3Q5PA

Crystal structure of bmrr bound to tetracycline
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna/antibiotic
molecule keywords Multidrug-efflux transporter 1 regulator
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q5pA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q5pA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q5pA03
1EXIA 3IAOA 3D6YA 3E0HA 5KAUA 3GP4A 2OQQA 5I41B 1Q07A 3Q3DA 1BOWA 2KCUA 4AYZB 5I44A 3G9RA 2HVAA 5KATA 4AYZA 2JMLA 2GOVA 3QAOA 1R8EA 3GK6A 5KCBA 3Q1MA 1Q09A 4R22B 4R4LA 3B49A 4R4EA 3HH0A 3R8JA 3D6ZA 1D5YA 4J2NA 5E01A 3GPVA 3Q5SA 2BOWA 3D70A 1JYHA 4A1MA 3Q2YA 1DIPA 5D90A 3R8KA 1Q06A 1Q08A 3UCSA 2ZHHA 1Q0AA 2VZ4A 4WLSA 1R8DA 2J5UA 4R24B 3D71A 2ZHGA 4B0YA 4WLWA 5GQQA 5KAWA 5KAXA 1JBGA 1EXJA 5D8CA 3Q5PA 4R4MA 3LURA 5KAVA 3T97B 1Q05A 3Q5RA 2DG6A
chains in the Genus database with same CATH superfamily
2O3JA 3IAOA 1NTZJ 2AXCA 3KYQA 2AEMA 2Q9IA 1BSHA 3TSIA 1IC2A 1G1JA 2QJPB 1OVRA 1ZLLA 1S5LH 2OG0A 3MUDC 1G1IA 1SQVD 1LT9C 3L74J 3U59A 3H1JE 3P32A 4DOJA 1M1KQ 2PFXA 4R4MA 2IDBA 4C46A 4H13C 4JYCA 2HVAA 1MUUA 2OGUA 3VMZA 1RQUA 3CX5D 1PIXA 1S5LE 3SWYA 2M0BA 1HTLC 3GHGB 2HG5D 4H44C 4AQRD 3AE1C 1Q90D 2N1TC 3A0BH 1LWUA 1SQVJ 1NTKG 3H1LJ 2A06D 4UB8H 1SQBG 1L0NE 3H1IJ 5B66H 1PPJG 1FZCB 3SWFA 3MZWB 1ZMEC 3GW6A 1LTGC 2YMKA 3EZ2A 2GM4A 3AEGC 5BU5A 2ITAA 3BRTB 1NU1D 1NU1G 1KYOH 2RN0A 4D6TE 1N86A 5E01A 2E75D 1N73B 3FGAD 1U7MA 3IN6A 3IF4A 4Y28J 3M9HA 2Y9ZA 2ZYGA 4KJMA 3MP7B 1IZNB 1KILE 3H1KG 1SQVE 3WMM0 1P84I 4UB6E 4XA4A 3U1CA 1PFIA 4A7PA 3KZIE 4D6TD 3L72J 1GL2A 3ZDMA 2L91A 3AEAC 4PD4H 1H88A 2WTYA 1NTMG 3FWLA 3WUTA 2IBZI 1RHZB 5AVTB 1T3UA 4YTPC 2R44A 4WY4A 3HD7A 2I8DA 1AVOA 1KQSO 4AUWA 3AE3C 2WPSA 1ZR2A 1URQA 2FBWC 1W5CE 3GHGA 3I5CA 3BCCG 2R5DA 2Q1KA 3H32A 1JTHB 1HGVA 2WSSH 2NPSB 3S9OA 1EZVD 1L0LJ 2QIWA 2QA4P 1MZ9A 1S5LX 1PP9E 1EDKA 1OIPA 1CI6A 3CC2P 2JR8A 2QRXA 4I1LA 3RBZA 1KYOI 2JKVA 2P1JA 1NTMJ 1JCCA 4EYYQ 1YHQP 1J1EC 3E0HA 3CCMP 3CLQA 2QE7H 3L75G 3H1HD 3H1HG 1FC2C 1VF5C 3TGUE 2FKWB 4EOTA 5AW1B 1SQBK 4L74A 1SQBE 1G2CA 4YXDC 1KB9H 1A02J 4DCZA 1L4AB 1GDTA 3AE7C 5KLVG 2FYNC 2Y0DA 1LTJC 1VQKP 2YNYA 1GK4A 1NU1E 2C9NY 1X8YA 2D2CD 1WT6A 1YJNP 1Q81Q 3CCRP 1M1JB 1L4AA 1SQPJ 4D6TG 1SQPK 3GK6A 3AEDC 3AE2C 3HH0A 2W90A 4M3LA 3VP8A 1U57A 4WY4B 1MFZA 1RY3A 1LWUC 2MJZA 4IL6H 1SQVG 2PAJA 3W68A 5APXA 1S2EA 2Y9YA 1L0LG 2QEXP 2H7HA 1ZW0A 2ZXXA 4W80A 4BRYB 5CJ0A 3H32B 5CHXA 2Q5UA 1FZEA 2R3SA 1VL2A 1KQFB 2WSCH 1R5LA 1LT9A 3EQ2A 1K73Q 2MKVA 3MUDA 3Q1MA 1URQD 3NTNA 5AW7B 3A7OA 1KZUB 4QMAA 4Y99C 3LW5J 2A45H 1LTIC 2OYHB 1OW6A 3P8CD 1NTKD 4BWNA 3PP5A 1BE3J 3CCSP 1KMIZ 1FS0E 4OH8B 2WT7A 5E79E 2QVAA 1SQBD 2J58A 3H1IE 1JNMA 1PM6A 1P84E 3CCEP 2NPSD 1SQXK 5M1BA 4RJTA 2E74B 4N6JA 1EXJA 4W7ZA 2WZ7A 4AYZB 2KZJA 1DX7A 2XZRA 3CWBG 3GPVA 3L72D 5D90A 1Q06A 2ZHGA 3LURA 5KAFH 2B88A 1Q05A 1JY3O 2KOGA 1BSNA 4PV1C 1X79B 5APYA 3WU2E 1JUNA 3TYYA 2JWAA 2WVRA 3RK2D 1OVUA 2D2CB 4PD4I 2E42A 4JQ0D 3CC4P 2WWWA 1NGMB 3PHLA 1GU4A 1VQMP 3H6PA 3N7NA 1P84H 1L4AD 3BVHA 1SLQA 3M91A 1NKNA 1IK9A 1OVVA 1SFCD 2D2CC 2K9JA 1USEA 1SQQG 2OYOA 5CCHD 2ZXEB 3U1AA 1IFDA 1Z56A 1PGQA 4L73A 2UWJE 1R8DA 3L73G 2ZYAA 4LGDE 3JC22 1CSBA 3N4XA 3SWKA 3P8CE 2XV5A 1ZRTE 3C1LA 3OW2O 1OFCX 1KORA 1Q09A 1AQTA 1FOSF 1D5YA 5AVYB 3AE9C 2IYOA 1Q0AA 1RE3A 4XE5B 1QLED 1IO4A 2B89A 1G2CB 3A0BE 4NPEA 3F89A 1USDA 2M5AA 2OQQA 2BEZF 2PRRA 3C8VA 1L0LE 1RF1A 2O1KA 5TISH 3HD7B 4H0LB 3V2NA 1OW8A 1YITP 2OYIB 2HYNA 1UIIA 1CI6B 5KAWA 1URQB 3MGNA 3CCLP 1M1JA 2QG4A 1NAYA 1QX8A 3EWKA 3M06A 5KCBA 3L75D 2G8YA 4IFMA 3L70D 5TISE 1YQ3C 3HTKB 4DJGA 1K9MQ 2K37A 3HUSA 3D6YA 2KNCB 2K88A 2Z5IA 1RE4A 1M8OB 3CX5H 1FOSE 3AE6C 4W7YA 2K9YA 1GMJA 3WUUA 4WLWA 5KJ7C 3G4SP 3B4SA 2LR2A 3O6QA 1T2KC 4Z1MH 1PGPA 1PP9J 2G3AA 5I44A 3G71P 3MD0A 3T97A 3B49A 1T8ZA 1E79H 5AVWB 3KHUA 1VQ6P 1SQXD 2RH0A 1AV1A 1M1JC 1KB9D 2WSCJ 3GMAA 3LIDA 2A45G 1H0TA 4U3FE 1H89A 1BCCG 2A45I 1LTJB 1OXZA 4WVZA 3I55P 4YXWH 3HE5A 4TT3H 2B9BA 2OARA 2ZFCA 1OZHA 2NZ2A 1BCCD 3H1HJ 2KI7B 5TJHA 2OYIC 2H43A 2AXTH 3MIWA 1Q07A 1KILA 1GW3A 1LGHB 3TK1A 1NO4A 5BVZA 1S9KE 1NOHA 3CXHD 4GOEA 2POHA 4UB8E 1KILC 3VMAA 5KJ7D 1FZFA 4ZKUA 3P8MC 2M8RA 1NH4A 1BGYE 4WBAA 1HWTC 2K3RA 2YXQB 4LHFA 5GTHH 3HUSC 3CCVP 4R24B 3EZ7A 1LTAC 1L2PA 3L71J 1QGKB 3VTPC 4U3FD 3GP4A 1K04A 3H1LG 4C7RA 3BCCD 1KQLA 4PV1D 3S4RA 2ZVNB 1VQ5P 1BDCA 2AEFA 5AW5B 5KAUA 2FYUJ 1NTMK 1AQ5A 1WRGA 3EFGA 2XNXA 1Y8AA 2O01H 1JMMA 3B5NA 2BASA 4D6TJ 1YTZT 2E43A 3RK3E 4XFJA 2JEEA 5APWA 2Q7CA 1PGJA 2AXTE 1R5SA 5I41B 1CW5A 5CMZA 1HF9A 1L0ND 1L0NG 1X22A 1PPJE 5AVVB 3RGUA 1T6AA 2IEFA 2FYUD 3V5BA 1KTMA 1JB0J 2E5TA 3L72E 4PV1B 1GD2E 2WSEH 2YO3A 1N7SA 5CCHA 3L74D 1FU1A 1VQNP 2OYHC 3KQGA 3E7KA 3HUSB 1BCCE 2FY8A 3A2AA 2LXBA 5AW6B 3SSUA 5GTHE 4ASVA 2KUBA 1GW4A 2HPCB 2B87B 1GZLA 4A1MA 1FZCC 2BCCG 1DIPA 3CX5E 2WT7B 1FAVA 4HYTB 3K5BA 2FYUK 2WQYC 2L5GB 2KSJA 2B87A 1VQ8P 2WSFJ 1KILB 1NTZE 3KDPB 2OYIA 1IJDB 1KFNA 4R4LA 1M57D 1PL5A 2KB7P 4DZOA 1NTME 5K5GB 2KZIA 2FYZA 5C39A 3L70G 2N1TA 3BCCJ 3GF7A 1LWUB 4WLSA 4ZKPA 2Z4EA 4H13B 1BGYG 2IFNA 3B8EB 2KSEA 4BRYA 3KZIH 2KS1A 1L0NJ 1BOWA 4AYZA 1QVFO 1PV3A 5APTA 5APVA 1SVFA 2GOVA 2NRGA 3BCCE 4J2NA 1JTHA 3RL0D 3Q2YA 2WPQA 5BU8B 3G3ZA 3FX0A 3TNUB 2E74D 5KTBA 3AE8C 1CZQA 1JEKA 4IL6X 2C9LY 2FYNB 5KLIB 3QAOA 3RBXA 3MHVA 1T2KD 1M56D 1ZP0C 2ZAEB 4KT0J 3GF3A 1W2BO 1FBMA 2GA1A 3M0AA 2Q6QA 2WMMA 3PH0A 3Q5RA 1FZAA 3BRVB 2PGDA 2JDIH 4WY4C 1BCCJ 1Y6UA 5B66E 4N78E 4U3FJ 3H1KD 1HUCA 3IR9A 2FXMA 2KK7A 2YKQA 4B0YA 2HODA 3F5HA 1H8AA 1ZR4A 1AVYA 3R4YA 4WWIA 2Y0CA 5E79H 5AW4B 3S1KA 4KHXA 1L4AC 2V7QJ 1LX8A 1RQVA 2YO2A 4B86A 1URQC 2ZJSE 1EDJA 4PD4D 4H0LC 5KAFE 2C0WA 4DT0A 3HD7C 2BCCD 4NPFX 2A06E 1VF5B 3O6QB 2BEQD 2KNCA 1RE3C 2R3CA 1SQXE 2NPSA 2HR3A 2IPPA 1QEXA 3V4QA 1W2EA 2J5UA 1YQ4C 1EZVG 3L73D 3PTZA 1MV8A 1EZVI 2W6AA 1FE6A 2DW3A 1Y9BA 1SQVK 1TU3F 3V2PA 2BCCE 2P67A 3D6ZA 3SFDC 5GTIE 4H0LD 3HD7D 5KLVK 3I56P 5L8RJ 4HB1A 2FFDA 1SFCA 1S3JA 4EIJA 2NPSC 1SQQD 3H1JJ 5KJ7A 3CMEP 3QH9A 3UCSA 1JBGA 3A5TA 3HE5B 2IZ0A 3GLMA 1JY3P 3VMXA 1EDIA 2PP6A 2ZT9B 2ZYDA 5AVUB 3AEFC 5APQA 5KKZB 2J59M 2LKMA 1P84D 2N9BA 2KLUA 1DH3A 5APSA 2WPVB 1J1DB 1RE4C 1ZXGA 4RO0A 4JYBA 1FZBA 2HLOA 5AW0B 3V6IA 3LW5H 3H1JG 1FJKA 2CPBA 2JWDA 3R8KA 3W67A 1NAFA 3AECC 2M3EA 4C7NA 2E74C 1M7LA 5KAXA 4H44B 1HJ0A 2P2UA 3QWOC 1RH5B 2XKMA 2H88C 2BOWA 1QL1A 2JP3A 1NTKE 2C0XA 3CWBJ 2V4HA 4Y99B 1EXIA 1T3JA 1JMBA 1LT9B 3JCUH 1FZCA 1NTKK 3G9RA 1BE3D 3M9QA 3L71D 4R4EA 3CCUP 3O8ZA 3PRJA 1KB9I 1YJWP 3G6EP 3PLNA 3VYIA 3B5ND 5EFWB 4HJGH 5AVRB 5AVZB 3HE4A 4GKGA 2YKOA 1U7JA 3L73E 1VQPP 1JCDA 1JY2P 1GTWA 1R8EA 2WITA 4JBZA 1K05A 1YBKA 1ZRTD 2P58A 3NMDA 1VPCA 1KC8Q 1EZVE 2IX7C 4C7NB 1KYOD 1S1CX 3CXHI 1DD3A 2V7QH 5CBOA 4EI2A 4GOFA 1JO5A 4HKZH 3V2RA 1HH0A 4ASWA 3TGUJ 4HH2A 3ITKA 2YIUB 1VQ4P 1IFNA 3KPEA 4H44D 3USSA 2RMZA 1BE3E 2W8ZA 4PJ0H 1GU5A 4YPCA 5KLVD 2WSEJ 5CBNA 4OGQB 4CPGA 3CX5I 1FDOA 1YJ9P 3RK3D 2VRSA 4I2LC 4RKUJ 4IL6E 5AVQB 3Q3DA 3L71E 4RESB 1K8AQ 1PP9D 1SQPG 4OWFA 4LC1A 4K3AA 2K9JB 1FDIA 1HGZA 1J1EB 3VMYA 1LNQA 2IZ1A 3CL3D 1MKMA 1PP9G 1OWAA 1SQPD 1RF1C 4GODA 5H2FE 3CXHH 4I6MC 2K1AA 1KQGB 2FFDB 1VQ7P 2KXPB 2FXOA 3VOPA 3UIAA 1FZGA 1LP1B 3A3YB 1DEEG 3L75J 1KB9E 5GTIH 1KYOE 3HTKA 3L75E 1IFPA 3H1HE 1H0TB 3L73J 1L0LD 2GUSA 2E76D 2KLVA 5H2FH 3TGUG 3TGUD 3A0HH 3RL0C 3FXEA 5B5EE 2XNDH 2OYHA 1IFJA 2Q3IA 5KLVE 1LTTC 3RL0B 1GL2B 1VQOP 1XTGB 4R22B 1NTMD 1AA0A 1VQ9P 1Q82Q 1OX3A 1NVOA 2QM7A 1HJBA 3H25A 3CC7P 4PD4E 5KLVJ 1JY2O 3M9BA 2OTKE 1AJYA 2E76C 3TF5A 4IFDK 4GIFA 1N7LA 2JMLA 1KD1Q 1E5WA 2P7JA 1EDLA 1SP4A 5APUA 3AEEC 3CXHE 3GG2A 3M0DA 4OGQD 5AVXB 2YKPA 4WB4A 5CCHC 3L35A 2W27A 1N73C 3JSVC 3H1LE 1UIXA 2O1JA 2SPZA 1NKZB 3L4FA 1IFIA 2JJLA 4I7ZC 1IK7A 3WU2H 3CMAP 2QM8A 1M90Q 4LLHA 1LTBC 3CI9A 1BE3G 2KP8A 2ZT9D 4IOIH 2Q3EA 1FDMA 2QJKC 1EQ7A 1LTSC 4OGQC 2HODB 1N7SB 3RK2C 1D7MA 2FXPA 3RK3C 1FJPA 1NTZK 1WMKA 1YI2P 3L71G 2OTLP 3BATA 1SQPE 3H1IG 2N1TB 2Y0EA 1NWQA 3B5NC 3OAKA 1Q2NA 3GHGC 4TLFA 1KFMA 1HBWA 2QJYB 1Q7YQ 4JPZB 1VDFA 2W6BA 1Y47A 3BASA 2JO1A 3CWBE 1SQBJ 1EC5A 2QJPC 5CCGD 3II6A 1RF0C 4H13D 1QL2A 1NTKJ 4O9BA 3B5NB 3E1IA 1SQQK 1JOCA 5AVSB 3H1JD 2ZHHA 2KYVA 3L72G 5DJTB 5B5EH 3RK3B 5CCGC 2WPRA 1VQLP 3H1LD 1SFCC 1KILD 3A0HE 3RK2B 1RH6A 3CWBD 1AFOA 1KV4A 4DCKA 5CJ4A 3JCUE 3EZFA 4WY4D 2IFMA 3P7KA 2VZ4A 1LTJA 1JY3N 5AW9B 5GQQA 5KAIH 3Q5PA 5DJUB 1L0LK 2GUVA 1YIJP 4I7ZB 4N3YB 3TDKA 1NTZG 1RF0A 1SQQE 1ZN5A 5AW2B 2QJYC 1NJIQ 1NU1J 1NHLA 3L70E 2HPCA 2BCCJ 3EZ6A 1QVGO 3NFQA 1NTZD 1LJ2A 4L75A 1SQQJ 4L76A 2I1KA 3H1ID 2FYUG 1JM0A 3AEBC 2O01J 3V2QA 1N7SC 1SS1A 1PPJD 2E76B 5KAIE 2YXRB 3L74E 3V4WA 2QJKB 2E75B 1XTCC 4GT1A 4U7JA 5CCGA 2IBZE 5D8CA 1J1DC 1OW7A 1N2DC 2DG6A 5AW8B 4ZNCA 2R5BA 2IYPA 3OA7A 2CPSA 3R8JA 3VP9A 5KKZC 1GK6A 1LP1A 2RKLA 4NPDA 2ZT9C 1YYCA 2OTJP 2M3BA 1S72P 2CK3H 1PZQA 2N1TD 4PJ0E 1HVVA 2KS1B 3KXDA 4AYCA 2XU6A 2IBZD 3EFFK 2KCUA 1KN7A 5KATA 2AEJA 3RL0g 3CCQP 1OMIA 4ZMDA 1IFMA 3E1RA 5AW3B 1A02F 2R32A 2M5AB 1BGYD 3NXSA 3TNUA 3L36A 1NU1K 2P10A 4N78D 4BXLA 2FFDC 2I1JA 3D70A 1GL2C 1ZV8A 3HRNA 3MTUE 1Q08A 3H1KJ 1PGOA 2XDJA 3D71A 3CCJP 3CD6P 3L37A 3IFMA 2N9YB 2Z5HA 2A06G 3Q5SA 2H89C 3VN0A 1N73A 3WUVA 3ABVC 1SQXG 1MFTA 1J2JB 4U3FG 2E75C 1S4XA 3M0DC 3LIEA 1JY2N 4MN4C 1X9VA 2WSFH 3R2PA 1Q86Q 2W83C 1GL2D 4GDOA 3H1KE 2QSIA 1S9KD 4UB6H 1X0TA 3AE5C 1SQXJ 2YIUC 1N8RQ 2ZVOB 3FWNA 1RF1B 4IFFA 3OJAB 3CPWO 1LT1A 1YTZI 1DD4A 2LXCB 2H8PD 1NYHA 3HE4B 3FXDA 3C9IA 1BDDA 2HFED 5KAVA 2KVVA 1ZOYC 2YMYA 2FYUE 2KIKA 1L0NK 1DEBA 3B71A 3SFEC 1VF5D 2E5YA 4EDFA 1BGYJ 2W6JH 1N7SD 3L74G 3EZ9A 1SFCB 1JYHA 3PJSK 2O01N 3L70J 2IBZG 4JF7A 4OVNF 5KLIC 3AE4C 4K35A 3T97B
chains in the Genus database with same CATH topology
3IAOA 3D6YA 1KQFB 3E0HA 4H44B 1HJ0A 4H44D 2MKVA 1KILE 3QAOA 1Y9BA 3Q1MA 1KTMA 1TU3F 2D2CC 4R22B 3AEBC 2O01J 1ZP0C 2H88C 4KT0J 3D6ZA 1JB0J 2OG0A 2WSEJ 3Q5SA 1VF5C 3AE6C 2BOWA 2E76B 4LHFA 4OGQB 3SFDC 2JP3A 3GF3A 4H0LD 2H89C 4PV1B 3LW5J 3ABVC 1FDOA 2E75B 2K9YA 1R8DA 4R24B 3EZ7A 1OW6A 4U7JA 1GMJA 4WLWA 5L8RJ 3AEAC 3O6QA 5D8CA 4R4MA 1OW7A 2IDBA 2E75C 3H25A 1KMIZ 4IL6X 4YXDC 3Q5RA 2DG6A 4RKUJ 1EXIA 4H13C 4Z1MH 3GP4A 3Q3DA 1AJYA 1K04A 2JO1A 1ZRTE 2E76C 2G3AA 5I44A 1Y6UA 3G9RA 2HVAA 1KORA 2JMLA 4DCZA 1PM6A 1Q09A 2QJPC 5KKZC 4GDOA 4R4EA 3AE7C 4H13D 3B49A 3R8JA 1RQUA 4YTPC 1PIXA 2QSIA 1FDIA 3AEEC 1D5YA 2FYNC 4A1MA 2ZT9C 3AE5C 4H44C 3AE1C 1DIPA 1Q90D 3AE9C 4PV1D 3UCSA 2ZHHA 1Q0AA 2YIUC 1MKMA 4OGQD 5M1BA 2D2CD 2E74B 2WQYC 2WSCJ 4B0YA 3GMAA 3AE3C 1JBGA 1EXJA 2WSFJ 3GLMA 5KAUA 2FBWC 2OQQA 2KCUA 4AYZB 1DD4A 2BEZF 5KATA 3GK6A 3C8VA 1RH6A 1R8EA 3AEDC 2ZT9B 3R4YA 1KQGB 1NYHA 3AE2C 4R4LA 1K05A 1UIXA 3HH0A 1PL5A 3AEFC 1ZMEC 3GPVA 3RL0g 3EZFA 2YMKA 4H0LB 2V7QJ 1IK7A 3EZ2A 4I7ZC 1OMIA 3AEGC 5D90A 1LX8A 1OW8A 3GF7A 1Q06A 4TT3H 1RQVA 1U57A 2VZ4A 4WLSA 3RK3E 4H13B 4XFJA 3S9OA 2ZHGA 5GQQA 5KAWA 2WPVB 2NZ2A 5KAVA 3Q5PA 1S1CX 2QIWA 2KVVA 1ZOYC 3LURA 1Q05A 1S5LX 1DD3A 2ZT9D 4I7ZB 4H0LC 5I41B 1Q07A 1BOWA 2QJKC 4AYZA 1PV3A 2P10A 1HF9A 3B71A 4PV1C 2GOVA 5KCBA 3EWKA 4OGQC 2E76D 3SFEC 1VF5D 1VF5B 2QJYC 2BEQD 4J2NA 5E01A 2E75D 3EZ9A 2D2CB 3D70A 1JYHA 2G8YA 3FGAD 3Q2YA 3R8KA 2FXPA 5KLIC 1Q08A 3IN6A 1NGMB 1YQ3C 3AECC 2J5UA 1WMKA 1YQ4C 3AE4C 2E74C 3D71A 4Y28J 2E74D 2IEFA 3AE8C 5KAXA 3EZ6A 3T97B 1VL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EXI A;  3IAO A;  3D6Y A;  3E0H A;  5KAU A;  3GP4 A;  2OQQ A;  5I41 B;  1Q07 A;  3Q3D A;  1BOW A;  2KCU A;  4AYZ B;  5I44 A;  3G9R A;  2HVA A;  5KAT A;  4AYZ A;  2JML A;  2GOV A;  3QAO A;  1R8E A;  3GK6 A;  5KCB A;  3Q1M A;  1Q09 A;  4R22 B;  4R4L A;  3B49 A;  4R4E A;  3HH0 A;  3R8J A;  3D6Z A;  1D5Y A;  4J2N A;  5E01 A;  3GPV A;  3Q5S A;  2BOW A;  3D70 A;  1JYH A;  4A1M A;  3Q2Y A;  1DIP A;  5D90 A;  3R8K A;  1Q06 A;  1Q08 A;  3UCS A;  2ZHH A;  1Q0A A;  2VZ4 A;  4WLS A;  1R8D A;  2J5U A;  4R24 B;  3D71 A;  2ZHG A;  4B0Y A;  4WLW A;  5GQQ A;  5KAW A;  5KAX A;  1JBG A;  1EXJ A;  5D8C A;  3Q5P A;  4R4M A;  3LUR A;  5KAV A;  3T97 B;  1Q05 A;  3Q5R A;  2DG6 A; 
#chains in the Genus database with same CATH topology
 2O3J A;  3IAO A;  1NTZ J;  2AXC A;  3KYQ A;  2AEM A;  2Q9I A;  1BSH A;  3TSI A;  1IC2 A;  1G1J A;  2QJP B;  1OVR A;  1ZLL A;  1S5L H;  2OG0 A;  3MUD C;  1G1I A;  1SQV D;  1LT9 C;  3L74 J;  3U59 A;  3H1J E;  3P32 A;  4DOJ A;  1M1K Q;  2PFX A;  4R4M A;  2IDB A;  4C46 A;  4H13 C;  4JYC A;  2HVA A;  1MUU A;  2OGU A;  3VMZ A;  1RQU A;  3CX5 D;  1PIX A;  1S5L E;  3SWY A;  2M0B A;  1HTL C;  3GHG B;  2HG5 D;  4H44 C;  4AQR D;  3AE1 C;  1Q90 D;  2N1T C;  3A0B H;  1LWU A;  1SQV J;  1NTK G;  3H1L J;  2A06 D;  4UB8 H;  1SQB G;  1L0N E;  3H1I J;  5B66 H;  1PPJ G;  1FZC B;  3SWF A;  3MZW B;  1ZME C;  3GW6 A;  1LTG C;  2YMK A;  3EZ2 A;  2GM4 A;  3AEG C;  5BU5 A;  2ITA A;  3BRT B;  1NU1 D;  1NU1 G;  1KYO H;  2RN0 A;  4D6T E;  1N86 A;  5E01 A;  2E75 D;  1N73 B;  3FGA D;  1U7M A;  3IN6 A;  3IF4 A;  4Y28 J;  3M9H A;  2Y9Z A;  2ZYG A;  4KJM A;  3MP7 B;  1IZN B;  1KIL E;  3H1K G;  1SQV E;  3WMM 0;  1P84 I;  4UB6 E;  4XA4 A;  3U1C A;  1PFI A;  4A7P A;  3KZI E;  4D6T D;  3L72 J;  1GL2 A;  3ZDM A;  2L91 A;  3AEA C;  4PD4 H;  1H88 A;  2WTY A;  1NTM G;  3FWL A;  3WUT A;  2IBZ I;  1RHZ B;  5AVT B;  1T3U A;  4YTP C;  2R44 A;  4WY4 A;  3HD7 A;  2I8D A;  1AVO A;  1KQS O;  4AUW A;  3AE3 C;  2WPS A;  1ZR2 A;  1URQ A;  2FBW C;  1W5C E;  3GHG A;  3I5C A;  3BCC G;  2R5D A;  2Q1K A;  3H32 A;  1JTH B;  1HGV A;  2WSS H;  2NPS B;  3S9O A;  1EZV D;  1L0L J;  2QIW A;  2QA4 P;  1MZ9 A;  1S5L X;  1PP9 E;  1EDK A;  1OIP A;  1CI6 A;  3CC2 P;  2JR8 A;  2QRX A;  4I1L A;  3RBZ A;  1KYO I;  2JKV A;  2P1J A;  1NTM J;  1JCC A;  4EYY Q;  1YHQ P;  1J1E C;  3E0H A;  3CCM P;  3CLQ A;  2QE7 H;  3L75 G;  3H1H D;  3H1H G;  1FC2 C;  1VF5 C;  3TGU E;  2FKW B;  4EOT A;  5AW1 B;  1SQB K;  4L74 A;  1SQB E;  1G2C A;  4YXD C;  1KB9 H;  1A02 J;  4DCZ A;  1L4A B;  1GDT A;  3AE7 C;  5KLV G;  2FYN C;  2Y0D A;  1LTJ C;  1VQK P;  2YNY A;  1GK4 A;  1NU1 E;  2C9N Y;  1X8Y A;  2D2C D;  1WT6 A;  1YJN P;  1Q81 Q;  3CCR P;  1M1J B;  1L4A A;  1SQP J;  4D6T G;  1SQP K;  3GK6 A;  3AED C;  3AE2 C;  3HH0 A;  2W90 A;  4M3L A;  3VP8 A;  1U57 A;  4WY4 B;  1MFZ A;  1RY3 A;  1LWU C;  2MJZ A;  4IL6 H;  1SQV G;  2PAJ A;  3W68 A;  5APX A;  1S2E A;  2Y9Y A;  1L0L G;  2QEX P;  2H7H A;  1ZW0 A;  2ZXX A;  4W80 A;  4BRY B;  5CJ0 A;  3H32 B;  5CHX A;  2Q5U A;  1FZE A;  2R3S A;  1VL2 A;  1KQF B;  2WSC H;  1R5L A;  1LT9 A;  3EQ2 A;  1K73 Q;  2MKV A;  3MUD A;  3Q1M A;  1URQ D;  3NTN A;  5AW7 B;  3A7O A;  1KZU B;  4QMA A;  4Y99 C;  3LW5 J;  2A45 H;  1LTI C;  2OYH B;  1OW6 A;  3P8C D;  1NTK D;  4BWN A;  3PP5 A;  1BE3 J;  3CCS P;  1KMI Z;  1FS0 E;  4OH8 B;  2WT7 A;  5E79 E;  2QVA A;  1SQB D;  2J58 A;  3H1I E;  1JNM A;  1PM6 A;  1P84 E;  3CCE P;  2NPS D;  1SQX K;  5M1B A;  4RJT A;  2E74 B;  4N6J A;  1EXJ A;  4W7Z A;  2WZ7 A;  4AYZ B;  2KZJ A;  1DX7 A;  2XZR A;  3CWB G;  3GPV A;  3L72 D;  5D90 A;  1Q06 A;  2ZHG A;  3LUR A;  5KAF H;  2B88 A;  1Q05 A;  1JY3 O;  2KOG A;  1BSN A;  4PV1 C;  1X79 B;  5APY A;  3WU2 E;  1JUN A;  3TYY A;  2JWA A;  2WVR A;  3RK2 D;  1OVU A;  2D2C B;  4PD4 I;  2E42 A;  4JQ0 D;  3CC4 P;  2WWW A;  1NGM B;  3PHL A;  1GU4 A;  1VQM P;  3H6P A;  3N7N A;  1P84 H;  1L4A D;  3BVH A;  1SLQ A;  3M91 A;  1NKN A;  1IK9 A;  1OVV A;  1SFC D;  2D2C C;  2K9J A;  1USE A;  1SQQ G;  2OYO A;  5CCH D;  2ZXE B;  3U1A A;  1IFD A;  1Z56 A;  1PGQ A;  4L73 A;  2UWJ E;  1R8D A;  3L73 G;  2ZYA A;  4LGD E;  3JC2 2;  1CSB A;  3N4X A;  3SWK A;  3P8C E;  2XV5 A;  1ZRT E;  3C1L A;  3OW2 O;  1OFC X;  1KOR A;  1Q09 A;  1AQT A;  1FOS F;  1D5Y A;  5AVY B;  3AE9 C;  2IYO A;  1Q0A A;  1RE3 A;  4XE5 B;  1QLE D;  1IO4 A;  2B89 A;  1G2C B;  3A0B E;  4NPE A;  3F89 A;  1USD A;  2M5A A;  2OQQ A;  2BEZ F;  2PRR A;  3C8V A;  1L0L E;  1RF1 A;  2O1K A;  5TIS H;  3HD7 B;  4H0L B;  3V2N A;  1OW8 A;  1YIT P;  2OYI B;  2HYN A;  1UII A;  1CI6 B;  5KAW A;  1URQ B;  3MGN A;  3CCL P;  1M1J A;  2QG4 A;  1NAY A;  1QX8 A;  3EWK A;  3M06 A;  5KCB A;  3L75 D;  2G8Y A;  4IFM A;  3L70 D;  5TIS E;  1YQ3 C;  3HTK B;  4DJG A;  1K9M Q;  2K37 A;  3HUS A;  3D6Y A;  2KNC B;  2K88 A;  2Z5I A;  1RE4 A;  1M8O B;  3CX5 H;  1FOS E;  3AE6 C;  4W7Y A;  2K9Y A;  1GMJ A;  3WUU A;  4WLW A;  5KJ7 C;  3G4S P;  3B4S A;  2LR2 A;  3O6Q A;  1T2K C;  4Z1M H;  1PGP A;  1PP9 J;  2G3A A;  5I44 A;  3G71 P;  3MD0 A;  3T97 A;  3B49 A;  1T8Z A;  1E79 H;  5AVW B;  3KHU A;  1VQ6 P;  1SQX D;  2RH0 A;  1AV1 A;  1M1J C;  1KB9 D;  2WSC J;  3GMA A;  3LID A;  2A45 G;  1H0T A;  4U3F E;  1H89 A;  1BCC G;  2A45 I;  1LTJ B;  1OXZ A;  4WVZ A;  3I55 P;  4YXW H;  3HE5 A;  4TT3 H;  2B9B A;  2OAR A;  2ZFC A;  1OZH A;  2NZ2 A;  1BCC D;  3H1H J;  2KI7 B;  5TJH A;  2OYI C;  2H43 A;  2AXT H;  3MIW A;  1Q07 A;  1KIL A;  1GW3 A;  1LGH B;  3TK1 A;  1NO4 A;  5BVZ A;  1S9K E;  1NOH A;  3CXH D;  4GOE A;  2POH A;  4UB8 E;  1KIL C;  3VMA A;  5KJ7 D;  1FZF A;  4ZKU A;  3P8M C;  2M8R A;  1NH4 A;  1BGY E;  4WBA A;  1HWT C;  2K3R A;  2YXQ B;  4LHF A;  5GTH H;  3HUS C;  3CCV P;  4R24 B;  3EZ7 A;  1LTA C;  1L2P A;  3L71 J;  1QGK B;  3VTP C;  4U3F D;  3GP4 A;  1K04 A;  3H1L G;  4C7R A;  3BCC D;  1KQL A;  4PV1 D;  3S4R A;  2ZVN B;  1VQ5 P;  1BDC A;  2AEF A;  5AW5 B;  5KAU A;  2FYU J;  1NTM K;  1AQ5 A;  1WRG A;  3EFG A;  2XNX A;  1Y8A A;  2O01 H;  1JMM A;  3B5N A;  2BAS A;  4D6T J;  1YTZ T;  2E43 A;  3RK3 E;  4XFJ A;  2JEE A;  5APW A;  2Q7C A;  1PGJ A;  2AXT E;  1R5S A;  5I41 B;  1CW5 A;  5CMZ A;  1HF9 A;  1L0N D;  1L0N G;  1X22 A;  1PPJ E;  5AVV B;  3RGU A;  1T6A A;  2IEF A;  2FYU D;  3V5B A;  1KTM A;  1JB0 J;  2E5T A;  3L72 E;  4PV1 B;  1GD2 E;  2WSE H;  2YO3 A;  1N7S A;  5CCH A;  3L74 D;  1FU1 A;  1VQN P;  2OYH C;  3KQG A;  3E7K A;  3HUS B;  1BCC E;  2FY8 A;  3A2A A;  2LXB A;  5AW6 B;  3SSU A;  5GTH E;  4ASV A;  2KUB A;  1GW4 A;  2HPC B;  2B87 B;  1GZL A;  4A1M A;  1FZC C;  2BCC G;  1DIP A;  3CX5 E;  2WT7 B;  1FAV A;  4HYT B;  3K5B A;  2FYU K;  2WQY C;  2L5G B;  2KSJ A;  2B87 A;  1VQ8 P;  2WSF J;  1KIL B;  1NTZ E;  3KDP B;  2OYI A;  1IJD B;  1KFN A;  4R4L A;  1M57 D;  1PL5 A;  2KB7 P;  4DZO A;  1NTM E;  5K5G B;  2KZI A;  2FYZ A;  5C39 A;  3L70 G;  2N1T A;  3BCC J;  3GF7 A;  1LWU B;  4WLS A;  4ZKP A;  2Z4E A;  4H13 B;  1BGY G;  2IFN A;  3B8E B;  2KSE A;  4BRY A;  3KZI H;  2KS1 A;  1L0N J;  1BOW A;  4AYZ A;  1QVF O;  1PV3 A;  5APT A;  5APV A;  1SVF A;  2GOV A;  2NRG A;  3BCC E;  4J2N A;  1JTH A;  3RL0 D;  3Q2Y A;  2WPQ A;  5BU8 B;  3G3Z A;  3FX0 A;  3TNU B;  2E74 D;  5KTB A;  3AE8 C;  1CZQ A;  1JEK A;  4IL6 X;  2C9L Y;  2FYN B;  5KLI B;  3QAO A;  3RBX A;  3MHV A;  1T2K D;  1M56 D;  1ZP0 C;  2ZAE B;  4KT0 J;  3GF3 A;  1W2B O;  1FBM A;  2GA1 A;  3M0A A;  2Q6Q A;  2WMM A;  3PH0 A;  3Q5R A;  1FZA A;  3BRV B;  2PGD A;  2JDI H;  4WY4 C;  1BCC J;  1Y6U A;  5B66 E;  4N78 E;  4U3F J;  3H1K D;  1HUC A;  3IR9 A;  2FXM A;  2KK7 A;  2YKQ A;  4B0Y A;  2HOD A;  3F5H A;  1H8A A;  1ZR4 A;  1AVY A;  3R4Y A;  4WWI A;  2Y0C A;  5E79 H;  5AW4 B;  3S1K A;  4KHX A;  1L4A C;  2V7Q J;  1LX8 A;  1RQV A;  2YO2 A;  4B86 A;  1URQ C;  2ZJS E;  1EDJ A;  4PD4 D;  4H0L C;  5KAF E;  2C0W A;  4DT0 A;  3HD7 C;  2BCC D;  4NPF X;  2A06 E;  1VF5 B;  3O6Q B;  2BEQ D;  2KNC A;  1RE3 C;  2R3C A;  1SQX E;  2NPS A;  2HR3 A;  2IPP A;  1QEX A;  3V4Q A;  1W2E A;  2J5U A;  1YQ4 C;  1EZV G;  3L73 D;  3PTZ A;  1MV8 A;  1EZV I;  2W6A A;  1FE6 A;  2DW3 A;  1Y9B A;  1SQV K;  1TU3 F;  3V2P A;  2BCC E;  2P67 A;  3D6Z A;  3SFD C;  5GTI E;  4H0L D;  3HD7 D;  5KLV K;  3I56 P;  5L8R J;  4HB1 A;  2FFD A;  1SFC A;  1S3J A;  4EIJ A;  2NPS C;  1SQQ D;  3H1J J;  5KJ7 A;  3CME P;  3QH9 A;  3UCS A;  1JBG A;  3A5T A;  3HE5 B;  2IZ0 A;  3GLM A;  1JY3 P;  3VMX A;  1EDI A;  2PP6 A;  2ZT9 B;  2ZYD A;  5AVU B;  3AEF C;  5APQ A;  5KKZ B;  2J59 M;  2LKM A;  1P84 D;  2N9B A;  2KLU A;  1DH3 A;  5APS A;  2WPV B;  1J1D B;  1RE4 C;  1ZXG A;  4RO0 A;  4JYB A;  1FZB A;  2HLO A;  5AW0 B;  3V6I A;  3LW5 H;  3H1J G;  1FJK A;  2CPB A;  2JWD A;  3R8K A;  3W67 A;  1NAF A;  3AEC C;  2M3E A;  4C7N A;  2E74 C;  1M7L A;  5KAX A;  4H44 B;  1HJ0 A;  2P2U A;  3QWO C;  1RH5 B;  2XKM A;  2H88 C;  2BOW A;  1QL1 A;  2JP3 A;  1NTK E;  2C0X A;  3CWB J;  2V4H A;  4Y99 B;  1EXI A;  1T3J A;  1JMB A;  1LT9 B;  3JCU H;  1FZC A;  1NTK K;  3G9R A;  1BE3 D;  3M9Q A;  3L71 D;  4R4E A;  3CCU P;  3O8Z A;  3PRJ A;  1KB9 I;  1YJW P;  3G6E P;  3PLN A;  3VYI A;  3B5N D;  5EFW B;  4HJG H;  5AVR B;  5AVZ B;  3HE4 A;  4GKG A;  2YKO A;  1U7J A;  3L73 E;  1VQP P;  1JCD A;  1JY2 P;  1GTW A;  1R8E A;  2WIT A;  4JBZ A;  1K05 A;  1YBK A;  1ZRT D;  2P58 A;  3NMD A;  1VPC A;  1KC8 Q;  1EZV E;  2IX7 C;  4C7N B;  1KYO D;  1S1C X;  3CXH I;  1DD3 A;  2V7Q H;  5CBO A;  4EI2 A;  4GOF A;  1JO5 A;  4HKZ H;  3V2R A;  1HH0 A;  4ASW A;  3TGU J;  4HH2 A;  3ITK A;  2YIU B;  1VQ4 P;  1IFN A;  3KPE A;  4H44 D;  3USS A;  2RMZ A;  1BE3 E;  2W8Z A;  4PJ0 H;  1GU5 A;  4YPC A;  5KLV D;  2WSE J;  5CBN A;  4OGQ B;  4CPG A;  3CX5 I;  1FDO A;  1YJ9 P;  3RK3 D;  2VRS A;  4I2L C;  4RKU J;  4IL6 E;  5AVQ B;  3Q3D A;  3L71 E;  4RES B;  1K8A Q;  1PP9 D;  1SQP G;  4OWF A;  4LC1 A;  4K3A A;  2K9J B;  1FDI A;  1HGZ A;  1J1E B;  3VMY A;  1LNQ A;  2IZ1 A;  3CL3 D;  1MKM A;  1PP9 G;  1OWA A;  1SQP D;  1RF1 C;  4GOD A;  5H2F E;  3CXH H;  4I6M C;  2K1A A;  1KQG B;  2FFD B;  1VQ7 P;  2KXP B;  2FXO A;  3VOP A;  3UIA A;  1FZG A;  1LP1 B;  3A3Y B;  1DEE G;  3L75 J;  1KB9 E;  5GTI H;  1KYO E;  3HTK A;  3L75 E;  1IFP A;  3H1H E;  1H0T B;  3L73 J;  1L0L D;  2GUS A;  2E76 D;  2KLV A;  5H2F H;  3TGU G;  3TGU D;  3A0H H;  3RL0 C;  3FXE A;  5B5E E;  2XND H;  2OYH A;  1IFJ A;  2Q3I A;  5KLV E;  1LTT C;  3RL0 B;  1GL2 B;  1VQO P;  1XTG B;  4R22 B;  1NTM D;  1AA0 A;  1VQ9 P;  1Q82 Q;  1OX3 A;  1NVO A;  2QM7 A;  1HJB A;  3H25 A;  3CC7 P;  4PD4 E;  5KLV J;  1JY2 O;  3M9B A;  2OTK E;  1AJY A;  2E76 C;  3TF5 A;  4IFD K;  4GIF A;  1N7L A;  2JML A;  1KD1 Q;  1E5W A;  2P7J A;  1EDL A;  1SP4 A;  5APU A;  3AEE C;  3CXH E;  3GG2 A;  3M0D A;  4OGQ D;  5AVX B;  2YKP A;  4WB4 A;  5CCH C;  3L35 A;  2W27 A;  1N73 C;  3JSV C;  3H1L E;  1UIX A;  2O1J A;  2SPZ A;  1NKZ B;  3L4F A;  1IFI A;  2JJL A;  4I7Z C;  1IK7 A;  3WU2 H;  3CMA P;  2QM8 A;  1M90 Q;  4LLH A;  1LTB C;  3CI9 A;  1BE3 G;  2KP8 A;  2ZT9 D;  4IOI H;  2Q3E A;  1FDM A;  2QJK C;  1EQ7 A;  1LTS C;  4OGQ C;  2HOD B;  1N7S B;  3RK2 C;  1D7M A;  2FXP A;  3RK3 C;  1FJP A;  1NTZ K;  1WMK A;  1YI2 P;  3L71 G;  2OTL P;  3BAT A;  1SQP E;  3H1I G;  2N1T B;  2Y0E A;  1NWQ A;  3B5N C;  3OAK A;  1Q2N A;  3GHG C;  4TLF A;  1KFM A;  1HBW A;  2QJY B;  1Q7Y Q;  4JPZ B;  1VDF A;  2W6B A;  1Y47 A;  3BAS A;  2JO1 A;  3CWB E;  1SQB J;  1EC5 A;  2QJP C;  5CCG D;  3II6 A;  1RF0 C;  4H13 D;  1QL2 A;  1NTK J;  4O9B A;  3B5N B;  3E1I A;  1SQQ K;  1JOC A;  5AVS B;  3H1J D;  2ZHH A;  2KYV A;  3L72 G;  5DJT B;  5B5E H;  3RK3 B;  5CCG C;  2WPR A;  1VQL P;  3H1L D;  1SFC C;  1KIL D;  3A0H E;  3RK2 B;  1RH6 A;  3CWB D;  1AFO A;  1KV4 A;  4DCK A;  5CJ4 A;  3JCU E;  3EZF A;  4WY4 D;  2IFM A;  3P7K A;  2VZ4 A;  1LTJ A;  1JY3 N;  5AW9 B;  5GQQ A;  5KAI H;  3Q5P A;  5DJU B;  1L0L K;  2GUV A;  1YIJ P;  4I7Z B;  4N3Y B;  3TDK A;  1NTZ G;  1RF0 A;  1SQQ E;  1ZN5 A;  5AW2 B;  2QJY C;  1NJI Q;  1NU1 J;  1NHL A;  3L70 E;  2HPC A;  2BCC J;  3EZ6 A;  1QVG O;  3NFQ A;  1NTZ D;  1LJ2 A;  4L75 A;  1SQQ J;  4L76 A;  2I1K A;  3H1I D;  2FYU G;  1JM0 A;  3AEB C;  2O01 J;  3V2Q A;  1N7S C;  1SS1 A;  1PPJ D;  2E76 B;  5KAI E;  2YXR B;  3L74 E;  3V4W A;  2QJK B;  2E75 B;  1XTC C;  4GT1 A;  4U7J A;  5CCG A;  2IBZ E;  5D8C A;  1J1D C;  1OW7 A;  1N2D C;  2DG6 A;  5AW8 B;  4ZNC A;  2R5B A;  2IYP A;  3OA7 A;  2CPS A;  3R8J A;  3VP9 A;  5KKZ C;  1GK6 A;  1LP1 A;  2RKL A;  4NPD A;  2ZT9 C;  1YYC A;  2OTJ P;  2M3B A;  1S72 P;  2CK3 H;  1PZQ A;  2N1T D;  4PJ0 E;  1HVV A;  2KS1 B;  3KXD A;  4AYC A;  2XU6 A;  2IBZ D;  3EFF K;  2KCU A;  1KN7 A;  5KAT A;  2AEJ A;  3RL0 g;  3CCQ P;  1OMI A;  4ZMD A;  1IFM A;  3E1R A;  5AW3 B;  1A02 F;  2R32 A;  2M5A B;  1BGY D;  3NXS A;  3TNU A;  3L36 A;  1NU1 K;  2P10 A;  4N78 D;  4BXL A;  2FFD C;  2I1J A;  3D70 A;  1GL2 C;  1ZV8 A;  3HRN A;  3MTU E;  1Q08 A;  3H1K J;  1PGO A;  2XDJ A;  3D71 A;  3CCJ P;  3CD6 P;  3L37 A;  3IFM A;  2N9Y B;  2Z5H A;  2A06 G;  3Q5S A;  2H89 C;  3VN0 A;  1N73 A;  3WUV A;  3ABV C;  1SQX G;  1MFT A;  1J2J B;  4U3F G;  2E75 C;  1S4X A;  3M0D C;  3LIE A;  1JY2 N;  4MN4 C;  1X9V A;  2WSF H;  3R2P A;  1Q86 Q;  2W83 C;  1GL2 D;  4GDO A;  3H1K E;  2QSI A;  1S9K D;  4UB6 H;  1X0T A;  3AE5 C;  1SQX J;  2YIU C;  1N8R Q;  2ZVO B;  3FWN A;  1RF1 B;  4IFF A;  3OJA B;  3CPW O;  1LT1 A;  1YTZ I;  1DD4 A;  2LXC B;  2H8P D;  1NYH A;  3HE4 B;  3FXD A;  3C9I A;  1BDD A;  2HFE D;  5KAV A;  2KVV A;  1ZOY C;  2YMY A;  2FYU E;  2KIK A;  1L0N K;  1DEB A;  3B71 A;  3SFE C;  1VF5 D;  2E5Y A;  4EDF A;  1BGY J;  2W6J H;  1N7S D;  3L74 G;  3EZ9 A;  1SFC B;  1JYH A;  3PJS K;  2O01 N;  3L70 J;  2IBZ G;  4JF7 A;  4OVN F;  5KLI C;  3AE4 C;  4K35 A;  3T97 B; 
#chains in the Genus database with same CATH homology
 3IAO A;  3D6Y A;  1KQF B;  3E0H A;  4H44 B;  1HJ0 A;  4H44 D;  2MKV A;  1KIL E;  3QAO A;  1Y9B A;  3Q1M A;  1KTM A;  1TU3 F;  2D2C C;  4R22 B;  3AEB C;  2O01 J;  1ZP0 C;  2H88 C;  4KT0 J;  3D6Z A;  1JB0 J;  2OG0 A;  2WSE J;  3Q5S A;  1VF5 C;  3AE6 C;  2BOW A;  2E76 B;  4LHF A;  4OGQ B;  3SFD C;  2JP3 A;  3GF3 A;  4H0L D;  2H89 C;  4PV1 B;  3LW5 J;  3ABV C;  1FDO A;  2E75 B;  2K9Y A;  1R8D A;  4R24 B;  3EZ7 A;  1OW6 A;  4U7J A;  1GMJ A;  4WLW A;  5L8R J;  3AEA C;  3O6Q A;  5D8C A;  4R4M A;  1OW7 A;  2IDB A;  2E75 C;  3H25 A;  1KMI Z;  4IL6 X;  4YXD C;  3Q5R A;  2DG6 A;  4RKU J;  1EXI A;  4H13 C;  4Z1M H;  3GP4 A;  3Q3D A;  1AJY A;  1K04 A;  2JO1 A;  1ZRT E;  2E76 C;  2G3A A;  5I44 A;  1Y6U A;  3G9R A;  2HVA A;  1KOR A;  2JML A;  4DCZ A;  1PM6 A;  1Q09 A;  2QJP C;  5KKZ C;  4GDO A;  4R4E A;  3AE7 C;  4H13 D;  3B49 A;  3R8J A;  1RQU A;  4YTP C;  1PIX A;  2QSI A;  1FDI A;  3AEE C;  1D5Y A;  2FYN C;  4A1M A;  2ZT9 C;  3AE5 C;  4H44 C;  3AE1 C;  1DIP A;  1Q90 D;  3AE9 C;  4PV1 D;  3UCS A;  2ZHH A;  1Q0A A;  2YIU C;  1MKM A;  4OGQ D;  5M1B A;  2D2C D;  2E74 B;  2WQY C;  2WSC J;  4B0Y A;  3GMA A;  3AE3 C;  1JBG A;  1EXJ A;  2WSF J;  3GLM A;  5KAU A;  2FBW C;  2OQQ A;  2KCU A;  4AYZ B;  1DD4 A;  2BEZ F;  5KAT A;  3GK6 A;  3C8V A;  1RH6 A;  1R8E A;  3AED C;  2ZT9 B;  3R4Y A;  1KQG B;  1NYH A;  3AE2 C;  4R4L A;  1K05 A;  1UIX A;  3HH0 A;  1PL5 A;  3AEF C;  1ZME C;  3GPV A;  3RL0 g;  3EZF A;  2YMK A;  4H0L B;  2V7Q J;  1IK7 A;  3EZ2 A;  4I7Z C;  1OMI A;  3AEG C;  5D90 A;  1LX8 A;  1OW8 A;  3GF7 A;  1Q06 A;  4TT3 H;  1RQV A;  1U57 A;  2VZ4 A;  4WLS A;  3RK3 E;  4H13 B;  4XFJ A;  3S9O A;  2ZHG A;  5GQQ A;  5KAW A;  2WPV B;  2NZ2 A;  5KAV A;  3Q5P A;  1S1C X;  2QIW A;  2KVV A;  1ZOY C;  3LUR A;  1Q05 A;  1S5L X;  1DD3 A;  2ZT9 D;  4I7Z B;  4H0L C;  5I41 B;  1Q07 A;  1BOW A;  2QJK C;  4AYZ A;  1PV3 A;  2P10 A;  1HF9 A;  3B71 A;  4PV1 C;  2GOV A;  5KCB A;  3EWK A;  4OGQ C;  2E76 D;  3SFE C;  1VF5 D;  1VF5 B;  2QJY C;  2BEQ D;  4J2N A;  5E01 A;  2E75 D;  3EZ9 A;  2D2C B;  3D70 A;  1JYH A;  2G8Y A;  3FGA D;  3Q2Y A;  3R8K A;  2FXP A;  5KLI C;  1Q08 A;  3IN6 A;  1NGM B;  1YQ3 C;  3AEC C;  2J5U A;  1WMK A;  1YQ4 C;  3AE4 C;  2E74 C;  3D71 A;  4Y28 J;  2E74 D;  2IEF A;  3AE8 C;  5KAX A;  3EZ6 A;  3T97 B;  1VL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...