3Q5PA

Crystal structure of bmrr bound to tetracycline
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna/antibiotic
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q5pA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q5pA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q5pA03
1Q0AA 4R4MA 1BOWA 5KAUA 4AYZB 5KAXA 1D5YA 3Q2YA 5GQQA 3Q3DA 1Q06A 1Q05A 2ZHHA 3GP4A 3D6YA 3E0HA 3R8KA 3T97B 1DIPA 5KAWA 3D6ZA 3Q5SA 2OQQA 2GOVA 4J2NA 2VZ4A 1Q08A 3Q5PA 3IAOA 1JYHA 4R4EA 4R22B 1R8EA 3QAOA 3LURA 1Q07A 3B49A 1EXJA 2DG6A 1EXIA 4A1MA 2ZHGA 3GPVA 3HH0A 3Q5RA 4R4LA 3UCSA 5E01A 3GK6A 5KAVA 5I41B 3R8JA 4B0YA 5KATA 2J5UA 1JBGA 2BOWA 2HVAA 1Q09A 5I44A 4R24B 4WLWA 3D70A 2JMLA 3Q1MA 5KCBA 4AYZA 4WLSA 5D8CA 3D71A 3G9RA 1R8DA 5D90A 2KCUA
chains in the Genus database with same CATH superfamily
3BASA 1GW4A 2NPSC 3D6YA 1YI2P 2YIUB 1ZV8A 2KOGA 3WU2E 1N8RQ 5B5EE 5APWA 2P7JA 1PPJE 1HF9A 1VDFA 1RF0A 3H1HG 3TNUB 5GTHE 3FWNA 1JY3N 3P8CD 4LHFA 4IL6X 2JDIH 4R22B 1U7MA 1X0TA 4RJTA 4AQRD 3RL0g 3CXHH 3WUVA 1IK9A 5KATA 3M0DA 1LTBC 5APYA 4WVZA 1FZBA 1LP1A 3HD7C 5AW4B 1Q08A 3G3ZA 2HG5D 3IN6A 3A0BH 3SFEC 1N73A 1N7LA 2I1KA 2Q1KA 3H1JE 1NTMJ 3CLQA 1RF1C 1BE3J 1L0LE 3IAOA 1SQQG 1N2DC 3VOPA 1J2JB 2B89A 2K9YA 2Q9IA 5GTIH 4IL6H 2FYZA 1FAVA 1PPJG 3L70D 2JWAA 5AVYB 5AVSB 2D2CC 2WT7B 5AW1B 1K8AQ 3NXSA 1IJDB 1IFJA 2W6BA 2H43A 4Y99C 1DD3A 1S2EA 2O01H 2LKMA 2GUSA 3H1LJ 1RE4C 1NU1J 5KJ7A 3MD0A 3B8EB 4C46A 1A02F 1IFIA 2CPSA 1M90Q 2E74C 2LXBA 2JR8A 2O1KA 3A0HH 2WMMA 1NTMK 3H1JG 2IEFA 1LTAC 1AQ5A 3S1KA 2XNDH 1NTKJ 1HBWA 3GK6A 1FE6A 1L0LG 5KLVD 1EZVI 1QL2A 3E7KA 5APVA 2HPCA 4N78E 3M0AA 1GW3A 2JP3A 3AE9C 3RK2D 2FBWC 2OYIB 1NGMB 2ZT9C 1NKZB 3TF5A 1OVVA 4OGQD 3KXDA 3EQ2A 2ZVOB 4B0YA 5KAVA 3UIAA 2OTLP 2PP6A 3L75J 3CWBE 1L0ND 3RK2B 3KQGA 2NPSD 2Q7CA 1QEXA 4RO0A 1QX8A 1HGVA 1OVRA 4WY4A 3B5NC 3T97A 4OGQB 3C1LA 3Q3DA 1LT9B 4MN4C 1NU1K 2AEMA 3EFFK 5AW5B 4CPGA 5KAIE 1FOSF 3CX5D 2NPSB 3CCRP 2J5UA 1JBGA 3Q1MA 4UB8H 4N3YB 1R5SA 3JCUH 2B88A 2WSCJ 3VP9A 1PV3A 5AVVB 2DG6A 2PGDA 4H44D 2Q3IA 2BCCE 4PD4I 3H1HD 1NTKK 3AEBC 2IBZD 2P67A 1UIIA 2E75C 2H7HA 1RE4A 1S9KE 1Q05A 4C7RA 1FJKA 3LIDA 2XV5A 1FS0E 3VN0A 1JYHA 5AVXB 5AW8B 1KV4A 4H0LC 1JTHA 3LW5J 2WWWA 1KORA 2ZYGA 3CWBG 1PL5A 2VRSA 1CZQA 4U3FJ 2WPRA 5APTA 2DW3A 4ZNCA 1GZLA 3TGUE 1N7SA 1NTME 1BE3E 1FZEA 1DD4A 1YBKA 2YMYA 5L8RJ 2YXRB 1LT1A 3WUUA 1Q06A 1T8ZA 2D2CD 4GDOA 3CCEP 3R8KA 2SPZA 2FYUD 1SQQD 3GLMA 2H8PD 2HLOA 3AECC 3W68A 2D2CB 3PHLA 5AVWB 1LTSC 1SFCC 2WPSA 4IFMA 2BCCG 1Q81Q 2B87A 3EZ2A 3CCSP 2FYUJ 1RY3A 1BCCJ 2KIKA 2K1AA 2O1JA 3HE5B 3H1LE 5GTIE 2QA4P 3N7NA 1Q09A 4IL6E 1NU1E 1PZQA 1L4AD 1VQNP 1YJWP 2E74B 4W7ZA 2GM4A 4B86A 3RL0D 2K9JA 5KLIC 3R4YA 1SVFA 3A3YB 1L4AB 2W90A 1IK7A 3I55P 3MGNA 3RL0B 4PD4H 4EYYQ 1OMIA 4ASWA 3TGUG 1NTMG 1BE3G 1NTKE 1IZNB 4JPZB 4NPDA 2AXCA 1L0LD 1M8OB 2JEEA 3A0HE 2E5YA 2Q5UA 5D90A 4D6TD 2J58A 2OYHA 3L74D 1LX8A 3Q5SA 3B5NB 3N4XA 3L75E 1J1DB 3L35A 1OFCX 3AEEC 4D6TJ 2Q6QA 3MZWB 3O8ZA 1P84D 3H1LG 3SWKA 4AYZB 1NU1G 1X22A 4BRYB 1QGKB 3CCLP 1URQA 3L37A 1M56D 2E75D 1KZUB 2KSEA 1VPCA 1LGHB 1TU3F 1NAFA 3AE8C 2KNCB 1LTJC 1VF5C 3O6QA 3Q5PA 2ZXXA 2E75B 1Q07A 2E76C 3V2RA 3GPVA 3A2AA 1QVGO 4UB8E 5AW0B 2QM7A 1D7MA 1ZMEC 3JCUE 1ZN5A 4I2LC 1ZR4A 5CJ0A 2A06D 2R3CA 1CI6B 1JY3O 2VZ4A 1JM0A 3R2PA 1SQXG 1CSBA 3HTKB 2IX7C 1VQ6P 2HODB 3L75G 4U3FE 2OYIC 3CPWO 2XZRA 4XA4A 3JSVC 1R5LA 2FKWB 1FZFA 5CCGD 2K37A 1DIPA 1W2BO 1YYCA 3RK2C 1NTZJ 3ZDMA 4RESB 1SFCD 1VQ8P 4OGQC 4DCKA 2L5GB 4XE5B 3HUSA 3MUDA 3AE2C 2C9LY 2WSSH 2ZHHA 1SFCB 3H1IE 3OAKA 3MIWA 1SQPK 2KK7A 1FOSE 1S1CX 3PRJA 2BOWA 1J1EC 3G4SP 3FGAD 2KYVA 4HB1A 1KTMA 1EZVE 2BCCD 1Q7YQ 2GA1A 4HYTB 2WT7A 1FDOA 1YIJP 1VQOP 4J2NA 3V6IA 3GHGB 4DOJA 2ZYAA 2YO2A 3AEDC 1VL2A 3K5BA 5KLIB 4IFFA 4H44C 2HYNA 4TLFA 1ZRTE 4W80A 1ZW0A 5TJHA 1HJ0A 2I8DA 2NZ2A 2Y0CA 2Y0DA 3L73E 2N1TD 4U3FG 3QAOA 2OYOA 5E79H 2E42A 1NTZK 3BCCD 2YXQB 1L2PA 4K35A 3CX5I 3CXHD 2N1TB 4BXLA 3RK3C 1JEKA 1OX3A 2K3RA 2BEZF 2M5AB 3EWKA 3GMAA 3BVHA 2M3EA 1MFTA 1PIXA 3V4WA 4BWNA 5B66H 1T3JA 3CCQP 5K5GB 3G71P 1YJNP 3H1IG 1USDA 4PD4E 5D8CA 2Q3EA 2YKQA 1JCCA 3RBXA 2Z5IA 2OTJP 1K04A 2OYIA 1GL2C 5KAUA 1RE3A 2AEJA 3CCUP 2IBZI 1SLQA 1EZVG 3PJSK 4JBZA 1G1JA 3V4QA 3QH9A 4IFDK 4DJGA 1SP4A 5AW6B 1UIXA 4EI2A 3L70J 1LT9A 2JWDA 1VF5D 1Q86Q 4AUWA 4OH8B 2NPSA 2E76D 1HTLC 3AE5C 1LTJB 3V2NA 1OW8A 1VF5B 3L73G 2QJKB 2KXPB 5AW2B 1EDKA 2E76B 1SQPE 1EDJA 1L4AC 5CBOA 3L72D 2FXPA 3BRVB 1JCDA 1PP9E 1YTZT 4L76A 3RL0C 2XNXA 1KILD 1AVYA 1SQBD 1GD2E 4OWFA 3D70A 1FBMA 2FYNC 3L72J 5M1BA 1SQVD 3A5TA 1GDTA 1H0TB 1FZGA 3H1KE 1KILB 1SS1A 1BGYD 3OJAB 3ITKA 2QE7H 1FDMA 1USEA 3HD7A 1DEBA 1SQXD 5KLVJ 1T2KD 1EC5A 4Z1MH 2YKPA 2HFED 4L73A 3CI9A 1ZP0C 1J1DC 2WSCH 2WQYC 1NTZE 1RF1A 2KUBA 2NRGA 1M7LA 1JY2P 4EDFA 1L0NJ 3AE1C 3L71E 2AXTH 5CHXA 3H32B 2KLVA 1BDDA 3D71A 3KZIE 1AFOA 3IR9A 1J1EB 5KAWA 3H6PA 1DH3A 1SQPG 1FU1A 3CMAP 3MHVA 3EZ9A 3Q5RA 1OXZA 1T3UA 1PP9G 2RH0A 3LW5H 2WVRA 1D5YA 3HE5A 4H44B 2QIWA 5CJ4A 2KB7P 3H1HJ 3H1KG 3UCSA 1LWUC 5KLVK 5I44A 3P8CE 4WWIA 3RK3D 2WSEH 1Q0AA 4PJ0H 3GP4A 1OIPA 1L4AA 1RH6A 4PV1D 1YQ3C 1K05A 1M1JC 1P84I 3RK3B 3VP8A 1Q82Q 4O9BA 3C9IA 1KB9D 4WY4D 1ZLLA 1NTZG 3F5HA 1NYHA 3VTPC 1L0NK 1GL2D 2FXMA 4JYBA 3HE4B 4N6JA 1DEEG 1KYOD 5AW9B 1U7JA 3L71G 3BRTB 2WSEJ 5E79E 3CC4P 3V2PA 1GL2B 2W83C 5CCGC 3U1AA 1PGJA 3H1ID 4LLHA 4H13C 2OG0A 2BEQD 1PPJD 5KAXA 5B66E 3B5NA 2O01N 2P1JA 1SQQJ 3TK1A 3SSUA 2IPPA 3B71A 1H8AA 3EZFA 1QVFO 5I41B 4XFJA 1X9VA 1VQ4P 4DZOA 1FC2C 4AYZA 1HUCA 3V5BA 1FZCC 3GHGC 1Y47A 2JKVA 1G2CB 1H88A 3L73D 2G3AA 2ZAEB 2R32A 2WZ7A 5KAFH 2KNCA 2M3BA 2Z5HA 2KS1B 3KHUA 1Z56A 3H1JD 2FFDC 1N7SD 2FYNB 3KPEA 1IFNA 1JY2N 2PRRA 4W7YA 5C39A 2A45I 2KSJA 3G6EP 2N1TC 1GMJA 2P10A 5AVQB 2K88A 3NTNA 3H1JJ 3VMYA 1S72P 3II6A 4K3AA 5KLVE 3HTKA 2FYUK 1SQQK 2O3JA 2XDJA 1VQ7P 2V4HA 4C7NB 1IO4A 1L0LJ 2HODA 3V2QA 1P84H 2KLUA 5CMZA 4ZKPA 1QL1A 3P8MC 3VMZA 2Y9YA 4ZMDA 5KKZC 4Y28J 3L74J 1Y6UA 4GOEA 4JF7A 1L0NE 1LTGC 1RF0C 5CCGA 4WLWA 3GG2A 1HWTC 5AW7B 1GK4A 3CX5E 1SFCA 4WB4A 3CXHI 5APUA 3CC7P 1JNMA 5AVRB 1SQPD 3LURA 2QJKC 2AXTE 4A7PA 2QEXP 3M0DC 3TNUA 5E01A 1IFDA 1NTKG 1LJ2A 2H89C 1LWUB 3FXEA 1KQSO 1GU4A 4GOFA 2KZIA 3GHGA 3CCMP 2IBZE 3PTZA 4N78D 4WBAA 1GK6A 1N73C 3H1KD 1S3JA 5KLVG 1M1JB 4LC1A 2FXOA 3M9HA 1KILC 3AE6C 4HKZH 2M8RA 1PM6A 2JJLA 3CWBD 3KZIH 1AV1A 1LTIC 2MJZA 3B4SA 4L75A 1R8EA 1E79H 2WSFJ 2N1TA 4H13D 2CPBA 5KCBA 3L36A 1NVOA 1KD1Q 3NFQA 4PJ0E 3PH0A 2C0XA 1T2KC 1S5LH 1BDCA 2UWJE 1Y9BA 2JO1A 3CCJP 1HH0A 4H13B 4A1MA 1NH4A 4I1LA 2H88C 2C0WA 1VQMP 2FYUE 1SQQE 5KJ7C 5TISH 1BCCE 2IFNA 3U1CA 1BOWA 2M0BA 3W67A 1HJBA 2FY8A 1M1KQ 1HGZA 1FZCB 5AVZB 3O6QB 1S9KD 1LNQA 1LTTC 2P58A 2IBZG 1NAYA 1PGPA 4GODA 2BCCJ 2IZ1A 4YTPC 1KQGB 2CK3H 1LTJA 1WRGA 2XU6A 3AEGC 5CCHD 3CCVP 2FFDB 1EQ7A 1JUNA 2IYPA 2L91A 4UB6E 3TSIA 3TGUD 1KQLA 1NTMD 1BE3D 1X8YA 4QMAA 3A7OA 4DT0A 3VYIA 2HR3A 4ASVA 2WTYA 3BCCJ 4PV1C 5KAFE 4AYCA 2WPVB 4WY4C 1H0TA 3G9RA 3USSA 1DX7A 1KILA 5APSA 3TGUJ 2KCUA 1YJ9P 1Q2NA 5DJUB 3HUSB 4NPFX 2N9YB 1YTZI 1WT6A 2FYUG 4YXWH 1BCCG 3M9QA 5KKZB 2IZ0A 3B49A 1OWAA 4I6MC 4D6TE 5CBNA 2C9NY 3L74E 3H1LD 3GF7A 1NU1D 2KP8A 1MKMA 1OVUA 3H32A 1P84E 3QWOC 1KB9I 4I7ZC 3PLNA 2QJYC 1AQTA 3P7KA 1EDIA 1KYOI 1LP1B 3F89A 3AE4C 2Y0EA 2ZJSE 1NTKD 3RGUA 1N73B 2O01J 1FZAA 2POHA 2Z4EA 2W8ZA 2V7QH 3GF3A 1SQBJ 1N7SC 1OW7A 1G1IA 2A06E 2KZJA 1SQVJ 3L75D 4D6TG 3WUTA 1BGYJ 2W6AA 1OZHA 3CD6P 3CX5H 1KFNA 2RKLA 3FXDA 1K73Q 1FJPA 3L74G 4OVNF 1SQXJ 1PFIA 2GOVA 2QG4A 2V7QJ 2RMZA 5H2FE 3HE4A 1N86A 5KJ7D 1Q90D 1YHQP 4YPCA 3VMXA 2OTKE 2R5DA 1K9MQ 1JMBA 1NKNA 5GQQA 4YXDC 1GL2A 2OQQA 3VMAA 1KQFB 1KC8Q 1AVOA 1KMIZ 1WMKA 1S5LE 1YITP 3IFMA 3SWFA 1KN7A 1HVVA 2QSIA 3P32A 4R4EA 1AJYA 5BU8B 3EFGA 1SQBK 2OGUA 5TISE 2IDBA 1A02J 3KDPB 3HD7D 1SQVK 2R44A 5KTBA 2HPCB 2A06G 1T6AA 1KB9H 5AVUB 1G2CA 1KFMA 4U3FD 3S9OA 1S4XA 1SQXK 3HD7B 1EXIA 1E5WA 2HVAA 2WITA 1KYOH 5DJTB 4ZKUA 3OW2O 4WLSA 2KS1A 4PV1B 2W6JH 2OYHC 3AE7C 5APXA 4L74A 3BCCE 3HRNA 4WY4B 4EIJA 3T97B 1ZR2A 1JOCA 1RF1B 3CXHE 3WU2H 1IFPA 3M9BA 1XTCC 2ZHGA 2WPQA 5B5EH 3EZ6A 1JY2O 3C8VA 1NJIQ 2QJPC 4M3LA 1VQ9P 3OA7A 5BU5A 5GTHH 1MV8A 2A45G 1IFMA 2KI7B 3A0BE 1XTGB 4C7NA 1FDIA 4LGDE 1NOHA 2OARA 1EZVD 2R3SA 1BCCD 5AVTB 3E1IA 3H1IJ 1URQC 3MP7B 3RBZA 1RHZB 3L70E 5EFWB 2YIUC 5APQA 1BSHA 2IYOA 3TYYA 4UB6H 4Y99B 2PAJA 3I5CA 3BATA 4BRYA 1RQUA 1JMMA 2E74D 4GKGA 1ZRTD 3GW6A 4I7ZB 4GIFA 4KJMA 2QJYB 4GT1A 3IF4A 3AEFC 2E5TA 2I1JA 1JTHB 2YMKA 4IOIH 2G8YA 3SWYA 3L73J 1PGOA 3BCCG 3S4RA 1W5CE 3L72E 2KVVA 2ZYDA 1LWUA 3SFDC 5CCHC 1YQ4C 2ZVNB 1N7SB 3E1RA 1IC2A 4TT3H 1AA0A 2LXCB 2ZT9D 3CC2P 1CI6A 1KILE 1SQBE 3E0HA 1U57A 4PD4D 1JY3P 4JYCA 3D6ZA 1RH5B 1M1JA 3PP5A 1SQVE 3L4FA 4KT0J 3TDKA 2ZT9B 2W27A 3B5ND 1EDLA 1BGYE 2Y9ZA 2N9BA 3HUSC 3MUDC 1R8DA 5AW3B 1SQXE 1QLED 1NO4A 3L70G 3M91A 4U7JA 3AEAC 2B87B 1VQ5P 1ZXGA 3KYQA 3R8JA 2XKMA 2ZXEB 1GTWA 1MUUA 1Y8AA 5BVZA 1M57D 3H25A 4DCZA 1BSNA 3I56P 4HJGH 1VQLP 2YKOA 1GU5A 4KHXA 2K9JB 2LR2A 2IFMA 2E43A 1S5LX 1NHLA 1ZOYC 2JMLA 1PP9D 2QVAA 2RN0A 2YNYA 2B9BA 2R5BA 3WMM0 2J59M 3FX0A 3L72G 3FWLA 4HH2A 1FZCA 1SQPJ 3H1HE 3CL3D 1MZ9A 2ZFCA 4H0LD 3ABVC 1SQBG 4NPEA 1PP9J 2WSFH 3HH0A 1L0LK 5H2FH 1SQVG 2BASA 2AEFA 2P2UA 4H0LB 1BGYG 3H1KJ 3RK3E 2ITAA 1JB0J 1VQPP 2OYHB 5KAIH 2FFDA 3JC22 1EXJA 2QM8A 2PFXA 3M06A 1H89A 1NTZD 1W2EA 1CW5A 1JO5A 4R24B 1L0NG 3NMDA 4EOTA 2MKVA 3AE3C 3U59A 1RE3C 2A45H 3EZ7A 3MTUE 2QRXA 2M5AA 3CWBJ 5CCHA 4R4MA 3L71D 1KB9E 3Q2YA 2QJPB 1RQVA 1MFZA 1OW6A 2YO3A 1URQD 3CMEP 1PGQA 1KYOE 3LIEA 4R4LA 4JQ0D 1X79B 1VQKP 1LT9C 4RKUJ 2GUVA 3L71J 1URQB 1NWQA
chains in the Genus database with same CATH topology
1Q0AA 5L8RJ 4OGQB 4I7ZC 3Q3DA 1Q06A 3GP4A 3D6YA 1KQGB 2BEZF 2D2CD 3EWKA 3GMAA 4GDOA 3R8KA 4PV1D 1RH6A 2QJYC 1PIXA 1DIPA 1RQUA 1YQ3C 1K05A 1LX8A 3Q5SA 2QSIA 2E74D 2D2CC 4R4EA 3GLMA 1AJYA 4I7ZB 3AE4C 3AEGC 1S5LX 1HF9A 3AEEC 1NYHA 1GMJA 1ZOYC 1JBGA 2J5UA 5M1BA 3AECC 1DD3A 2P10A 2D2CB 2JMLA 3Q1MA 4OGQC 2IDBA 4Z1MH 5D8CA 3AEFC 2O01J 3AE6C 1K04A 3AE2C 5KAUA 4AYZB 2WSEJ 3EZ2A 1ZP0C 1PM6A 2YMKA 2WQYC 2ZHHA 2WSCJ 4LHFA 3GF3A 4IL6X 3S9OA 1PV3A 4R22B 1R8EA 2G8YA 4H0LD 3ABVC 4PV1C 2DG6A 3RL0g 1EXIA 4H44D 1S1CX 3HH0A 3AE1C 1OW7A 2E74C 2WSFJ 5KATA 2BOWA 2HVAA 3AEBC 1Q09A 4H13D 2KVVA 2WPVB 2E75D 5KCBA 3SFDC 4WLSA 1UIXA 3FGAD 1KTMA 3D71A 3G9RA 4PV1B 1YQ4C 4H13C 2KCUA 1TU3F 2OG0A 1VF5D 2BEQD 2E75C 2E74B 4TT3H 5KKZC 4H0LB 2ZT9D 3AE8C 4Y28J 1KILE 3AE7C 5KAXA 3E0HA 1Q05A 1Y6UA 1FDOA 1U57A 1VF5C 3T97B 2IEFA 5KAWA 3D6ZA 1Y9BA 2E76D 2JO1A 2GOVA 5KLIC 4J2NA 3O6QA 1Q08A 3Q5PA 2V7QJ 3IN6A 3R4YA 2E75B 4H13B 3RK3E 3SFEC 1JYHA 1JB0J 3AE5C 3B71A 1Q07A 3B49A 1EXJA 3EZFA 3EZ9A 1IK7A 2E76C 4A1MA 1OW8A 2ZHGA 3GPVA 3Q5RA 1VF5B 3GK6A 3EZ6A 4KT0J 5I41B 3AEDC 4XFJA 2ZT9B 3C8VA 1VL2A 4R24B 1Q90D 2QJPC 4WLWA 2H88C 2MKVA 3AE3C 4H0LC 4AYZA 4H44C 3LW5J 1ZMEC 2E76B 1R8DA 3EZ7A 1OMIA 1ZRTE 4R4MA 1BOWA 1KORA 1D5YA 3Q2YA 1HJ0A 1PL5A 1RQVA 2JP3A 2NZ2A 3AE9C 4YXDC 5GQQA 1OW6A 2FXPA 3GF7A 4H44B 4U7JA 2FBWC 2QIWA 1FDIA 3AEAC 1NGMB 2OQQA 1MKMA 2VZ4A 2ZT9C 3IAOA 3QAOA 3LURA 2QJKC 4OGQD 1KQFB 3R8JA 4R4LA 3UCSA 5E01A 5KAVA 4B0YA 2G3AA 2K9YA 5I44A 3D70A 3H25A 4RKUJ 1KMIZ 4DCZA 2YIUC 1WMKA 2H89C 4YTPC 2FYNC 5D90A 1DD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0A A;  4R4M A;  1BOW A;  5KAU A;  4AYZ B;  5KAX A;  1D5Y A;  3Q2Y A;  5GQQ A;  3Q3D A;  1Q06 A;  1Q05 A;  2ZHH A;  3GP4 A;  3D6Y A;  3E0H A;  3R8K A;  3T97 B;  1DIP A;  5KAW A;  3D6Z A;  3Q5S A;  2OQQ A;  2GOV A;  4J2N A;  2VZ4 A;  1Q08 A;  3Q5P A;  3IAO A;  1JYH A;  4R4E A;  4R22 B;  1R8E A;  3QAO A;  3LUR A;  1Q07 A;  3B49 A;  1EXJ A;  2DG6 A;  1EXI A;  4A1M A;  2ZHG A;  3GPV A;  3HH0 A;  3Q5R A;  4R4L A;  3UCS A;  5E01 A;  3GK6 A;  5KAV A;  5I41 B;  3R8J A;  4B0Y A;  5KAT A;  2J5U A;  1JBG A;  2BOW A;  2HVA A;  1Q09 A;  5I44 A;  4R24 B;  4WLW A;  3D70 A;  2JML A;  3Q1M A;  5KCB A;  4AYZ A;  4WLS A;  5D8C A;  3D71 A;  3G9R A;  1R8D A;  5D90 A;  2KCU A; 
#chains in the Genus database with same CATH topology
 3BAS A;  1GW4 A;  2NPS C;  3D6Y A;  1YI2 P;  2YIU B;  1ZV8 A;  2KOG A;  3WU2 E;  1N8R Q;  5B5E E;  5APW A;  2P7J A;  1PPJ E;  1HF9 A;  1VDF A;  1RF0 A;  3H1H G;  3TNU B;  5GTH E;  3FWN A;  1JY3 N;  3P8C D;  4LHF A;  4IL6 X;  2JDI H;  4R22 B;  1U7M A;  1X0T A;  4RJT A;  4AQR D;  3RL0 g;  3CXH H;  3WUV A;  1IK9 A;  5KAT A;  3M0D A;  1LTB C;  5APY A;  4WVZ A;  1FZB A;  1LP1 A;  3HD7 C;  5AW4 B;  1Q08 A;  3G3Z A;  2HG5 D;  3IN6 A;  3A0B H;  3SFE C;  1N73 A;  1N7L A;  2I1K A;  2Q1K A;  3H1J E;  1NTM J;  3CLQ A;  1RF1 C;  1BE3 J;  1L0L E;  3IAO A;  1SQQ G;  1N2D C;  3VOP A;  1J2J B;  2B89 A;  2K9Y A;  2Q9I A;  5GTI H;  4IL6 H;  2FYZ A;  1FAV A;  1PPJ G;  3L70 D;  2JWA A;  5AVY B;  5AVS B;  2D2C C;  2WT7 B;  5AW1 B;  1K8A Q;  3NXS A;  1IJD B;  1IFJ A;  2W6B A;  2H43 A;  4Y99 C;  1DD3 A;  1S2E A;  2O01 H;  2LKM A;  2GUS A;  3H1L J;  1RE4 C;  1NU1 J;  5KJ7 A;  3MD0 A;  3B8E B;  4C46 A;  1A02 F;  1IFI A;  2CPS A;  1M90 Q;  2E74 C;  2LXB A;  2JR8 A;  2O1K A;  3A0H H;  2WMM A;  1NTM K;  3H1J G;  2IEF A;  1LTA C;  1AQ5 A;  3S1K A;  2XND H;  1NTK J;  1HBW A;  3GK6 A;  1FE6 A;  1L0L G;  5KLV D;  1EZV I;  1QL2 A;  3E7K A;  5APV A;  2HPC A;  4N78 E;  3M0A A;  1GW3 A;  2JP3 A;  3AE9 C;  3RK2 D;  2FBW C;  2OYI B;  1NGM B;  2ZT9 C;  1NKZ B;  3TF5 A;  1OVV A;  4OGQ D;  3KXD A;  3EQ2 A;  2ZVO B;  4B0Y A;  5KAV A;  3UIA A;  2OTL P;  2PP6 A;  3L75 J;  3CWB E;  1L0N D;  3RK2 B;  3KQG A;  2NPS D;  2Q7C A;  1QEX A;  4RO0 A;  1QX8 A;  1HGV A;  1OVR A;  4WY4 A;  3B5N C;  3T97 A;  4OGQ B;  3C1L A;  3Q3D A;  1LT9 B;  4MN4 C;  1NU1 K;  2AEM A;  3EFF K;  5AW5 B;  4CPG A;  5KAI E;  1FOS F;  3CX5 D;  2NPS B;  3CCR P;  2J5U A;  1JBG A;  3Q1M A;  4UB8 H;  4N3Y B;  1R5S A;  3JCU H;  2B88 A;  2WSC J;  3VP9 A;  1PV3 A;  5AVV B;  2DG6 A;  2PGD A;  4H44 D;  2Q3I A;  2BCC E;  4PD4 I;  3H1H D;  1NTK K;  3AEB C;  2IBZ D;  2P67 A;  1UII A;  2E75 C;  2H7H A;  1RE4 A;  1S9K E;  1Q05 A;  4C7R A;  1FJK A;  3LID A;  2XV5 A;  1FS0 E;  3VN0 A;  1JYH A;  5AVX B;  5AW8 B;  1KV4 A;  4H0L C;  1JTH A;  3LW5 J;  2WWW A;  1KOR A;  2ZYG A;  3CWB G;  1PL5 A;  2VRS A;  1CZQ A;  4U3F J;  2WPR A;  5APT A;  2DW3 A;  4ZNC A;  1GZL A;  3TGU E;  1N7S A;  1NTM E;  1BE3 E;  1FZE A;  1DD4 A;  1YBK A;  2YMY A;  5L8R J;  2YXR B;  1LT1 A;  3WUU A;  1Q06 A;  1T8Z A;  2D2C D;  4GDO A;  3CCE P;  3R8K A;  2SPZ A;  2FYU D;  1SQQ D;  3GLM A;  2H8P D;  2HLO A;  3AEC C;  3W68 A;  2D2C B;  3PHL A;  5AVW B;  1LTS C;  1SFC C;  2WPS A;  4IFM A;  2BCC G;  1Q81 Q;  2B87 A;  3EZ2 A;  3CCS P;  2FYU J;  1RY3 A;  1BCC J;  2KIK A;  2K1A A;  2O1J A;  3HE5 B;  3H1L E;  5GTI E;  2QA4 P;  3N7N A;  1Q09 A;  4IL6 E;  1NU1 E;  1PZQ A;  1L4A D;  1VQN P;  1YJW P;  2E74 B;  4W7Z A;  2GM4 A;  4B86 A;  3RL0 D;  2K9J A;  5KLI C;  3R4Y A;  1SVF A;  3A3Y B;  1L4A B;  2W90 A;  1IK7 A;  3I55 P;  3MGN A;  3RL0 B;  4PD4 H;  4EYY Q;  1OMI A;  4ASW A;  3TGU G;  1NTM G;  1BE3 G;  1NTK E;  1IZN B;  4JPZ B;  4NPD A;  2AXC A;  1L0L D;  1M8O B;  2JEE A;  3A0H E;  2E5Y A;  2Q5U A;  5D90 A;  4D6T D;  2J58 A;  2OYH A;  3L74 D;  1LX8 A;  3Q5S A;  3B5N B;  3N4X A;  3L75 E;  1J1D B;  3L35 A;  1OFC X;  3AEE C;  4D6T J;  2Q6Q A;  3MZW B;  3O8Z A;  1P84 D;  3H1L G;  3SWK A;  4AYZ B;  1NU1 G;  1X22 A;  4BRY B;  1QGK B;  3CCL P;  1URQ A;  3L37 A;  1M56 D;  2E75 D;  1KZU B;  2KSE A;  1VPC A;  1LGH B;  1TU3 F;  1NAF A;  3AE8 C;  2KNC B;  1LTJ C;  1VF5 C;  3O6Q A;  3Q5P A;  2ZXX A;  2E75 B;  1Q07 A;  2E76 C;  3V2R A;  3GPV A;  3A2A A;  1QVG O;  4UB8 E;  5AW0 B;  2QM7 A;  1D7M A;  1ZME C;  3JCU E;  1ZN5 A;  4I2L C;  1ZR4 A;  5CJ0 A;  2A06 D;  2R3C A;  1CI6 B;  1JY3 O;  2VZ4 A;  1JM0 A;  3R2P A;  1SQX G;  1CSB A;  3HTK B;  2IX7 C;  1VQ6 P;  2HOD B;  3L75 G;  4U3F E;  2OYI C;  3CPW O;  2XZR A;  4XA4 A;  3JSV C;  1R5L A;  2FKW B;  1FZF A;  5CCG D;  2K37 A;  1DIP A;  1W2B O;  1YYC A;  3RK2 C;  1NTZ J;  3ZDM A;  4RES B;  1SFC D;  1VQ8 P;  4OGQ C;  4DCK A;  2L5G B;  4XE5 B;  3HUS A;  3MUD A;  3AE2 C;  2C9L Y;  2WSS H;  2ZHH A;  1SFC B;  3H1I E;  3OAK A;  3MIW A;  1SQP K;  2KK7 A;  1FOS E;  1S1C X;  3PRJ A;  2BOW A;  1J1E C;  3G4S P;  3FGA D;  2KYV A;  4HB1 A;  1KTM A;  1EZV E;  2BCC D;  1Q7Y Q;  2GA1 A;  4HYT B;  2WT7 A;  1FDO A;  1YIJ P;  1VQO P;  4J2N A;  3V6I A;  3GHG B;  4DOJ A;  2ZYA A;  2YO2 A;  3AED C;  1VL2 A;  3K5B A;  5KLI B;  4IFF A;  4H44 C;  2HYN A;  4TLF A;  1ZRT E;  4W80 A;  1ZW0 A;  5TJH A;  1HJ0 A;  2I8D A;  2NZ2 A;  2Y0C A;  2Y0D A;  3L73 E;  2N1T D;  4U3F G;  3QAO A;  2OYO A;  5E79 H;  2E42 A;  1NTZ K;  3BCC D;  2YXQ B;  1L2P A;  4K35 A;  3CX5 I;  3CXH D;  2N1T B;  4BXL A;  3RK3 C;  1JEK A;  1OX3 A;  2K3R A;  2BEZ F;  2M5A B;  3EWK A;  3GMA A;  3BVH A;  2M3E A;  1MFT A;  1PIX A;  3V4W A;  4BWN A;  5B66 H;  1T3J A;  3CCQ P;  5K5G B;  3G71 P;  1YJN P;  3H1I G;  1USD A;  4PD4 E;  5D8C A;  2Q3E A;  2YKQ A;  1JCC A;  3RBX A;  2Z5I A;  2OTJ P;  1K04 A;  2OYI A;  1GL2 C;  5KAU A;  1RE3 A;  2AEJ A;  3CCU P;  2IBZ I;  1SLQ A;  1EZV G;  3PJS K;  4JBZ A;  1G1J A;  3V4Q A;  3QH9 A;  4IFD K;  4DJG A;  1SP4 A;  5AW6 B;  1UIX A;  4EI2 A;  3L70 J;  1LT9 A;  2JWD A;  1VF5 D;  1Q86 Q;  4AUW A;  4OH8 B;  2NPS A;  2E76 D;  1HTL C;  3AE5 C;  1LTJ B;  3V2N A;  1OW8 A;  1VF5 B;  3L73 G;  2QJK B;  2KXP B;  5AW2 B;  1EDK A;  2E76 B;  1SQP E;  1EDJ A;  1L4A C;  5CBO A;  3L72 D;  2FXP A;  3BRV B;  1JCD A;  1PP9 E;  1YTZ T;  4L76 A;  3RL0 C;  2XNX A;  1KIL D;  1AVY A;  1SQB D;  1GD2 E;  4OWF A;  3D70 A;  1FBM A;  2FYN C;  3L72 J;  5M1B A;  1SQV D;  3A5T A;  1GDT A;  1H0T B;  1FZG A;  3H1K E;  1KIL B;  1SS1 A;  1BGY D;  3OJA B;  3ITK A;  2QE7 H;  1FDM A;  1USE A;  3HD7 A;  1DEB A;  1SQX D;  5KLV J;  1T2K D;  1EC5 A;  4Z1M H;  2YKP A;  2HFE D;  4L73 A;  3CI9 A;  1ZP0 C;  1J1D C;  2WSC H;  2WQY C;  1NTZ E;  1RF1 A;  2KUB A;  2NRG A;  1M7L A;  1JY2 P;  4EDF A;  1L0N J;  3AE1 C;  3L71 E;  2AXT H;  5CHX A;  3H32 B;  2KLV A;  1BDD A;  3D71 A;  3KZI E;  1AFO A;  3IR9 A;  1J1E B;  5KAW A;  3H6P A;  1DH3 A;  1SQP G;  1FU1 A;  3CMA P;  3MHV A;  3EZ9 A;  3Q5R A;  1OXZ A;  1T3U A;  1PP9 G;  2RH0 A;  3LW5 H;  2WVR A;  1D5Y A;  3HE5 A;  4H44 B;  2QIW A;  5CJ4 A;  2KB7 P;  3H1H J;  3H1K G;  3UCS A;  1LWU C;  5KLV K;  5I44 A;  3P8C E;  4WWI A;  3RK3 D;  2WSE H;  1Q0A A;  4PJ0 H;  3GP4 A;  1OIP A;  1L4A A;  1RH6 A;  4PV1 D;  1YQ3 C;  1K05 A;  1M1J C;  1P84 I;  3RK3 B;  3VP8 A;  1Q82 Q;  4O9B A;  3C9I A;  1KB9 D;  4WY4 D;  1ZLL A;  1NTZ G;  3F5H A;  1NYH A;  3VTP C;  1L0N K;  1GL2 D;  2FXM A;  4JYB A;  3HE4 B;  4N6J A;  1DEE G;  1KYO D;  5AW9 B;  1U7J A;  3L71 G;  3BRT B;  2WSE J;  5E79 E;  3CC4 P;  3V2P A;  1GL2 B;  2W83 C;  5CCG C;  3U1A A;  1PGJ A;  3H1I D;  4LLH A;  4H13 C;  2OG0 A;  2BEQ D;  1PPJ D;  5KAX A;  5B66 E;  3B5N A;  2O01 N;  2P1J A;  1SQQ J;  3TK1 A;  3SSU A;  2IPP A;  3B71 A;  1H8A A;  3EZF A;  1QVF O;  5I41 B;  4XFJ A;  1X9V A;  1VQ4 P;  4DZO A;  1FC2 C;  4AYZ A;  1HUC A;  3V5B A;  1FZC C;  3GHG C;  1Y47 A;  2JKV A;  1G2C B;  1H88 A;  3L73 D;  2G3A A;  2ZAE B;  2R32 A;  2WZ7 A;  5KAF H;  2KNC A;  2M3B A;  2Z5H A;  2KS1 B;  3KHU A;  1Z56 A;  3H1J D;  2FFD C;  1N7S D;  2FYN B;  3KPE A;  1IFN A;  1JY2 N;  2PRR A;  4W7Y A;  5C39 A;  2A45 I;  2KSJ A;  3G6E P;  2N1T C;  1GMJ A;  2P10 A;  5AVQ B;  2K88 A;  3NTN A;  3H1J J;  3VMY A;  1S72 P;  3II6 A;  4K3A A;  5KLV E;  3HTK A;  2FYU K;  1SQQ K;  2O3J A;  2XDJ A;  1VQ7 P;  2V4H A;  4C7N B;  1IO4 A;  1L0L J;  2HOD A;  3V2Q A;  1P84 H;  2KLU A;  5CMZ A;  4ZKP A;  1QL1 A;  3P8M C;  3VMZ A;  2Y9Y A;  4ZMD A;  5KKZ C;  4Y28 J;  3L74 J;  1Y6U A;  4GOE A;  4JF7 A;  1L0N E;  1LTG C;  1RF0 C;  5CCG A;  4WLW A;  3GG2 A;  1HWT C;  5AW7 B;  1GK4 A;  3CX5 E;  1SFC A;  4WB4 A;  3CXH I;  5APU A;  3CC7 P;  1JNM A;  5AVR B;  1SQP D;  3LUR A;  2QJK C;  2AXT E;  4A7P A;  2QEX P;  3M0D C;  3TNU A;  5E01 A;  1IFD A;  1NTK G;  1LJ2 A;  2H89 C;  1LWU B;  3FXE A;  1KQS O;  1GU4 A;  4GOF A;  2KZI A;  3GHG A;  3CCM P;  2IBZ E;  3PTZ A;  4N78 D;  4WBA A;  1GK6 A;  1N73 C;  3H1K D;  1S3J A;  5KLV G;  1M1J B;  4LC1 A;  2FXO A;  3M9H A;  1KIL C;  3AE6 C;  4HKZ H;  2M8R A;  1PM6 A;  2JJL A;  3CWB D;  3KZI H;  1AV1 A;  1LTI C;  2MJZ A;  3B4S A;  4L75 A;  1R8E A;  1E79 H;  2WSF J;  2N1T A;  4H13 D;  2CPB A;  5KCB A;  3L36 A;  1NVO A;  1KD1 Q;  3NFQ A;  4PJ0 E;  3PH0 A;  2C0X A;  1T2K C;  1S5L H;  1BDC A;  2UWJ E;  1Y9B A;  2JO1 A;  3CCJ P;  1HH0 A;  4H13 B;  4A1M A;  1NH4 A;  4I1L A;  2H88 C;  2C0W A;  1VQM P;  2FYU E;  1SQQ E;  5KJ7 C;  5TIS H;  1BCC E;  2IFN A;  3U1C A;  1BOW A;  2M0B A;  3W67 A;  1HJB A;  2FY8 A;  1M1K Q;  1HGZ A;  1FZC B;  5AVZ B;  3O6Q B;  1S9K D;  1LNQ A;  1LTT C;  2P58 A;  2IBZ G;  1NAY A;  1PGP A;  4GOD A;  2BCC J;  2IZ1 A;  4YTP C;  1KQG B;  2CK3 H;  1LTJ A;  1WRG A;  2XU6 A;  3AEG C;  5CCH D;  3CCV P;  2FFD B;  1EQ7 A;  1JUN A;  2IYP A;  2L91 A;  4UB6 E;  3TSI A;  3TGU D;  1KQL A;  1NTM D;  1BE3 D;  1X8Y A;  4QMA A;  3A7O A;  4DT0 A;  3VYI A;  2HR3 A;  4ASV A;  2WTY A;  3BCC J;  4PV1 C;  5KAF E;  4AYC A;  2WPV B;  4WY4 C;  1H0T A;  3G9R A;  3USS A;  1DX7 A;  1KIL A;  5APS A;  3TGU J;  2KCU A;  1YJ9 P;  1Q2N A;  5DJU B;  3HUS B;  4NPF X;  2N9Y B;  1YTZ I;  1WT6 A;  2FYU G;  4YXW H;  1BCC G;  3M9Q A;  5KKZ B;  2IZ0 A;  3B49 A;  1OWA A;  4I6M C;  4D6T E;  5CBN A;  2C9N Y;  3L74 E;  3H1L D;  3GF7 A;  1NU1 D;  2KP8 A;  1MKM A;  1OVU A;  3H32 A;  1P84 E;  3QWO C;  1KB9 I;  4I7Z C;  3PLN A;  2QJY C;  1AQT A;  3P7K A;  1EDI A;  1KYO I;  1LP1 B;  3F89 A;  3AE4 C;  2Y0E A;  2ZJS E;  1NTK D;  3RGU A;  1N73 B;  2O01 J;  1FZA A;  2POH A;  2Z4E A;  2W8Z A;  2V7Q H;  3GF3 A;  1SQB J;  1N7S C;  1OW7 A;  1G1I A;  2A06 E;  2KZJ A;  1SQV J;  3L75 D;  4D6T G;  3WUT A;  1BGY J;  2W6A A;  1OZH A;  3CD6 P;  3CX5 H;  1KFN A;  2RKL A;  3FXD A;  1K73 Q;  1FJP A;  3L74 G;  4OVN F;  1SQX J;  1PFI A;  2GOV A;  2QG4 A;  2V7Q J;  2RMZ A;  5H2F E;  3HE4 A;  1N86 A;  5KJ7 D;  1Q90 D;  1YHQ P;  4YPC A;  3VMX A;  2OTK E;  2R5D A;  1K9M Q;  1JMB A;  1NKN A;  5GQQ A;  4YXD C;  1GL2 A;  2OQQ A;  3VMA A;  1KQF B;  1KC8 Q;  1AVO A;  1KMI Z;  1WMK A;  1S5L E;  1YIT P;  3IFM A;  3SWF A;  1KN7 A;  1HVV A;  2QSI A;  3P32 A;  4R4E A;  1AJY A;  5BU8 B;  3EFG A;  1SQB K;  2OGU A;  5TIS E;  2IDB A;  1A02 J;  3KDP B;  3HD7 D;  1SQV K;  2R44 A;  5KTB A;  2HPC B;  2A06 G;  1T6A A;  1KB9 H;  5AVU B;  1G2C A;  1KFM A;  4U3F D;  3S9O A;  1S4X A;  1SQX K;  3HD7 B;  1EXI A;  1E5W A;  2HVA A;  2WIT A;  1KYO H;  5DJT B;  4ZKU A;  3OW2 O;  4WLS A;  2KS1 A;  4PV1 B;  2W6J H;  2OYH C;  3AE7 C;  5APX A;  4L74 A;  3BCC E;  3HRN A;  4WY4 B;  4EIJ A;  3T97 B;  1ZR2 A;  1JOC A;  1RF1 B;  3CXH E;  3WU2 H;  1IFP A;  3M9B A;  1XTC C;  2ZHG A;  2WPQ A;  5B5E H;  3EZ6 A;  1JY2 O;  3C8V A;  1NJI Q;  2QJP C;  4M3L A;  1VQ9 P;  3OA7 A;  5BU5 A;  5GTH H;  1MV8 A;  2A45 G;  1IFM A;  2KI7 B;  3A0B E;  1XTG B;  4C7N A;  1FDI A;  4LGD E;  1NOH A;  2OAR A;  1EZV D;  2R3S A;  1BCC D;  5AVT B;  3E1I A;  3H1I J;  1URQ C;  3MP7 B;  3RBZ A;  1RHZ B;  3L70 E;  5EFW B;  2YIU C;  5APQ A;  1BSH A;  2IYO A;  3TYY A;  4UB6 H;  4Y99 B;  2PAJ A;  3I5C A;  3BAT A;  4BRY A;  1RQU A;  1JMM A;  2E74 D;  4GKG A;  1ZRT D;  3GW6 A;  4I7Z B;  4GIF A;  4KJM A;  2QJY B;  4GT1 A;  3IF4 A;  3AEF C;  2E5T A;  2I1J A;  1JTH B;  2YMK A;  4IOI H;  2G8Y A;  3SWY A;  3L73 J;  1PGO A;  3BCC G;  3S4R A;  1W5C E;  3L72 E;  2KVV A;  2ZYD A;  1LWU A;  3SFD C;  5CCH C;  1YQ4 C;  2ZVN B;  1N7S B;  3E1R A;  1IC2 A;  4TT3 H;  1AA0 A;  2LXC B;  2ZT9 D;  3CC2 P;  1CI6 A;  1KIL E;  1SQB E;  3E0H A;  1U57 A;  4PD4 D;  1JY3 P;  4JYC A;  3D6Z A;  1RH5 B;  1M1J A;  3PP5 A;  1SQV E;  3L4F A;  4KT0 J;  3TDK A;  2ZT9 B;  2W27 A;  3B5N D;  1EDL A;  1BGY E;  2Y9Z A;  2N9B A;  3HUS C;  3MUD C;  1R8D A;  5AW3 B;  1SQX E;  1QLE D;  1NO4 A;  3L70 G;  3M91 A;  4U7J A;  3AEA C;  2B87 B;  1VQ5 P;  1ZXG A;  3KYQ A;  3R8J A;  2XKM A;  2ZXE B;  1GTW A;  1MUU A;  1Y8A A;  5BVZ A;  1M57 D;  3H25 A;  4DCZ A;  1BSN A;  3I56 P;  4HJG H;  1VQL P;  2YKO A;  1GU5 A;  4KHX A;  2K9J B;  2LR2 A;  2IFM A;  2E43 A;  1S5L X;  1NHL A;  1ZOY C;  2JML A;  1PP9 D;  2QVA A;  2RN0 A;  2YNY A;  2B9B A;  2R5B A;  3WMM 0;  2J59 M;  3FX0 A;  3L72 G;  3FWL A;  4HH2 A;  1FZC A;  1SQP J;  3H1H E;  3CL3 D;  1MZ9 A;  2ZFC A;  4H0L D;  3ABV C;  1SQB G;  4NPE A;  1PP9 J;  2WSF H;  3HH0 A;  1L0L K;  5H2F H;  1SQV G;  2BAS A;  2AEF A;  2P2U A;  4H0L B;  1BGY G;  3H1K J;  3RK3 E;  2ITA A;  1JB0 J;  1VQP P;  2OYH B;  5KAI H;  2FFD A;  3JC2 2;  1EXJ A;  2QM8 A;  2PFX A;  3M06 A;  1H89 A;  1NTZ D;  1W2E A;  1CW5 A;  1JO5 A;  4R24 B;  1L0N G;  3NMD A;  4EOT A;  2MKV A;  3AE3 C;  3U59 A;  1RE3 C;  2A45 H;  3EZ7 A;  3MTU E;  2QRX A;  2M5A A;  3CWB J;  5CCH A;  4R4M A;  3L71 D;  1KB9 E;  3Q2Y A;  2QJP B;  1RQV A;  1MFZ A;  1OW6 A;  2YO3 A;  1URQ D;  3CME P;  1PGQ A;  1KYO E;  3LIE A;  4R4L A;  4JQ0 D;  1X79 B;  1VQK P;  1LT9 C;  4RKU J;  2GUV A;  3L71 J;  1URQ B;  1NWQ A; 
#chains in the Genus database with same CATH homology
 1Q0A A;  5L8R J;  4OGQ B;  4I7Z C;  3Q3D A;  1Q06 A;  3GP4 A;  3D6Y A;  1KQG B;  2BEZ F;  2D2C D;  3EWK A;  3GMA A;  4GDO A;  3R8K A;  4PV1 D;  1RH6 A;  2QJY C;  1PIX A;  1DIP A;  1RQU A;  1YQ3 C;  1K05 A;  1LX8 A;  3Q5S A;  2QSI A;  2E74 D;  2D2C C;  4R4E A;  3GLM A;  1AJY A;  4I7Z B;  3AE4 C;  3AEG C;  1S5L X;  1HF9 A;  3AEE C;  1NYH A;  1GMJ A;  1ZOY C;  1JBG A;  2J5U A;  5M1B A;  3AEC C;  1DD3 A;  2P10 A;  2D2C B;  2JML A;  3Q1M A;  4OGQ C;  2IDB A;  4Z1M H;  5D8C A;  3AEF C;  2O01 J;  3AE6 C;  1K04 A;  3AE2 C;  5KAU A;  4AYZ B;  2WSE J;  3EZ2 A;  1ZP0 C;  1PM6 A;  2YMK A;  2WQY C;  2ZHH A;  2WSC J;  4LHF A;  3GF3 A;  4IL6 X;  3S9O A;  1PV3 A;  4R22 B;  1R8E A;  2G8Y A;  4H0L D;  3ABV C;  4PV1 C;  2DG6 A;  3RL0 g;  1EXI A;  4H44 D;  1S1C X;  3HH0 A;  3AE1 C;  1OW7 A;  2E74 C;  2WSF J;  5KAT A;  2BOW A;  2HVA A;  3AEB C;  1Q09 A;  4H13 D;  2KVV A;  2WPV B;  2E75 D;  5KCB A;  3SFD C;  4WLS A;  1UIX A;  3FGA D;  1KTM A;  3D71 A;  3G9R A;  4PV1 B;  1YQ4 C;  4H13 C;  2KCU A;  1TU3 F;  2OG0 A;  1VF5 D;  2BEQ D;  2E75 C;  2E74 B;  4TT3 H;  5KKZ C;  4H0L B;  2ZT9 D;  3AE8 C;  4Y28 J;  1KIL E;  3AE7 C;  5KAX A;  3E0H A;  1Q05 A;  1Y6U A;  1FDO A;  1U57 A;  1VF5 C;  3T97 B;  2IEF A;  5KAW A;  3D6Z A;  1Y9B A;  2E76 D;  2JO1 A;  2GOV A;  5KLI C;  4J2N A;  3O6Q A;  1Q08 A;  3Q5P A;  2V7Q J;  3IN6 A;  3R4Y A;  2E75 B;  4H13 B;  3RK3 E;  3SFE C;  1JYH A;  1JB0 J;  3AE5 C;  3B71 A;  1Q07 A;  3B49 A;  1EXJ A;  3EZF A;  3EZ9 A;  1IK7 A;  2E76 C;  4A1M A;  1OW8 A;  2ZHG A;  3GPV A;  3Q5R A;  1VF5 B;  3GK6 A;  3EZ6 A;  4KT0 J;  5I41 B;  3AED C;  4XFJ A;  2ZT9 B;  3C8V A;  1VL2 A;  4R24 B;  1Q90 D;  2QJP C;  4WLW A;  2H88 C;  2MKV A;  3AE3 C;  4H0L C;  4AYZ A;  4H44 C;  3LW5 J;  1ZME C;  2E76 B;  1R8D A;  3EZ7 A;  1OMI A;  1ZRT E;  4R4M A;  1BOW A;  1KOR A;  1D5Y A;  3Q2Y A;  1HJ0 A;  1PL5 A;  1RQV A;  2JP3 A;  2NZ2 A;  3AE9 C;  4YXD C;  5GQQ A;  1OW6 A;  2FXP A;  3GF7 A;  4H44 B;  4U7J A;  2FBW C;  2QIW A;  1FDI A;  3AEA C;  1NGM B;  2OQQ A;  1MKM A;  2VZ4 A;  2ZT9 C;  3IAO A;  3QAO A;  3LUR A;  2QJK C;  4OGQ D;  1KQF B;  3R8J A;  4R4L A;  3UCS A;  5E01 A;  5KAV A;  4B0Y A;  2G3A A;  2K9Y A;  5I44 A;  3D70 A;  3H25 A;  4RKU J;  1KMI Z;  4DCZ A;  2YIU C;  1WMK A;  2H89 C;  4YTP C;  2FYN C;  5D90 A;  1DD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...