3Q5MA

Crystal structure of escherichia coli bamd
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
222
structure length
210
Chain Sequence
ASKEEVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSRDPQHARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia coli BamD and its functional implications in outer membrane protein assembly
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
molecule keywords UPF0169 lipoprotein yfiO
total genus 81
structure length 210
sequence length 222
ec nomenclature
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13525 YfiO Outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3q5mA00
4JA7A 4WNGA 2AVPA 3CEQA 3SZ7A 3AS8A 3CVPA 3PE4A 4W9RA 5ARGA 4J8FA 2WQHA 5G05C 2XCBA 3UUXA 5C1DA 4G23A 3MEKA 2VQ2A 3NF1A 1Y8MA 3S7DA 4A1SA 2UWJG 4APOA 4BT9A 2C2LA 3EDTB 4GA1A 3LY9A 3Q49B 4G26A 5FT9A 2YHCA 3ASDA 2Q7FA 3S7BA 2P58C 3HYMB 4NQ0A 4U0UA 4B94A 4NRHB 2QFCA 4H7XA 1KLXA 4WNDA 4I2WA 4U0ZA 1A17A 3AS4A 3CV0A 3IEGA 2XEVA 4N3CA 2MHKA 3PE3A 5EKQD 3RO3A 5G04C 3TG5A 3U3WA 1HZ4A 4CDRA 2LSUA 5CCLA 2FF4A 3QDNA 4AY5A 2HO1A 3VTYA 5FJYA 4J0UA 4O6FA 4N2QA 3RO2A 4G24A 4AM9A 5LCWJ 2PQRA 4CGWA 3RKVA 3AS5A 2C0LA 2KCKA 2UY1A 3LYAA 5CCMA 2KATA 4GZ6A 4XIFA 3ASHA 4GCOA 4F3VA 2LSVA 2VGXA 5HQ8A 2Y4UA 4Y6WA 2J9QA 3QWPA 4JA9A 5CHEE 4UQZA 2LNIA 3ZN3A 2KC7A 3CK9A 3GYZA 4GA0A 1YA0A 3OXGA 3CK7A 4G25A 4G2VA 4KYOB 3UPVA 5HI7A 2V5FA 4GPKA 2KCVA 4GCNA 2BUGA 2L6JA 4BTAA 2PZIA 2XGSA 1B89A 2XGMA 1OUVA 4ME2A 4YNDA 2FO7A 2FBNA 2IF4A 4GYYA 5FZSA 5JJ6A 5BNWA 5KJKA 2VGXB 4N5CA 4UI9C 1HH8A 4UI9J 3TAXA 1XNFA 4YVOA 5DIZA 3KS2A 3BEEA 4XI0A 3CKBA 3ZPJA 4AY6A 2OOEA 3CVNA 3LCAA 3LY8A 5JJTA 3ZHEB 4I9CA 3CKCA 4I2ZA 2IFUA 2WPVA 4GYOA 5G04J 4GA2A 3MKRA 1KT1A 2HYZA 2VSYA 4HOUA 3GW4A 1WM5A 4XI9A 3OXFA 3QKYA 4U0SA 2Y4TA 4GYWA 3QWVA 2VSNA 2JLBA 5EX3A 2HR2A 5FTPA 1QQEA 3U4TA 4J8DA 3CVQA 1FCHA 1NA3A 3MV3B 4KBQA 3N71A 3ESKA 3CVLA 4U04A 1WAO1 3ASFA 5G05J 4HOQA 4BWRA 4IN3B 1NA0A 4KXKB 1ZBPA 2DBAA 2VYIA 5FZRA 5EX0A 3RU0A 4JHRA 3ASGA 3GZ2A 5D0OD 4HOSA 4Y6CA 4CGVA 4J8EA 4WUYA 5AYWD 4BT8A 1P5QA 4I9EA 3VTXA 4HORA 3ZHEA 1IYGA 1ELRA 2GW1A 3RIBA 3OXLA 3MV2B 3PDNA 3ULQA 2PL2A 3ZGQA 3O48A 2R5SA 4EQFA 1ELWA 2XGOA 4RG9A 1QZ2A 3FP3A 1PC2A 1TJCA 4WNEA 5ARFA 2NC9A 5A6CA 2FEZA 3MA5A 3Q47B 4GZ5A 5KJNA 3KAEA 3Q15A 5KJLA 2YQ8A 3E4BA 3Q4AB 3RJVA 3FWVA 3URZA 4N3AA 4UI9K 5KJMA 4WNFA 4HOTA 3K9IA 3TG4A 1NZNA 5BW8C 1KT0A 4RG6A 5D0QD 3UQ3A 2UY1B 2C0MA 4GZ3A 1HXIA 2XCCA 3LKUA 4BTBA 3TGOA 3FFLA 2VGYA 4H7YA 1E96B 4ABNA 4AIFA 3R9AB 3S7JA 4I1AA 5LCWC 3JYSA 2ONDA 4G1TA 4I17A 3QOUA 4UQXA 2FI7A 2E2EA 4JL0A 5FZQA 4N3BA 5A7DB 3SF4A 4U07A 3LPZA 4UQYA 3WXXA 1ZU2A 3ZFWA 5BT1A 4N2SA 5JJ7A 5DBKA 3S7FA 3QWWA 5M72A 3Q5MA 2KCLA 3CK8A 3LY7A 4LEUA 2I6HA 3KD7A 4N39A 2PQNA 4YVQC 2XPIA 3GZ1A 1W3BA 1IHGA
chains in the Genus database with same CATH superfamily
2BKGA 3EIQC 3L82A 5C1DA 5KNHD 2MYOA 1K8KG 2CFUA 1HO8A 2GROB 3U3WA 3DXKG 2CG3A 2OEWA 2P2CP 4DX7D 4N2QA 2PQRA 1TEZA 3D9HA 4O60A 2VGXA 5ANLA 2I1JA 2R03A 1K1AA 4GA0A 4CT0A 3EIJA 1OUVA 1H2VC 2NYJA 3U64A 4K0RA 5FWQA 2WPVA 3FTZA 2VSYA 1HFAA 1DC2A 4KBQA 4EECA 4LNGA 3FUKA 2J4BA 5D0OD 4U7EB 4BT8A 2GW1A 5KBAA 4C9BB 4GB9A 4NACA 2DYSE 3B7TA 2V0PA 3UIOC 5ARFA 4JEHA 2VJ8A 4GAAA 5A6CA 3R7QA 3Q4AB 3V30A 3QK0A 3HIZA 4HRNA 5CRUA 4AIFA 5IY5E 4FA6A 2XPIA 4OAUC 3UT4A 3CEQA 4W9RA 2ETCA 2I2OA 3MGBA 3RRNB 2VTBB 1K1BA 3EDTB 1SZ9A 5A23A 3S7BA 2A4ZA 2P9UG 2WMOA 1KLXA 3EHRA 5EKQD 1QYMA 3E34A 3HXBA 2IEJA 4G24A 1N9AA 3FEXA 4BSXA 5CCMA 3SI5A 3CVWA 1JPLA 1SA5A 4KYOB 2BUGA 2FBNA 2IF4A 4HLEA 3TAXA 3DSUA 4IYPA 5FQ8A 3DEPA 4OVVA 3QNKA 3IXEA 3UT8A 4BETA 3OXFA 1O1RA 4GMLA 4LNUD 5FTPA 2GGFA 1E90A 3MV3B 2WXRA 1TNUA 3MKQA 3ASFA 4J7WA 3RU0A 2VTBA 2DCPA 3JQ0A 1IYGA 2MRIA 3FUMA 2XRZA 3FH8A 4OYSA 1TJCA 5ENNA 4GTRA 3FWVA 5KJMA 4HOTA 1KT0A 3TGOA 4EZJA 4HI9A 2VGYA 1RZ4A 3R9MA 4I1AA 4F1SA 4UQXA 5ENSD 3AG1E 3T9KA 1INZA 3I5PA 3C3RA 4AJWA 1TN8A 4GZCA 1K3ZD 3UM1A 3I4GA 2QFCA 4AP2A 3Q7AA 4F1PA 3RRMB 1L5JA 5FJYA 4KVMA 3UKRG 1IXVA 1MX2A 3PNTB 2BF0X 4V3IA 3TXMA 1PAQA 2FO7A 4N5CA 4UI9C 4EBAA 5AJLA 4XEIG 4YVOA 3BG1B 5J90A 1TNBA 4U8YD 1TNZA 1UOHA 4TXQA 3CKCA 3PUJA 4HOUA 3GW4A 3QKYA 2WXHA 2H6IA 3CHQA 1MQSA 4J8DA 1FCHA 1PY1A 1HS6A 5AQ9A 5FQ7A 4DJAA 4HORA 3PDNA 3C5RA 5B1BE 4I6EA 2RG8A 2P9NG 4Q69A 2Y1LE 2XS1A 3Q73A 3JYSA 4CT4A 3PEUB 1LD8A 2IQCA 4U95D 3W9FA 3FTUA 1UN9A 2QC9A 5JMND 3ZYLA 2H6HA 3IV0A 3VLDA 4HB5A 3Q78A 5ENOD 2GRLA 3MEKA 1HF8A 5EIBE 3D3MA 4AXHA 3FH5A 4N3CA 2MHKA 3LVQE 4JVSA 2LSUA 2J07A 1O5MA 2R05A 2J8SD 4O1PA 1V54E 4UWKA 3V31A 1E7VA 2Y4UA 2RKKA 1OWPA 3OXGA 3UPVA 4HVBA 3G2VA 2WQ7A 3FUHA 3PZDA 2OCCE 3KSLA 5DIZA 1BU9A 4A63B 2ZU6B 3G2UA 5ENPD 3SY2A 4I9CA 3D9KA 3EJNA 4GYOA 3BQOA 4A55A 5HRYA 5AAOA 3EU5A 4K5BA 4BY6A 4EPZA 4QQIA 4LUNU 3N71A 4FJYA 2OVFA 2VYIA 1N0RA 4JHRA 3ASGA 1OCCE 2KM4A 4JZYA 3NAWA 2XGOA 2LAIA 3ZVVA 3FEYA 3GZSA 3KAEA 2A5EA 3K9IA 3MZLB 2X3MA 3LKUA 1KZOA 5AARA 5FZQA 3RRUA 2FI7A 3TWWA 4C48B 4I43A 4LERA 5DBKA 2PQNA 3S7DA 3UM2A 5C2YA 3L54A 1EF1C 1WDYA 2WM9A 2ETBA 2YHCA 2QYJA 4ZFHA 3IEGA 3CHPA 3AU5A 2IU1A 1JCQA 2FF4A 3HDXA 3CQCB 4AM9A 3L6AA 1N95A 3LJNA 4HRMB 4GCOA 3SBTB 3T5VA 5HQ8A 3ABME 2EIKE 4CDMA 3LXUX 3ZU7B 4G25A 5AQAA 1OWNA 2KCVA 5BV1A 2X6JA 1E8XA 5KJKA 4DRXE 5EILA 4ANUA 2OOEA 3CVNA 1BLXB 3LJ3A 4I2ZA 3MJWA 3L22A 4P29A 5G04J 2P9KG 2VSNA 4JW1A 5ENRD 1ZBPA 5FZRA 3DBSA 1FVHA 3O48A 2XENA 2WXKA 3FUFA 2NC9A 2Y69E 2YQ8A 3E4BA 4I6GA 3ZYKA 3U66A 2WXPA 3FTYA 1LF8A 4HBDA 4ABNA 4DLOA 4LCTA 3V2XA 4E85A 3ML8A 3MCXA 1VDYA 3HXFA 3QJZA 4N2SA 3C72A 4PS7A 5M72A 2PNNA 1SW6A 2IJGX 5G05C 4FHJA 1NFIE 1SZAA 4APOA 4MS6A 3QC1A 3E33A 3KSQA 3CIAA 3NOCD 2AXVA 2ETAA 3ZXSA 2CHWA 2H6FA 4CGWA 3UINC 2KZTA 3E32A 4HI8A 2XS8A 4O1OA 4JC8A 2WXMA 4JXTA 4J8SA 5HI7A 2L6JA 2XGSA 4Z68A 2XGMA 4GYYA 1O1SA 4I6JA 1MHQA 2VSXE 3DWLG 4GYWA 4BX9A 3VLFA 4HOQA 4F7AA 1NA0A 4HFGA 3GZ2A 2GRRB 3B95A 2WMNA 2R5SA 4XZ4A 3BUAA 3CHSA 2QYUA 2VGEA 4IULA 3L17A 4LSZE 2XZDG 3PS6A 4N5QA 3SFXA 2WQ6A 5D0QD 4GPMA 4GTVA 2C0MA 2P9PG 4FHKA 1E96B 1MX4A 2F37A 5ITZF 4WWNA 2Y3AA 3CVYA 5BT1A 5H7PA 1UN8A 1S64A 3LY7A 5CBNA 2I6HA 2MOWA 2PM7A 1RW2A 1W3BA 5B1AE 4JA7A 3AG4E 2AVPA 5D66A 4F6RD 4KVOA 3AS8A 3CVPA 1E8ZA 2VSOE 5G55A 4FJZA 3HYMB 4K5CA 3APFA 5FIOA 2DIWA 4CDRA 3ESLA 1BI8B 3QB2A 2HO1A 4ACLA 3EHQA 4NURA 5EDSA 1D9SA 3RKVA 3HXCA 4DPRA 4F3VA 5EIDA 1N11A 2LSVA 4Q96A 4Y6WA 4ILGA 3Q7FA 2NSZA 4GPKA 1U2VG 3SFYA 1XGWA 1LTXA 5JJ6A 3CVVA 2FULA 1XNFA 3T8KA 3BEEA 4L23A 3LY8A 4RVBA 4X8QA 1U3DA 5CEDB 3FTVA 1TJFA 4BESA 3DSXA 5ENQD 3ZEFA 5T3RA 3ISMC 4L2LA 1P5QA 3ABKE 4RG9A 1QZ2A 1ELKA 3FP3A 3ONKA 3FTXA 5CRVA 4U8HA 4WNFA 3TG4A 4G8LA 1DCEA 4D10C 3TWVA 5FQ4A 4AV7A 1S63A 3JCKC 4GTMA 4BT9A 4GA1A 1WY6A 4BERA 3PZ2A 4KMOA 3FTSA 4K03A 4I2WA 4WNDA 3BU8A 3TWQA 1TR4A 2B6CA 1OWOA 5BUZA 5HS0A 5LP0A 4JHKA 3TWUA 3QWPA 2M63A 4UWFA 2V5FA 2PZIA 1N0QA 5BNWA 1JWFA 2J09A 5T4YA 3SBSA 2ZXWE 2V8SE 3MYVA 2XHEA 1KT1A 4CYMD 4KZ0A 2HYZA 4M3OA 1H0AA 2HR2A 1OY3D 4PDXA 1NA3A 4XKBA 2IOSA 3TJPA 3FU3A 2PL2A 4EBAG 3CGHA 2P9IG 4JPSA 3HXEA 4C0EA 4CRWA 1E7UA 3OAWA 4XKCA 4H7YA 3ONLA 1N4RA 2LXLA 4MLPA 5BXOA 4UQYA 4HS2A 2V4LA 4YVQC 3TWSA 1BI7B 3E37A 1N4QA 3TWTA 3D9NA 4CCAA 4MKTA 3DSTA 4G23A 3V79K 2X38A 2J49A 2XPYA 3IBEA 3CV0A 1AP7A 5KWDA 1GW6A 2WVIA 2JEKA 5KCMA 3CQGB 3NQPA 3ZUVB 3IHYA 3BG0B 1OCOE 4XIFA 1V55E 3Q9UC 2RFAA 3RK6A 2KZTB 1OT8A 4OVUA 2KC7A 3TWXA 4WWOA 4U96D 2OEVA 3ZPJA 1JWGA 4A3TA 3QARA 5BV0A 4DX6D 4ILHB 2P9LG 4YDOA 1HG2A 5EX3A 2KBXA 3DSVA 3U4TA 4BFRA 2CG2A 1TNYA 3C98A 4Y6CA 4YDWA 3C3QA 2HE0A 2J08A 4XX5A 3MA5A 5KJNA 3URZA 2IOLA 2LUHA 1UW4B 4IRUA 4R7LA 3AU4A 4G1TA 3RAUA 3ZIMA 2AW6A 3LPZA 3ML9A 1JCRA 2GRQB 3AAAC 3CHMA 2KCLA 1H6PA 1IQUA 4CEMA 3CLJA 4DI3A 3UI2A 5AIJA 1S70B 3IKOB 1HE8A 4A1SA 3LY9A 5ENTD 4B94A 1A17A 2KXPC 2XEVA 2YINA 3R7RA 5LOZA 1X5BA 4DX5D 1KZPA 2UY1A 4JB8P 3PEVB 3ZRHA 4EHMA 3EHMA 5CHEE 2LNIA 2A5UA 3D9IA 4GCNA 4BTAA 2L6BA 4I1MA 1SQMA 2BEDA 4TUUA 4A3VA 1NI1A 4BEPA 1H6OA 3D9PA 3FULA 4DX2A 4LNBA 2XEHA 5G05J 1DCQA 4PUCA 3FH7A 4J8EA 1AWCB 3ULQA 2BKKB 4WNEA 4GZ5A 3Q15A 1G3NB 5BW8C 4BTBA 2IO2C 3UQ3A 2LXMA 4L2YA 4B0ZA 3R9AB 1SA4A 4AVXA 4JL0A 3P1UA 1MX6A 1Z5SC 2WXGA 1UG3A 3ABLE 4YDEA 1HX8A 3PE4A 5ARGA 3UUXA 2XCBA 3NBNB 3EU9A 2IO3C 3AG2E 2L0IA 2WXJA 2CFZA 2DZNA 3EHNA 3FUNA 3ZHEB 4ATGA 3TG5A 5G04C 1D8DA 1EYHA 4AY5A 3RO2A 5AJDA 5LCWJ 2R02A 3AS5A 2KATA 3G2SA 2H6GA 3CR3A 2CHZA 1Q2ZA 3T8MA 3F6QA 2I9CA 1HH8A 4UI9J 5AENA 4J8YA 4HLLA 3SHFA 5CERB 2IFUA 2GRMA 4GTPA 4OAVB 4CDNA 1DVPA 2JLBA 3CVQA 4GMRA 4AOFA 5AN8A 3MX3A 1NP7A 1OXJA 2DBAA 2QY7A 2YNQA 4KZCA 5LFAA 1ELRA 2X6HA 3ZGQA 3HHMA 4EZKA 4EQFA 4PH4B 4ANXA 4DLQA 3SQVA 5JHAA 3JXIA 1N54A 4HRLA 2UY1B 2F8YA 5LCWC 3JXJA 4UWHA 3SF4A 2E2EA 3HG0D 3L9TA 3WXXA 4N3BA 4JEUA 1IHBA 3ZFWA 2IONA 4GU5A 4ANVA 3CK8A 4GTOA 1N94A 1HU3A 4GZDA 3U9WA 4GTQA 3JQ1A 2DWZA 5BPPA 2P58C 4U0UA 4H7XA 4TXRA 1HZ4A 2R59A 1U3CA 2F0YA 4DX1A 3PRZA 3QAQA 4UWLA 3D9LA 1MJ0A 2EILE 4M7CA 2DVWA 3B7SA 2ZGGA 3PREA 3CK9A 3GYZA 4K5AB 3UIPC 3UKUG 1FT1A 1YA0A 3ZW3A 3G2TA 3KS2A 1UJJA 2R17C 4AEZC 2WB2A 2J4DA 4GA2A 1WM5A 4U0SA 3B7BA 1LD7A 3B7UX 4B93B 2RD0A 2XQ0A 2R2LA 4EZLA 3MV2B 4HXIA 5E76A 4TXPA 4URKA 3SNXA 1PC2A 5E75A 3X2QE 3UXGA 2OVBA 5KJLA 4RQIA 4XE0A 4CZ2D 4PS3A 1NZNA 1HXIA 3Q75A 1JCSA 3LVRE 4BX8A 3L16A 4I17A 2QZAA 5JJ7A 3CHOA 3D9OA 1TN7A 3LEWA 1BPOA 5JHBA 2HM8A 4C0MA 3WG7E 5CMWA 3G2WA 3Q49B 1BD8A 3KEZA 4NQ0A 4NRHB 4ACKA 4HNAD 3ULYA 2XPZA 4E6HA 5CBOA 4U8VD 3I3NA 3S2AA 5EYPF 2F8XK 4J0UA 3B13A 1WG0A 2KCKA 2LO6A 1O1TA 1FVFA 4F53A 2EQXA 4JA9A 3ZN3A 3DPDA 4DUIA 2Y0BG 2XEEA 1QBQA 4ATZD 3PZ3A 4AY6A 4WAFA 4XI0A 4LRZA 4JD2G 4ANWA 3D9JA 3FU0A 2WXNA 3CHRA 4ILIA 2RFMA 2ZISA 3J5PA 1TNOA 2V5QC 4HQDA 3HVEA 4G8KA 5EX0A 2YHEA 3RIBA 2FO1E 4B8CB 3HXDA 1OCZE 5AQBA 4N3AA 4GZ3A 2XCCA 1IQRA 3S7JA 3QOUA 5JA4D 1UJKA 5A7DB 3ASOE 3I4RB 3QWWA 4GMJA 3GZ1A 1IHGA 4L7TA 2WQHA 1HG5A 3O4ZA 1EDUA 3DEOA 4U63A 1Y8MA 4LG6A 2UWJG 2WXQA 4G26A 1N4PA 3CVUA 1H2UA 2NXPA 2CHXA 1Y6IA 3FUIA 3QDNA 3VTYA 2ILRA 2IY0C 3LYAA 3E30A 1YMPA 3FDHA 2X6FA 4FLBA 4A1GA 1Z6TA 4UQZA 4FLHA 4MBGA 2PM6A 3APDA 2WXIA 3PNLB 4G2VA 1S0PA 5J08A 5FZSA 3PZ1A 3NB2A 3CKBA 5JJTA 4G11A 1NL4A 4UUCA 1OWLA 3UMVA 5EYLA 3ZNGA 1YYHA 1IKND 3UTMA 1WAO1 4IN3B 4KXKB 2L0TB 4CGVA 3B7RL 4I9EA 5CMYA 3UM3A 1E8YA 1ELWA 2FEZA 3Q47B 5T8IA 2DYRE 4UI9K 3ENEA 4RG6A 3FHEA 4DI4A 4RLYA 4TRQA 3UM0A 4APFA 2JABA 3Q9NC 3Q5MA 4LEUA 3SD5A 4I1OB 1EPUA 3ULEG 2EINE 4J8FA 4MRUA 2VQ2A 3NF1A 4JHJA 1YCSB 3NOGD 2C2LA 4L9PA 4L1BA 4TUMA 3T5XA 3ZXPA 5FT9A 5B3SE 4GTTA 3FTWA 4U0ZA 2AJAA 4DK5A 2XZTG 2LAHA 3ZYMA 4YDYA 3CSTA 5CCLA 4J6IA 4NIKA 2AWIA 3TWRA 2X6KA 2XRYA 4TV3A 4GTSA 4O6FA 2E0IA 2C0LA 4GZ6A 3ASHA 3W9GA 3L08A 2J9QA 2P9SG 5FQ6A 3FU5A 3VLEA 4ME2A 3TXNA 3DSSA 3J5QB 1DNPA 5CEAA 4QFVA 3LCAA 1JUQA 3APCA 5D2MC 1TYQG 4XI9A 2Y4TA 3MKQB 3NZUA 2DZOA 2L9BA 3NZSA 1TN6A 1QQEA 1OWMA 5FINA 3OTNA 2ZGDA 3CVLA 4BWRA 3D9MA 2EIME 5AYWD 2WXFA 3VTXA 4FC8A 3OXLA 3L13A 2B0OE 3CSFA 1OCRE 3CVXA 1E8WA 3SFZA 3LDZA 1D8EA 1MZCA 4UWGA 3FUJA 1H19A 3FFLA 4ZHBA 1A5EA 3PVLA 5AQ7A 3FY4A 2ONDA 3ASNE 1N4SA 5EN5D 2I1KA 4U07A 5ANRA 3FUEA 3S7FA 3UT7A 2X6IA 4N39A 2GRPB 3KD7A 4WNGA 3SZ7A 1FPPA 2V4HC 4PS8A 3ASDA 3JUIA 2Q7FA 3DSWA 3LS8A 3UX4A 3RO3A 3AS4A 3AJIA 3EUVA 4FULA 3PE3A 4FP7A 1FT2A 1SVXA 1Z3YA 5G2NA 5LX8A 1N52A 3FUDA 3CK7A 4B8AA 3KEAA 1B89A 2BTDA 3DRAA 3V2OA 4B89A 4YNDA 5BXUA 2WXLA 2WXOA 2VGXB 1QNFA 2EIJE 1H2TC 3ZYQA 2AXUA 3MKRA 1Z3XA 2AXZA 3JUEA 3TL5A 2ZIRA 5CECB 1KPSB 3QWVA 1H6KA 4BSZB 4Q94A 3P2BA 4WWPA 2GRNB 3ESKA 3Q79A 4U04A 4FADA 3IHVA 4HOSA 4WUYA 4RSYA 3ZHEA 1X81A 3HVEB 3AG3E 2OV8A 4KT6B 3SO8A 5KNGA 3RJVA 3PZ4A 5HKPA 3PH0C 1MYOA 3FU6A 3ZKJA 3SGHA 3HRAA 1ZU2A 4FU3A 3DPYA 1ZB1A 3C3OA 3DXMG 3PUKA 3RSEG
chains in the Genus database with same CATH topology
3D9NA 3EIQC 5C2YA 3L54A 4CCAA 4MKTA 3LEWA 1BPOA 1EF1C 4G23A 5C1DA 5JHBA 2HM8A 2CFUA 4C0MA 5CMWA 2WM9A 2X38A 3G2WA 1HO8A 3Q49B 2YHCA 3KEZA 4NQ0A 2J49A 2XPYA 4NRHB 3IBEA 3CV0A 3IEGA 4ACKA 3U3WA 3CHPA 2XPZA 3AU5A 1GW6A 2IU1A 2CG3A 4E6HA 3I3NA 3S2AA 2FF4A 3HDXA 3CQCB 2WVIA 2JEKA 5KCMA 3CQGB 4J0UA 3NQPA 4N2QA 4AM9A 3IHYA 2PQRA 3B13A 3BG0B 2LO6A 2KCKA 3L6AA 1TEZA 4XIFA 1FVFA 4F53A 4GCOA 3SBTB 3T5VA 2VGXA 5ANLA 2EQXA 5HQ8A 2I1JA 3RK6A 4CDMA 4JA9A 3LXUX 3ZN3A 2KZTB 3DPDA 4OVUA 2KC7A 4GA0A 4CT0A 4G25A 4WWOA 3EIJA 1OWNA 2KCVA 5BV1A 2X6JA 1OUVA 1E8XA 1H2VC 5KJKA 4AY6A 3ZPJA 1JWGA 4XI0A 3QARA 4LRZA 4WAFA 4A3TA 2OOEA 3CVNA 4ANUA 4ANWA 3U64A 4K0RA 5BV0A 3LJ3A 3D9JA 3FU0A 4I2ZA 5FWQA 3MJWA 2WPVA 3L22A 3FTZA 4ILHB 4P29A 5G04J 2WXNA 3CHRA 2VSYA 4ILIA 1HG2A 1HFAA 2VSNA 5EX3A 4BFRA 3U4TA 4KBQA 4EECA 4JW1A 3FUKA 3HVEA 2J4BA 1ZBPA 2CG2A 5FZRA 5EX0A 5D0OD 2YHEA 3C98A 4Y6CA 4BT8A 3DBSA 3RIBA 2GW1A 1FVHA 3O48A 4GB9A 4NACA 3B7TA 4C9BB 2V0PA 4B8CB 2WXKA 5ARFA 2J08A 4JEHA 4XX5A 3FUFA 2NC9A 2VJ8A 4GAAA 5A6CA 3MA5A 3R7QA 5KJNA 2YQ8A 3E4BA 3Q4AB 4I6GA 3URZA 4N3AA 3ZYKA 3U66A 2IOLA 2WXPA 1UW4B 3FTYA 4GZ3A 2XCCA 4IRUA 1LF8A 3HIZA 3QK0A 4R7LA 4ABNA 4AIFA 4DLOA 4LCTA 3AU4A 1IQRA 4G1TA 3S7JA 3ZIMA 3ML8A 3QOUA 4E85A 3MCXA 1UJKA 5A7DB 2AW6A 3LPZA 1VDYA 3I4RB 4FA6A 3QJZA 4N2SA 4PS7A 3ML9A 3QWWA 4GMJA 5M72A 3CHMA 2KCLA 2XPIA 1IQUA 3GZ1A 1IHGA 4CEMA 3CLJA 2IJGX 3CEQA 4W9RA 3UT4A 4DI3A 5AIJA 4L7TA 2WQHA 1HG5A 2I2OA 3MGBA 3O4ZA 5G05C 1EDUA 3RRNB 3IKOB 4FHJA 1HE8A 1Y8MA 1SZAA 4U63A 2UWJG 4A1SA 4APOA 2VTBB 3EDTB 1SZ9A 2WXQA 3LY9A 4MS6A 4G26A 5A23A 3QC1A 3S7BA 3CVUA 2A4ZA 4B94A 2WMOA 1KLXA 1A17A 2XEVA 1H2UA 5EKQD 2NXPA 2YINA 3CIAA 3R7RA 2CHXA 1Y6IA 3FUIA 2AXVA 5LOZA 3ZXSA 3QDNA 3VTYA 1X5BA 2CHWA 4G24A 2ILRA 3FEXA 4BSXA 4CGWA 3LYAA 5CCMA 2UY1A 2KZTA 3SI5A 3CVWA 3FDHA 4A55A 3PEVB 1JPLA 3ZRHA 2X6FA 4FLBA 4A1GA 1Z6TA 3EHMA 5CHEE 4UQZA 2LNIA 4FLHA 4JC8A 2A5UA 2PM6A 2WXMA 4JXTA 3APDA 4J8SA 2WXIA 3D9IA 3PNLB 4G2VA 4KYOB 5HI7A 1S0PA 4GCNA 2BUGA 2L6JA 4BTAA 5J08A 2XGSA 2XGMA 5FZSA 4GYYA 2FBNA 2IF4A 4HLEA 4I1MA 3TAXA 1SQMA 3CKBA 4IYPA 5FQ8A 4I6JA 4TUUA 4OVVA 5JJTA 4G11A 3QNKA 1MHQA 1OWLA 4A3VA 2VSXE 3UMVA 3UT8A 3OXFA 4GYWA 4BX9A 3D9PA 4GMLA 3FULA 5FTPA 3VLFA 2GGFA 1E90A 3MV3B 2WXRA 3MKQA 1WAO1 3ASFA 5G05J 4HOQA 4PUCA 4IN3B 1NA0A 4HFGA 4KXKB 4F7AA 2L0TB 3RU0A 2VTBA 3FH7A 3GZ2A 2DCPA 4CGVA 4J8EA 3B7RL 4I9EA 3JQ0A 5CMYA 1IYGA 2MRIA 3ULQA 2WMNA 3FUMA 2R5SA 1E8YA 1ELWA 2XRZA 3FH8A 4OYSA 1TJCA 4WNEA 4XZ4A 3CHSA 2FEZA 3Q47B 5T8IA 4GZ5A 4IULA 3L17A 3Q15A 5ENNA 3PS6A 3FWVA 4UI9K 5KJMA 2WQ6A 4HOTA 3ENEA 5BW8C 1KT0A 4RG6A 5D0QD 3FHEA 3UQ3A 2C0MA 4BTBA 4DI4A 4EZJA 3TGOA 4L2YA 2VGYA 4FHKA 1E96B 4TRQA 4B0ZA 3R9AB 4I1AA 4AVXA 4WWNA 4F1SA 2Y3AA 4UQXA 3CVYA 4JL0A 3P1UA 4APFA 5BT1A 1UN8A 2WXGA 1UG3A 3Q5MA 3LY7A 4LEUA 2I6HA 2MOWA 3SD5A 2PM7A 4I1OB 1INZA 1W3BA 1EPUA 3I5PA 1HX8A 4JA7A 2AVPA 4AJWA 4KVOA 3AS8A 3CVPA 3PE4A 1E8ZA 5ARGA 4J8FA 2VSOE 3UUXA 2XCBA 4EZKA 4GZCA 4MRUA 2VQ2A 3NF1A 4JHJA 5G55A 4L1BA 2C2LA 2L0IA 2WXJA 2CFZA 3T5XA 5FT9A 4FJZA 3I4GA 3HYMB 2QFCA 3EHNA 3APFA 3FTWA 2DIWA 3FUNA 4U0ZA 3ZHEB 4AP2A 4ATGA 3TG5A 5G04C 4DK5A 4CDRA 2LAHA 3RRMB 3ZYMA 3ESLA 1EYHA 3CSTA 5CCLA 4J6IA 3QB2A 2AWIA 4AY5A 2HO1A 2X6KA 2XRYA 1L5JA 4TV3A 5FJYA 4ACLA 4O6FA 3RO2A 5AJDA 4NURA 5EDSA 2E0IA 5LCWJ 4KVMA 3RKVA 3AS5A 2C0LA 2KATA 4GZ6A 3ASHA 4DPRA 4F3VA 3G2SA 2LSVA 3L08A 4Q96A 4Y6WA 2J9QA 3PNTB 4ILGA 3CR3A 2NSZA 2BF0X 4V3IA 5FQ6A 3FU5A 3TXMA 4GPKA 2CHZA 3T8MA 3VLEA 1PAQA 1XGWA 4ME2A 2I9CA 2FO7A 5JJ6A 3TXNA 3CVVA 4N5CA 2FULA 4UI9C 1HH8A 4UI9J 5AJLA 4EBAA 1XNFA 1DNPA 3BG1B 4YVOA 3BEEA 4L23A 5AENA 4QFVA 5J90A 3LY8A 3LCAA 4RVBA 3CKCA 1JUQA 3APCA 3PUJA 3SHFA 1U3DA 2IFUA 3FTVA 1TJFA 2GRMA 4HOUA 3GW4A 4CDNA 4XI9A 3QKYA 2WXHA 1DVPA 2Y4TA 3MKQB 3NZUA 2L9BA 2JLBA 3NZSA 3CHQA 1QQEA 1OWMA 3ZEFA 1MQSA 3CVQA 1FCHA 4J8DA 1PY1A 3OTNA 5T3RA 4AOFA 3CVLA 3MX3A 4BWRA 2WQ7A 1HS6A 1NP7A 2QY7A 2DBAA 2YNQA 5FQ7A 4DJAA 4L2LA 3D9MA 4KZCA 5AYWD 2WXFA 1P5QA 3VTXA 4HORA 5LFAA 4FC8A 1ELRA 3OXLA 2X6HA 3PDNA 3ZGQA 3HHMA 4I6EA 3L13A 4EQFA 4PH4B 4ANXA 4RG9A 4DLQA 1QZ2A 1ELKA 3FP3A 3ONKA 3FTXA 3CSFA 3CVXA 5JHAA 1E8WA 4U8HA 2RG8A 3LDZA 3SFZA 4UWGA 4Q69A 4WNFA 1N54A 3FUJA 3TG4A 2UY1B 1H19A 3FFLA 3PVLA 5LCWC 3FY4A 3JYSA 2ONDA 4UWHA 4CT4A 3SF4A 2E2EA 4D10C 4N3BA 2I1KA 3PEUB 4JEUA 4U07A 3WXXA 5ANRA 2IQCA 3FUEA 5FQ4A 3ZFWA 3FTUA 1UN9A 2IONA 4GU5A 3S7FA 3UT7A 4AV7A 4ANVA 2X6IA 3CK8A 4N39A 3KD7A 3ZYLA 3IV0A 4WNGA 3VLDA 3SZ7A 3JCKC 1HU3A 2GRLA 4GZDA 3MEKA 3U9WA 4GA1A 4PS8A 4BT9A 3JQ1A 1WY6A 1HF8A 3ASDA 5BPPA 3JUIA 2Q7FA 3LS8A 2P58C 3D3MA 4KMOA 4U0UA 3UX4A 4AXHA 4H7XA 3FH5A 3FTSA 4K03A 4I2WA 4WNDA 3RO3A 3AS4A 4FULA 4N3CA 2MHKA 3PE3A 3LVQE 4JVSA 1HZ4A 2R59A 4FP7A 1OWOA 5BUZA 2LSUA 1U3CA 1Z3YA 5G2NA 2J07A 5LP0A 3PRZA 3QAQA 4UWLA 3D9LA 5LX8A 4JHKA 1N52A 4UWKA 1E7VA 3B7SA 2Y4UA 3FUDA 3QWPA 1OWPA 3PREA 2M63A 3CK9A 3GYZA 1YA0A 3OXGA 3CK7A 3UPVA 4UWFA 2V5FA 4HVBA 4B8AA 2PZIA 1B89A 2BTDA 3G2VA 4B89A 4YNDA 5BNWA 3FUHA 1JWFA 2WXLA 2WXOA 3PZDA 3G2TA 3ZW3A 2VGXB 5DIZA 1QNFA 3KS2A 1UJJA 2J09A 5T4YA 2ZU6B 2R17C 3SBSA 3G2UA 4AEZC 1H2TC 2V8SE 4I9CA 3ZYQA 3D9KA 3EJNA 3MYVA 2WB2A 2AXUA 4GYOA 2J4DA 2XHEA 1KT1A 3MKRA 4GA2A 1Z3XA 2AXZA 2HYZA 4KZ0A 3TL5A 1WM5A 4M3OA 4U0SA 1H0AA 3QWVA 1H6KA 4BY6A 2HR2A 4Q94A 3P2BA 4PDXA 4WWPA 3B7UX 4EPZA 1NA3A 4LUNU 3N71A 3ESKA 4XKBA 4U04A 4FJYA 2OVFA 2IOSA 2VYIA 2RD0A 4FADA 2XQ0A 3ASGA 3IHVA 4JHRA 4HOSA 4WUYA 4RSYA 3ZHEA 3TJPA 2KM4A 3FU3A 3HVEB 4EZLA 3MV2B 4HXIA 2PL2A 4EBAG 4JZYA 5E76A 3CGHA 2XGOA 3SNXA 4URKA 4JPSA 1PC2A 5E75A 2OV8A 2LAIA 2OVBA 4C0EA 3ZVVA 3FEYA 3GZSA 4KT6B 3KAEA 5KJLA 3RJVA 4CRWA 4XE0A 3PH0C 3K9IA 4PS3A 1NZNA 3MZLB 1HXIA 1E7UA 2X3MA 3LKUA 3OAWA 4XKCA 3FU6A 4H7YA 3ONLA 3LVRE 4BX8A 3L16A 4I17A 3SGHA 5FZQA 4MLPA 2FI7A 3RRUA 4UQYA 1ZU2A 4I43A 4LERA 4HS2A 4FU3A 5JJ7A 5DBKA 2V4LA 3CHOA 4YVQC 3PUKA 3D9OA 2PQNA 3S7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JA7 A;  4WNG A;  2AVP A;  3CEQ A;  3SZ7 A;  3AS8 A;  3CVP A;  3PE4 A;  4W9R A;  5ARG A;  4J8F A;  2WQH A;  5G05 C;  2XCB A;  3UUX A;  5C1D A;  4G23 A;  3MEK A;  2VQ2 A;  3NF1 A;  1Y8M A;  3S7D A;  4A1S A;  2UWJ G;  4APO A;  4BT9 A;  2C2L A;  3EDT B;  4GA1 A;  3LY9 A;  3Q49 B;  4G26 A;  5FT9 A;  2YHC A;  3ASD A;  2Q7F A;  3S7B A;  2P58 C;  3HYM B;  4NQ0 A;  4U0U A;  4B94 A;  4NRH B;  2QFC A;  4H7X A;  1KLX A;  4WND A;  4I2W A;  4U0Z A;  1A17 A;  3AS4 A;  3CV0 A;  3IEG A;  2XEV A;  4N3C A;  2MHK A;  3PE3 A;  5EKQ D;  3RO3 A;  5G04 C;  3TG5 A;  3U3W A;  1HZ4 A;  4CDR A;  2LSU A;  5CCL A;  2FF4 A;  3QDN A;  4AY5 A;  2HO1 A;  3VTY A;  5FJY A;  4J0U A;  4O6F A;  4N2Q A;  3RO2 A;  4G24 A;  4AM9 A;  5LCW J;  2PQR A;  4CGW A;  3RKV A;  3AS5 A;  2C0L A;  2KCK A;  2UY1 A;  3LYA A;  5CCM A;  2KAT A;  4GZ6 A;  4XIF A;  3ASH A;  4GCO A;  4F3V A;  2LSV A;  2VGX A;  5HQ8 A;  2Y4U A;  4Y6W A;  2J9Q A;  3QWP A;  4JA9 A;  5CHE E;  4UQZ A;  2LNI A;  3ZN3 A;  2KC7 A;  3CK9 A;  3GYZ A;  4GA0 A;  1YA0 A;  3OXG A;  3CK7 A;  4G25 A;  4G2V A;  4KYO B;  3UPV A;  5HI7 A;  2V5F A;  4GPK A;  2KCV A;  4GCN A;  2BUG A;  2L6J A;  4BTA A;  2PZI A;  2XGS A;  1B89 A;  2XGM A;  1OUV A;  4ME2 A;  4YND A;  2FO7 A;  2FBN A;  2IF4 A;  4GYY A;  5FZS A;  5JJ6 A;  5BNW A;  5KJK A;  2VGX B;  4N5C A;  4UI9 C;  1HH8 A;  4UI9 J;  3TAX A;  1XNF A;  4YVO A;  5DIZ A;  3KS2 A;  3BEE A;  4XI0 A;  3CKB A;  3ZPJ A;  4AY6 A;  2OOE A;  3CVN A;  3LCA A;  3LY8 A;  5JJT A;  3ZHE B;  4I9C A;  3CKC A;  4I2Z A;  2IFU A;  2WPV A;  4GYO A;  5G04 J;  4GA2 A;  3MKR A;  1KT1 A;  2HYZ A;  2VSY A;  4HOU A;  3GW4 A;  1WM5 A;  4XI9 A;  3OXF A;  3QKY A;  4U0S A;  2Y4T A;  4GYW A;  3QWV A;  2VSN A;  2JLB A;  5EX3 A;  2HR2 A;  5FTP A;  1QQE A;  3U4T A;  4J8D A;  3CVQ A;  1FCH A;  1NA3 A;  3MV3 B;  4KBQ A;  3N71 A;  3ESK A;  3CVL A;  4U04 A;  1WAO 1;  3ASF A;  5G05 J;  4HOQ A;  4BWR A;  4IN3 B;  1NA0 A;  4KXK B;  1ZBP A;  2DBA A;  2VYI A;  5FZR A;  5EX0 A;  3RU0 A;  4JHR A;  3ASG A;  3GZ2 A;  5D0O D;  4HOS A;  4Y6C A;  4CGV A;  4J8E A;  4WUY A;  5AYW D;  4BT8 A;  1P5Q A;  4I9E A;  3VTX A;  4HOR A;  3ZHE A;  1IYG A;  1ELR A;  2GW1 A;  3RIB A;  3OXL A;  3MV2 B;  3PDN A;  3ULQ A;  2PL2 A;  3ZGQ A;  3O48 A;  2R5S A;  4EQF A;  1ELW A;  2XGO A;  4RG9 A;  1QZ2 A;  3FP3 A;  1PC2 A;  1TJC A;  4WNE A;  5ARF A;  2NC9 A;  5A6C A;  2FEZ A;  3MA5 A;  3Q47 B;  4GZ5 A;  5KJN A;  3KAE A;  3Q15 A;  5KJL A;  2YQ8 A;  3E4B A;  3Q4A B;  3RJV A;  3FWV A;  3URZ A;  4N3A A;  4UI9 K;  5KJM A;  4WNF A;  4HOT A;  3K9I A;  3TG4 A;  1NZN A;  5BW8 C;  1KT0 A;  4RG6 A;  5D0Q D;  3UQ3 A;  2UY1 B;  2C0M A;  4GZ3 A;  1HXI A;  2XCC A;  3LKU A;  4BTB A;  3TGO A;  3FFL A;  2VGY A;  4H7Y A;  1E96 B;  4ABN A;  4AIF A;  3R9A B;  3S7J A;  4I1A A;  5LCW C;  3JYS A;  2OND A;  4G1T A;  4I17 A;  3QOU A;  4UQX A;  2FI7 A;  2E2E A;  4JL0 A;  5FZQ A;  4N3B A;  5A7D B;  3SF4 A;  4U07 A;  3LPZ A;  4UQY A;  3WXX A;  1ZU2 A;  3ZFW A;  5BT1 A;  4N2S A;  5JJ7 A;  5DBK A;  3S7F A;  3QWW A;  5M72 A;  3Q5M A;  2KCL A;  3CK8 A;  3LY7 A;  4LEU A;  2I6H A;  3KD7 A;  4N39 A;  2PQN A;  4YVQ C;  2XPI A;  3GZ1 A;  1W3B A;  1IHG A; 
#chains in the Genus database with same CATH topology
 2BKG A;  3EIQ C;  3L82 A;  5C1D A;  5KNH D;  2MYO A;  1K8K G;  2CFU A;  1HO8 A;  2GRO B;  3U3W A;  3DXK G;  2CG3 A;  2OEW A;  2P2C P;  4DX7 D;  4N2Q A;  2PQR A;  1TEZ A;  3D9H A;  4O60 A;  2VGX A;  5ANL A;  2I1J A;  2R03 A;  1K1A A;  4GA0 A;  4CT0 A;  3EIJ A;  1OUV A;  1H2V C;  2NYJ A;  3U64 A;  4K0R A;  5FWQ A;  2WPV A;  3FTZ A;  2VSY A;  1HFA A;  1DC2 A;  4KBQ A;  4EEC A;  4LNG A;  3FUK A;  2J4B A;  5D0O D;  4U7E B;  4BT8 A;  2GW1 A;  5KBA A;  4C9B B;  4GB9 A;  4NAC A;  2DYS E;  3B7T A;  2V0P A;  3UIO C;  5ARF A;  4JEH A;  2VJ8 A;  4GAA A;  5A6C A;  3R7Q A;  3Q4A B;  3V30 A;  3QK0 A;  3HIZ A;  4HRN A;  5CRU A;  4AIF A;  5IY5 E;  4FA6 A;  2XPI A;  4OAU C;  3UT4 A;  3CEQ A;  4W9R A;  2ETC A;  2I2O A;  3MGB A;  3RRN B;  2VTB B;  1K1B A;  3EDT B;  1SZ9 A;  5A23 A;  3S7B A;  2A4Z A;  2P9U G;  2WMO A;  1KLX A;  3EHR A;  5EKQ D;  1QYM A;  3E34 A;  3HXB A;  2IEJ A;  4G24 A;  1N9A A;  3FEX A;  4BSX A;  5CCM A;  3SI5 A;  3CVW A;  1JPL A;  1SA5 A;  4KYO B;  2BUG A;  2FBN A;  2IF4 A;  4HLE A;  3TAX A;  3DSU A;  4IYP A;  5FQ8 A;  3DEP A;  4OVV A;  3QNK A;  3IXE A;  3UT8 A;  4BET A;  3OXF A;  1O1R A;  4GML A;  4LNU D;  5FTP A;  2GGF A;  1E90 A;  3MV3 B;  2WXR A;  1TNU A;  3MKQ A;  3ASF A;  4J7W A;  3RU0 A;  2VTB A;  2DCP A;  3JQ0 A;  1IYG A;  2MRI A;  3FUM A;  2XRZ A;  3FH8 A;  4OYS A;  1TJC A;  5ENN A;  4GTR A;  3FWV A;  5KJM A;  4HOT A;  1KT0 A;  3TGO A;  4EZJ A;  4HI9 A;  2VGY A;  1RZ4 A;  3R9M A;  4I1A A;  4F1S A;  4UQX A;  5ENS D;  3AG1 E;  3T9K A;  1INZ A;  3I5P A;  3C3R A;  4AJW A;  1TN8 A;  4GZC A;  1K3Z D;  3UM1 A;  3I4G A;  2QFC A;  4AP2 A;  3Q7A A;  4F1P A;  3RRM B;  1L5J A;  5FJY A;  4KVM A;  3UKR G;  1IXV A;  1MX2 A;  3PNT B;  2BF0 X;  4V3I A;  3TXM A;  1PAQ A;  2FO7 A;  4N5C A;  4UI9 C;  4EBA A;  5AJL A;  4XEI G;  4YVO A;  3BG1 B;  5J90 A;  1TNB A;  4U8Y D;  1TNZ A;  1UOH A;  4TXQ A;  3CKC A;  3PUJ A;  4HOU A;  3GW4 A;  3QKY A;  2WXH A;  2H6I A;  3CHQ A;  1MQS A;  4J8D A;  1FCH A;  1PY1 A;  1HS6 A;  5AQ9 A;  5FQ7 A;  4DJA A;  4HOR A;  3PDN A;  3C5R A;  5B1B E;  4I6E A;  2RG8 A;  2P9N G;  4Q69 A;  2Y1L E;  2XS1 A;  3Q73 A;  3JYS A;  4CT4 A;  3PEU B;  1LD8 A;  2IQC A;  4U95 D;  3W9F A;  3FTU A;  1UN9 A;  2QC9 A;  5JMN D;  3ZYL A;  2H6H A;  3IV0 A;  3VLD A;  4HB5 A;  3Q78 A;  5ENO D;  2GRL A;  3MEK A;  1HF8 A;  5EIB E;  3D3M A;  4AXH A;  3FH5 A;  4N3C A;  2MHK A;  3LVQ E;  4JVS A;  2LSU A;  2J07 A;  1O5M A;  2R05 A;  2J8S D;  4O1P A;  1V54 E;  4UWK A;  3V31 A;  1E7V A;  2Y4U A;  2RKK A;  1OWP A;  3OXG A;  3UPV A;  4HVB A;  3G2V A;  2WQ7 A;  3FUH A;  3PZD A;  2OCC E;  3KSL A;  5DIZ A;  1BU9 A;  4A63 B;  2ZU6 B;  3G2U A;  5ENP D;  3SY2 A;  4I9C A;  3D9K A;  3EJN A;  4GYO A;  3BQO A;  4A55 A;  5HRY A;  5AAO A;  3EU5 A;  4K5B A;  4BY6 A;  4EPZ A;  4QQI A;  4LUN U;  3N71 A;  4FJY A;  2OVF A;  2VYI A;  1N0R A;  4JHR A;  3ASG A;  1OCC E;  2KM4 A;  4JZY A;  3NAW A;  2XGO A;  2LAI A;  3ZVV A;  3FEY A;  3GZS A;  3KAE A;  2A5E A;  3K9I A;  3MZL B;  2X3M A;  3LKU A;  1KZO A;  5AAR A;  5FZQ A;  3RRU A;  2FI7 A;  3TWW A;  4C48 B;  4I43 A;  4LER A;  5DBK A;  2PQN A;  3S7D A;  3UM2 A;  5C2Y A;  3L54 A;  1EF1 C;  1WDY A;  2WM9 A;  2ETB A;  2YHC A;  2QYJ A;  4ZFH A;  3IEG A;  3CHP A;  3AU5 A;  2IU1 A;  1JCQ A;  2FF4 A;  3HDX A;  3CQC B;  4AM9 A;  3L6A A;  1N95 A;  3LJN A;  4HRM B;  4GCO A;  3SBT B;  3T5V A;  5HQ8 A;  3ABM E;  2EIK E;  4CDM A;  3LXU X;  3ZU7 B;  4G25 A;  5AQA A;  1OWN A;  2KCV A;  5BV1 A;  2X6J A;  1E8X A;  5KJK A;  4DRX E;  5EIL A;  4ANU A;  2OOE A;  3CVN A;  1BLX B;  3LJ3 A;  4I2Z A;  3MJW A;  3L22 A;  4P29 A;  5G04 J;  2P9K G;  2VSN A;  4JW1 A;  5ENR D;  1ZBP A;  5FZR A;  3DBS A;  1FVH A;  3O48 A;  2XEN A;  2WXK A;  3FUF A;  2NC9 A;  2Y69 E;  2YQ8 A;  3E4B A;  4I6G A;  3ZYK A;  3U66 A;  2WXP A;  3FTY A;  1LF8 A;  4HBD A;  4ABN A;  4DLO A;  4LCT A;  3V2X A;  4E85 A;  3ML8 A;  3MCX A;  1VDY A;  3HXF A;  3QJZ A;  4N2S A;  3C72 A;  4PS7 A;  5M72 A;  2PNN A;  1SW6 A;  2IJG X;  5G05 C;  4FHJ A;  1NFI E;  1SZA A;  4APO A;  4MS6 A;  3QC1 A;  3E33 A;  3KSQ A;  3CIA A;  3NOC D;  2AXV A;  2ETA A;  3ZXS A;  2CHW A;  2H6F A;  4CGW A;  3UIN C;  2KZT A;  3E32 A;  4HI8 A;  2XS8 A;  4O1O A;  4JC8 A;  2WXM A;  4JXT A;  4J8S A;  5HI7 A;  2L6J A;  2XGS A;  4Z68 A;  2XGM A;  4GYY A;  1O1S A;  4I6J A;  1MHQ A;  2VSX E;  3DWL G;  4GYW A;  4BX9 A;  3VLF A;  4HOQ A;  4F7A A;  1NA0 A;  4HFG A;  3GZ2 A;  2GRR B;  3B95 A;  2WMN A;  2R5S A;  4XZ4 A;  3BUA A;  3CHS A;  2QYU A;  2VGE A;  4IUL A;  3L17 A;  4LSZ E;  2XZD G;  3PS6 A;  4N5Q A;  3SFX A;  2WQ6 A;  5D0Q D;  4GPM A;  4GTV A;  2C0M A;  2P9P G;  4FHK A;  1E96 B;  1MX4 A;  2F37 A;  5ITZ F;  4WWN A;  2Y3A A;  3CVY A;  5BT1 A;  5H7P A;  1UN8 A;  1S64 A;  3LY7 A;  5CBN A;  2I6H A;  2MOW A;  2PM7 A;  1RW2 A;  1W3B A;  5B1A E;  4JA7 A;  3AG4 E;  2AVP A;  5D66 A;  4F6R D;  4KVO A;  3AS8 A;  3CVP A;  1E8Z A;  2VSO E;  5G55 A;  4FJZ A;  3HYM B;  4K5C A;  3APF A;  5FIO A;  2DIW A;  4CDR A;  3ESL A;  1BI8 B;  3QB2 A;  2HO1 A;  4ACL A;  3EHQ A;  4NUR A;  5EDS A;  1D9S A;  3RKV A;  3HXC A;  4DPR A;  4F3V A;  5EID A;  1N11 A;  2LSV A;  4Q96 A;  4Y6W A;  4ILG A;  3Q7F A;  2NSZ A;  4GPK A;  1U2V G;  3SFY A;  1XGW A;  1LTX A;  5JJ6 A;  3CVV A;  2FUL A;  1XNF A;  3T8K A;  3BEE A;  4L23 A;  3LY8 A;  4RVB A;  4X8Q A;  1U3D A;  5CED B;  3FTV A;  1TJF A;  4BES A;  3DSX A;  5ENQ D;  3ZEF A;  5T3R A;  3ISM C;  4L2L A;  1P5Q A;  3ABK E;  4RG9 A;  1QZ2 A;  1ELK A;  3FP3 A;  3ONK A;  3FTX A;  5CRV A;  4U8H A;  4WNF A;  3TG4 A;  4G8L A;  1DCE A;  4D10 C;  3TWV A;  5FQ4 A;  4AV7 A;  1S63 A;  3JCK C;  4GTM A;  4BT9 A;  4GA1 A;  1WY6 A;  4BER A;  3PZ2 A;  4KMO A;  3FTS A;  4K03 A;  4I2W A;  4WND A;  3BU8 A;  3TWQ A;  1TR4 A;  2B6C A;  1OWO A;  5BUZ A;  5HS0 A;  5LP0 A;  4JHK A;  3TWU A;  3QWP A;  2M63 A;  4UWF A;  2V5F A;  2PZI A;  1N0Q A;  5BNW A;  1JWF A;  2J09 A;  5T4Y A;  3SBS A;  2ZXW E;  2V8S E;  3MYV A;  2XHE A;  1KT1 A;  4CYM D;  4KZ0 A;  2HYZ A;  4M3O A;  1H0A A;  2HR2 A;  1OY3 D;  4PDX A;  1NA3 A;  4XKB A;  2IOS A;  3TJP A;  3FU3 A;  2PL2 A;  4EBA G;  3CGH A;  2P9I G;  4JPS A;  3HXE A;  4C0E A;  4CRW A;  1E7U A;  3OAW A;  4XKC A;  4H7Y A;  3ONL A;  1N4R A;  2LXL A;  4MLP A;  5BXO A;  4UQY A;  4HS2 A;  2V4L A;  4YVQ C;  3TWS A;  1BI7 B;  3E37 A;  1N4Q A;  3TWT A;  3D9N A;  4CCA A;  4MKT A;  3DST A;  4G23 A;  3V79 K;  2X38 A;  2J49 A;  2XPY A;  3IBE A;  3CV0 A;  1AP7 A;  5KWD A;  1GW6 A;  2WVI A;  2JEK A;  5KCM A;  3CQG B;  3NQP A;  3ZUV B;  3IHY A;  3BG0 B;  1OCO E;  4XIF A;  1V55 E;  3Q9U C;  2RFA A;  3RK6 A;  2KZT B;  1OT8 A;  4OVU A;  2KC7 A;  3TWX A;  4WWO A;  4U96 D;  2OEV A;  3ZPJ A;  1JWG A;  4A3T A;  3QAR A;  5BV0 A;  4DX6 D;  4ILH B;  2P9L G;  4YDO A;  1HG2 A;  5EX3 A;  2KBX A;  3DSV A;  3U4T A;  4BFR A;  2CG2 A;  1TNY A;  3C98 A;  4Y6C A;  4YDW A;  3C3Q A;  2HE0 A;  2J08 A;  4XX5 A;  3MA5 A;  5KJN A;  3URZ A;  2IOL A;  2LUH A;  1UW4 B;  4IRU A;  4R7L A;  3AU4 A;  4G1T A;  3RAU A;  3ZIM A;  2AW6 A;  3LPZ A;  3ML9 A;  1JCR A;  2GRQ B;  3AAA C;  3CHM A;  2KCL A;  1H6P A;  1IQU A;  4CEM A;  3CLJ A;  4DI3 A;  3UI2 A;  5AIJ A;  1S70 B;  3IKO B;  1HE8 A;  4A1S A;  3LY9 A;  5ENT D;  4B94 A;  1A17 A;  2KXP C;  2XEV A;  2YIN A;  3R7R A;  5LOZ A;  1X5B A;  4DX5 D;  1KZP A;  2UY1 A;  4JB8 P;  3PEV B;  3ZRH A;  4EHM A;  3EHM A;  5CHE E;  2LNI A;  2A5U A;  3D9I A;  4GCN A;  4BTA A;  2L6B A;  4I1M A;  1SQM A;  2BED A;  4TUU A;  4A3V A;  1NI1 A;  4BEP A;  1H6O A;  3D9P A;  3FUL A;  4DX2 A;  4LNB A;  2XEH A;  5G05 J;  1DCQ A;  4PUC A;  3FH7 A;  4J8E A;  1AWC B;  3ULQ A;  2BKK B;  4WNE A;  4GZ5 A;  3Q15 A;  1G3N B;  5BW8 C;  4BTB A;  2IO2 C;  3UQ3 A;  2LXM A;  4L2Y A;  4B0Z A;  3R9A B;  1SA4 A;  4AVX A;  4JL0 A;  3P1U A;  1MX6 A;  1Z5S C;  2WXG A;  1UG3 A;  3ABL E;  4YDE A;  1HX8 A;  3PE4 A;  5ARG A;  3UUX A;  2XCB A;  3NBN B;  3EU9 A;  2IO3 C;  3AG2 E;  2L0I A;  2WXJ A;  2CFZ A;  2DZN A;  3EHN A;  3FUN A;  3ZHE B;  4ATG A;  3TG5 A;  5G04 C;  1D8D A;  1EYH A;  4AY5 A;  3RO2 A;  5AJD A;  5LCW J;  2R02 A;  3AS5 A;  2KAT A;  3G2S A;  2H6G A;  3CR3 A;  2CHZ A;  1Q2Z A;  3T8M A;  3F6Q A;  2I9C A;  1HH8 A;  4UI9 J;  5AEN A;  4J8Y A;  4HLL A;  3SHF A;  5CER B;  2IFU A;  2GRM A;  4GTP A;  4OAV B;  4CDN A;  1DVP A;  2JLB A;  3CVQ A;  4GMR A;  4AOF A;  5AN8 A;  3MX3 A;  1NP7 A;  1OXJ A;  2DBA A;  2QY7 A;  2YNQ A;  4KZC A;  5LFA A;  1ELR A;  2X6H A;  3ZGQ A;  3HHM A;  4EZK A;  4EQF A;  4PH4 B;  4ANX A;  4DLQ A;  3SQV A;  5JHA A;  3JXI A;  1N54 A;  4HRL A;  2UY1 B;  2F8Y A;  5LCW C;  3JXJ A;  4UWH A;  3SF4 A;  2E2E A;  3HG0 D;  3L9T A;  3WXX A;  4N3B A;  4JEU A;  1IHB A;  3ZFW A;  2ION A;  4GU5 A;  4ANV A;  3CK8 A;  4GTO A;  1N94 A;  1HU3 A;  4GZD A;  3U9W A;  4GTQ A;  3JQ1 A;  2DWZ A;  5BPP A;  2P58 C;  4U0U A;  4H7X A;  4TXR A;  1HZ4 A;  2R59 A;  1U3C A;  2F0Y A;  4DX1 A;  3PRZ A;  3QAQ A;  4UWL A;  3D9L A;  1MJ0 A;  2EIL E;  4M7C A;  2DVW A;  3B7S A;  2ZGG A;  3PRE A;  3CK9 A;  3GYZ A;  4K5A B;  3UIP C;  3UKU G;  1FT1 A;  1YA0 A;  3ZW3 A;  3G2T A;  3KS2 A;  1UJJ A;  2R17 C;  4AEZ C;  2WB2 A;  2J4D A;  4GA2 A;  1WM5 A;  4U0S A;  3B7B A;  1LD7 A;  3B7U X;  4B93 B;  2RD0 A;  2XQ0 A;  2R2L A;  4EZL A;  3MV2 B;  4HXI A;  5E76 A;  4TXP A;  4URK A;  3SNX A;  1PC2 A;  5E75 A;  3X2Q E;  3UXG A;  2OVB A;  5KJL A;  4RQI A;  4XE0 A;  4CZ2 D;  4PS3 A;  1NZN A;  1HXI A;  3Q75 A;  1JCS A;  3LVR E;  4BX8 A;  3L16 A;  4I17 A;  2QZA A;  5JJ7 A;  3CHO A;  3D9O A;  1TN7 A;  3LEW A;  1BPO A;  5JHB A;  2HM8 A;  4C0M A;  3WG7 E;  5CMW A;  3G2W A;  3Q49 B;  1BD8 A;  3KEZ A;  4NQ0 A;  4NRH B;  4ACK A;  4HNA D;  3ULY A;  2XPZ A;  4E6H A;  5CBO A;  4U8V D;  3I3N A;  3S2A A;  5EYP F;  2F8X K;  4J0U A;  3B13 A;  1WG0 A;  2KCK A;  2LO6 A;  1O1T A;  1FVF A;  4F53 A;  2EQX A;  4JA9 A;  3ZN3 A;  3DPD A;  4DUI A;  2Y0B G;  2XEE A;  1QBQ A;  4ATZ D;  3PZ3 A;  4AY6 A;  4WAF A;  4XI0 A;  4LRZ A;  4JD2 G;  4ANW A;  3D9J A;  3FU0 A;  2WXN A;  3CHR A;  4ILI A;  2RFM A;  2ZIS A;  3J5P A;  1TNO A;  2V5Q C;  4HQD A;  3HVE A;  4G8K A;  5EX0 A;  2YHE A;  3RIB A;  2FO1 E;  4B8C B;  3HXD A;  1OCZ E;  5AQB A;  4N3A A;  4GZ3 A;  2XCC A;  1IQR A;  3S7J A;  3QOU A;  5JA4 D;  1UJK A;  5A7D B;  3ASO E;  3I4R B;  3QWW A;  4GMJ A;  3GZ1 A;  1IHG A;  4L7T A;  2WQH A;  1HG5 A;  3O4Z A;  1EDU A;  3DEO A;  4U63 A;  1Y8M A;  4LG6 A;  2UWJ G;  2WXQ A;  4G26 A;  1N4P A;  3CVU A;  1H2U A;  2NXP A;  2CHX A;  1Y6I A;  3FUI A;  3QDN A;  3VTY A;  2ILR A;  2IY0 C;  3LYA A;  3E30 A;  1YMP A;  3FDH A;  2X6F A;  4FLB A;  4A1G A;  1Z6T A;  4UQZ A;  4FLH A;  4MBG A;  2PM6 A;  3APD A;  2WXI A;  3PNL B;  4G2V A;  1S0P A;  5J08 A;  5FZS A;  3PZ1 A;  3NB2 A;  3CKB A;  5JJT A;  4G11 A;  1NL4 A;  4UUC A;  1OWL A;  3UMV A;  5EYL A;  3ZNG A;  1YYH A;  1IKN D;  3UTM A;  1WAO 1;  4IN3 B;  4KXK B;  2L0T B;  4CGV A;  3B7R L;  4I9E A;  5CMY A;  3UM3 A;  1E8Y A;  1ELW A;  2FEZ A;  3Q47 B;  5T8I A;  2DYR E;  4UI9 K;  3ENE A;  4RG6 A;  3FHE A;  4DI4 A;  4RLY A;  4TRQ A;  3UM0 A;  4APF A;  2JAB A;  3Q9N C;  3Q5M A;  4LEU A;  3SD5 A;  4I1O B;  1EPU A;  3ULE G;  2EIN E;  4J8F A;  4MRU A;  2VQ2 A;  3NF1 A;  4JHJ A;  1YCS B;  3NOG D;  2C2L A;  4L9P A;  4L1B A;  4TUM A;  3T5X A;  3ZXP A;  5FT9 A;  5B3S E;  4GTT A;  3FTW A;  4U0Z A;  2AJA A;  4DK5 A;  2XZT G;  2LAH A;  3ZYM A;  4YDY A;  3CST A;  5CCL A;  4J6I A;  4NIK A;  2AWI A;  3TWR A;  2X6K A;  2XRY A;  4TV3 A;  4GTS A;  4O6F A;  2E0I A;  2C0L A;  4GZ6 A;  3ASH A;  3W9G A;  3L08 A;  2J9Q A;  2P9S G;  5FQ6 A;  3FU5 A;  3VLE A;  4ME2 A;  3TXN A;  3DSS A;  3J5Q B;  1DNP A;  5CEA A;  4QFV A;  3LCA A;  1JUQ A;  3APC A;  5D2M C;  1TYQ G;  4XI9 A;  2Y4T A;  3MKQ B;  3NZU A;  2DZO A;  2L9B A;  3NZS A;  1TN6 A;  1QQE A;  1OWM A;  5FIN A;  3OTN A;  2ZGD A;  3CVL A;  4BWR A;  3D9M A;  2EIM E;  5AYW D;  2WXF A;  3VTX A;  4FC8 A;  3OXL A;  3L13 A;  2B0O E;  3CSF A;  1OCR E;  3CVX A;  1E8W A;  3SFZ A;  3LDZ A;  1D8E A;  1MZC A;  4UWG A;  3FUJ A;  1H19 A;  3FFL A;  4ZHB A;  1A5E A;  3PVL A;  5AQ7 A;  3FY4 A;  2OND A;  3ASN E;  1N4S A;  5EN5 D;  2I1K A;  4U07 A;  5ANR A;  3FUE A;  3S7F A;  3UT7 A;  2X6I A;  4N39 A;  2GRP B;  3KD7 A;  4WNG A;  3SZ7 A;  1FPP A;  2V4H C;  4PS8 A;  3ASD A;  3JUI A;  2Q7F A;  3DSW A;  3LS8 A;  3UX4 A;  3RO3 A;  3AS4 A;  3AJI A;  3EUV A;  4FUL A;  3PE3 A;  4FP7 A;  1FT2 A;  1SVX A;  1Z3Y A;  5G2N A;  5LX8 A;  1N52 A;  3FUD A;  3CK7 A;  4B8A A;  3KEA A;  1B89 A;  2BTD A;  3DRA A;  3V2O A;  4B89 A;  4YND A;  5BXU A;  2WXL A;  2WXO A;  2VGX B;  1QNF A;  2EIJ E;  1H2T C;  3ZYQ A;  2AXU A;  3MKR A;  1Z3X A;  2AXZ A;  3JUE A;  3TL5 A;  2ZIR A;  5CEC B;  1KPS B;  3QWV A;  1H6K A;  4BSZ B;  4Q94 A;  3P2B A;  4WWP A;  2GRN B;  3ESK A;  3Q79 A;  4U04 A;  4FAD A;  3IHV A;  4HOS A;  4WUY A;  4RSY A;  3ZHE A;  1X81 A;  3HVE B;  3AG3 E;  2OV8 A;  4KT6 B;  3SO8 A;  5KNG A;  3RJV A;  3PZ4 A;  5HKP A;  3PH0 C;  1MYO A;  3FU6 A;  3ZKJ A;  3SGH A;  3HRA A;  1ZU2 A;  4FU3 A;  3DPY A;  1ZB1 A;  3C3O A;  3DXM G;  3PUK A;  3RSE G; 
#chains in the Genus database with same CATH homology
 3D9N A;  3EIQ C;  5C2Y A;  3L54 A;  4CCA A;  4MKT A;  3LEW A;  1BPO A;  1EF1 C;  4G23 A;  5C1D A;  5JHB A;  2HM8 A;  2CFU A;  4C0M A;  5CMW A;  2WM9 A;  2X38 A;  3G2W A;  1HO8 A;  3Q49 B;  2YHC A;  3KEZ A;  4NQ0 A;  2J49 A;  2XPY A;  4NRH B;  3IBE A;  3CV0 A;  3IEG A;  4ACK A;  3U3W A;  3CHP A;  2XPZ A;  3AU5 A;  1GW6 A;  2IU1 A;  2CG3 A;  4E6H A;  3I3N A;  3S2A A;  2FF4 A;  3HDX A;  3CQC B;  2WVI A;  2JEK A;  5KCM A;  3CQG B;  4J0U A;  3NQP A;  4N2Q A;  4AM9 A;  3IHY A;  2PQR A;  3B13 A;  3BG0 B;  2LO6 A;  2KCK A;  3L6A A;  1TEZ A;  4XIF A;  1FVF A;  4F53 A;  4GCO A;  3SBT B;  3T5V A;  2VGX A;  5ANL A;  2EQX A;  5HQ8 A;  2I1J A;  3RK6 A;  4CDM A;  4JA9 A;  3LXU X;  3ZN3 A;  2KZT B;  3DPD A;  4OVU A;  2KC7 A;  4GA0 A;  4CT0 A;  4G25 A;  4WWO A;  3EIJ A;  1OWN A;  2KCV A;  5BV1 A;  2X6J A;  1OUV A;  1E8X A;  1H2V C;  5KJK A;  4AY6 A;  3ZPJ A;  1JWG A;  4XI0 A;  3QAR A;  4LRZ A;  4WAF A;  4A3T A;  2OOE A;  3CVN A;  4ANU A;  4ANW A;  3U64 A;  4K0R A;  5BV0 A;  3LJ3 A;  3D9J A;  3FU0 A;  4I2Z A;  5FWQ A;  3MJW A;  2WPV A;  3L22 A;  3FTZ A;  4ILH B;  4P29 A;  5G04 J;  2WXN A;  3CHR A;  2VSY A;  4ILI A;  1HG2 A;  1HFA A;  2VSN A;  5EX3 A;  4BFR A;  3U4T A;  4KBQ A;  4EEC A;  4JW1 A;  3FUK A;  3HVE A;  2J4B A;  1ZBP A;  2CG2 A;  5FZR A;  5EX0 A;  5D0O D;  2YHE A;  3C98 A;  4Y6C A;  4BT8 A;  3DBS A;  3RIB A;  2GW1 A;  1FVH A;  3O48 A;  4GB9 A;  4NAC A;  3B7T A;  4C9B B;  2V0P A;  4B8C B;  2WXK A;  5ARF A;  2J08 A;  4JEH A;  4XX5 A;  3FUF A;  2NC9 A;  2VJ8 A;  4GAA A;  5A6C A;  3MA5 A;  3R7Q A;  5KJN A;  2YQ8 A;  3E4B A;  3Q4A B;  4I6G A;  3URZ A;  4N3A A;  3ZYK A;  3U66 A;  2IOL A;  2WXP A;  1UW4 B;  3FTY A;  4GZ3 A;  2XCC A;  4IRU A;  1LF8 A;  3HIZ A;  3QK0 A;  4R7L A;  4ABN A;  4AIF A;  4DLO A;  4LCT A;  3AU4 A;  1IQR A;  4G1T A;  3S7J A;  3ZIM A;  3ML8 A;  3QOU A;  4E85 A;  3MCX A;  1UJK A;  5A7D B;  2AW6 A;  3LPZ A;  1VDY A;  3I4R B;  4FA6 A;  3QJZ A;  4N2S A;  4PS7 A;  3ML9 A;  3QWW A;  4GMJ A;  5M72 A;  3CHM A;  2KCL A;  2XPI A;  1IQU A;  3GZ1 A;  1IHG A;  4CEM A;  3CLJ A;  2IJG X;  3CEQ A;  4W9R A;  3UT4 A;  4DI3 A;  5AIJ A;  4L7T A;  2WQH A;  1HG5 A;  2I2O A;  3MGB A;  3O4Z A;  5G05 C;  1EDU A;  3RRN B;  3IKO B;  4FHJ A;  1HE8 A;  1Y8M A;  1SZA A;  4U63 A;  2UWJ G;  4A1S A;  4APO A;  2VTB B;  3EDT B;  1SZ9 A;  2WXQ A;  3LY9 A;  4MS6 A;  4G26 A;  5A23 A;  3QC1 A;  3S7B A;  3CVU A;  2A4Z A;  4B94 A;  2WMO A;  1KLX A;  1A17 A;  2XEV A;  1H2U A;  5EKQ D;  2NXP A;  2YIN A;  3CIA A;  3R7R A;  2CHX A;  1Y6I A;  3FUI A;  2AXV A;  5LOZ A;  3ZXS A;  3QDN A;  3VTY A;  1X5B A;  2CHW A;  4G24 A;  2ILR A;  3FEX A;  4BSX A;  4CGW A;  3LYA A;  5CCM A;  2UY1 A;  2KZT A;  3SI5 A;  3CVW A;  3FDH A;  4A55 A;  3PEV B;  1JPL A;  3ZRH A;  2X6F A;  4FLB A;  4A1G A;  1Z6T A;  3EHM A;  5CHE E;  4UQZ A;  2LNI A;  4FLH A;  4JC8 A;  2A5U A;  2PM6 A;  2WXM A;  4JXT A;  3APD A;  4J8S A;  2WXI A;  3D9I A;  3PNL B;  4G2V A;  4KYO B;  5HI7 A;  1S0P A;  4GCN A;  2BUG A;  2L6J A;  4BTA A;  5J08 A;  2XGS A;  2XGM A;  5FZS A;  4GYY A;  2FBN A;  2IF4 A;  4HLE A;  4I1M A;  3TAX A;  1SQM A;  3CKB A;  4IYP A;  5FQ8 A;  4I6J A;  4TUU A;  4OVV A;  5JJT A;  4G11 A;  3QNK A;  1MHQ A;  1OWL A;  4A3V A;  2VSX E;  3UMV A;  3UT8 A;  3OXF A;  4GYW A;  4BX9 A;  3D9P A;  4GML A;  3FUL A;  5FTP A;  3VLF A;  2GGF A;  1E90 A;  3MV3 B;  2WXR A;  3MKQ A;  1WAO 1;  3ASF A;  5G05 J;  4HOQ A;  4PUC A;  4IN3 B;  1NA0 A;  4HFG A;  4KXK B;  4F7A A;  2L0T B;  3RU0 A;  2VTB A;  3FH7 A;  3GZ2 A;  2DCP A;  4CGV A;  4J8E A;  3B7R L;  4I9E A;  3JQ0 A;  5CMY A;  1IYG A;  2MRI A;  3ULQ A;  2WMN A;  3FUM A;  2R5S A;  1E8Y A;  1ELW A;  2XRZ A;  3FH8 A;  4OYS A;  1TJC A;  4WNE A;  4XZ4 A;  3CHS A;  2FEZ A;  3Q47 B;  5T8I A;  4GZ5 A;  4IUL A;  3L17 A;  3Q15 A;  5ENN A;  3PS6 A;  3FWV A;  4UI9 K;  5KJM A;  2WQ6 A;  4HOT A;  3ENE A;  5BW8 C;  1KT0 A;  4RG6 A;  5D0Q D;  3FHE A;  3UQ3 A;  2C0M A;  4BTB A;  4DI4 A;  4EZJ A;  3TGO A;  4L2Y A;  2VGY A;  4FHK A;  1E96 B;  4TRQ A;  4B0Z A;  3R9A B;  4I1A A;  4AVX A;  4WWN A;  4F1S A;  2Y3A A;  4UQX A;  3CVY A;  4JL0 A;  3P1U A;  4APF A;  5BT1 A;  1UN8 A;  2WXG A;  1UG3 A;  3Q5M A;  3LY7 A;  4LEU A;  2I6H A;  2MOW A;  3SD5 A;  2PM7 A;  4I1O B;  1INZ A;  1W3B A;  1EPU A;  3I5P A;  1HX8 A;  4JA7 A;  2AVP A;  4AJW A;  4KVO A;  3AS8 A;  3CVP A;  3PE4 A;  1E8Z A;  5ARG A;  4J8F A;  2VSO E;  3UUX A;  2XCB A;  4EZK A;  4GZC A;  4MRU A;  2VQ2 A;  3NF1 A;  4JHJ A;  5G55 A;  4L1B A;  2C2L A;  2L0I A;  2WXJ A;  2CFZ A;  3T5X A;  5FT9 A;  4FJZ A;  3I4G A;  3HYM B;  2QFC A;  3EHN A;  3APF A;  3FTW A;  2DIW A;  3FUN A;  4U0Z A;  3ZHE B;  4AP2 A;  4ATG A;  3TG5 A;  5G04 C;  4DK5 A;  4CDR A;  2LAH A;  3RRM B;  3ZYM A;  3ESL A;  1EYH A;  3CST A;  5CCL A;  4J6I A;  3QB2 A;  2AWI A;  4AY5 A;  2HO1 A;  2X6K A;  2XRY A;  1L5J A;  4TV3 A;  5FJY A;  4ACL A;  4O6F A;  3RO2 A;  5AJD A;  4NUR A;  5EDS A;  2E0I A;  5LCW J;  4KVM A;  3RKV A;  3AS5 A;  2C0L A;  2KAT A;  4GZ6 A;  3ASH A;  4DPR A;  4F3V A;  3G2S A;  2LSV A;  3L08 A;  4Q96 A;  4Y6W A;  2J9Q A;  3PNT B;  4ILG A;  3CR3 A;  2NSZ A;  2BF0 X;  4V3I A;  5FQ6 A;  3FU5 A;  3TXM A;  4GPK A;  2CHZ A;  3T8M A;  3VLE A;  1PAQ A;  1XGW A;  4ME2 A;  2I9C A;  2FO7 A;  5JJ6 A;  3TXN A;  3CVV A;  4N5C A;  2FUL A;  4UI9 C;  1HH8 A;  4UI9 J;  5AJL A;  4EBA A;  1XNF A;  1DNP A;  3BG1 B;  4YVO A;  3BEE A;  4L23 A;  5AEN A;  4QFV A;  5J90 A;  3LY8 A;  3LCA A;  4RVB A;  3CKC A;  1JUQ A;  3APC A;  3PUJ A;  3SHF A;  1U3D A;  2IFU A;  3FTV A;  1TJF A;  2GRM A;  4HOU A;  3GW4 A;  4CDN A;  4XI9 A;  3QKY A;  2WXH A;  1DVP A;  2Y4T A;  3MKQ B;  3NZU A;  2L9B A;  2JLB A;  3NZS A;  3CHQ A;  1QQE A;  1OWM A;  3ZEF A;  1MQS A;  3CVQ A;  1FCH A;  4J8D A;  1PY1 A;  3OTN A;  5T3R A;  4AOF A;  3CVL A;  3MX3 A;  4BWR A;  2WQ7 A;  1HS6 A;  1NP7 A;  2QY7 A;  2DBA A;  2YNQ A;  5FQ7 A;  4DJA A;  4L2L A;  3D9M A;  4KZC A;  5AYW D;  2WXF A;  1P5Q A;  3VTX A;  4HOR A;  5LFA A;  4FC8 A;  1ELR A;  3OXL A;  2X6H A;  3PDN A;  3ZGQ A;  3HHM A;  4I6E A;  3L13 A;  4EQF A;  4PH4 B;  4ANX A;  4RG9 A;  4DLQ A;  1QZ2 A;  1ELK A;  3FP3 A;  3ONK A;  3FTX A;  3CSF A;  3CVX A;  5JHA A;  1E8W A;  4U8H A;  2RG8 A;  3LDZ A;  3SFZ A;  4UWG A;  4Q69 A;  4WNF A;  1N54 A;  3FUJ A;  3TG4 A;  2UY1 B;  1H19 A;  3FFL A;  3PVL A;  5LCW C;  3FY4 A;  3JYS A;  2OND A;  4UWH A;  4CT4 A;  3SF4 A;  2E2E A;  4D10 C;  4N3B A;  2I1K A;  3PEU B;  4JEU A;  4U07 A;  3WXX A;  5ANR A;  2IQC A;  3FUE A;  5FQ4 A;  3ZFW A;  3FTU A;  1UN9 A;  2ION A;  4GU5 A;  3S7F A;  3UT7 A;  4AV7 A;  4ANV A;  2X6I A;  3CK8 A;  4N39 A;  3KD7 A;  3ZYL A;  3IV0 A;  4WNG A;  3VLD A;  3SZ7 A;  3JCK C;  1HU3 A;  2GRL A;  4GZD A;  3MEK A;  3U9W A;  4GA1 A;  4PS8 A;  4BT9 A;  3JQ1 A;  1WY6 A;  1HF8 A;  3ASD A;  5BPP A;  3JUI A;  2Q7F A;  3LS8 A;  2P58 C;  3D3M A;  4KMO A;  4U0U A;  3UX4 A;  4AXH A;  4H7X A;  3FH5 A;  3FTS A;  4K03 A;  4I2W A;  4WND A;  3RO3 A;  3AS4 A;  4FUL A;  4N3C A;  2MHK A;  3PE3 A;  3LVQ E;  4JVS A;  1HZ4 A;  2R59 A;  4FP7 A;  1OWO A;  5BUZ A;  2LSU A;  1U3C A;  1Z3Y A;  5G2N A;  2J07 A;  5LP0 A;  3PRZ A;  3QAQ A;  4UWL A;  3D9L A;  5LX8 A;  4JHK A;  1N52 A;  4UWK A;  1E7V A;  3B7S A;  2Y4U A;  3FUD A;  3QWP A;  1OWP A;  3PRE A;  2M63 A;  3CK9 A;  3GYZ A;  1YA0 A;  3OXG A;  3CK7 A;  3UPV A;  4UWF A;  2V5F A;  4HVB A;  4B8A A;  2PZI A;  1B89 A;  2BTD A;  3G2V A;  4B89 A;  4YND A;  5BNW A;  3FUH A;  1JWF A;  2WXL A;  2WXO A;  3PZD A;  3G2T A;  3ZW3 A;  2VGX B;  5DIZ A;  1QNF A;  3KS2 A;  1UJJ A;  2J09 A;  5T4Y A;  2ZU6 B;  2R17 C;  3SBS A;  3G2U A;  4AEZ C;  1H2T C;  2V8S E;  4I9C A;  3ZYQ A;  3D9K A;  3EJN A;  3MYV A;  2WB2 A;  2AXU A;  4GYO A;  2J4D A;  2XHE A;  1KT1 A;  3MKR A;  4GA2 A;  1Z3X A;  2AXZ A;  2HYZ A;  4KZ0 A;  3TL5 A;  1WM5 A;  4M3O A;  4U0S A;  1H0A A;  3QWV A;  1H6K A;  4BY6 A;  2HR2 A;  4Q94 A;  3P2B A;  4PDX A;  4WWP A;  3B7U X;  4EPZ A;  1NA3 A;  4LUN U;  3N71 A;  3ESK A;  4XKB A;  4U04 A;  4FJY A;  2OVF A;  2IOS A;  2VYI A;  2RD0 A;  4FAD A;  2XQ0 A;  3ASG A;  3IHV A;  4JHR A;  4HOS A;  4WUY A;  4RSY A;  3ZHE A;  3TJP A;  2KM4 A;  3FU3 A;  3HVE B;  4EZL A;  3MV2 B;  4HXI A;  2PL2 A;  4EBA G;  4JZY A;  5E76 A;  3CGH A;  2XGO A;  3SNX A;  4URK A;  4JPS A;  1PC2 A;  5E75 A;  2OV8 A;  2LAI A;  2OVB A;  4C0E A;  3ZVV A;  3FEY A;  3GZS A;  4KT6 B;  3KAE A;  5KJL A;  3RJV A;  4CRW A;  4XE0 A;  3PH0 C;  3K9I A;  4PS3 A;  1NZN A;  3MZL B;  1HXI A;  1E7U A;  2X3M A;  3LKU A;  3OAW A;  4XKC A;  3FU6 A;  4H7Y A;  3ONL A;  3LVR E;  4BX8 A;  3L16 A;  4I17 A;  3SGH A;  5FZQ A;  4MLP A;  2FI7 A;  3RRU A;  4UQY A;  1ZU2 A;  4I43 A;  4LER A;  4HS2 A;  4FU3 A;  5JJ7 A;  5DBK A;  2V4L A;  3CHO A;  4YVQ C;  3PUK A;  3D9O A;  2PQN A;  3S7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...