;  2V8T A;  4LQV A;  5FFC A;  3KHK A;  4M34 A;  2ZG7 X;  5CMR A;  4PG0 A;  4E40 A;  4TOH A;  4X0J A;  2G38 B;  1VJX A;  5LG8 A;  3KA9 A;  5J93 A;  2VXI A;  3SHX A;  4XKU A;  3UOF A;  1Z6O M;  5JKM A;  4ETR A;  1LB3 A;  2XJO A;  5GN8 A;  4PGI A;  4KXR B;  4ML5 A;  3ISE A;  3EZ0 A;  5D8R A;  4A25 A;  2ZUR X;  3PVR A;  3D19 A;  2RBD A;  2MGY A;  2C2F A;  3WVU A;  3NOZ X;  4WJG 4;  1HRS A;  2Z5P A;  4DYU A;  1NF4 A;  1OTK A;  2FKZ A;  3FSE A;  4ZJK A;  3HL1 A;  4CVP A;  3KWO A;  1N1Q A;  5C6F A;  4RC8 A;  3FI6 A;  1RCG A;  5D8Q A;  2OKC A;  4IXK A;  3C1Y A;  4ZLW A;  4RC7 B;  3E6R A;  4ZKX A;  3IS8 A;  4EVB A;  1RCC A;  3PVT A;  4EVE A;  2GYD A;  1JI4 A;  2CF7 A;  5J9V A;  5AXS A;  3PW8 A;  3H7G A;  3BVI A;  3BVL A;  4CYA A;  5GU0 X;  4ZTT A;  4TOG A;  2BKC A;  1SQ3 A;  1S30 A;  2JD8 0;  4Y08 A;  1GWG A;  1B71 A;  5IX6 A;  4ZMC A;  2V8U A;  1YUZ A;  3R2O A;  3F34 A;  2ZG9 X;  4OYN A;  4ITW A;  2FG4 A;  2CEI A;  4W4L B;  3HIU A;  2ZA6 A;  4ISM A;  5K52 A;  4DYZ A;  1UVH A;  3E6S A;  1JRE A;  3E1L A;  2VZB A;  3BT5 A;  4DZ0 A;  4RC6 A;  1S2Z A;  1UMN A;  3F33 A;  2ZA8 A;  4M35 A;  1ZS3 A;  1RCD A;  5JKL G;  4CMY V;  3PVY B;  2BK6 A;  3F39 A;  5JKM G;  4PGK A;  1DVB A;  4RC5 A;  1L8H A;  2PYB A;  3U90 A;  4LPJ A;  3F32 A;  2CN6 A;  2V2S A;  4MJY A;  2IY4 A;  2YJK A;  4TO9 A;  5FFB A;  1YV1 A;  2V2R A;  5CMQ A;  2JD7 0;  1F30 A;  3AF8 X;  4TOC A;  3RAV A;  3VV9 A;  2FZF A;  3R2M A;  3AJQ A;  3BVF A;  3FRS A;  3FVB A;  4LQJ A;  3C1Z A;  4MY7 A;  2FJC A;  2V2O A;  3Q4Q A;  2GYQ A;  4RC7 A;  3W54 A;  3LKD A;  3BVK A;  3E1M A;  2FL0 A;  3SH6 A;  2C2J A;  3GVY A;  2V2P A;  3QHB A;  1KRQ A;  4KVQ A;  2Z5Q A;  4RC6 B;  1LKP A;  2Z5R A;  3KDQ A;  3NP0 X;  2OH3 A;  2GS4 A;  5D8Y A;  2ITB A;  4CY9 A;  3UNO A;  1JKU A;  5HU6 D;  4RC5 B;  4EVC A;  4ZKH A;  2CLU A;  2F7N A;  1EUM A;  3PW1 B;  4TOE A;  5D8O A;  3TA8 A;  1J30 A;  2V2N A;  5HQO A;  3EZU A;  3GGZ A;  4YVZ A;  2X17 0;  2CWL A;  3PWQ C;  3KA4 A;  3R2R A;  4TOF A;  2FFX J;  4KVS A;  1MOJ A;  1O9R A;  4IWK A;  2HR5 A;  5JDO B;  3IS7 A;  2C6R A;  2XGW A;  2CLB A;  3QB9 A;  1LKO A;  3R2H A;  3N6O A;  3RE7 A;  3QVD A;  5HJH A;  4DAS A;  3PVY A;  3AK9 A;  2BW1 A;  2UX1 A;  5FFA A;  2CIH A;  5FFE A;  3BVE A;  3AF9 X;  3BKN A;  3ES3 A;  3GHQ A;  3E1Q A;  2D5K A;  4XKS A;  4DI0 A;  1MFR A;  5J8S A;  4XKT A;  5FFD A;  5HJF A;  2WTL A;  3SE1 A;  2XJM A;  3DBY A;  4EVD A;  4PG1 A;  1VLG A;  1QGH A;  3PW8 C;  3Q4N A;  1TKO A;  3A9Q A;  3WNW A;  2FG8 A;  1TKP A;  1IES A;  3RBC A;  5K53 A;  3E1P A;  4ISP A;  2V2M A;  2Y3Q A;  4II4 B;  3E1O A;  4QUW A;  3UFB A;  4E6K A;  1RCI A;  2WLU A;  2HTN A;  4XGS A;  1S3Q A;  5LS9 A;  2YJJ A;  3PW1 A;  1JI5 A;  1AEW A;  3FRR A;  3O7R A;  4Z5S A;  5GU2 X;  1VEL A;  3VVA A;  1XZ1 A;  4TOA A;  3A68 A;  1XZ3 A;  4MXP A;  4LQN A;  2ZA7 A;  5GU1 X; 
#chains in the Genus database with same CATH homology
 3E1J A;  4U3G A;  3AJO A;  3KA3 A;  5D8P A;  1NF6 A;  3AJP A;  4AM2 A;  2XJN A;  4LQH A;  2N02 A;  2XKQ A;  2V2J A;  2YW7 A;  4ZL6 A;  5E2D A;  2V2I A;  5D8S A;  5JDO A;  4TOB A;  1Z4A A;  1DAT A;  3L0M A;  5GU3 X;  2AR0 A;  2V15 A;  5E1U A;  5JAC A;  3UOI A;  5LG2 A;  4ZKW A;  1JKV A;  4AM5 A;  4YKH A;  2CHI A;  2C41 A;  2W0O A;  1L8I A;  2OC5 A;  5JKL A;  2Z6M A;  4IWJ A;  1R03 A;  4CYB A;  3NP2 X;  4REU A;  3PWQ A;  2FHA A;  4CVS A;  1Z6O A;  1LKM A;  3C21 A;  1BCF A;  4LYX A;  4CVT A;  4MN9 A;  2WWX B;  1TK6 A;  5GOU A;  3ISF A;  3MPS A;  1O9I A;  1RCE A;  4CMY A;  1JYB A;  1YUX A;  2G4H A;  1VEI A;  3V3K B;  3F36 A;  4P18 A;  4II4 A;  5D8X A;  5ERK A;  2YW6 A;  2Y44 A;  4M32 A;  2JD6 0;  3KA8 A;  1JTS A;  3E2C A;  3OGH A;  2IU2 A;  1VEQ A;  3QHC A;  1F33 A;  2QF9 A;  3F37 A;  4M33 A;  2CHP A;  4ERU A;  3VNX A;  3AK8 A;  5FEJ A;  3RGD A;  4DYX A;  5LBH A;  4DE6 A;  3KA6 A;  5GN8 B;  3Q4R A;  1FHA A;  4CVR A;  4R42 A;  3C23 A;  4LPN A;  3WVW A;  3OJ5 A;  1DPS A;  4YXM A;  3PVR B;  4KVR A;  3R2K A;  4YXJ A;  2IB0 A;  3EGM A;  4LPM A;  3ERZ A;  5CZU A;  3AF7 X;  1NNQ A;  4LYU A;  3F35 A;  3E1N A;  3RD0 A;  1SOF A;  2VXX A;  1RYT A;  2CN7 A;  3M6J A;  3Q4O A;  3QZ3 A;  4ITT A;  4MKU A;  3T9J A;  4ZL5 A;  1ZUJ A;  3R2L A;  3PZA A;  3GE4 A;  3KX9 A;  5J8W A;  3JZ9 A;  3PVT B;  4W4K B;  3KXU A;  4TW3 A;  3R2S A;  4MUD A;  3WVV A;  3GGY A;  1H96 A;  4TOD A;  5I4J A;  2C2U A;  2BJY A;  1IER A;  2Z90 A;  1JIG A;  1TJO A;  3PWF A;  1JGC A;  2ZG8 X;  3O7S A;  2WLA A;  4Z3B A;  3JZA B;  4DYY A;  1QYB A;  1BG7 A;  3SID A;  3F38 A;  3IQ1 A;  5ERJ A;  4AM4 A;  2QQY A;  2V2L A;  3QD8 A;  1NFV A;  1BFR A;  2V8T A;  4LQV A;  5FFC A;  3KHK A;  4M34 A;  2ZG7 X;  5CMR A;  4PG0 A;  4E40 A;  4TOH A;  4X0J A;  2G38 B;  1VJX A;  5LG8 A;  3KA9 A;  5J93 A;  2VXI A;  3SHX A;  4XKU A;  3UOF A;  1Z6O M;  5JKM A;  4ETR A;  1LB3 A;  2XJO A;  5GN8 A;  4PGI A;  4KXR B;  4ML5 A;  3ISE A;  3EZ0 A;  5D8R A;  4A25 A;  2ZUR X;  3PVR A;  3D19 A;  2RBD A;  2MGY A;  2C2F A;  3WVU A;  3NOZ X;  4WJG 4;  1HRS A;  2Z5P A;  4DYU A;  1NF4 A;  1OTK A;  2FKZ A;  3FSE A;  4ZJK A;  3HL1 A;  4CVP A;  3KWO A;  1N1Q A;  5C6F A;  4RC8 A;  3FI6 A;  1RCG A;  5D8Q A;  2OKC A;  4IXK A;  3C1Y A;  4ZLW A;  4RC7 B;  3E6R A;  4ZKX A;  3IS8 A;  4EVB A;  1RCC A;  3PVT A;  4EVE A;  2GYD A;  1JI4 A;  2CF7 A;  5J9V A;  5AXS A;  3PW8 A;  3H7G A;  3BVI A;  3BVL A;  4CYA A;  5GU0 X;  4ZTT A;  4TOG A;  2BKC A;  1SQ3 A;  1S30 A;  2JD8 0;  4Y08 A;  1GWG A;  1B71 A;  5IX6 A;  4ZMC A;  2V8U A;  1YUZ A;  3R2O A;  3F34 A;  2ZG9 X;  4OYN A;  4ITW A;  2FG4 A;  2CEI A;  4W4L B;  3HIU A;  2ZA6 A;  4ISM A;  5K52 A;  4DYZ A;  1UVH A;  3E6S A;  1JRE A;  3E1L A;  2VZB A;  3BT5 A;  4DZ0 A;  4RC6 A;  1S2Z A;  1UMN A;  3F33 A;  2ZA8 A;  4M35 A;  1ZS3 A;  1RCD A;  5JKL G;  4CMY V;  3PVY B;  2BK6 A;  3F39 A;  5JKM G;  4PGK A;  1DVB A;  4RC5 A;  1L8H A;  2PYB A;  3U90 A;  4LPJ A;  3F32 A;  2CN6 A;  2V2S A;  4MJY A;  2IY4 A;  2YJK A;  4TO9 A;  5FFB A;  1YV1 A;  2V2R A;  5CMQ A;  2JD7 0;  1F30 A;  3AF8 X;  4TOC A;  3RAV A;  3VV9 A;  2FZF A;  3R2M A;  3AJQ A;  3BVF A;  3FRS A;  3FVB A;  4LQJ A;  3C1Z A;  4MY7 A;  2FJC A;  2V2O A;  3Q4Q A;  2GYQ A;  4RC7 A;  3W54 A;  3LKD A;  3BVK A;  3E1M A;  2FL0 A;  3SH6 A;  2C2J A;  3GVY A;  2V2P A;  3QHB A;  1KRQ A;  4KVQ A;  2Z5Q A;  4RC6 B;  1LKP A;  2Z5R A;  3KDQ A;  3NP0 X;  2OH3 A;  2GS4 A;  5D8Y A;  2ITB A;  4CY9 A;  3UNO A;  1JKU A;  5HU6 D;  4RC5 B;  4EVC A;  4ZKH A;  2CLU A;  2F7N A;  1EUM A;  3PW1 B;  4TOE A;  5D8O A;  3TA8 A;  1J30 A;  2V2N A;  5HQO A;  3EZU A;  3GGZ A;  4YVZ A;  2X17 0;  2CWL A;  3PWQ C;  3KA4 A;  3R2R A;  4TOF A;  2FFX J;  4KVS A;  1MOJ A;  1O9R A;  4IWK A;  2HR5 A;  5JDO B;  3IS7 A;  2C6R A;  2XGW A;  2CLB A;  3QB9 A;  1LKO A;  3R2H A;  3N6O A;  3RE7 A;  3QVD A;  5HJH A;  4DAS A;  3PVY A;  3AK9 A;  2BW1 A;  2UX1 A;  5FFA A;  2CIH A;  5FFE A;  3BVE A;  3AF9 X;  3BKN A;  3ES3 A;  3GHQ A;  3E1Q A;  2D5K A;  4XKS A;  4DI0 A;  1MFR A;  5J8S A;  4XKT A;  5FFD A;  5HJF A;  2WTL A;  3SE1 A;  2XJM A;  3DBY A;  4EVD A;  4PG1 A;  1VLG A;  1QGH A;  3PW8 C;  3Q4N A;  1TKO A;  3A9Q A;  3WNW A;  2FG8 A;  1TKP A;  1IES A;  3RBC A;  5K53 A;  3E1P A;  4ISP A;  2V2M A;  2Y3Q A;  4II4 B;  3E1O A;  4QUW A;  3UFB A;  4E6K A;  1RCI A;  2WLU A;  2HTN A;  4XGS A;  1S3Q A;  5LS9 A;  2YJJ A;  3PW1 A;  1JI5 A;  1AEW A;  3FRR A;  3O7R A;  4Z5S A;  5GU2 X;  1VEL A;  3VVA A;  1XZ1 A;  4TOA A;  3A68 A;  1XZ3 A;  4MXP A;  4LQN A;  2ZA7 A;  5GU1 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...