3Q5PA

Crystal structure of bmrr bound to tetracycline
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
b'KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna/antibiotic
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q5pA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q5pA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q5pA03
5KAUA 4R24B 2KCUA 1EXIA 5KAXA 3Q1MA 4R22B 3Q5RA 3D6ZA 5KATA 4AYZA 1Q0AA 2J5UA 3Q5PA 5D90A 2HVAA 3R8KA 1R8EA 3LURA 4R4MA 2DG6A 3R8JA 3UCSA 4B0YA 4R4EA 3B49A 3GK6A 3E0HA 2ZHHA 3T97B 5KAVA 1R8DA 3D6YA 2VZ4A 2ZHGA 1Q06A 3GPVA 3IAOA 3D70A 4R4LA 5KCBA 1D5YA 3GP4A 3HH0A 2GOVA 1BOWA 5I41B 4WLWA 3Q5SA 4J2NA 2JMLA 1DIPA 3QAOA 5E01A 3Q3DA 5KAWA 4WLSA 4A1MA 5I44A 1Q09A 5D8CA 5GQQA 1JBGA 1Q05A 1JYHA 1Q08A 3D71A 4AYZB 2OQQA 1Q07A 1EXJA 3Q2YA 2BOWA 3G9RA
chains in the Genus database with same CATH superfamily
3SFDC 2K9JB 3L75E 1S9KE 3MIWA 3P8CD 2MJZA 3O6QA 3U1CA 5KAVA 2K37A 1JMBA 1OVVA 3HH0A 2L5GB 3R4YA 1ZR2A 2HG5D 4I2LC 2JEEA 1JY3P 4UB8H 2HODA 2PP6A 2QJKB 3AEEC 1LX8A 2DG6A 4W7ZA 1L0LK 1FZCC 3R8JA 1FZCA 1YJNP 3IAOA 1VQ8P 2MKVA 2E74B 2E43A 2JMLA 1BGYJ 3RK3D 3WU2H 2YO2A 2ZJSE 1DH3A 2M5AA 2B89A 2IBZE 3HTKA 4RKUJ 3WUUA 4PV1D 2O1JA 3RK2C 1P84D 2QRXA 2JWDA 1L0LG 3B4SA 3FX0A 4RO0A 2JJLA 3S4RA 1IK9A 1FJPA 1URQB 3L71G 1K73Q 4I7ZC 1Q0AA 2HR3A 2ZVOB 3CX5H 1QL2A 3TGUE 1PP9E 1LP1A 4U3FG 1VQ5P 2WT7B 4WVZA 1GZLA 1L0LD 1RY3A 2IFNA 1FJKA 2Q9IA 1KQGB 1FDOA 1G2CB 2FFDC 2FKWB 2WSEJ 3E0HA 5AVUB 2FFDA 5KAFH 1GDTA 4KJMA 1SFCD 2PGDA 4WLSA 4U3FD 2HLOA 1HJBA 3FXEA 2IFMA 4BRYA 2KSEA 4U7JA 3OW2O 3KQGA 1R8DA 3KZIE 3CL3D 3BRTB 4HH2A 3MGNA 1RQUA 4PD4H 4JYBA 2LR2A 4NPDA 5B66H 1PPJG 2V7QJ 2ZXEB 1T2KD 1FC2C 1KYOH 4I1LA 1GW3A 3AE4C 4NPFX 3CC7P 3GW6A 1BCCG 4RJTA 3V4WA 1JYHA 3TNUA 4H13D 1SQPD 3H1LE 1YQ3C 1J1DC 4DCZA 5D90A 3SSUA 3EQ2A 3CXHD 2OG0A 3A0BH 1HUCA 1MV8A 1RH6A 4A1MA 4IL6H 4N78D 4N3YB 1BCCD 1YTZT 1X0TA 2RN0A 1EZVI 3AE5C 4ASWA 5KATA 2OTKE 4U3FJ 3O6QB 1KN7A 4EIJA 1OVUA 2ZFCA 1PL5A 2B88A 1T6AA 2JWAA 2N9YB 3CX5I 1KILC 4WWIA 2LKMA 4TT3H 3H1JG 3H25A 1ZXGA 1KILA 1LTGC 3VP9A 4BXLA 1VQ9P 2QE7H 2OGUA 2H88C 3RL0D 1KMIZ 4WY4D 2KLUA 1FZCB 3UCSA 5APYA 3M0AA 1EDIA 3TK1A 2Y0EA 2FXPA 2C0XA 2AXTH 3Q5SA 1MUUA 3L75D 1BGYE 3H1JD 2FYNC 2OYIC 4ZMDA 2SPZA 3TYYA 2KCUA 2OYIA 4IFMA 4TLFA 3UIAA 1NTZE 1PGQA 3PHLA 3SWKA 5GTHH 1YHQP 1SQPJ 4OGQC 3EFGA 3S1KA 3V2RA 4EDFA 1QL1A 5E79E 5AVXB 4WLWA 2A45G 3BCCG 3H1HJ 4PD4I 2KNCB 3WUVA 4K35A 3AE8C 4DZOA 1BCCJ 4HYTB 1WRGA 3HE5A 5BVZA 3G3ZA 2KYVA 3TSIA 2W8ZA 1KYOI 1HVVA 4GODA 1FOSF 1DIPA 1M7LA 1IFDA 1N7SB 2LXCB 3V2PA 1ZN5A 1L4AC 1ZV8A 2NPSD 3CC4P 2ZHHA 1LGHB 2KB7P 1RH5B 1NTMK 1FZAA 5I41B 2R44A 4B86A 1SQVK 3KYQA 1H89A 4BRYB 1VQ6P 3L75J 2HVAA 1J1EB 1R8EA 3H1JJ 2K9JA 3RK3E 1JUNA 4OVNF 2E75B 3GG2A 2P2UA 2VRSA 4LLHA 1JY2P 3GF7A 4GT1A 3VP8A 3FGAD 2OARA 1NTMG 4JPZB 3NFQA 2Q7CA 1VQMP 1RF0C 1SQVG 1H88A 1M56D 2QJKC 1OIPA 3H32B 2J59M 1JOCA 1LTTC 5KAWA 1FE6A 2E74C 3CLQA 3GLMA 4OWFA 1NH4A 1JCDA 3CCVP 3LIDA 5B5EE 3CCJP 1NTMD 3QH9A 3RK2D 4Z1MH 1YITP 1L0LE 1SQVD 2VZ4A 1Q06A 1TU3F 4AYCA 3P8MC 1S5LX 1URQC 4U3FE 5AVRB 3M0DC 1URQA 2ZYGA 1OWAA 1NKNA 1AJYA 3M0DA 1MFTA 3L73G 3IF4A 2WSFJ 3H1LD 2OQQA 4R24B 4GIFA 5CCGD 1SQBK 2IDBA 2WT7A 3CWBG 3M06A 2M3BA 1LNQA 2HPCB 1DD3A 1RE4C 1L0NK 1HWTC 1G2CA 1RE4A 3L73D 2GM4A 1PM6A 3AECC 3MD0A 4KT0J 3V6IA 5TISE 2P58A 3B5NA 2Z5IA 1S5LE 3CWBD 3KZIH 1FDIA 1VQKP 1SQBG 4LGDE 1PPJE 2A06G 2XDJA 1NTMJ 1NAFA 3CXHE 4BWNA 2KVVA 1SQVJ 1Q07A 2BOWA 1L0NG 1X8YA 1AA0A 4N78E 1BCCE 1BDCA 3E7KA 5APXA 3AE2C 2AEFA 3A0HH 1Q81Q 2Q6QA 2KZIA 1SQBD 3A3YB 3BASA 2A06D 3AE1C 1AVYA 3PTZA 3H1LJ 1BDDA 3KPEA 1L0ND 1SS1A 1DEBA 1ZLLA 2IX7C 5DJTB 3PLNA 3IN6A 3A7OA 1RHZB 1A02J 1EQ7A 2WSCJ 5AW4B 1OW8A 2XNXA 3L73J 3Q1MA 5CMZA 2N1TC 3B8EB 2N1TA 3H1JE 1KILD 1JY3N 2YXRB 4ZKPA 2KP8A 1YBKA 5E01A 3CWBJ 3A5TA 3SWFA 2FYUK 1Q82Q 1OXZA 2R5BA 1GD2E 2XNDH 1AQ5A 1IFIA 2ZT9B 2K3RA 3TF5A 3LIEA 1LTBC 1QLED 1VPCA 3VN0A 1HTLC 1OZHA 2Y9YA 4YTPC 1SQXK 4LHFA 1W5CE 2YXQB 5APQA 1XTCC 2WMMA 1SQBJ 1NTZJ 4OGQD 3U59A 5H2FE 2IZ1A 2FYUG 3BCCE 1DEEG 1L0NJ 2XU6A 4WB4A 1SQQK 2KI7B 4H44B 1HBWA 3VMZA 1YTZI 2QJPB 5KLIB 1DX7A 1NU1K 3G9RA 3VYIA 3L72G 3MP7B 2KNCA 1SQXG 1N2DC 2O01J 1FZBA 3JCUE 1KV4A 2UWJE 2E42A 2FYUD 3CD6P 1K05A 1IFMA 5KKZB 1PGOA 3VMAA 3CCEP 2YNYA 3D71A 3L74G 3F5HA 1L4AD 1N7SC 1N7SA 1SQQG 2QVAA 3WUTA 1KQSO 1GK4A 3L71D 1NU1G 1BSNA 3USSA 2WSEH 3GHGB 3L72D 1E5WA 2D2CB 1SVFA 4YXWH 1SQXD 2QA4P 1GL2C 2V4HA 3BRVB 1GL2A 1JB0J 5AVVB 2JO1A 3B5NB 1X9VA 1QEXA 3L74D 3GF3A 3Q5PA 5CBNA 1J1EC 1SQQD 1YQ4C 1JCCA 2H89C 4PJ0H 1NU1D 2E75C 4DOJA 3PH0A 1ZRTE 1NTME 1YYCA 2V7QH 1SQVE 1P84H 1K8AQ 5CCHC 4M3LA 2K9YA 2KZJA 1RQVA 4RESB 5CCHA 1LT1A 3MTUE 2E74D 2GUSA 3H32A 4L74A 1USEA 2L91A 2FYUJ 4R22B 2QSIA 2Q1KA 5CHXA 5GTIH 1PPJD 1S2EA 1L0LJ 3AEAC 1IZNB 1KQLA 3L71J 3BATA 2WQYC 1BSHA 2R5DA 3L72J 3A2AA 1URQD 3KHUA 5KAXA 3L73E 2N1TB 2DW3A 3SFEC 1R5SA 4DCKA 4W80A 1T3UA 3VMYA 1JY3O 2K88A 5KAIH 3T97B 3D6YA 3L74J 3MHVA 3RGUA 4H0LC 1SQQJ 3CWBE 1JO5A 4GDOA 1NU1J 2W6JH 1VF5B 2YKOA 4C7NA 4L76A 1YIJP 2BEQD 4Y28J 4UB6H 4Y99B 1CSBA 4K3AA 3C9IA 2HPCA 1Y8AA 1U7JA 2PFXA 4UB8E 1OVRA 5KJ7C 1SQBE 3AEBC 2A06E 5KJ7A 1N8RQ 3H1IG 5KTBA 3CMAP 1S72P 1L0NE 5EFWB 2PAJA 3CI9A 3CXHH 1N86A 4HJGH 3WU2E 3WMM0 1FU1A 1JMMA 1Q86Q 1KB9D 2G3AA 3OAKA 3LURA 1P84I 5TJHA 2C9LY 2H43A 4PV1C 3AEGC 2KSJA 1LTSC 1U57A 3H1ID 1KILE 3SWYA 1BE3G 2ZAEB 1JNMA 3BCCD 2R32A 4LC1A 1U7MA 1W2EA 3C8VA 3CX5E 2ZHGA 4L73A 1GL2B 2O1KA 1SP4A 1QGKB 5D8CA 1IO4A 2POHA 5AW9B 2IYOA 1N73A 1Y47A 3S9OA 1JY2N 2E76B 1CW5A 3FXDA 3W67A 3V2QA 5KAFE 2FYZA 1PGJA 3B71A 3G4SP 1FDMA 1FBMA 1D7MA 3E1RA 3AE9C 2HFED 1GK6A 2ZT9C 4HKZH 1OFCX 4IFFA 1KQFB 3RL0g 3VMXA 4C46A 2YMYA 2YO3A 1S3JA 1VQ4P 2G8YA 3V4QA 5GQQA 4IOIH 3IFMA 2FYUE 3H1IJ 2KOGA 3R2PA 1KYOE 2IZ0A 1ZRTD 2KLVA 1QVFO 3BCCJ 2WPRA 3EWKA 1D5YA 2WPQA 4D6TG 5APUA 4OH8B 1FS0E 3L71E 4H44C 3HD7B 3L72E 3CCQP 5KLIC 2QJPC 2E5YA 1EDKA 3CXHI 1NHLA 1GU5A 1SQXE 3I55P 1W2BO 3V2NA 3CCLP 3JCUH 3LW5J 2WSFH 1VDFA 5AVZB 3L74E 1LTIC 4H0LB 1N7SD 3W68A 1SQQE 5KKZC 3I5CA 2I1JA 2JKVA 2OYOA 4C7NB 5AW2B 3M91A 1NU1E 2QIWA 2K1AA 1QX8A 1NO4A 1YJ9P 2M0BA 4ZKUA 3GHGC 2D2CC 1LTAC 4I6MC 3GHGA 5AVQB 2KUBA 4XE5B 1RE3C 3B5NC 4N6JA 3BVHA 1RE3A 2W90A 3F89A 3G6EP 1LT9B 3MUDA 2E75D 2XZRA 1X79B 4WY4A 5KLVK 2Q3EA 1WT6A 2QM8A 3GMAA 1VQOP 2ZYDA 5CCHD 3RK3B 1XTGB 5AVSB 2WPVB 1A02F 1HH0A 5CJ0A 2YKQA 4R4MA 3JC22 1HGZA 2P7JA 4PV1B 1M57D 4ASVA 1IC2A 2QJYB 2H7HA 3C1LA 5AVWB 3HRNA 5KLVG 1NYHA 1KTMA 1EZVG 3EZFA 3PP5A 1IK7A 2IBZI 1Y9BA 1MZ9A 1LWUB 3Q3DA 2KXPB 1PFIA 2FBWC 1ZOYC 2WSCH 1N73B 2BEZF 1JY2O 2FXOA 3CCMP 5KLVD 3V5BA 2NZ2A 2FY8A 3EFFK 2WPSA 1EZVD 1AQTA 3MZWB 3L70G 1KC8Q 3CC2P 3T97A 4CPGA 3N7NA 1SFCB 1OX3A 3CX5D 4YPCA 3NXSA 4XFJA 1VF5C 2B87A 1FOSE 2ZXXA 1NTKK 3L35A 5AW6B 1KB9E 1JTHB 4Y99C 2IPPA 3IR9A 3L70D 5AW3B 1Q05A 3O8ZA 5KJ7D 1EXIA 4JBZA 2H8PD 4HB1A 3H1IE 4EYYQ 3GPVA 3AE3C 2PRRA 5E79H 2OYHB 5APWA 5AW0B 2YIUB 2XV5A 2IEFA 1NTKG 4GKGA 3EZ2A 1KFNA 1PIXA 2R3SA 4H13B 1KZUB 1GU4A 2W83C 1ZW0A 4PD4D 1NVOA 1USDA 2M3EA 5DJUB 1IFPA 2O01H 4GOFA 5KLVJ 1BE3E 3HUSB 1PZQA 2P10A 1KYOD 4JYCA 4DJGA 1NTKD 2O3JA 5AW7B 1X22A 4KHXA 3AEDC 3ZDMA 1PGPA 1CI6B 3RBXA 1Q7YQ 4NPEA 4O9BA 1Q09A 4JF7A 2W6AA 2RKLA 4AYZB 2E5TA 2Q5UA 3L70J 1M1JC 3H1KG 1SQPK 5CCGC 2Q3IA 3RL0B 4WY4B 1M1JA 5CCGA 2E76C 1EC5A 1LTJB 4EI2A 2FXMA 1VQNP 2JR8A 2ZYAA 3QWOC 1VQ7P 3AE7C 1NKZB 1NJIQ 2ZT9D 1G1JA 1KFMA 1OW7A 3M9HA 3OJAB 2GUVA 3H1KD 1YJWP 5APTA 3CMEP 3P32A 2IYPA 1BOWA 1SQPG 5BU5A 1NWQA 2CPBA 1MKMA 4AQRD 2Y9ZA 2Y0DA 2OTJP 3H1HG 5B5EH 2KS1B 5BU8B 4D6TE 1NTKJ 5AVTB 4H44D 3EZ9A 2WTYA 3A0HE 3QAOA 1Z56A 3FWNA 2P67A 3EZ6A 2KIKA 3HD7C 2QEXP 1SQXJ 2KK7A 3HD7A 1RF1B 4W7YA 2CK3H 1KORA 3N4XA 3H1HD 2NPSB 4R4EA 2LXBA 5APSA 4AUWA 1H0TA 2J58A 1FAVA 1QVGO 2BCCG 1JM0A 1G1IA 2CPSA 2B87B 1OMIA 1GTWA 2RH0A 5APVA 1LJ2A 1E79H 1NOHA 2D2CD 4B0YA 1EDLA 2ITAA 3L75G 2Z5HA 1YI2P 1AV1A 1N7LA 3H1KJ 3B5ND 1VQLP 2HODB 3L37A 2BCCD 5TISH 2O01N 2I1KA 1FZEA 2I8DA 5M1BA 1S5LH 2NRGA 1IFNA 1HF9A 1LT9C 3HE4A 1LT9A 5K5GB 2N9BA 3NMDA 1AFOA 2M5AB 1S9KD 3HTKB 2R3CA 3M9QA 1T3JA 1CZQA 1K04A 1Q90D 3RK3C 2WITA 1VQPP 1L2PA 5L8RJ 2QG4A 1FZFA 1WMKA 1NAYA 2WWWA 2IBZG 3RK2B 1ZP0C 5KLVE 1M1KQ 1HJ0A 2QJYC 1EZVE 1UIXA 3CPWO 3Q2YA 4I7ZB 3JSVC 3VTPC 1T8ZA 3OA7A 3TDKA 3KXDA 1LP1B 3ABVC 3GK6A 2HYNA 3E1IA 5KCBA 2IBZD 3TGUG 2OTLP 3P8CE 1PP9G 1LWUC 1LWUA 2N1TD 1N73C 1M1JB 4GOEA 3L70E 1BE3D 1L4AA 2FFDB 2BCCJ 3NTNA 5AW8B 1Y6UA 4A7PA 3TGUD 2AEMA 1R5LA 1SFCC 1PP9D 1VF5D 1SFCA 3RBZA 2Z4EA 3G71P 2ZVNB 4EOTA 1KB9H 5CJ4A 3PJSK 4DT0A 4IL6X 2XKMA 4PJ0E 4XA4A 3GP4A 2W6BA 2QM7A 4L75A 2RMZA 4PD4E 2YMKA 1JTHA 1UIIA 5B66E 1P84E 3D6ZA 1RF0A 5H2FH 2A45H 1ZR4A 1T2KC 5AW5B 1NTKE 2JDIH 3TNUB 4J2NA 2JP3A 2OYHC 2C0WA 2OYHA 2YIUC 1EXJA 1H8AA 1JEKA 2AXCA 5KAUA 1J1DB 4H13C 5GTIE 3R8KA 1H0TB 1OW6A 1K9MQ 3H1LG 3LW5H 3A0BE 2GOVA 1BE3J 3K5BA 3II6A 2M8RA 3KDPB 4IL6E 3HUSC 1AVOA 3EZ7A 4D6TD 2AEJA 3HUSA 1S1CX 4WBAA 1PV3A 1J2JB 3TGUJ 1FZGA 1PP9J 1KILB 5KAIE 1GL2D 1MFZA 1DD4A 2W27A 1M8OB 2C9NY 5I44A 1CI6A 3H1KE 2P1JA 2WSSH 1IFJA 1NTZK 3FWLA 1ZMEC 1Q2NA 2E76D 4AYZA 3AE6C 3HE4B 3MUDC 3RL0C 2B9BA 3CCRP 4WY4C 4UB6E 2YKPA 1LTJC 1KD1Q 1LTJA 1M90Q 2AXTE 2FYNB 2OYIB 1JBGA 3Q5RA 3L36A 1BGYG 3ITKA 2J5UA 4OGQB 5GTHE 1SQPE 1S4XA 1NTZG 3D70A 5AVYB 2BASA 1SLQA 2GA1A 1KB9I 4JQ0D 3H1HE 3L4FA 1GW4A 3HE5B 3H6PA 3I56P 4D6TJ 3M9BA 1BGYD 1VL2A 3B49A 4ZNCA 3CCUP 2KS1A 4C7RA 3AEFC 2A45I 1HGVA 2WZ7A 1NTZD 3VOPA 3HD7D 5C39A 4YXDC 1L4AB 5AW1B 3P7KA 2WVRA 1RF1C 3CCSP 4QMAA 2BCCE 1RF1A 3U1AA 2NPSC 4MN4C 1EDJA 4H0LD 4R4LA 5CBOA 1NGMB 2NPSA 3PRJA 2Y0CA 1IJDB 1Q08A 1GMJA 4IFDK
chains in the Genus database with same CATH topology
1EXIA 1VF5D 1S5LX 2WPVB 3AE5C 3SFDC 1ZMEC 4R22B 2QSIA 2ZT9D 2G3AA 5KATA 2E76D 4AYZA 3AE6C 1OW7A 1KQGB 5M1BA 4R4MA 3LURA 1AJYA 1FDOA 1HF9A 1PL5A 3O6QA 2WSEJ 3E0HA 2ZHHA 2O01J 5KAVA 4PV1B 2WSFJ 3AEAC 3IN6A 3EWKA 3GPVA 4IL6X 3AE3C 4PV1C 1D5YA 3AEGC 4TT3H 3GP4A 3HH0A 1BOWA 5I41B 3H25A 1K05A 1U57A 3R4YA 4WLSA 2YMKA 2WQYC 4H44C 1MKMA 1KILE 1JBGA 2IEFA 3D71A 2WSCJ 2OQQA 2QJPC 3EZ2A 5KLIC 1OW8A 1NYHA 4R24B 1PIXA 1K04A 4H13B 5KAXA 3Q1MA 1Q90D 1KTMA 2IDBA 3Q5RA 3D6ZA 2H88C 3SFEC 1KMIZ 3EZFA 2J5UA 4U7JA 5L8RJ 2HVAA 1R8EA 1WMKA 3AEEC 1LX8A 2DG6A 4OGQB 3C8VA 3RK3E 3R8JA 3UCSA 1IK7A 1DD3A 2D2CB 3LW5J 3T97B 1R8DA 3D6YA 2ZHGA 3D70A 2E75B 3IAOA 1Y9BA 1ZP0C 4H44D 3EZ9A 2MKVA 2FXPA 2E74B 4H0LB 1RQUA 1PM6A 3Q5SA 2JMLA 4J2NA 2JP3A 3QAOA 5E01A 3Q3DA 1HJ0A 3GF7A 4H0LC 2P10A 2QJYC 5D8CA 1UIXA 3AECC 1JB0J 1ZOYC 2FBWC 2YIUC 5KKZC 2FYNC 3EZ6A 1EXJA 3Q2YA 2JO1A 2V7QJ 4KT0J 3FGAD 4I7ZB 4GDOA 2BEZF 2KCUA 5KAUA 4H13C 1VF5B 2QIWA 4RKUJ 3S9OA 3GF3A 3Q5PA 2ZT9B 3R8KA 1KORA 2E76B 2NZ2A 3AEDC 1OW6A 2BEQD 4Y28J 1VL2A 2QJKC 4PV1D 4R4EA 4OGQC 3B49A 3ABVC 3GK6A 1YQ4C 3AE4C 1FDIA 5KCBA 2D2CC 2H89C 3AEFC 2E75C 2GOVA 4WLWA 4YTPC 5KAWA 2E74C 1ZRTE 1Q09A 3B71A 2KVVA 1JYHA 3GLMA 4AYZB 4H13D 3EZ7A 1Q07A 4LHFA 5GQQA 2BOWA 1S1CX 4YXDC 4I7ZC 1YQ3C 3AE9C 1Q0AA 1OMIA 4XFJA 4DCZA 3AE8C 5D90A 2K9YA 4OGQD 1PV3A 1VF5C 1RQVA 3AEBC 2ZT9C 1KQFB 2D2CD 2E76C 4B0YA 2E75D 3RL0g 2OG0A 4Z1MH 3AE2C 1Y6UA 2VZ4A 1Q06A 2E74D 4H0LD 4R4LA 1NGMB 1DD4A 1RH6A 4H44B 1DIPA 3GMAA 4A1MA 5I44A 2G8YA 1Q05A 1TU3F 3AE1C 1Q08A 1GMJA 3AE7C 3G9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAU A;  4R24 B;  2KCU A;  1EXI A;  5KAX A;  3Q1M A;  4R22 B;  3Q5R A;  3D6Z A;  5KAT A;  4AYZ A;  1Q0A A;  2J5U A;  3Q5P A;  5D90 A;  2HVA A;  3R8K A;  1R8E A;  3LUR A;  4R4M A;  2DG6 A;  3R8J A;  3UCS A;  4B0Y A;  4R4E A;  3B49 A;  3GK6 A;  3E0H A;  2ZHH A;  3T97 B;  5KAV A;  1R8D A;  3D6Y A;  2VZ4 A;  2ZHG A;  1Q06 A;  3GPV A;  3IAO A;  3D70 A;  4R4L A;  5KCB A;  1D5Y A;  3GP4 A;  3HH0 A;  2GOV A;  1BOW A;  5I41 B;  4WLW A;  3Q5S A;  4J2N A;  2JML A;  1DIP A;  3QAO A;  5E01 A;  3Q3D A;  5KAW A;  4WLS A;  4A1M A;  5I44 A;  1Q09 A;  5D8C A;  5GQQ A;  1JBG A;  1Q05 A;  1JYH A;  1Q08 A;  3D71 A;  4AYZ B;  2OQQ A;  1Q07 A;  1EXJ A;  3Q2Y A;  2BOW A;  3G9R A; 
#chains in the Genus database with same CATH topology
 3SFD C;  2K9J B;  3L75 E;  1S9K E;  3MIW A;  3P8C D;  2MJZ A;  3O6Q A;  3U1C A;  5KAV A;  2K37 A;  1JMB A;  1OVV A;  3HH0 A;  2L5G B;  3R4Y A;  1ZR2 A;  2HG5 D;  4I2L C;  2JEE A;  1JY3 P;  4UB8 H;  2HOD A;  2PP6 A;  2QJK B;  3AEE C;  1LX8 A;  2DG6 A;  4W7Z A;  1L0L K;  1FZC C;  3R8J A;  1FZC A;  1YJN P;  3IAO A;  1VQ8 P;  2MKV A;  2E74 B;  2E43 A;  2JML A;  1BGY J;  3RK3 D;  3WU2 H;  2YO2 A;  2ZJS E;  1DH3 A;  2M5A A;  2B89 A;  2IBZ E;  3HTK A;  4RKU J;  3WUU A;  4PV1 D;  2O1J A;  3RK2 C;  1P84 D;  2QRX A;  2JWD A;  1L0L G;  3B4S A;  3FX0 A;  4RO0 A;  2JJL A;  3S4R A;  1IK9 A;  1FJP A;  1URQ B;  3L71 G;  1K73 Q;  4I7Z C;  1Q0A A;  2HR3 A;  2ZVO B;  3CX5 H;  1QL2 A;  3TGU E;  1PP9 E;  1LP1 A;  4U3F G;  1VQ5 P;  2WT7 B;  4WVZ A;  1GZL A;  1L0L D;  1RY3 A;  2IFN A;  1FJK A;  2Q9I A;  1KQG B;  1FDO A;  1G2C B;  2FFD C;  2FKW B;  2WSE J;  3E0H A;  5AVU B;  2FFD A;  5KAF H;  1GDT A;  4KJM A;  1SFC D;  2PGD A;  4WLS A;  4U3F D;  2HLO A;  1HJB A;  3FXE A;  2IFM A;  4BRY A;  2KSE A;  4U7J A;  3OW2 O;  3KQG A;  1R8D A;  3KZI E;  3CL3 D;  3BRT B;  4HH2 A;  3MGN A;  1RQU A;  4PD4 H;  4JYB A;  2LR2 A;  4NPD A;  5B66 H;  1PPJ G;  2V7Q J;  2ZXE B;  1T2K D;  1FC2 C;  1KYO H;  4I1L A;  1GW3 A;  3AE4 C;  4NPF X;  3CC7 P;  3GW6 A;  1BCC G;  4RJT A;  3V4W A;  1JYH A;  3TNU A;  4H13 D;  1SQP D;  3H1L E;  1YQ3 C;  1J1D C;  4DCZ A;  5D90 A;  3SSU A;  3EQ2 A;  3CXH D;  2OG0 A;  3A0B H;  1HUC A;  1MV8 A;  1RH6 A;  4A1M A;  4IL6 H;  4N78 D;  4N3Y B;  1BCC D;  1YTZ T;  1X0T A;  2RN0 A;  1EZV I;  3AE5 C;  4ASW A;  5KAT A;  2OTK E;  4U3F J;  3O6Q B;  1KN7 A;  4EIJ A;  1OVU A;  2ZFC A;  1PL5 A;  2B88 A;  1T6A A;  2JWA A;  2N9Y B;  3CX5 I;  1KIL C;  4WWI A;  2LKM A;  4TT3 H;  3H1J G;  3H25 A;  1ZXG A;  1KIL A;  1LTG C;  3VP9 A;  4BXL A;  1VQ9 P;  2QE7 H;  2OGU A;  2H88 C;  3RL0 D;  1KMI Z;  4WY4 D;  2KLU A;  1FZC B;  3UCS A;  5APY A;  3M0A A;  1EDI A;  3TK1 A;  2Y0E A;  2FXP A;  2C0X A;  2AXT H;  3Q5S A;  1MUU A;  3L75 D;  1BGY E;  3H1J D;  2FYN C;  2OYI C;  4ZMD A;  2SPZ A;  3TYY A;  2KCU A;  2OYI A;  4IFM A;  4TLF A;  3UIA A;  1NTZ E;  1PGQ A;  3PHL A;  3SWK A;  5GTH H;  1YHQ P;  1SQP J;  4OGQ C;  3EFG A;  3S1K A;  3V2R A;  4EDF A;  1QL1 A;  5E79 E;  5AVX B;  4WLW A;  2A45 G;  3BCC G;  3H1H J;  4PD4 I;  2KNC B;  3WUV A;  4K35 A;  3AE8 C;  4DZO A;  1BCC J;  4HYT B;  1WRG A;  3HE5 A;  5BVZ A;  3G3Z A;  2KYV A;  3TSI A;  2W8Z A;  1KYO I;  1HVV A;  4GOD A;  1FOS F;  1DIP A;  1M7L A;  1IFD A;  1N7S B;  2LXC B;  3V2P A;  1ZN5 A;  1L4A C;  1ZV8 A;  2NPS D;  3CC4 P;  2ZHH A;  1LGH B;  2KB7 P;  1RH5 B;  1NTM K;  1FZA A;  5I41 B;  2R44 A;  4B86 A;  1SQV K;  3KYQ A;  1H89 A;  4BRY B;  1VQ6 P;  3L75 J;  2HVA A;  1J1E B;  1R8E A;  3H1J J;  2K9J A;  3RK3 E;  1JUN A;  4OVN F;  2E75 B;  3GG2 A;  2P2U A;  2VRS A;  4LLH A;  1JY2 P;  3GF7 A;  4GT1 A;  3VP8 A;  3FGA D;  2OAR A;  1NTM G;  4JPZ B;  3NFQ A;  2Q7C A;  1VQM P;  1RF0 C;  1SQV G;  1H88 A;  1M56 D;  2QJK C;  1OIP A;  3H32 B;  2J59 M;  1JOC A;  1LTT C;  5KAW A;  1FE6 A;  2E74 C;  3CLQ A;  3GLM A;  4OWF A;  1NH4 A;  1JCD A;  3CCV P;  3LID A;  5B5E E;  3CCJ P;  1NTM D;  3QH9 A;  3RK2 D;  4Z1M H;  1YIT P;  1L0L E;  1SQV D;  2VZ4 A;  1Q06 A;  1TU3 F;  4AYC A;  3P8M C;  1S5L X;  1URQ C;  4U3F E;  5AVR B;  3M0D C;  1URQ A;  2ZYG A;  1OWA A;  1NKN A;  1AJY A;  3M0D A;  1MFT A;  3L73 G;  3IF4 A;  2WSF J;  3H1L D;  2OQQ A;  4R24 B;  4GIF A;  5CCG D;  1SQB K;  2IDB A;  2WT7 A;  3CWB G;  3M06 A;  2M3B A;  1LNQ A;  2HPC B;  1DD3 A;  1RE4 C;  1L0N K;  1HWT C;  1G2C A;  1RE4 A;  3L73 D;  2GM4 A;  1PM6 A;  3AEC C;  3MD0 A;  4KT0 J;  3V6I A;  5TIS E;  2P58 A;  3B5N A;  2Z5I A;  1S5L E;  3CWB D;  3KZI H;  1FDI A;  1VQK P;  1SQB G;  4LGD E;  1PPJ E;  2A06 G;  2XDJ A;  1NTM J;  1NAF A;  3CXH E;  4BWN A;  2KVV A;  1SQV J;  1Q07 A;  2BOW A;  1L0N G;  1X8Y A;  1AA0 A;  4N78 E;  1BCC E;  1BDC A;  3E7K A;  5APX A;  3AE2 C;  2AEF A;  3A0H H;  1Q81 Q;  2Q6Q A;  2KZI A;  1SQB D;  3A3Y B;  3BAS A;  2A06 D;  3AE1 C;  1AVY A;  3PTZ A;  3H1L J;  1BDD A;  3KPE A;  1L0N D;  1SS1 A;  1DEB A;  1ZLL A;  2IX7 C;  5DJT B;  3PLN A;  3IN6 A;  3A7O A;  1RHZ B;  1A02 J;  1EQ7 A;  2WSC J;  5AW4 B;  1OW8 A;  2XNX A;  3L73 J;  3Q1M A;  5CMZ A;  2N1T C;  3B8E B;  2N1T A;  3H1J E;  1KIL D;  1JY3 N;  2YXR B;  4ZKP A;  2KP8 A;  1YBK A;  5E01 A;  3CWB J;  3A5T A;  3SWF A;  2FYU K;  1Q82 Q;  1OXZ A;  2R5B A;  1GD2 E;  2XND H;  1AQ5 A;  1IFI A;  2ZT9 B;  2K3R A;  3TF5 A;  3LIE A;  1LTB C;  1QLE D;  1VPC A;  3VN0 A;  1HTL C;  1OZH A;  2Y9Y A;  4YTP C;  1SQX K;  4LHF A;  1W5C E;  2YXQ B;  5APQ A;  1XTC C;  2WMM A;  1SQB J;  1NTZ J;  4OGQ D;  3U59 A;  5H2F E;  2IZ1 A;  2FYU G;  3BCC E;  1DEE G;  1L0N J;  2XU6 A;  4WB4 A;  1SQQ K;  2KI7 B;  4H44 B;  1HBW A;  3VMZ A;  1YTZ I;  2QJP B;  5KLI B;  1DX7 A;  1NU1 K;  3G9R A;  3VYI A;  3L72 G;  3MP7 B;  2KNC A;  1SQX G;  1N2D C;  2O01 J;  1FZB A;  3JCU E;  1KV4 A;  2UWJ E;  2E42 A;  2FYU D;  3CD6 P;  1K05 A;  1IFM A;  5KKZ B;  1PGO A;  3VMA A;  3CCE P;  2YNY A;  3D71 A;  3L74 G;  3F5H A;  1L4A D;  1N7S C;  1N7S A;  1SQQ G;  2QVA A;  3WUT A;  1KQS O;  1GK4 A;  3L71 D;  1NU1 G;  1BSN A;  3USS A;  2WSE H;  3GHG B;  3L72 D;  1E5W A;  2D2C B;  1SVF A;  4YXW H;  1SQX D;  2QA4 P;  1GL2 C;  2V4H A;  3BRV B;  1GL2 A;  1JB0 J;  5AVV B;  2JO1 A;  3B5N B;  1X9V A;  1QEX A;  3L74 D;  3GF3 A;  3Q5P A;  5CBN A;  1J1E C;  1SQQ D;  1YQ4 C;  1JCC A;  2H89 C;  4PJ0 H;  1NU1 D;  2E75 C;  4DOJ A;  3PH0 A;  1ZRT E;  1NTM E;  1YYC A;  2V7Q H;  1SQV E;  1P84 H;  1K8A Q;  5CCH C;  4M3L A;  2K9Y A;  2KZJ A;  1RQV A;  4RES B;  5CCH A;  1LT1 A;  3MTU E;  2E74 D;  2GUS A;  3H32 A;  4L74 A;  1USE A;  2L91 A;  2FYU J;  4R22 B;  2QSI A;  2Q1K A;  5CHX A;  5GTI H;  1PPJ D;  1S2E A;  1L0L J;  3AEA C;  1IZN B;  1KQL A;  3L71 J;  3BAT A;  2WQY C;  1BSH A;  2R5D A;  3L72 J;  3A2A A;  1URQ D;  3KHU A;  5KAX A;  3L73 E;  2N1T B;  2DW3 A;  3SFE C;  1R5S A;  4DCK A;  4W80 A;  1T3U A;  3VMY A;  1JY3 O;  2K88 A;  5KAI H;  3T97 B;  3D6Y A;  3L74 J;  3MHV A;  3RGU A;  4H0L C;  1SQQ J;  3CWB E;  1JO5 A;  4GDO A;  1NU1 J;  2W6J H;  1VF5 B;  2YKO A;  4C7N A;  4L76 A;  1YIJ P;  2BEQ D;  4Y28 J;  4UB6 H;  4Y99 B;  1CSB A;  4K3A A;  3C9I A;  2HPC A;  1Y8A A;  1U7J A;  2PFX A;  4UB8 E;  1OVR A;  5KJ7 C;  1SQB E;  3AEB C;  2A06 E;  5KJ7 A;  1N8R Q;  3H1I G;  5KTB A;  3CMA P;  1S72 P;  1L0N E;  5EFW B;  2PAJ A;  3CI9 A;  3CXH H;  1N86 A;  4HJG H;  3WU2 E;  3WMM 0;  1FU1 A;  1JMM A;  1Q86 Q;  1KB9 D;  2G3A A;  3OAK A;  3LUR A;  1P84 I;  5TJH A;  2C9L Y;  2H43 A;  4PV1 C;  3AEG C;  2KSJ A;  1LTS C;  1U57 A;  3H1I D;  1KIL E;  3SWY A;  1BE3 G;  2ZAE B;  1JNM A;  3BCC D;  2R32 A;  4LC1 A;  1U7M A;  1W2E A;  3C8V A;  3CX5 E;  2ZHG A;  4L73 A;  1GL2 B;  2O1K A;  1SP4 A;  1QGK B;  5D8C A;  1IO4 A;  2POH A;  5AW9 B;  2IYO A;  1N73 A;  1Y47 A;  3S9O A;  1JY2 N;  2E76 B;  1CW5 A;  3FXD A;  3W67 A;  3V2Q A;  5KAF E;  2FYZ A;  1PGJ A;  3B71 A;  3G4S P;  1FDM A;  1FBM A;  1D7M A;  3E1R A;  3AE9 C;  2HFE D;  1GK6 A;  2ZT9 C;  4HKZ H;  1OFC X;  4IFF A;  1KQF B;  3RL0 g;  3VMX A;  4C46 A;  2YMY A;  2YO3 A;  1S3J A;  1VQ4 P;  2G8Y A;  3V4Q A;  5GQQ A;  4IOI H;  3IFM A;  2FYU E;  3H1I J;  2KOG A;  3R2P A;  1KYO E;  2IZ0 A;  1ZRT D;  2KLV A;  1QVF O;  3BCC J;  2WPR A;  3EWK A;  1D5Y A;  2WPQ A;  4D6T G;  5APU A;  4OH8 B;  1FS0 E;  3L71 E;  4H44 C;  3HD7 B;  3L72 E;  3CCQ P;  5KLI C;  2QJP C;  2E5Y A;  1EDK A;  3CXH I;  1NHL A;  1GU5 A;  1SQX E;  3I55 P;  1W2B O;  3V2N A;  3CCL P;  3JCU H;  3LW5 J;  2WSF H;  1VDF A;  5AVZ B;  3L74 E;  1LTI C;  4H0L B;  1N7S D;  3W68 A;  1SQQ E;  5KKZ C;  3I5C A;  2I1J A;  2JKV A;  2OYO A;  4C7N B;  5AW2 B;  3M91 A;  1NU1 E;  2QIW A;  2K1A A;  1QX8 A;  1NO4 A;  1YJ9 P;  2M0B A;  4ZKU A;  3GHG C;  2D2C C;  1LTA C;  4I6M C;  3GHG A;  5AVQ B;  2KUB A;  4XE5 B;  1RE3 C;  3B5N C;  4N6J A;  3BVH A;  1RE3 A;  2W90 A;  3F89 A;  3G6E P;  1LT9 B;  3MUD A;  2E75 D;  2XZR A;  1X79 B;  4WY4 A;  5KLV K;  2Q3E A;  1WT6 A;  2QM8 A;  3GMA A;  1VQO P;  2ZYD A;  5CCH D;  3RK3 B;  1XTG B;  5AVS B;  2WPV B;  1A02 F;  1HH0 A;  5CJ0 A;  2YKQ A;  4R4M A;  3JC2 2;  1HGZ A;  2P7J A;  4PV1 B;  1M57 D;  4ASV A;  1IC2 A;  2QJY B;  2H7H A;  3C1L A;  5AVW B;  3HRN A;  5KLV G;  1NYH A;  1KTM A;  1EZV G;  3EZF A;  3PP5 A;  1IK7 A;  2IBZ I;  1Y9B A;  1MZ9 A;  1LWU B;  3Q3D A;  2KXP B;  1PFI A;  2FBW C;  1ZOY C;  2WSC H;  1N73 B;  2BEZ F;  1JY2 O;  2FXO A;  3CCM P;  5KLV D;  3V5B A;  2NZ2 A;  2FY8 A;  3EFF K;  2WPS A;  1EZV D;  1AQT A;  3MZW B;  3L70 G;  1KC8 Q;  3CC2 P;  3T97 A;  4CPG A;  3N7N A;  1SFC B;  1OX3 A;  3CX5 D;  4YPC A;  3NXS A;  4XFJ A;  1VF5 C;  2B87 A;  1FOS E;  2ZXX A;  1NTK K;  3L35 A;  5AW6 B;  1KB9 E;  1JTH B;  4Y99 C;  2IPP A;  3IR9 A;  3L70 D;  5AW3 B;  1Q05 A;  3O8Z A;  5KJ7 D;  1EXI A;  4JBZ A;  2H8P D;  4HB1 A;  3H1I E;  4EYY Q;  3GPV A;  3AE3 C;  2PRR A;  5E79 H;  2OYH B;  5APW A;  5AW0 B;  2YIU B;  2XV5 A;  2IEF A;  1NTK G;  4GKG A;  3EZ2 A;  1KFN A;  1PIX A;  2R3S A;  4H13 B;  1KZU B;  1GU4 A;  2W83 C;  1ZW0 A;  4PD4 D;  1NVO A;  1USD A;  2M3E A;  5DJU B;  1IFP A;  2O01 H;  4GOF A;  5KLV J;  1BE3 E;  3HUS B;  1PZQ A;  2P10 A;  1KYO D;  4JYC A;  4DJG A;  1NTK D;  2O3J A;  5AW7 B;  1X22 A;  4KHX A;  3AED C;  3ZDM A;  1PGP A;  1CI6 B;  3RBX A;  1Q7Y Q;  4NPE A;  4O9B A;  1Q09 A;  4JF7 A;  2W6A A;  2RKL A;  4AYZ B;  2E5T A;  2Q5U A;  3L70 J;  1M1J C;  3H1K G;  1SQP K;  5CCG C;  2Q3I A;  3RL0 B;  4WY4 B;  1M1J A;  5CCG A;  2E76 C;  1EC5 A;  1LTJ B;  4EI2 A;  2FXM A;  1VQN P;  2JR8 A;  2ZYA A;  3QWO C;  1VQ7 P;  3AE7 C;  1NKZ B;  1NJI Q;  2ZT9 D;  1G1J A;  1KFM A;  1OW7 A;  3M9H A;  3OJA B;  2GUV A;  3H1K D;  1YJW P;  5APT A;  3CME P;  3P32 A;  2IYP A;  1BOW A;  1SQP G;  5BU5 A;  1NWQ A;  2CPB A;  1MKM A;  4AQR D;  2Y9Z A;  2Y0D A;  2OTJ P;  3H1H G;  5B5E H;  2KS1 B;  5BU8 B;  4D6T E;  1NTK J;  5AVT B;  4H44 D;  3EZ9 A;  2WTY A;  3A0H E;  3QAO A;  1Z56 A;  3FWN A;  2P67 A;  3EZ6 A;  2KIK A;  3HD7 C;  2QEX P;  1SQX J;  2KK7 A;  3HD7 A;  1RF1 B;  4W7Y A;  2CK3 H;  1KOR A;  3N4X A;  3H1H D;  2NPS B;  4R4E A;  2LXB A;  5APS A;  4AUW A;  1H0T A;  2J58 A;  1FAV A;  1QVG O;  2BCC G;  1JM0 A;  1G1I A;  2CPS A;  2B87 B;  1OMI A;  1GTW A;  2RH0 A;  5APV A;  1LJ2 A;  1E79 H;  1NOH A;  2D2C D;  4B0Y A;  1EDL A;  2ITA A;  3L75 G;  2Z5H A;  1YI2 P;  1AV1 A;  1N7L A;  3H1K J;  3B5N D;  1VQL P;  2HOD B;  3L37 A;  2BCC D;  5TIS H;  2O01 N;  2I1K A;  1FZE A;  2I8D A;  5M1B A;  1S5L H;  2NRG A;  1IFN A;  1HF9 A;  1LT9 C;  3HE4 A;  1LT9 A;  5K5G B;  2N9B A;  3NMD A;  1AFO A;  2M5A B;  1S9K D;  3HTK B;  2R3C A;  3M9Q A;  1T3J A;  1CZQ A;  1K04 A;  1Q90 D;  3RK3 C;  2WIT A;  1VQP P;  1L2P A;  5L8R J;  2QG4 A;  1FZF A;  1WMK A;  1NAY A;  2WWW A;  2IBZ G;  3RK2 B;  1ZP0 C;  5KLV E;  1M1K Q;  1HJ0 A;  2QJY C;  1EZV E;  1UIX A;  3CPW O;  3Q2Y A;  4I7Z B;  3JSV C;  3VTP C;  1T8Z A;  3OA7 A;  3TDK A;  3KXD A;  1LP1 B;  3ABV C;  3GK6 A;  2HYN A;  3E1I A;  5KCB A;  2IBZ D;  3TGU G;  2OTL P;  3P8C E;  1PP9 G;  1LWU C;  1LWU A;  2N1T D;  1N73 C;  1M1J B;  4GOE A;  3L70 E;  1BE3 D;  1L4A A;  2FFD B;  2BCC J;  3NTN A;  5AW8 B;  1Y6U A;  4A7P A;  3TGU D;  2AEM A;  1R5L A;  1SFC C;  1PP9 D;  1VF5 D;  1SFC A;  3RBZ A;  2Z4E A;  3G71 P;  2ZVN B;  4EOT A;  1KB9 H;  5CJ4 A;  3PJS K;  4DT0 A;  4IL6 X;  2XKM A;  4PJ0 E;  4XA4 A;  3GP4 A;  2W6B A;  2QM7 A;  4L75 A;  2RMZ A;  4PD4 E;  2YMK A;  1JTH A;  1UII A;  5B66 E;  1P84 E;  3D6Z A;  1RF0 A;  5H2F H;  2A45 H;  1ZR4 A;  1T2K C;  5AW5 B;  1NTK E;  2JDI H;  3TNU B;  4J2N A;  2JP3 A;  2OYH C;  2C0W A;  2OYH A;  2YIU C;  1EXJ A;  1H8A A;  1JEK A;  2AXC A;  5KAU A;  1J1D B;  4H13 C;  5GTI E;  3R8K A;  1H0T B;  1OW6 A;  1K9M Q;  3H1L G;  3LW5 H;  3A0B E;  2GOV A;  1BE3 J;  3K5B A;  3II6 A;  2M8R A;  3KDP B;  4IL6 E;  3HUS C;  1AVO A;  3EZ7 A;  4D6T D;  2AEJ A;  3HUS A;  1S1C X;  4WBA A;  1PV3 A;  1J2J B;  3TGU J;  1FZG A;  1PP9 J;  1KIL B;  5KAI E;  1GL2 D;  1MFZ A;  1DD4 A;  2W27 A;  1M8O B;  2C9N Y;  5I44 A;  1CI6 A;  3H1K E;  2P1J A;  2WSS H;  1IFJ A;  1NTZ K;  3FWL A;  1ZME C;  1Q2N A;  2E76 D;  4AYZ A;  3AE6 C;  3HE4 B;  3MUD C;  3RL0 C;  2B9B A;  3CCR P;  4WY4 C;  4UB6 E;  2YKP A;  1LTJ C;  1KD1 Q;  1LTJ A;  1M90 Q;  2AXT E;  2FYN B;  2OYI B;  1JBG A;  3Q5R A;  3L36 A;  1BGY G;  3ITK A;  2J5U A;  4OGQ B;  5GTH E;  1SQP E;  1S4X A;  1NTZ G;  3D70 A;  5AVY B;  2BAS A;  1SLQ A;  2GA1 A;  1KB9 I;  4JQ0 D;  3H1H E;  3L4F A;  1GW4 A;  3HE5 B;  3H6P A;  3I56 P;  4D6T J;  3M9B A;  1BGY D;  1VL2 A;  3B49 A;  4ZNC A;  3CCU P;  2KS1 A;  4C7R A;  3AEF C;  2A45 I;  1HGV A;  2WZ7 A;  1NTZ D;  3VOP A;  3HD7 D;  5C39 A;  4YXD C;  1L4A B;  5AW1 B;  3P7K A;  2WVR A;  1RF1 C;  3CCS P;  4QMA A;  2BCC E;  1RF1 A;  3U1A A;  2NPS C;  4MN4 C;  1EDJ A;  4H0L D;  4R4L A;  5CBO A;  1NGM B;  2NPS A;  3PRJ A;  2Y0C A;  1IJD B;  1Q08 A;  1GMJ A;  4IFD K; 
#chains in the Genus database with same CATH homology
 1EXI A;  1VF5 D;  1S5L X;  2WPV B;  3AE5 C;  3SFD C;  1ZME C;  4R22 B;  2QSI A;  2ZT9 D;  2G3A A;  5KAT A;  2E76 D;  4AYZ A;  3AE6 C;  1OW7 A;  1KQG B;  5M1B A;  4R4M A;  3LUR A;  1AJY A;  1FDO A;  1HF9 A;  1PL5 A;  3O6Q A;  2WSE J;  3E0H A;  2ZHH A;  2O01 J;  5KAV A;  4PV1 B;  2WSF J;  3AEA C;  3IN6 A;  3EWK A;  3GPV A;  4IL6 X;  3AE3 C;  4PV1 C;  1D5Y A;  3AEG C;  4TT3 H;  3GP4 A;  3HH0 A;  1BOW A;  5I41 B;  3H25 A;  1K05 A;  1U57 A;  3R4Y A;  4WLS A;  2YMK A;  2WQY C;  4H44 C;  1MKM A;  1KIL E;  1JBG A;  2IEF A;  3D71 A;  2WSC J;  2OQQ A;  2QJP C;  3EZ2 A;  5KLI C;  1OW8 A;  1NYH A;  4R24 B;  1PIX A;  1K04 A;  4H13 B;  5KAX A;  3Q1M A;  1Q90 D;  1KTM A;  2IDB A;  3Q5R A;  3D6Z A;  2H88 C;  3SFE C;  1KMI Z;  3EZF A;  2J5U A;  4U7J A;  5L8R J;  2HVA A;  1R8E A;  1WMK A;  3AEE C;  1LX8 A;  2DG6 A;  4OGQ B;  3C8V A;  3RK3 E;  3R8J A;  3UCS A;  1IK7 A;  1DD3 A;  2D2C B;  3LW5 J;  3T97 B;  1R8D A;  3D6Y A;  2ZHG A;  3D70 A;  2E75 B;  3IAO A;  1Y9B A;  1ZP0 C;  4H44 D;  3EZ9 A;  2MKV A;  2FXP A;  2E74 B;  4H0L B;  1RQU A;  1PM6 A;  3Q5S A;  2JML A;  4J2N A;  2JP3 A;  3QAO A;  5E01 A;  3Q3D A;  1HJ0 A;  3GF7 A;  4H0L C;  2P10 A;  2QJY C;  5D8C A;  1UIX A;  3AEC C;  1JB0 J;  1ZOY C;  2FBW C;  2YIU C;  5KKZ C;  2FYN C;  3EZ6 A;  1EXJ A;  3Q2Y A;  2JO1 A;  2V7Q J;  4KT0 J;  3FGA D;  4I7Z B;  4GDO A;  2BEZ F;  2KCU A;  5KAU A;  4H13 C;  1VF5 B;  2QIW A;  4RKU J;  3S9O A;  3GF3 A;  3Q5P A;  2ZT9 B;  3R8K A;  1KOR A;  2E76 B;  2NZ2 A;  3AED C;  1OW6 A;  2BEQ D;  4Y28 J;  1VL2 A;  2QJK C;  4PV1 D;  4R4E A;  4OGQ C;  3B49 A;  3ABV C;  3GK6 A;  1YQ4 C;  3AE4 C;  1FDI A;  5KCB A;  2D2C C;  2H89 C;  3AEF C;  2E75 C;  2GOV A;  4WLW A;  4YTP C;  5KAW A;  2E74 C;  1ZRT E;  1Q09 A;  3B71 A;  2KVV A;  1JYH A;  3GLM A;  4AYZ B;  4H13 D;  3EZ7 A;  1Q07 A;  4LHF A;  5GQQ A;  2BOW A;  1S1C X;  4YXD C;  4I7Z C;  1YQ3 C;  3AE9 C;  1Q0A A;  1OMI A;  4XFJ A;  4DCZ A;  3AE8 C;  5D90 A;  2K9Y A;  4OGQ D;  1PV3 A;  1VF5 C;  1RQV A;  3AEB C;  2ZT9 C;  1KQF B;  2D2C D;  2E76 C;  4B0Y A;  2E75 D;  3RL0 g;  2OG0 A;  4Z1M H;  3AE2 C;  1Y6U A;  2VZ4 A;  1Q06 A;  2E74 D;  4H0L D;  4R4L A;  1NGM B;  1DD4 A;  1RH6 A;  4H44 B;  1DIP A;  3GMA A;  4A1M A;  5I44 A;  2G8Y A;  1Q05 A;  1TU3 F;  3AE1 C;  1Q08 A;  1GMJ A;  3AE7 C;  3G9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...