3Q5MA

Crystal structure of escherichia coli bamd
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
222
structure length
210
Chain Sequence
ASKEEVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSRDPQHARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia coli BamD and its functional implications in outer membrane protein assembly
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
molecule keywords UPF0169 lipoprotein yfiO
total genus 81
structure length 210
sequence length 222
ec nomenclature
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13525 YfiO Outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3q5mA00
2FI7A 5CCMA 2FF4A 2LSVA 4UI9J 2KCLA 2PQRA 3LPZA 4G23A 3OXLA 3QDNA 3RO3A 1QQEA 2E2EA 4GZ5A 3S7DA 4G25A 1B89A 1HXIA 1KT0A 5HQ8A 2UWJG 2VGYA 3FWVA 3GW4A 5JJ7A 3KS2A 3PE3A 4UQYA 1A17A 3LKUA 3GZ1A 4KYOB 4YVOA 4WNGA 4NRHB 4UQZA 3UQ3A 2C2LA 1XNFA 2L6JA 4G2VA 4JHRA 3CVQA 4BT8A 4HOSA 5LCWC 3ASDA 4UI9C 4Y6CA 5CHEE 4KBQA 5AYWD 3RO2A 4CGVA 4BTBA 4I1AA 3WXXA 4RG9A 5M72A 2XGSA 2LSUA 2BUGA 4RG6A 5G05J 5ARGA 3TG5A 2XCCA 3QOUA 2WPVA 4GA0A 3CK7A 4O6FA 2HR2A 3LY9A 5EX3A 3OXGA 2XPIA 3CK8A 4YNDA 5EKQD 2UY1B 3MA5A 3Q5MA 3O48A 4AIFA 5JJTA 2P58C 3S7JA 1OUVA 3ZGQA 5JJ6A 4GA1A 5BT1A 3PE4A 4IN3B 4APOA 3QWPA 4G24A 5FZSA 2GW1A 2UY1A 2XGOA 4N5CA 4XIFA 3K9IA 4GZ3A 3TGOA 4H7YA 2VQ2A 2PQNA 5G05C 3TAXA 3QWWA 2QFCA 4EQFA 2Q7FA 1QZ2A 2XCBA 4J8DA 4BTAA 3CEQA 4GPKA 4U0UA 2PZIA 3AS8A 2NC9A 2C0MA 3CKCA 3Q15A 2PL2A 4H7XA 4N39A 3LYAA 5FTPA 4WNFA 3ZPJA 1ZBPA 4JL0A 3CVPA 4WUYA 4CDRA 5KJLA 2VGXA 3MEKA 1NZNA 4JA9A 4J8FA 4NQ0A 3VTYA 4J8EA 5FZRA 4BT9A 5KJMA 3KD7A 5G04J 2OOEA 2FEZA 2KC7A 3ULQA 3CVLA 5FT9A 4HORA 2KCVA 2YHCA 4YVQC 3SZ7A 3ASHA 3RJVA 3GZ2A 1NA0A 4N2SA 3AS4A 2C0LA 2YQ8A 3MKRA 1WAO1 4N3BA 3LY8A 5FZQA 5EX0A 4B94A 5A6CA 3FP3A 3RKVA 4LEUA 3S7FA 3Q49B 4GZ6A 2V5FA 3CKBA 3JYSA 4AY5A 3RIBA 3N71A 4I9EA 1WM5A 3RU0A 3KAEA 3URZA 1P5QA 3CK9A 3QWVA 3UUXA 2Y4TA 5LCWJ 1KLXA 3PDNA 4HOUA 2J9QA 3HYMB 3IEGA 5C1DA 4U0ZA 2VGXB 1PC2A 5CCLA 4N2QA 2Y4UA 4U04A 3TG4A 3LCAA 3UPVA 3Q47B 4WNDA 5FJYA 3FFLA 4BWRA 4N3AA 5A7DB 5KJKA 4G26A 4XI9A 5HI7A 1IYGA 1NA3A 1KT1A 2XEVA 4G1TA 4WNEA 5BW8C 3BEEA 4ABNA 2HYZA 3E4BA 2XGMA 3ZHEB 2MHKA 1HH8A 3CV0A 4HOTA 1TJCA 2FO7A 3LY7A 3NF1A 4GYOA 2AVPA 5D0QD 5D0OD 3U4TA 1ZU2A 3VTXA 3CVNA 5DIZA 1ELRA 1HZ4A 1YA0A 5BNWA 3ESKA 4U07A 2HO1A 5DBKA 3SF4A 4F3VA 2WQHA 2LNIA 4CGWA 3MV3B 2VSYA 4GCOA 3QKYA 4ME2A 4Y6WA 2I6HA 3EDTB 4U0SA 4GYWA 4XI0A 2R5SA 4GYYA 4HOQA 2IF4A 4I2ZA 4W9RA 4GCNA 4I17A 3ZHEA 3ZN3A 4J0UA 3ASFA 5G04C 1W3BA 1FCHA 4UQXA 4UI9K 4AY6A 2DBAA 2FBNA 2KCKA 5KJNA 2JLBA 4I9CA 4JA7A 3ZFWA 3ASGA 3U3WA 5ARFA 3OXFA 2VSNA 2ONDA 1E96B 1Y8MA 2VYIA 4AM9A 2KATA 3MV2B 3AS5A 4GA2A 4KXKB 3R9AB 3S7BA 1ELWA 2IFUA 3GYZA 1IHGA 3Q4AB 4N3CA 4I2WA 4A1SA
chains in the Genus database with same CATH superfamily
4FADA 5AJDA 1QYMA 1KT0A 2CG3A 2UWJG 3GW4A 1H6PA 2L6JA 4GTMA 4UWFA 4AOFA 4UI9C 2OCCE 3PH0C 3PVLA 1RZ4A 4CDNA 4PDXA 1KZPA 3J5PA 2J4BA 2JEKA 4XIFA 4GZ3A 4H7YA 3CHMA 2AXZA 4ZHBA 4G11A 2XRZA 1NZNA 3TL5A 3RK6A 1E7UA 5J08A 2FEZA 3CVLA 4GTPA 3ZW3A 1HG5A 3LY8A 4CCAA 3RKVA 4LEUA 3S7FA 3JUIA 2J49A 4WWPA 3NOCD 3HG0D 3G2TA 4CDMA 1TN6A 3Q47B 4C48B 3P2BA 3PS6A 4WNEA 3PUJA 4CEMA 5LX8A 1TNYA 4ILIA 3OAWA 5D0OD 4A1GA 2F37A 3HVEA 4I6JA 3SD5A 2BKGA 3EDTB 4GYYA 2ILRA 1K1AA 2WXLA 2V5QC 5KWDA 1FCHA 4JZYA 1OCCE 3CQCB 1KPSB 1U2VG 5CEAA 3PZDA 1E96B 4MRUA 2A5EA 4RVBA 4DLOA 4KXKB 3MCXA 3GYZA 2OEVA 3T5VA 5ENPD 3TXNA 4GZ5A 2E2EA 3FTWA 1HXIA 2VGYA 2BF0X 4C0EA 2DZNA 1A17A 3HHMA 1Y6IA 2AWIA 3CQGB 2P9NG 4F53A 4B93B 4I1AA 5EILA 2XEEA 3FUNA 1UOHA 3QOUA 1WY6A 3OXGA 3CK8A 3TWRA 3CVYA 4EZLA 3IBEA 4IN3B 2L6BA 2LXLA 3CHOA 2GGFA 2PQNA 1N4PA 4CT4A 3SGHA 2LAHA 5CRUA 5FZQA 3RRUA 4G8KA 3N71A 2KM4A 3ZYQA 1KLXA 3ML9A 2Y4UA 4WNDA 2GRRB 4HI8A 4J8SA 3FU6A 2NYJA 1DC2A 4ABNA 2HYZA 1H0AA 1HH8A 2HM8A 3QKYA 1V54E 3G2SA 2XENA 2XZDG 3J5QB 4J6IA 2ONDA 3MV2B 1JWFA 3SHFA 4M3OA 5D66A 1OWPA 4G23A 5HQ8A 3SNXA 1HF8A 3S7DA 1HX8A 3CR3A 4L7TA 4OVVA 1TNZA 3Q79A 3V2OA 3FTXA 4AJWA 1S64A 5CMWA 1INZA 2H6GA 3V2XA 4BEPA 1X5BA 3ZRHA 4XZ4A 1D8DA 4UWGA 4J8DA 2NC9A 2PL2A 4CDRA 3CVPA 3CLJA 3T9KA 2V0PA 4J8EA 3JQ1A 1TNOA 3FULA 1KZOA 2WXOA 3FP3A 2L0TB 3ABME 3CHQA 3UT8A 1S63A 4BX8A 4HOUA 1IXVA 4GB9A 4G26A 3Q7AA 4BSZB 3C3OA 4I6GA 4LNBA 3JQ0A 1H6KA 1Z3XA 3SO8A 3AJIA 2QC9A 3I4RB 5BPPA 1N4RA 4XI0A 3EHMA 4UI9K 4UWLA 1TYQG 3ENEA 3HXEA 5IY5E 2J8SD 4FA6A 3ASNE 3L16A 2R2LA 3LPZA 3G2WA 2RFMA 3UKUG 3ZUVB 1OCRE 3UQ3A 5BUZA 1DCEA 4WWOA 3CVQA 3ONKA 4DX2A 3WXXA 2AW6A 1UW4B 1UJJA 2MRIA 3CSFA 1YYHA 3SBSA 3DSTA 3JUEA 2RKKA 3S7JA 4G24A 4OAUC 4Z68A 2P9IG 5C2YA 1QZ2A 1LTXA 3ZYKA 2B6CA 2IJGX 4A55A 4B8CB 3R9MA 4AY5A 3MKRA 1A5EA 4N3BA 4DI3A 3C98A 4KMOA 3QWVA 3PDNA 3CHSA 2H6FA 1H19A 2RG8A 5A7DB 5CBOA 3DWLG 1MHQA 1TNUA 2MHKA 2J08A 3FU0A 3T8KA 2WQHA 3KEZA 4GYWA 3C72A 2WXFA 2EQXA 1JCRA 3OXFA 5FQ4A 2AXVA 2P9KG 4YVOA 2X6JA 5FIOA 3QC1A 4FJZA 1G3NB 3UMVA 3U9WA 4JHRA 5B1BE 2GRPB 3C3RA 1FVHA 3FUFA 1MZCA 2UY1B 2X6FA 4LG6A 5JJTA 4GTTA 1Z6TA 2NSZA 3PZ2A 3PE4A 3MZLB 3CGHA 2H6HA 3TXMA 1JUQA 2X6KA 2VQ2A 5LP0A 4N2SA 2WXJA 3MEKA 4J8FA 3FUMA 4O1PA 3PREA 1WAO1 3X2QE 4GZ6A 4Q69A 3RIBA 4GTQA 3UM2A 4IYPA 3UUXA 3ZNGA 4U7EB 4EHMA 2R03A 4N3AA 4XI9A 5EDSA 1NA3A 4LNUD 4DK5A 1HE8A 4JC8A 1EYHA 3KSLA 5JHAA 1AWCB 3Q7FA 1LD8A 3B95A 4TUUA 4HOQA 4WAFA 4UWKA 1MX2A 2IONA 5CEDB 5KCMA 1SZAA 4AY6A 1SA4A 2DYSE 3L13A 3LXUX 2A4ZA 4JD2G 5ENTD 4JB8P 2YNQA 3V31A 1B89A 4BESA 3HXDA 2PM6A 3LKUA 4AV7A 3TWUA 4F1PA 2C2LA 3L6AA 1E8YA 3HXBA 4RG9A 3DRAA 1N0QA 2LAIA 3CK7A 2XPIA 4APOA 3RRNB 3QAQA 1E8ZA 3MX3A 5ITZF 4FHJA 1Z5SC 1BI7B 3Q73A 3ML8A 3W9FA 4OYSA 3UM1A 2HE0A 4C0MA 3NOGD 1WM5A 3CVXA 3CHPA 4JEUA 3LCAA 4XE0A 4M7CA 1IQRA 5CECB 3SQVA 2X6HA 2P9SG 2J07A 2FO7A 4NIKA 4OVUA 1ZU2A 1K8KG 5JHBA 3E33A 2LNIA 1YCSB 5EN5D 4O60A 4HQDA 3ZHEA 2P2CP 3HIZA 4B0ZA 4ANVA 3IKOB 2I2OA 1IHBA 1EDUA 3D9HA 5LFAA 3DPYA 4FHKA 3UI2A 1SW6A 3PNTB 4JEHA 4EBAA 4AEZC 3NBNB 2WQ7A 2FF4A 2LSVA 4DX7D 4FC8A 1QQEA 4RSYA 3VLFA 4E85A 2CHWA 2XPZA 1OY3D 1QNFA 3U66A 4HOSA 3G2UA 4Y6CA 2ZIRA 4BSXA 3BG0B 2XGSA 2XCCA 4GA0A 2VSOE 4F1SA 5BXUA 4PUCA 3ZKJA 4DX1A 3O48A 3AG2E 4TXPA 3QWPA 2GW1A 1E8XA 2LO6A 3CVUA 2PZIA 3FTYA 4JL0A 5KJLA 4HRMB 3FEYA 5G04J 1NFIE 5FT9A 4YVQC 1NA0A 3AS4A 1EPUA 2GRNB 3Q49B 4UUCA 4HFGA 2QYJA 3HDXA 2WQ6A 2AJAA 4B8AA 1O1TA 2J9QA 2KZTA 1IQUA 4U0ZA 3UPVA 2V4HC 4I1MA 5FJYA 2XS8A 1JPLA 1NL4A 4G1TA 4KZ0A 4F7AA 3BEEA 1BI8B 1WDYA 3ZHEB 4NACA 4TUMA 4WWNA 3LY7A 2AVPA 5AAOA 5DIZA 1YA0A 2HO1A 3UX4A 4L2YA 4F3VA 3ZXSA 4ME2A 4CT0A 4MBGA 1N11A 4I17A 5G04C 4MLPA 3VLDA 3JXJA 2KCKA 4PH4B 4ACLA 3ASGA 4GMLA 2X6IA 2XZTG 2NXPA 4AM9A 5ENNA 4NURA 3Q4AB 5HI7A 1O5MA 3AU4A 2PQRA 3D9NA 4ANUA 4GPKA 4RLYA 2VSXE 4ANXA 5BV0A 4HRNA 1XNFA 4G2VA 4GMJA 2DCPA 5CHEE 3RO2A 5FWQA 1HS6A 5M72A 1LD7A 4XEIG 1TN7A 3Q5MA 2P58C 4BFRA 3LVRE 2R02A 4GA1A 3MKQB 4QFVA 4LCTA 3CKCA 3QARA 2VGXA 1UN9A 2DYRE 5ENQD 1ZB1A 3PZ1A 2Y1LE 2OVBA 5EX0A 2CHZA 4MKTA 1BPOA 1XGWA 3URZA 1U3CA 3FUJA 2VGXB 2GRMA 3FFLA 3ZVVA 2RFAA 3DSUA 3NQPA 2L9BA 1KT1A 5BW8C 3SY2A 5T4YA 3RAUA 3CV0A 3D9MA 5D0QD 1HZ4A 1AP7A 3ONLA 4U0SA 4L2LA 3P1UA 4ZFHA 1N9AA 2FBNA 5KJNA 3FUEA 3ZFWA 2VSNA 2VYIA 4YDOA 4K5BA 3KSQA 1MJ0A 2FI7A 5CCMA 2VTBB 1DCQA 3OXLA 3AU5A 3HVEB 4HNAD 3UIPC 4GTVA 4GTOA 4UQZA 2I9CA 3LVQE 4DRXE 3EU5A 3Q9UC 3TG5A 2WMNA 5AJLA 5EX3A 2EIME 3BUAA 3LY9A 5EKQD 4EPZA 2XS1A 4K5CA 1TEZA 1H2VC 4MS6A 2UY1A 4IRUA 3AS8A 5A23A 3ULQA 5FQ7A 1DNPA 3E32A 3FTSA 4CRWA 3AG4E 5T3RA 3LJ3A 4DUIA 3RRMB 1HU3A 2BTDA 1LF8A 1OWLA 4XKCA 3LDZA 3CVNA 3PEVB 1N52A 2VSYA 4GCOA 4EZJA 1D8EA 1OWOA 2WXNA 3EHQA 3I5PA 3QK0A 2IF4A 3ULEG 4PS8A 5H7PA 4O1OA 4DX5D 1FT1A 4GU5A 4GTSA 2IY0C 4LSZE 4U8VD 3FHEA 2M63A 2J4DA 2XPYA 2ZGDA 1V55E 4JW1A 4UI9J 2KCLA 3ZXPA 4G25A 2XHEA 3GZ1A 3OTNA 3D9JA 4BT8A 3QNKA 1E8WA 4OAVB 4KT6B 4APFA 4A3VA 2BUGA 3FTZA 4LNGA 4O6FA 3D9OA 3UM0A 3PZ4A 5KNGA 1TNBA 3FU3A 4BX9A 3K9IA 3QB2A 4XKBA 5G05C 3TWSA 2XCBA 3FH8A 5CRVA 4BY6A 4J7WA 3B7RL 1JWGA 5AN8A 5FQ6A 3VTYA 5ENSD 1K3ZD 5ENRD 3DSVA 2WMOA 5AENA 1NI1A 3APDA 2WXHA 4B94A 2F8XK 3CKBA 3JYSA 1IKND 5JA4D 2VJ8A 3I3NA 1VDYA 5KJKA 2PNNA 4GZDA 2ETAA 3TWQA 3UKRG 4EECA 3PRZA 3HRAA 5HRYA 1YMPA 3BQOA 3L22A 2R17C 3O4ZA 1MQSA 1HO8A 5B3SE 1N94A 3QJZA 1MYOA 4B89A 4TXRA 2DBAA 1SQMA 1N4QA 2LXMA 2IQCA 2KATA 5T8IA 3RSEG 4DJAA 2F0YA 5E76A 4N3CA 3JCKC 4KVMA 4ACKA 1H6OA 4ILGA 1FVFA 3DPDA 3RO3A 2WXMA 5JJ7A 3KS2A 3PE3A 4TRQA 4UQYA 5J90A 4CYMD 5CMYA 3SFXA 5AYWD 4FU3A 4AVXA 3SFZA 3DSSA 2ETCA 1PAQA 4TXQA 4L9PA 3TAXA 3D9LA 4GPMA 2CG2A 2EINE 4HB5A 4DX6D 3HXFA 5FZRA 4ILHB 2WXQA 3RJVA 2KXPC 3NZUA 4P29A 5A6CA 3E37A 2KBXA 4HI9A 1FPPA 3R7RA 3KAEA 3CK9A 4IULA 1FT2A 2R59A 1MX4A 3B7SA 3T5XA 2EIKE 3GZSA 1NP7A 4U07A 3SF4A 3FUIA 3MV3B 2Y3AA 2J09A 2R5SA 3EJNA 2I1JA 2A5UA 1SVXA 4I9CA 4JPSA 4YDYA 4RQIA 5ARFA 5AIJA 2QZAA 4J8YA 4U8HA 3AS5A 3FTVA 1ELWA 2AXUA 3TWWA 4ATZD 2YHEA 3QDNA 4F6RD 4Q96A 5EYPF 4BETA 4KYOB 4NRHB 5LCWC 3G2VA 4CGVA 4BTBA 1DVPA 3IV0A 3LJNA 3DBSA 2MOWA 1SA5A 2LSUA 3FH5A 1BD8A 4YNDA 3MA5A 4L23A 3L82A 2QY7A 2Y0BG 2IOSA 2QFCA 4EBAG 1U3DA 4BTAA 2FO1E 2C0MA 4JVSA 4U96D 4WNFA 3FEXA 4BT9A 1H2TC 5AARA 2KC7A 3UXGA 4AP2A 3ASHA 2C0LA 2YQ8A 3ABLE 1OT8A 5AQBA 5EIBE 4DI4A 3MGBA 3DXMG 1HG2A 3IEGA 4A3TA 3I4GA 4FULA 3ZU7B 1IYGA 3EHNA 2F8YA 4JXTA 2PM7A 4U95D 1UJKA 2P9UG 1E90A 3VLEA 4I1OB 2E0IA 2WXIA 4EZKA 2FULA 3V30A 3D9PA 4I2ZA 4J0UA 1W3BA 4UQXA 4UWHA 4GZCA 1Y8MA 5FINA 2DVWA 1UG3A 4FJYA 1IHGA 4C9BB 3FTUA 5E75A 4W9RA 4I2WA 2ETBA 2RD0A 4A1SA 3DEOA 3EIQC 4WNGA 2Y69E 4U8YD 3BU8A 2DZOA 3PNLB 2H6IA 4Q94A 2X3MA 5AQAA 4RG6A 5G05J 3BG1B 2HR2A 3PEUB 2WM9A 3NZSA 1H2UA 3CIAA 3D3MA 4YDWA 4ATGA 4X8QA 2CFZA 3TWXA 4GMRA 4HS2A 4N5CA 3TGOA 3LEWA 3MYVA 1Q2ZA 2Q7FA 3CSTA 4H7XA 3Q15A 1EF1C 4HLLA 4I43A 5ENOD 3ZEFA 4HORA 1OCZE 5AQ7A 3APFA 2GRLA 3SFYA 2IO3C 5ANLA 3RU0A 1BU9A 2P9PG 3DSWA 3ZYMA 5CCLA 1N54A 5D2MC 2MYOA 2V4LA 3AG1E 4R7LA 2YINA 2EILE 4CGWA 3ESKA 4HOTA 5JMND 1E7VA 3UM3A 2GRQB 2WXKA 1GW6A 3UIOC 2JLBA 3UT4A 2P9LG 4DLQA 3U3WA 1L5JA 3ESLA 3DEPA 3B7BA 2IEJA 4K0RA 2IFUA 3L17A 2BKKB 1BLXB 3APCA 3FWVA 3L08A 5LOZA 4HVBA 3ASDA 3S2AA 2WXGA 3FUHA 3S7BA 2WPVA 4V3IA 3SZ7A 3MJWA 5JJ6A 5BT1A 3NB2A 3FY4A 3FUDA 4E6HA 2VGEA 3QWWA 3NAWA 3CEQA 5B1AE 4GAAA 2WB2A 5FTPA 1N4SA 4WUYA 3IXEA 4NQ0A 2YHCA 3AG3E 2OV8A 2CFUA 4I9EA 1P5QA 2Y4TA 3ULYA 3ZIMA 4K5AB 5FQ8A 5C1DA 4BWRA 4QQIA 3E30A 1TR4A 2XGMA 3B7TA 3T8MA 1TJCA 4GYOA 3NF1A 3IHVA 4D10C 1N95A 3U4TA 4PS3A 3B7UX 5BNWA 4U63A 1JCSA 5CERB 2WXRA 1MX6A 2QYUA 4GCNA 2OEWA 3Q78A 5ANRA 4CZ2D 1S70B 1JCQA 2ZISA 4JA7A 1WG0A 3HXCA 5G55A 3L54A 5BV1A 5EIDA 3EHRA 4HBDA 2WXPA 3LS8A 1QBQA 4LUNU 1Z3YA 1S0PA 2JABA 5AQ9A 3PUKA 3FUKA 3DSXA 3ZGQA 5CBNA 2CHXA 4YDEA 4URKA 3FDHA 3D9IA 2XRYA 4AXHA 1OXJA 2VTBA 5G2NA 3ISMC 4U0UA 1K1BA 4LRZA 1ZBPA 4JA9A 4XX5A 5KJMA 3CVVA 3CHRA 2DIWA 3C5RA 2GROB 3D9KA 3SBTB 3TWTA 1PC2A 4N2QA 3TG4A 4HXIA 3CVWA 3WG7E 2ZXWE 2DWZA 3ZYLA 3IHYA 3E4BA 3UTMA 1N0RA 1D9SA 1ELRA 5BXOA 2XEHA 4JHKA 1O1RA 4BERA 4KZCA 2I1KA 3TJPA 3AAAC 3E34A 3ZN3A 3F6QA 3ASFA 2X38A 2XQ0A 2IU1A 2V8SE 2IO2C 4GA2A 3R9AB 4KVOA 4L1BA 1OWMA 3PZ3A 3C3QA 1O1SA 3L9TA 2LUHA 4FP7A 2EIJE 3MKQA 3FH7A 3Q75A 3JXIA 3R7QA 3DXKG 4A63B 4KBQA 2ZU6B 1X81A 4HRLA 3W9GA 5EYLA 5ARGA 3Q9NC 3EIJA 1TJFA 3TWVA 4AIFA 4FLBA 1OUVA 4PS7A 3ASOE 3B13A 2XGOA 4GTRA 4TV3A 4EQFA 5FZSA 3U64A 4N39A 1SZ9A 2IOLA 3LYAA 3ZPJA 1RW2A 3V79K 4JHJA 4I6EA 4DPRA 3FU5A 3KD7A 2OOEA 3UINC 2KCVA 3EU9A 3GZ2A 5KBAA 2R05A 3EUVA 2V5FA 4HLEA 3UT7A 1UN8A 5LCWJ 1PY1A 3HYMB 4U04A 4LERA 3SI5A 2OVFA 2XEVA 4G8LA 2BEDA 1OCOE 5HS0A 1TN8A 2L0IA 3VTXA 4N5QA 2KZTB 5DBKA 4Y6WA 1OWNA 3KEAA 3ABKE 2I6HA 1ELKA 1HFAA 2WVIA 4FLHA 5HKPA 2ZGGA 4K03A 5KNHD 2B0OE 4ANWA
chains in the Genus database with same CATH topology
2FI7A 2X6JA 4FADA 5CCMA 2VTBB 5AJDA 2RD0A 4A1SA 3QC1A 3OXLA 4FJZA 3AU5A 1KT0A 2CG3A 2UWJG 3GW4A 3HVEB 3UMVA 3EIQC 4WNGA 4UQZA 2I9CA 2L6JA 4UWFA 3U9WA 4JHRA 3LVQE 4AOFA 4UI9C 3PNLB 3PH0C 3PVLA 4Q94A 2X3MA 4CDNA 1FVHA 4RG6A 5G05J 3TG5A 3BG1B 3FUFA 2WMNA 5AJLA 5EX3A 4PDXA 2HR2A 3LY9A 3PEUB 5HQ8A 2WM9A 3NZSA 1H2UA 3CIAA 2UY1B 2X6FA 3D3MA 5EKQD 4EPZA 1H2VC 1TEZA 4ATGA 5JJTA 1Z6TA 2CFZA 2NSZA 2J4BA 3PE4A 4MS6A 3MZLB 3CGHA 4HS2A 2UY1A 4N5CA 2JEKA 4IRUA 4XIFA 3TXMA 1JUQA 4GZ3A 3TGOA 2X6KA 2VQ2A 3LEWA 3MYVA 4H7YA 2Q7FA 5LP0A 3CSTA 3CHMA 3AS8A 2AXZA 4H7XA 4N2SA 3Q15A 2WXJA 5A23A 1EF1C 4G11A 4I43A 2XRZA 3MEKA 1NZNA 4J8FA 3FUMA 3TL5A 3ZEFA 3RK6A 1E7UA 5J08A 2FEZA 3ULQA 3CVLA 5FQ7A 4HORA 3PREA 3APFA 2GRLA 3ZW3A 1HG5A 1WAO1 1DNPA 3LY8A 4CCAA 3RKVA 4LEUA 3S7FA 3JUIA 3FTSA 2J49A 4GZ6A 4CRWA 4Q69A 3RIBA 4WWPA 5ANLA 3RU0A 4IYPA 3UUXA 5T3RA 3ZYMA 3LJ3A 3G2TA 5CCLA 3RRMB 4CDMA 3Q47B 3P2BA 4N3AA 1N54A 3PS6A 4XI9A 5EDSA 1HU3A 1NA3A 2BTDA 1LF8A 4WNEA 3PUJA 4CEMA 1OWLA 5LX8A 2V4LA 4R7LA 1HE8A 4DK5A 4ILIA 4XKCA 3OAWA 2YINA 4JC8A 5D0OD 4A1GA 3LDZA 3CVNA 3HVEA 1EYHA 4CGWA 3ESKA 4I6JA 4HOTA 3PEVB 3SD5A 1N52A 5JHAA 2VSYA 4GCOA 4EZJA 3EDTB 1OWOA 1E7VA 2WXNA 4TUUA 2ILRA 2WXLA 1GW6A 2WXKA 3I5PA 2IF4A 3QK0A 4GYYA 4HOQA 4UWKA 4W9RA 4WAFA 2IONA 5KCMA 1FCHA 1SZAA 4JZYA 4PS8A 4AY6A 2JLBA 3UT4A 3CQCB 4DLQA 3U3WA 4GU5A 1L5JA 3PZDA 3L13A 1E96B 3ESLA 4MRUA 4RVBA 4DLOA 3LXUX 4KXKB 2A4ZA 3FHEA 2M63A 2J4DA 2XPYA 4K0RA 3MCXA 2IFUA 3GYZA 3L17A 2YNQA 3T5VA 4JW1A 4UI9J 2KCLA 3TXNA 4GZ5A 2E2EA 3FTWA 3APCA 4G25A 1B89A 1HXIA 2VGYA 3FWVA 2BF0X 4C0EA 2PM6A 3L08A 1A17A 3LKUA 2XHEA 3GZ1A 3OTNA 4YVOA 4AV7A 2C2LA 3HHMA 5LOZA 4HVBA 3D9JA 3L6AA 4BT8A 1Y6IA 2AWIA 3CQGB 3ASDA 3QNKA 1E8WA 1E8YA 4F53A 4I1AA 4RG9A 3S2AA 4KT6B 4APFA 4A3VA 2BUGA 3FTZA 2WXGA 3FUNA 3FUHA 2LAIA 2WPVA 3QOUA 3CK7A 4O6FA 1WY6A 4V3IA 3S7BA 3OXGA 2XPIA 3CK8A 3D9OA 3CVYA 4EZLA 3IBEA 3FU3A 3MJWA 5JJ6A 5BT1A 4IN3B 4APOA 3FY4A 3FUDA 4E6HA 3RRNB 3QAQA 1E8ZA 4BX9A 3CHOA 3K9IA 3QB2A 2GGFA 4XKBA 2PQNA 5G05C 3MX3A 3QWWA 2XCBA 3FH8A 4BY6A 3CEQA 4FHJA 3B7RL 4GAAA 2WB2A 5FTPA 4CT4A 1JWGA 5FQ6A 4WUYA 3SGHA 3ML8A 4NQ0A 4OYSA 3VTYA 2WMOA 2YHCA 5AENA 4C0MA 2LAHA 3APDA 2WXHA 5FZQA 4B94A 2OV8A 2CFUA 3RRUA 3CKBA 3JYSA 3N71A 2KM4A 1WM5A 4I9EA 3ZYQA 1P5QA 2Y4TA 1KLXA 2VJ8A 3I3NA 3ZIMA 5FQ8A 5C1DA 3ML9A 3CVXA 1VDYA 2Y4UA 3CHPA 4JEUA 3LCAA 4XE0A 4BWRA 4WNDA 1IQRA 5KJKA 4J8SA 4GZDA 4EECA 2X6HA 3FU6A 3PRZA 4ABNA 2HYZA 1H0AA 2XGMA 3B7TA 1HH8A 3T8MA 2J07A 1TJCA 2FO7A 4GYOA 3NF1A 3IHVA 3L22A 4OVUA 1ZU2A 3U4TA 4D10C 2R17C 4PS3A 3O4ZA 1MQSA 3B7UX 5JHBA 5BNWA 4U63A 2HM8A 2LNIA 4C9BB 1HO8A 3QKYA 2WXRA 3QJZA 3G2SA 4GCNA 3ZHEA 3HIZA 5ANRA 4B0ZA 4B89A 4ANVA 2DBAA 3IKOB 4JA7A 2I2OA 1SQMA 4J6IA 1EDUA 2ONDA 2IQCA 5G55A 2KATA 5T8IA 3MV2B 1JWFA 5LFAA 3SHFA 4FHKA 3L54A 5BV1A 4DJAA 5E76A 4N3CA 3JCKC 3PNTB 4JEHA 4EBAA 4M3OA 4KVMA 4ACKA 4AEZC 2WQ7A 2FF4A 2LSVA 1OWPA 1FVFA 4ILGA 3DPDA 4FC8A 4G23A 2WXPA 1QQEA 4RSYA 1HF8A 3RO3A 3S7DA 1HX8A 3SNXA 3LS8A 3VLFA 3CR3A 4E85A 2WXMA 4L7TA 2CHWA 5JJ7A 3KS2A 3PE3A 2XPZA 4OVVA 4TRQA 4UQYA 5J90A 1QNFA 4LUNU 5CMYA 3U66A 4HOSA 3G2UA 1Z3YA 4Y6CA 5AYWD 4FU3A 4AVXA 4BSXA 3BG0B 1S0PA 3SFZA 3FTXA 2XGSA 3PUKA 4AJWA 3FUKA 5CMWA 2XCCA 4GA0A 2VSOE 4F1SA 1INZA 4PUCA 3O48A 1X5BA 3ZGQA 1PAQA 4XZ4A 3ZRHA 2CHXA 3QWPA 4URKA 3FDHA 4UWGA 2GW1A 3D9IA 1E8XA 2XRYA 3TAXA 4AXHA 2LO6A 3D9LA 4J8DA 2VTBA 5G2NA 3CVUA 4U0UA 2PZIA 2NC9A 2CG2A 2PL2A 3FTYA 4LRZA 1ZBPA 4JL0A 3CVPA 4CDRA 5KJLA 3CLJA 2V0PA 4JA9A 4XX5A 4J8EA 5FZRA 5KJMA 3JQ1A 3FEYA 5G04J 3CVVA 3FULA 5FT9A 4ILHB 4YVQC 3SZ7A 2WXQA 3RJVA 3CHRA 1NA0A 3NZUA 3AS4A 2WXOA 2DIWA 4P29A 5A6CA 1EPUA 3FP3A 2L0TB 3Q49B 4HFGA 3D9KA 3HDXA 2WQ6A 3SBTB 3CHQA 3R7RA 3KAEA 3UT8A 3CK9A 4B8AA 4BX8A 4HOUA 2J9QA 2KZTA 1IQUA 4U0ZA 1PC2A 4N2QA 4GB9A 3TG4A 4IULA 3UPVA 4I1MA 5FJYA 2R59A 4HXIA 1JPLA 4G26A 3CVWA 4G1TA 4KZ0A 4F7AA 3ZYLA 3BEEA 3IHYA 3B7SA 3T5XA 3E4BA 4I6GA 3ZHEB 4NACA 4WWNA 3JQ0A 1H6KA 3LY7A 1Z3XA 2AVPA 3GZSA 5DIZA 1ELRA 1YA0A 1NP7A 4U07A 2HO1A 3UX4A 4L2YA 3FUIA 3SF4A 3ZXSA 4F3VA 3I4RB 3MV3B 4ME2A 4JHKA 2Y3AA 4CT0A 5BPPA 4XI0A 2J09A 2R5SA 3EJNA 4KZCA 2I1KA 3TJPA 4I17A 2I1JA 3EHMA 3ZN3A 2A5UA 3ASFA 5G04C 2X38A 4MLPA 2XQ0A 4UI9K 3VLDA 2IU1A 2KCKA 2V8SE 4I9CA 4PH4B 4UWLA 4ACLA 4JPSA 3ASGA 4GMLA 3ENEA 5ARFA 5AIJA 2X6IA 2NXPA 4AM9A 4U8HA 4FA6A 3AS5A 4GA2A 5ENNA 4NURA 3FTVA 3R9AB 1ELWA 4KVOA 3Q4AB 4L1BA 1OWMA 5HI7A 3L16A 2AXUA 3AU4A 2YHEA 2PQRA 3D9NA 4ANUA 3LPZA 3G2WA 3QDNA 4GPKA 4FP7A 4Q96A 3MKQA 2VSXE 3FH7A 4ANXA 5BV0A 4KYOB 4NRHB 3UQ3A 1XNFA 5BUZA 4G2VA 4GMJA 4WWOA 3R7QA 2DCPA 3CVQA 3ONKA 5LCWC 5CHEE 3G2VA 2ZU6B 4KBQA 5FWQA 3RO2A 4CGVA 4BTBA 1DVPA 3IV0A 1HS6A 3DBSA 3WXXA 2AW6A 2MOWA 5M72A 1UW4B 1UJJA 2LSUA 2MRIA 3FH5A 3CSFA 5ARGA 3EIJA 4YNDA 1TJFA 3SBSA 3MA5A 3Q5MA 4L23A 4AIFA 4FLBA 2P58C 4BFRA 3LVRE 3S7JA 1OUVA 4GA1A 2QY7A 3MKQB 4G24A 4PS7A 3B13A 2XGOA 4TV3A 4EQFA 2IOSA 2QFCA 4LCTA 4QFVA 1QZ2A 1U3DA 5C2YA 4BTAA 4EBAG 3CKCA 5FZSA 3U64A 2C0MA 4N39A 1SZ9A 4JVSA 2IOLA 3ZYKA 3LYAA 3ZPJA 4WNFA 3QARA 2VGXA 2IJGX 4JHJA 1UN9A 3FEXA 4I6EA 4BT9A 1H2TC 4DPRA 3FU5A 3KD7A 2OOEA 2KC7A 4A55A 2KCVA 4AP2A 3ASHA 3GZ2A 4B8CB 2OVBA 2C0LA 2YQ8A 3MKRA 4AY5A 4N3BA 5EX0A 4DI3A 2CHZA 3C98A 2V5FA 4DI4A 4HLEA 3UT7A 4MKTA 1BPOA 3MGBA 4KMOA 1XGWA 1HG2A 1UN8A 1U3CA 3URZA 3QWVA 5LCWJ 3PDNA 3FUJA 3CHSA 1PY1A 3HYMB 3IEGA 2VGXB 4U04A 1H19A 4A3TA 2GRMA 2RG8A 3FFLA 3I4GA 4LERA 4FULA 3ZVVA 5A7DB 3SI5A 1IYGA 2OVFA 2L9BA 1KT1A 2XEVA 3EHNA 3NQPA 5BW8C 4JXTA 5T4YA 1MHQA 2PM7A 1UJKA 2MHKA 2J08A 3CV0A 3D9MA 3FU0A 1E90A 3VLEA 2L0IA 4I1OB 5D0QD 3VTXA 2E0IA 2WXIA 4EZKA 1HZ4A 2KZTB 2FULA 5DBKA 2WQHA 4Y6WA 1OWNA 3ONLA 2I6HA 4U0SA 3KEZA 4GYWA 4L2LA 3D9PA 3P1UA 4I2ZA 4J0UA 1W3BA 4UQXA 4UWHA 1ELKA 2FBNA 5KJNA 2WXFA 2EQXA 1HFAA 3FUEA 3ZFWA 2WVIA 4FLHA 4GZCA 3OXFA 2VSNA 1Y8MA 4K03A 2VYIA 5FQ4A 2AXVA 1UG3A 4FJYA 1IHGA 3FTUA 5E75A 4I2WA 4ANWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FI7 A;  5CCM A;  2FF4 A;  2LSV A;  4UI9 J;  2KCL A;  2PQR A;  3LPZ A;  4G23 A;  3OXL A;  3QDN A;  3RO3 A;  1QQE A;  2E2E A;  4GZ5 A;  3S7D A;  4G25 A;  1B89 A;  1HXI A;  1KT0 A;  5HQ8 A;  2UWJ G;  2VGY A;  3FWV A;  3GW4 A;  5JJ7 A;  3KS2 A;  3PE3 A;  4UQY A;  1A17 A;  3LKU A;  3GZ1 A;  4KYO B;  4YVO A;  4WNG A;  4NRH B;  4UQZ A;  3UQ3 A;  2C2L A;  1XNF A;  2L6J A;  4G2V A;  4JHR A;  3CVQ A;  4BT8 A;  4HOS A;  5LCW C;  3ASD A;  4UI9 C;  4Y6C A;  5CHE E;  4KBQ A;  5AYW D;  3RO2 A;  4CGV A;  4BTB A;  4I1A A;  3WXX A;  4RG9 A;  5M72 A;  2XGS A;  2LSU A;  2BUG A;  4RG6 A;  5G05 J;  5ARG A;  3TG5 A;  2XCC A;  3QOU A;  2WPV A;  4GA0 A;  3CK7 A;  4O6F A;  2HR2 A;  3LY9 A;  5EX3 A;  3OXG A;  2XPI A;  3CK8 A;  4YND A;  5EKQ D;  2UY1 B;  3MA5 A;  3Q5M A;  3O48 A;  4AIF A;  5JJT A;  2P58 C;  3S7J A;  1OUV A;  3ZGQ A;  5JJ6 A;  4GA1 A;  5BT1 A;  3PE4 A;  4IN3 B;  4APO A;  3QWP A;  4G24 A;  5FZS A;  2GW1 A;  2UY1 A;  2XGO A;  4N5C A;  4XIF A;  3K9I A;  4GZ3 A;  3TGO A;  4H7Y A;  2VQ2 A;  2PQN A;  5G05 C;  3TAX A;  3QWW A;  2QFC A;  4EQF A;  2Q7F A;  1QZ2 A;  2XCB A;  4J8D A;  4BTA A;  3CEQ A;  4GPK A;  4U0U A;  2PZI A;  3AS8 A;  2NC9 A;  2C0M A;  3CKC A;  3Q15 A;  2PL2 A;  4H7X A;  4N39 A;  3LYA A;  5FTP A;  4WNF A;  3ZPJ A;  1ZBP A;  4JL0 A;  3CVP A;  4WUY A;  4CDR A;  5KJL A;  2VGX A;  3MEK A;  1NZN A;  4JA9 A;  4J8F A;  4NQ0 A;  3VTY A;  4J8E A;  5FZR A;  4BT9 A;  5KJM A;  3KD7 A;  5G04 J;  2OOE A;  2FEZ A;  2KC7 A;  3ULQ A;  3CVL A;  5FT9 A;  4HOR A;  2KCV A;  2YHC A;  4YVQ C;  3SZ7 A;  3ASH A;  3RJV A;  3GZ2 A;  1NA0 A;  4N2S A;  3AS4 A;  2C0L A;  2YQ8 A;  3MKR A;  1WAO 1;  4N3B A;  3LY8 A;  5FZQ A;  5EX0 A;  4B94 A;  5A6C A;  3FP3 A;  3RKV A;  4LEU A;  3S7F A;  3Q49 B;  4GZ6 A;  2V5F A;  3CKB A;  3JYS A;  4AY5 A;  3RIB A;  3N71 A;  4I9E A;  1WM5 A;  3RU0 A;  3KAE A;  3URZ A;  1P5Q A;  3CK9 A;  3QWV A;  3UUX A;  2Y4T A;  5LCW J;  1KLX A;  3PDN A;  4HOU A;  2J9Q A;  3HYM B;  3IEG A;  5C1D A;  4U0Z A;  2VGX B;  1PC2 A;  5CCL A;  4N2Q A;  2Y4U A;  4U04 A;  3TG4 A;  3LCA A;  3UPV A;  3Q47 B;  4WND A;  5FJY A;  3FFL A;  4BWR A;  4N3A A;  5A7D B;  5KJK A;  4G26 A;  4XI9 A;  5HI7 A;  1IYG A;  1NA3 A;  1KT1 A;  2XEV A;  4G1T A;  4WNE A;  5BW8 C;  3BEE A;  4ABN A;  2HYZ A;  3E4B A;  2XGM A;  3ZHE B;  2MHK A;  1HH8 A;  3CV0 A;  4HOT A;  1TJC A;  2FO7 A;  3LY7 A;  3NF1 A;  4GYO A;  2AVP A;  5D0Q D;  5D0O D;  3U4T A;  1ZU2 A;  3VTX A;  3CVN A;  5DIZ A;  1ELR A;  1HZ4 A;  1YA0 A;  5BNW A;  3ESK A;  4U07 A;  2HO1 A;  5DBK A;  3SF4 A;  4F3V A;  2WQH A;  2LNI A;  4CGW A;  3MV3 B;  2VSY A;  4GCO A;  3QKY A;  4ME2 A;  4Y6W A;  2I6H A;  3EDT B;  4U0S A;  4GYW A;  4XI0 A;  2R5S A;  4GYY A;  4HOQ A;  2IF4 A;  4I2Z A;  4W9R A;  4GCN A;  4I17 A;  3ZHE A;  3ZN3 A;  4J0U A;  3ASF A;  5G04 C;  1W3B A;  1FCH A;  4UQX A;  4UI9 K;  4AY6 A;  2DBA A;  2FBN A;  2KCK A;  5KJN A;  2JLB A;  4I9C A;  4JA7 A;  3ZFW A;  3ASG A;  3U3W A;  5ARF A;  3OXF A;  2VSN A;  2OND A;  1E96 B;  1Y8M A;  2VYI A;  4AM9 A;  2KAT A;  3MV2 B;  3AS5 A;  4GA2 A;  4KXK B;  3R9A B;  3S7B A;  1ELW A;  2IFU A;  3GYZ A;  1IHG A;  3Q4A B;  4N3C A;  4I2W A;  4A1S A; 
#chains in the Genus database with same CATH topology
 4FAD A;  5AJD A;  1QYM A;  1KT0 A;  2CG3 A;  2UWJ G;  3GW4 A;  1H6P A;  2L6J A;  4GTM A;  4UWF A;  4AOF A;  4UI9 C;  2OCC E;  3PH0 C;  3PVL A;  1RZ4 A;  4CDN A;  4PDX A;  1KZP A;  3J5P A;  2J4B A;  2JEK A;  4XIF A;  4GZ3 A;  4H7Y A;  3CHM A;  2AXZ A;  4ZHB A;  4G11 A;  2XRZ A;  1NZN A;  3TL5 A;  3RK6 A;  1E7U A;  5J08 A;  2FEZ A;  3CVL A;  4GTP A;  3ZW3 A;  1HG5 A;  3LY8 A;  4CCA A;  3RKV A;  4LEU A;  3S7F A;  3JUI A;  2J49 A;  4WWP A;  3NOC D;  3HG0 D;  3G2T A;  4CDM A;  1TN6 A;  3Q47 B;  4C48 B;  3P2B A;  3PS6 A;  4WNE A;  3PUJ A;  4CEM A;  5LX8 A;  1TNY A;  4ILI A;  3OAW A;  5D0O D;  4A1G A;  2F37 A;  3HVE A;  4I6J A;  3SD5 A;  2BKG A;  3EDT B;  4GYY A;  2ILR A;  1K1A A;  2WXL A;  2V5Q C;  5KWD A;  1FCH A;  4JZY A;  1OCC E;  3CQC B;  1KPS B;  1U2V G;  5CEA A;  3PZD A;  1E96 B;  4MRU A;  2A5E A;  4RVB A;  4DLO A;  4KXK B;  3MCX A;  3GYZ A;  2OEV A;  3T5V A;  5ENP D;  3TXN A;  4GZ5 A;  2E2E A;  3FTW A;  1HXI A;  2VGY A;  2BF0 X;  4C0E A;  2DZN A;  1A17 A;  3HHM A;  1Y6I A;  2AWI A;  3CQG B;  2P9N G;  4F53 A;  4B93 B;  4I1A A;  5EIL A;  2XEE A;  3FUN A;  1UOH A;  3QOU A;  1WY6 A;  3OXG A;  3CK8 A;  3TWR A;  3CVY A;  4EZL A;  3IBE A;  4IN3 B;  2L6B A;  2LXL A;  3CHO A;  2GGF A;  2PQN A;  1N4P A;  4CT4 A;  3SGH A;  2LAH A;  5CRU A;  5FZQ A;  3RRU A;  4G8K A;  3N71 A;  2KM4 A;  3ZYQ A;  1KLX A;  3ML9 A;  2Y4U A;  4WND A;  2GRR B;  4HI8 A;  4J8S A;  3FU6 A;  2NYJ A;  1DC2 A;  4ABN A;  2HYZ A;  1H0A A;  1HH8 A;  2HM8 A;  3QKY A;  1V54 E;  3G2S A;  2XEN A;  2XZD G;  3J5Q B;  4J6I A;  2OND A;  3MV2 B;  1JWF A;  3SHF A;  4M3O A;  5D66 A;  1OWP A;  4G23 A;  5HQ8 A;  3SNX A;  1HF8 A;  3S7D A;  1HX8 A;  3CR3 A;  4L7T A;  4OVV A;  1TNZ A;  3Q79 A;  3V2O A;  3FTX A;  4AJW A;  1S64 A;  5CMW A;  1INZ A;  2H6G A;  3V2X A;  4BEP A;  1X5B A;  3ZRH A;  4XZ4 A;  1D8D A;  4UWG A;  4J8D A;  2NC9 A;  2PL2 A;  4CDR A;  3CVP A;  3CLJ A;  3T9K A;  2V0P A;  4J8E A;  3JQ1 A;  1TNO A;  3FUL A;  1KZO A;  2WXO A;  3FP3 A;  2L0T B;  3ABM E;  3CHQ A;  3UT8 A;  1S63 A;  4BX8 A;  4HOU A;  1IXV A;  4GB9 A;  4G26 A;  3Q7A A;  4BSZ B;  3C3O A;  4I6G A;  4LNB A;  3JQ0 A;  1H6K A;  1Z3X A;  3SO8 A;  3AJI A;  2QC9 A;  3I4R B;  5BPP A;  1N4R A;  4XI0 A;  3EHM A;  4UI9 K;  4UWL A;  1TYQ G;  3ENE A;  3HXE A;  5IY5 E;  2J8S D;  4FA6 A;  3ASN E;  3L16 A;  2R2L A;  3LPZ A;  3G2W A;  2RFM A;  3UKU G;  3ZUV B;  1OCR E;  3UQ3 A;  5BUZ A;  1DCE A;  4WWO A;  3CVQ A;  3ONK A;  4DX2 A;  3WXX A;  2AW6 A;  1UW4 B;  1UJJ A;  2MRI A;  3CSF A;  1YYH A;  3SBS A;  3DST A;  3JUE A;  2RKK A;  3S7J A;  4G24 A;  4OAU C;  4Z68 A;  2P9I G;  5C2Y A;  1QZ2 A;  1LTX A;  3ZYK A;  2B6C A;  2IJG X;  4A55 A;  4B8C B;  3R9M A;  4AY5 A;  3MKR A;  1A5E A;  4N3B A;  4DI3 A;  3C98 A;  4KMO A;  3QWV A;  3PDN A;  3CHS A;  2H6F A;  1H19 A;  2RG8 A;  5A7D B;  5CBO A;  3DWL G;  1MHQ A;  1TNU A;  2MHK A;  2J08 A;  3FU0 A;  3T8K A;  2WQH A;  3KEZ A;  4GYW A;  3C72 A;  2WXF A;  2EQX A;  1JCR A;  3OXF A;  5FQ4 A;  2AXV A;  2P9K G;  4YVO A;  2X6J A;  5FIO A;  3QC1 A;  4FJZ A;  1G3N B;  3UMV A;  3U9W A;  4JHR A;  5B1B E;  2GRP B;  3C3R A;  1FVH A;  3FUF A;  1MZC A;  2UY1 B;  2X6F A;  4LG6 A;  5JJT A;  4GTT A;  1Z6T A;  2NSZ A;  3PZ2 A;  3PE4 A;  3MZL B;  3CGH A;  2H6H A;  3TXM A;  1JUQ A;  2X6K A;  2VQ2 A;  5LP0 A;  4N2S A;  2WXJ A;  3MEK A;  4J8F A;  3FUM A;  4O1P A;  3PRE A;  1WAO 1;  3X2Q E;  4GZ6 A;  4Q69 A;  3RIB A;  4GTQ A;  3UM2 A;  4IYP A;  3UUX A;  3ZNG A;  4U7E B;  4EHM A;  2R03 A;  4N3A A;  4XI9 A;  5EDS A;  1NA3 A;  4LNU D;  4DK5 A;  1HE8 A;  4JC8 A;  1EYH A;  3KSL A;  5JHA A;  1AWC B;  3Q7F A;  1LD8 A;  3B95 A;  4TUU A;  4HOQ A;  4WAF A;  4UWK A;  1MX2 A;  2ION A;  5CED B;  5KCM A;  1SZA A;  4AY6 A;  1SA4 A;  2DYS E;  3L13 A;  3LXU X;  2A4Z A;  4JD2 G;  5ENT D;  4JB8 P;  2YNQ A;  3V31 A;  1B89 A;  4BES A;  3HXD A;  2PM6 A;  3LKU A;  4AV7 A;  3TWU A;  4F1P A;  2C2L A;  3L6A A;  1E8Y A;  3HXB A;  4RG9 A;  3DRA A;  1N0Q A;  2LAI A;  3CK7 A;  2XPI A;  4APO A;  3RRN B;  3QAQ A;  1E8Z A;  3MX3 A;  5ITZ F;  4FHJ A;  1Z5S C;  1BI7 B;  3Q73 A;  3ML8 A;  3W9F A;  4OYS A;  3UM1 A;  2HE0 A;  4C0M A;  3NOG D;  1WM5 A;  3CVX A;  3CHP A;  4JEU A;  3LCA A;  4XE0 A;  4M7C A;  1IQR A;  5CEC B;  3SQV A;  2X6H A;  2P9S G;  2J07 A;  2FO7 A;  4NIK A;  4OVU A;  1ZU2 A;  1K8K G;  5JHB A;  3E33 A;  2LNI A;  1YCS B;  5EN5 D;  4O60 A;  4HQD A;  3ZHE A;  2P2C P;  3HIZ A;  4B0Z A;  4ANV A;  3IKO B;  2I2O A;  1IHB A;  1EDU A;  3D9H A;  5LFA A;  3DPY A;  4FHK A;  3UI2 A;  1SW6 A;  3PNT B;  4JEH A;  4EBA A;  4AEZ C;  3NBN B;  2WQ7 A;  2FF4 A;  2LSV A;  4DX7 D;  4FC8 A;  1QQE A;  4RSY A;  3VLF A;  4E85 A;  2CHW A;  2XPZ A;  1OY3 D;  1QNF A;  3U66 A;  4HOS A;  3G2U A;  4Y6C A;  2ZIR A;  4BSX A;  3BG0 B;  2XGS A;  2XCC A;  4GA0 A;  2VSO E;  4F1S A;  5BXU A;  4PUC A;  3ZKJ A;  4DX1 A;  3O48 A;  3AG2 E;  4TXP A;  3QWP A;  2GW1 A;  1E8X A;  2LO6 A;  3CVU A;  2PZI A;  3FTY A;  4JL0 A;  5KJL A;  4HRM B;  3FEY A;  5G04 J;  1NFI E;  5FT9 A;  4YVQ C;  1NA0 A;  3AS4 A;  1EPU A;  2GRN B;  3Q49 B;  4UUC A;  4HFG A;  2QYJ A;  3HDX A;  2WQ6 A;  2AJA A;  4B8A A;  1O1T A;  2J9Q A;  2KZT A;  1IQU A;  4U0Z A;  3UPV A;  2V4H C;  4I1M A;  5FJY A;  2XS8 A;  1JPL A;  1NL4 A;  4G1T A;  4KZ0 A;  4F7A A;  3BEE A;  1BI8 B;  1WDY A;  3ZHE B;  4NAC A;  4TUM A;  4WWN A;  3LY7 A;  2AVP A;  5AAO A;  5DIZ A;  1YA0 A;  2HO1 A;  3UX4 A;  4L2Y A;  4F3V A;  3ZXS A;  4ME2 A;  4CT0 A;  4MBG A;  1N11 A;  4I17 A;  5G04 C;  4MLP A;  3VLD A;  3JXJ A;  2KCK A;  4PH4 B;  4ACL A;  3ASG A;  4GML A;  2X6I A;  2XZT G;  2NXP A;  4AM9 A;  5ENN A;  4NUR A;  3Q4A B;  5HI7 A;  1O5M A;  3AU4 A;  2PQR A;  3D9N A;  4ANU A;  4GPK A;  4RLY A;  2VSX E;  4ANX A;  5BV0 A;  4HRN A;  1XNF A;  4G2V A;  4GMJ A;  2DCP A;  5CHE E;  3RO2 A;  5FWQ A;  1HS6 A;  5M72 A;  1LD7 A;  4XEI G;  1TN7 A;  3Q5M A;  2P58 C;  4BFR A;  3LVR E;  2R02 A;  4GA1 A;  3MKQ B;  4QFV A;  4LCT A;  3CKC A;  3QAR A;  2VGX A;  1UN9 A;  2DYR E;  5ENQ D;  1ZB1 A;  3PZ1 A;  2Y1L E;  2OVB A;  5EX0 A;  2CHZ A;  4MKT A;  1BPO A;  1XGW A;  3URZ A;  1U3C A;  3FUJ A;  2VGX B;  2GRM A;  3FFL A;  3ZVV A;  2RFA A;  3DSU A;  3NQP A;  2L9B A;  1KT1 A;  5BW8 C;  3SY2 A;  5T4Y A;  3RAU A;  3CV0 A;  3D9M A;  5D0Q D;  1HZ4 A;  1AP7 A;  3ONL A;  4U0S A;  4L2L A;  3P1U A;  4ZFH A;  1N9A A;  2FBN A;  5KJN A;  3FUE A;  3ZFW A;  2VSN A;  2VYI A;  4YDO A;  4K5B A;  3KSQ A;  1MJ0 A;  2FI7 A;  5CCM A;  2VTB B;  1DCQ A;  3OXL A;  3AU5 A;  3HVE B;  4HNA D;  3UIP C;  4GTV A;  4GTO A;  4UQZ A;  2I9C A;  3LVQ E;  4DRX E;  3EU5 A;  3Q9U C;  3TG5 A;  2WMN A;  5AJL A;  5EX3 A;  2EIM E;  3BUA A;  3LY9 A;  5EKQ D;  4EPZ A;  2XS1 A;  4K5C A;  1TEZ A;  1H2V C;  4MS6 A;  2UY1 A;  4IRU A;  3AS8 A;  5A23 A;  3ULQ A;  5FQ7 A;  1DNP A;  3E32 A;  3FTS A;  4CRW A;  3AG4 E;  5T3R A;  3LJ3 A;  4DUI A;  3RRM B;  1HU3 A;  2BTD A;  1LF8 A;  1OWL A;  4XKC A;  3LDZ A;  3CVN A;  3PEV B;  1N52 A;  2VSY A;  4GCO A;  4EZJ A;  1D8E A;  1OWO A;  2WXN A;  3EHQ A;  3I5P A;  3QK0 A;  2IF4 A;  3ULE G;  4PS8 A;  5H7P A;  4O1O A;  4DX5 D;  1FT1 A;  4GU5 A;  4GTS A;  2IY0 C;  4LSZ E;  4U8V D;  3FHE A;  2M63 A;  2J4D A;  2XPY A;  2ZGD A;  1V55 E;  4JW1 A;  4UI9 J;  2KCL A;  3ZXP A;  4G25 A;  2XHE A;  3GZ1 A;  3OTN A;  3D9J A;  4BT8 A;  3QNK A;  1E8W A;  4OAV B;  4KT6 B;  4APF A;  4A3V A;  2BUG A;  3FTZ A;  4LNG A;  4O6F A;  3D9O A;  3UM0 A;  3PZ4 A;  5KNG A;  1TNB A;  3FU3 A;  4BX9 A;  3K9I A;  3QB2 A;  4XKB A;  5G05 C;  3TWS A;  2XCB A;  3FH8 A;  5CRV A;  4BY6 A;  4J7W A;  3B7R L;  1JWG A;  5AN8 A;  5FQ6 A;  3VTY A;  5ENS D;  1K3Z D;  5ENR D;  3DSV A;  2WMO A;  5AEN A;  1NI1 A;  3APD A;  2WXH A;  4B94 A;  2F8X K;  3CKB A;  3JYS A;  1IKN D;  5JA4 D;  2VJ8 A;  3I3N A;  1VDY A;  5KJK A;  2PNN A;  4GZD A;  2ETA A;  3TWQ A;  3UKR G;  4EEC A;  3PRZ A;  3HRA A;  5HRY A;  1YMP A;  3BQO A;  3L22 A;  2R17 C;  3O4Z A;  1MQS A;  1HO8 A;  5B3S E;  1N94 A;  3QJZ A;  1MYO A;  4B89 A;  4TXR A;  2DBA A;  1SQM A;  1N4Q A;  2LXM A;  2IQC A;  2KAT A;  5T8I A;  3RSE G;  4DJA A;  2F0Y A;  5E76 A;  4N3C A;  3JCK C;  4KVM A;  4ACK A;  1H6O A;  4ILG A;  1FVF A;  3DPD A;  3RO3 A;  2WXM A;  5JJ7 A;  3KS2 A;  3PE3 A;  4TRQ A;  4UQY A;  5J90 A;  4CYM D;  5CMY A;  3SFX A;  5AYW D;  4FU3 A;  4AVX A;  3SFZ A;  3DSS A;  2ETC A;  1PAQ A;  4TXQ A;  4L9P A;  3TAX A;  3D9L A;  4GPM A;  2CG2 A;  2EIN E;  4HB5 A;  4DX6 D;  3HXF A;  5FZR A;  4ILH B;  2WXQ A;  3RJV A;  2KXP C;  3NZU A;  4P29 A;  5A6C A;  3E37 A;  2KBX A;  4HI9 A;  1FPP A;  3R7R A;  3KAE A;  3CK9 A;  4IUL A;  1FT2 A;  2R59 A;  1MX4 A;  3B7S A;  3T5X A;  2EIK E;  3GZS A;  1NP7 A;  4U07 A;  3SF4 A;  3FUI A;  3MV3 B;  2Y3A A;  2J09 A;  2R5S A;  3EJN A;  2I1J A;  2A5U A;  1SVX A;  4I9C A;  4JPS A;  4YDY A;  4RQI A;  5ARF A;  5AIJ A;  2QZA A;  4J8Y A;  4U8H A;  3AS5 A;  3FTV A;  1ELW A;  2AXU A;  3TWW A;  4ATZ D;  2YHE A;  3QDN A;  4F6R D;  4Q96 A;  5EYP F;  4BET A;  4KYO B;  4NRH B;  5LCW C;  3G2V A;  4CGV A;  4BTB A;  1DVP A;  3IV0 A;  3LJN A;  3DBS A;  2MOW A;  1SA5 A;  2LSU A;  3FH5 A;  1BD8 A;  4YND A;  3MA5 A;  4L23 A;  3L82 A;  2QY7 A;  2Y0B G;  2IOS A;  2QFC A;  4EBA G;  1U3D A;  4BTA A;  2FO1 E;  2C0M A;  4JVS A;  4U96 D;  4WNF A;  3FEX A;  4BT9 A;  1H2T C;  5AAR A;  2KC7 A;  3UXG A;  4AP2 A;  3ASH A;  2C0L A;  2YQ8 A;  3ABL E;  1OT8 A;  5AQB A;  5EIB E;  4DI4 A;  3MGB A;  3DXM G;  1HG2 A;  3IEG A;  4A3T A;  3I4G A;  4FUL A;  3ZU7 B;  1IYG A;  3EHN A;  2F8Y A;  4JXT A;  2PM7 A;  4U95 D;  1UJK A;  2P9U G;  1E90 A;  3VLE A;  4I1O B;  2E0I A;  2WXI A;  4EZK A;  2FUL A;  3V30 A;  3D9P A;  4I2Z A;  4J0U A;  1W3B A;  4UQX A;  4UWH A;  4GZC A;  1Y8M A;  5FIN A;  2DVW A;  1UG3 A;  4FJY A;  1IHG A;  4C9B B;  3FTU A;  5E75 A;  4W9R A;  4I2W A;  2ETB A;  2RD0 A;  4A1S A;  3DEO A;  3EIQ C;  4WNG A;  2Y69 E;  4U8Y D;  3BU8 A;  2DZO A;  3PNL B;  2H6I A;  4Q94 A;  2X3M A;  5AQA A;  4RG6 A;  5G05 J;  3BG1 B;  2HR2 A;  3PEU B;  2WM9 A;  3NZS A;  1H2U A;  3CIA A;  3D3M A;  4YDW A;  4ATG A;  4X8Q A;  2CFZ A;  3TWX A;  4GMR A;  4HS2 A;  4N5C A;  3TGO A;  3LEW A;  3MYV A;  1Q2Z A;  2Q7F A;  3CST A;  4H7X A;  3Q15 A;  1EF1 C;  4HLL A;  4I43 A;  5ENO D;  3ZEF A;  4HOR A;  1OCZ E;  5AQ7 A;  3APF A;  2GRL A;  3SFY A;  2IO3 C;  5ANL A;  3RU0 A;  1BU9 A;  2P9P G;  3DSW A;  3ZYM A;  5CCL A;  1N54 A;  5D2M C;  2MYO A;  2V4L A;  3AG1 E;  4R7L A;  2YIN A;  2EIL E;  4CGW A;  3ESK A;  4HOT A;  5JMN D;  1E7V A;  3UM3 A;  2GRQ B;  2WXK A;  1GW6 A;  3UIO C;  2JLB A;  3UT4 A;  2P9L G;  4DLQ A;  3U3W A;  1L5J A;  3ESL A;  3DEP A;  3B7B A;  2IEJ A;  4K0R A;  2IFU A;  3L17 A;  2BKK B;  1BLX B;  3APC A;  3FWV A;  3L08 A;  5LOZ A;  4HVB A;  3ASD A;  3S2A A;  2WXG A;  3FUH A;  3S7B A;  2WPV A;  4V3I A;  3SZ7 A;  3MJW A;  5JJ6 A;  5BT1 A;  3NB2 A;  3FY4 A;  3FUD A;  4E6H A;  2VGE A;  3QWW A;  3NAW A;  3CEQ A;  5B1A E;  4GAA A;  2WB2 A;  5FTP A;  1N4S A;  4WUY A;  3IXE A;  4NQ0 A;  2YHC A;  3AG3 E;  2OV8 A;  2CFU A;  4I9E A;  1P5Q A;  2Y4T A;  3ULY A;  3ZIM A;  4K5A B;  5FQ8 A;  5C1D A;  4BWR A;  4QQI A;  3E30 A;  1TR4 A;  2XGM A;  3B7T A;  3T8M A;  1TJC A;  4GYO A;  3NF1 A;  3IHV A;  4D10 C;  1N95 A;  3U4T A;  4PS3 A;  3B7U X;  5BNW A;  4U63 A;  1JCS A;  5CER B;  2WXR A;  1MX6 A;  2QYU A;  4GCN A;  2OEW A;  3Q78 A;  5ANR A;  4CZ2 D;  1S70 B;  1JCQ A;  2ZIS A;  4JA7 A;  1WG0 A;  3HXC A;  5G55 A;  3L54 A;  5BV1 A;  5EID A;  3EHR A;  4HBD A;  2WXP A;  3LS8 A;  1QBQ A;  4LUN U;  1Z3Y A;  1S0P A;  2JAB A;  5AQ9 A;  3PUK A;  3FUK A;  3DSX A;  3ZGQ A;  5CBN A;  2CHX A;  4YDE A;  4URK A;  3FDH A;  3D9I A;  2XRY A;  4AXH A;  1OXJ A;  2VTB A;  5G2N A;  3ISM C;  4U0U A;  1K1B A;  4LRZ A;  1ZBP A;  4JA9 A;  4XX5 A;  5KJM A;  3CVV A;  3CHR A;  2DIW A;  3C5R A;  2GRO B;  3D9K A;  3SBT B;  3TWT A;  1PC2 A;  4N2Q A;  3TG4 A;  4HXI A;  3CVW A;  3WG7 E;  2ZXW E;  2DWZ A;  3ZYL A;  3IHY A;  3E4B A;  3UTM A;  1N0R A;  1D9S A;  1ELR A;  5BXO A;  2XEH A;  4JHK A;  1O1R A;  4BER A;  4KZC A;  2I1K A;  3TJP A;  3AAA C;  3E34 A;  3ZN3 A;  3F6Q A;  3ASF A;  2X38 A;  2XQ0 A;  2IU1 A;  2V8S E;  2IO2 C;  4GA2 A;  3R9A B;  4KVO A;  4L1B A;  1OWM A;  3PZ3 A;  3C3Q A;  1O1S A;  3L9T A;  2LUH A;  4FP7 A;  2EIJ E;  3MKQ A;  3FH7 A;  3Q75 A;  3JXI A;  3R7Q A;  3DXK G;  4A63 B;  4KBQ A;  2ZU6 B;  1X81 A;  4HRL A;  3W9G A;  5EYL A;  5ARG A;  3Q9N C;  3EIJ A;  1TJF A;  3TWV A;  4AIF A;  4FLB A;  1OUV A;  4PS7 A;  3ASO E;  3B13 A;  2XGO A;  4GTR A;  4TV3 A;  4EQF A;  5FZS A;  3U64 A;  4N39 A;  1SZ9 A;  2IOL A;  3LYA A;  3ZPJ A;  1RW2 A;  3V79 K;  4JHJ A;  4I6E A;  4DPR A;  3FU5 A;  3KD7 A;  2OOE A;  3UIN C;  2KCV A;  3EU9 A;  3GZ2 A;  5KBA A;  2R05 A;  3EUV A;  2V5F A;  4HLE A;  3UT7 A;  1UN8 A;  5LCW J;  1PY1 A;  3HYM B;  4U04 A;  4LER A;  3SI5 A;  2OVF A;  2XEV A;  4G8L A;  2BED A;  1OCO E;  5HS0 A;  1TN8 A;  2L0I A;  3VTX A;  4N5Q A;  2KZT B;  5DBK A;  4Y6W A;  1OWN A;  3KEA A;  3ABK E;  2I6H A;  1ELK A;  1HFA A;  2WVI A;  4FLH A;  5HKP A;  2ZGG A;  4K03 A;  5KNH D;  2B0O E;  4ANW A; 
#chains in the Genus database with same CATH homology
 2FI7 A;  2X6J A;  4FAD A;  5CCM A;  2VTB B;  5AJD A;  2RD0 A;  4A1S A;  3QC1 A;  3OXL A;  4FJZ A;  3AU5 A;  1KT0 A;  2CG3 A;  2UWJ G;  3GW4 A;  3HVE B;  3UMV A;  3EIQ C;  4WNG A;  4UQZ A;  2I9C A;  2L6J A;  4UWF A;  3U9W A;  4JHR A;  3LVQ E;  4AOF A;  4UI9 C;  3PNL B;  3PH0 C;  3PVL A;  4Q94 A;  2X3M A;  4CDN A;  1FVH A;  4RG6 A;  5G05 J;  3TG5 A;  3BG1 B;  3FUF A;  2WMN A;  5AJL A;  5EX3 A;  4PDX A;  2HR2 A;  3LY9 A;  3PEU B;  5HQ8 A;  2WM9 A;  3NZS A;  1H2U A;  3CIA A;  2UY1 B;  2X6F A;  3D3M A;  5EKQ D;  4EPZ A;  1H2V C;  1TEZ A;  4ATG A;  5JJT A;  1Z6T A;  2CFZ A;  2NSZ A;  2J4B A;  3PE4 A;  4MS6 A;  3MZL B;  3CGH A;  4HS2 A;  2UY1 A;  4N5C A;  2JEK A;  4IRU A;  4XIF A;  3TXM A;  1JUQ A;  4GZ3 A;  3TGO A;  2X6K A;  2VQ2 A;  3LEW A;  3MYV A;  4H7Y A;  2Q7F A;  5LP0 A;  3CST A;  3CHM A;  3AS8 A;  2AXZ A;  4H7X A;  4N2S A;  3Q15 A;  2WXJ A;  5A23 A;  1EF1 C;  4G11 A;  4I43 A;  2XRZ A;  3MEK A;  1NZN A;  4J8F A;  3FUM A;  3TL5 A;  3ZEF A;  3RK6 A;  1E7U A;  5J08 A;  2FEZ A;  3ULQ A;  3CVL A;  5FQ7 A;  4HOR A;  3PRE A;  3APF A;  2GRL A;  3ZW3 A;  1HG5 A;  1WAO 1;  1DNP A;  3LY8 A;  4CCA A;  3RKV A;  4LEU A;  3S7F A;  3JUI A;  3FTS A;  2J49 A;  4GZ6 A;  4CRW A;  4Q69 A;  3RIB A;  4WWP A;  5ANL A;  3RU0 A;  4IYP A;  3UUX A;  5T3R A;  3ZYM A;  3LJ3 A;  3G2T A;  5CCL A;  3RRM B;  4CDM A;  3Q47 B;  3P2B A;  4N3A A;  1N54 A;  3PS6 A;  4XI9 A;  5EDS A;  1HU3 A;  1NA3 A;  2BTD A;  1LF8 A;  4WNE A;  3PUJ A;  4CEM A;  1OWL A;  5LX8 A;  2V4L A;  4R7L A;  1HE8 A;  4DK5 A;  4ILI A;  4XKC A;  3OAW A;  2YIN A;  4JC8 A;  5D0O D;  4A1G A;  3LDZ A;  3CVN A;  3HVE A;  1EYH A;  4CGW A;  3ESK A;  4I6J A;  4HOT A;  3PEV B;  3SD5 A;  1N52 A;  5JHA A;  2VSY A;  4GCO A;  4EZJ A;  3EDT B;  1OWO A;  1E7V A;  2WXN A;  4TUU A;  2ILR A;  2WXL A;  1GW6 A;  2WXK A;  3I5P A;  2IF4 A;  3QK0 A;  4GYY A;  4HOQ A;  4UWK A;  4W9R A;  4WAF A;  2ION A;  5KCM A;  1FCH A;  1SZA A;  4JZY A;  4PS8 A;  4AY6 A;  2JLB A;  3UT4 A;  3CQC B;  4DLQ A;  3U3W A;  4GU5 A;  1L5J A;  3PZD A;  3L13 A;  1E96 B;  3ESL A;  4MRU A;  4RVB A;  4DLO A;  3LXU X;  4KXK B;  2A4Z A;  3FHE A;  2M63 A;  2J4D A;  2XPY A;  4K0R A;  3MCX A;  2IFU A;  3GYZ A;  3L17 A;  2YNQ A;  3T5V A;  4JW1 A;  4UI9 J;  2KCL A;  3TXN A;  4GZ5 A;  2E2E A;  3FTW A;  3APC A;  4G25 A;  1B89 A;  1HXI A;  2VGY A;  3FWV A;  2BF0 X;  4C0E A;  2PM6 A;  3L08 A;  1A17 A;  3LKU A;  2XHE A;  3GZ1 A;  3OTN A;  4YVO A;  4AV7 A;  2C2L A;  3HHM A;  5LOZ A;  4HVB A;  3D9J A;  3L6A A;  4BT8 A;  1Y6I A;  2AWI A;  3CQG B;  3ASD A;  3QNK A;  1E8W A;  1E8Y A;  4F53 A;  4I1A A;  4RG9 A;  3S2A A;  4KT6 B;  4APF A;  4A3V A;  2BUG A;  3FTZ A;  2WXG A;  3FUN A;  3FUH A;  2LAI A;  2WPV A;  3QOU A;  3CK7 A;  4O6F A;  1WY6 A;  4V3I A;  3S7B A;  3OXG A;  2XPI A;  3CK8 A;  3D9O A;  3CVY A;  4EZL A;  3IBE A;  3FU3 A;  3MJW A;  5JJ6 A;  5BT1 A;  4IN3 B;  4APO A;  3FY4 A;  3FUD A;  4E6H A;  3RRN B;  3QAQ A;  1E8Z A;  4BX9 A;  3CHO A;  3K9I A;  3QB2 A;  2GGF A;  4XKB A;  2PQN A;  5G05 C;  3MX3 A;  3QWW A;  2XCB A;  3FH8 A;  4BY6 A;  3CEQ A;  4FHJ A;  3B7R L;  4GAA A;  2WB2 A;  5FTP A;  4CT4 A;  1JWG A;  5FQ6 A;  4WUY A;  3SGH A;  3ML8 A;  4NQ0 A;  4OYS A;  3VTY A;  2WMO A;  2YHC A;  5AEN A;  4C0M A;  2LAH A;  3APD A;  2WXH A;  5FZQ A;  4B94 A;  2OV8 A;  2CFU A;  3RRU A;  3CKB A;  3JYS A;  3N71 A;  2KM4 A;  1WM5 A;  4I9E A;  3ZYQ A;  1P5Q A;  2Y4T A;  1KLX A;  2VJ8 A;  3I3N A;  3ZIM A;  5FQ8 A;  5C1D A;  3ML9 A;  3CVX A;  1VDY A;  2Y4U A;  3CHP A;  4JEU A;  3LCA A;  4XE0 A;  4BWR A;  4WND A;  1IQR A;  5KJK A;  4J8S A;  4GZD A;  4EEC A;  2X6H A;  3FU6 A;  3PRZ A;  4ABN A;  2HYZ A;  1H0A A;  2XGM A;  3B7T A;  1HH8 A;  3T8M A;  2J07 A;  1TJC A;  2FO7 A;  4GYO A;  3NF1 A;  3IHV A;  3L22 A;  4OVU A;  1ZU2 A;  3U4T A;  4D10 C;  2R17 C;  4PS3 A;  3O4Z A;  1MQS A;  3B7U X;  5JHB A;  5BNW A;  4U63 A;  2HM8 A;  2LNI A;  4C9B B;  1HO8 A;  3QKY A;  2WXR A;  3QJZ A;  3G2S A;  4GCN A;  3ZHE A;  3HIZ A;  5ANR A;  4B0Z A;  4B89 A;  4ANV A;  2DBA A;  3IKO B;  4JA7 A;  2I2O A;  1SQM A;  4J6I A;  1EDU A;  2OND A;  2IQC A;  5G55 A;  2KAT A;  5T8I A;  3MV2 B;  1JWF A;  5LFA A;  3SHF A;  4FHK A;  3L54 A;  5BV1 A;  4DJA A;  5E76 A;  4N3C A;  3JCK C;  3PNT B;  4JEH A;  4EBA A;  4M3O A;  4KVM A;  4ACK A;  4AEZ C;  2WQ7 A;  2FF4 A;  2LSV A;  1OWP A;  1FVF A;  4ILG A;  3DPD A;  4FC8 A;  4G23 A;  2WXP A;  1QQE A;  4RSY A;  1HF8 A;  3RO3 A;  3S7D A;  1HX8 A;  3SNX A;  3LS8 A;  3VLF A;  3CR3 A;  4E85 A;  2WXM A;  4L7T A;  2CHW A;  5JJ7 A;  3KS2 A;  3PE3 A;  2XPZ A;  4OVV A;  4TRQ A;  4UQY A;  5J90 A;  1QNF A;  4LUN U;  5CMY A;  3U66 A;  4HOS A;  3G2U A;  1Z3Y A;  4Y6C A;  5AYW D;  4FU3 A;  4AVX A;  4BSX A;  3BG0 B;  1S0P A;  3SFZ A;  3FTX A;  2XGS A;  3PUK A;  4AJW A;  3FUK A;  5CMW A;  2XCC A;  4GA0 A;  2VSO E;  4F1S A;  1INZ A;  4PUC A;  3O48 A;  1X5B A;  3ZGQ A;  1PAQ A;  4XZ4 A;  3ZRH A;  2CHX A;  3QWP A;  4URK A;  3FDH A;  4UWG A;  2GW1 A;  3D9I A;  1E8X A;  2XRY A;  3TAX A;  4AXH A;  2LO6 A;  3D9L A;  4J8D A;  2VTB A;  5G2N A;  3CVU A;  4U0U A;  2PZI A;  2NC9 A;  2CG2 A;  2PL2 A;  3FTY A;  4LRZ A;  1ZBP A;  4JL0 A;  3CVP A;  4CDR A;  5KJL A;  3CLJ A;  2V0P A;  4JA9 A;  4XX5 A;  4J8E A;  5FZR A;  5KJM A;  3JQ1 A;  3FEY A;  5G04 J;  3CVV A;  3FUL A;  5FT9 A;  4ILH B;  4YVQ C;  3SZ7 A;  2WXQ A;  3RJV A;  3CHR A;  1NA0 A;  3NZU A;  3AS4 A;  2WXO A;  2DIW A;  4P29 A;  5A6C A;  1EPU A;  3FP3 A;  2L0T B;  3Q49 B;  4HFG A;  3D9K A;  3HDX A;  2WQ6 A;  3SBT B;  3CHQ A;  3R7R A;  3KAE A;  3UT8 A;  3CK9 A;  4B8A A;  4BX8 A;  4HOU A;  2J9Q A;  2KZT A;  1IQU A;  4U0Z A;  1PC2 A;  4N2Q A;  4GB9 A;  3TG4 A;  4IUL A;  3UPV A;  4I1M A;  5FJY A;  2R59 A;  4HXI A;  1JPL A;  4G26 A;  3CVW A;  4G1T A;  4KZ0 A;  4F7A A;  3ZYL A;  3BEE A;  3IHY A;  3B7S A;  3T5X A;  3E4B A;  4I6G A;  3ZHE B;  4NAC A;  4WWN A;  3JQ0 A;  1H6K A;  3LY7 A;  1Z3X A;  2AVP A;  3GZS A;  5DIZ A;  1ELR A;  1YA0 A;  1NP7 A;  4U07 A;  2HO1 A;  3UX4 A;  4L2Y A;  3FUI A;  3SF4 A;  3ZXS A;  4F3V A;  3I4R B;  3MV3 B;  4ME2 A;  4JHK A;  2Y3A A;  4CT0 A;  5BPP A;  4XI0 A;  2J09 A;  2R5S A;  3EJN A;  4KZC A;  2I1K A;  3TJP A;  4I17 A;  2I1J A;  3EHM A;  3ZN3 A;  2A5U A;  3ASF A;  5G04 C;  2X38 A;  4MLP A;  2XQ0 A;  4UI9 K;  3VLD A;  2IU1 A;  2KCK A;  2V8S E;  4I9C A;  4PH4 B;  4UWL A;  4ACL A;  4JPS A;  3ASG A;  4GML A;  3ENE A;  5ARF A;  5AIJ A;  2X6I A;  2NXP A;  4AM9 A;  4U8H A;  4FA6 A;  3AS5 A;  4GA2 A;  5ENN A;  4NUR A;  3FTV A;  3R9A B;  1ELW A;  4KVO A;  3Q4A B;  4L1B A;  1OWM A;  5HI7 A;  3L16 A;  2AXU A;  3AU4 A;  2YHE A;  2PQR A;  3D9N A;  4ANU A;  3LPZ A;  3G2W A;  3QDN A;  4GPK A;  4FP7 A;  4Q96 A;  3MKQ A;  2VSX E;  3FH7 A;  4ANX A;  5BV0 A;  4KYO B;  4NRH B;  3UQ3 A;  1XNF A;  5BUZ A;  4G2V A;  4GMJ A;  4WWO A;  3R7Q A;  2DCP A;  3CVQ A;  3ONK A;  5LCW C;  5CHE E;  3G2V A;  2ZU6 B;  4KBQ A;  5FWQ A;  3RO2 A;  4CGV A;  4BTB A;  1DVP A;  3IV0 A;  1HS6 A;  3DBS A;  3WXX A;  2AW6 A;  2MOW A;  5M72 A;  1UW4 B;  1UJJ A;  2LSU A;  2MRI A;  3FH5 A;  3CSF A;  5ARG A;  3EIJ A;  4YND A;  1TJF A;  3SBS A;  3MA5 A;  3Q5M A;  4L23 A;  4AIF A;  4FLB A;  2P58 C;  4BFR A;  3LVR E;  3S7J A;  1OUV A;  4GA1 A;  2QY7 A;  3MKQ B;  4G24 A;  4PS7 A;  3B13 A;  2XGO A;  4TV3 A;  4EQF A;  2IOS A;  2QFC A;  4LCT A;  4QFV A;  1QZ2 A;  1U3D A;  5C2Y A;  4BTA A;  4EBA G;  3CKC A;  5FZS A;  3U64 A;  2C0M A;  4N39 A;  1SZ9 A;  4JVS A;  2IOL A;  3ZYK A;  3LYA A;  3ZPJ A;  4WNF A;  3QAR A;  2VGX A;  2IJG X;  4JHJ A;  1UN9 A;  3FEX A;  4I6E A;  4BT9 A;  1H2T C;  4DPR A;  3FU5 A;  3KD7 A;  2OOE A;  2KC7 A;  4A55 A;  2KCV A;  4AP2 A;  3ASH A;  3GZ2 A;  4B8C B;  2OVB A;  2C0L A;  2YQ8 A;  3MKR A;  4AY5 A;  4N3B A;  5EX0 A;  4DI3 A;  2CHZ A;  3C98 A;  2V5F A;  4DI4 A;  4HLE A;  3UT7 A;  4MKT A;  1BPO A;  3MGB A;  4KMO A;  1XGW A;  1HG2 A;  1UN8 A;  1U3C A;  3URZ A;  3QWV A;  5LCW J;  3PDN A;  3FUJ A;  3CHS A;  1PY1 A;  3HYM B;  3IEG A;  2VGX B;  4U04 A;  1H19 A;  4A3T A;  2GRM A;  2RG8 A;  3FFL A;  3I4G A;  4LER A;  4FUL A;  3ZVV A;  5A7D B;  3SI5 A;  1IYG A;  2OVF A;  2L9B A;  1KT1 A;  2XEV A;  3EHN A;  3NQP A;  5BW8 C;  4JXT A;  5T4Y A;  1MHQ A;  2PM7 A;  1UJK A;  2MHK A;  2J08 A;  3CV0 A;  3D9M A;  3FU0 A;  1E90 A;  3VLE A;  2L0I A;  4I1O B;  5D0Q D;  3VTX A;  2E0I A;  2WXI A;  4EZK A;  1HZ4 A;  2KZT B;  2FUL A;  5DBK A;  2WQH A;  4Y6W A;  1OWN A;  3ONL A;  2I6H A;  4U0S A;  3KEZ A;  4GYW A;  4L2L A;  3D9P A;  3P1U A;  4I2Z A;  4J0U A;  1W3B A;  4UQX A;  4UWH A;  1ELK A;  2FBN A;  5KJN A;  2WXF A;  2EQX A;  1HFA A;  3FUE A;  3ZFW A;  2WVI A;  4FLH A;  4GZC A;  3OXF A;  2VSN A;  1Y8M A;  4K03 A;  2VYI A;  5FQ4 A;  2AXV A;  1UG3 A;  4FJY A;  1IHG A;  3FTU A;  5E75 A;  4I2W A;  4ANW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...