3Q5PA

Crystal structure of bmrr bound to tetracycline
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna/antibiotic
molecule keywords Multidrug-efflux transporter 1 regulator
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q5pA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q5pA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q5pA03
4J2NA 1R8DA 2BOWA 5KAUA 3QAOA 5KATA 5KAXA 2HVAA 3LURA 3R8JA 4R4LA 2JMLA 4B0YA 3Q3DA 5KAVA 2GOVA 3IAOA 3Q5PA 2OQQA 5D90A 3B49A 1D5YA 5D8CA 3D6YA 1Q05A 4R22B 3T97B 1Q08A 1JBGA 3D71A 3Q2YA 1DIPA 1BOWA 3GK6A 3E0HA 1EXIA 3Q5SA 3D6ZA 3Q1MA 1Q0AA 2DG6A 1Q09A 2VZ4A 3R8KA 4R4MA 5E01A 1EXJA 4WLWA 5KAWA 4A1MA 5KCBA 1Q06A 3GP4A 2ZHGA 2J5UA 3D70A 3HH0A 2ZHHA 4WLSA 4AYZB 4R24B 1JYHA 4R4EA 1R8EA 5GQQA 3GPVA 4AYZA 2KCUA 3UCSA 5I44A 5I41B 3Q5RA 1Q07A 3G9RA
chains in the Genus database with same CATH superfamily
1JCCA 3BATA 2LR2A 3KDPB 5APWA 2JWAA 1S9KD 1JBGA 3I5CA 1VF5C 5AVRB 3RL0C 1HBWA 3HD7D 3I55P 5TJHA 5H2FE 4JYCA 1ZMEC 2KSEA 1W2EA 1VPCA 1P84D 4M3LA 4ZKUA 3HE5B 1CW5A 3USSA 3B5ND 1NHLA 3PP5A 2FXMA 3VP9A 2KS1A 2GUSA 1GU4A 1M1KQ 4WY4A 3R2PA 2KS1B 3GMAA 1RE4A 5DJUB 1TU3F 2VRSA 4H13C 1L0LE 1LP1A 3V2NA 1HJ0A 2BEZF 4WY4C 5AW3B 1FDMA 2ZFCA 1HF9A 1G2CB 2ZYDA 2AXTE 3GW6A 3L72E 4DCZA 1PGQA 4WLSA 5KLVD 1M8OB 3A7OA 5KAIH 1X0TA 2K9JA 1FDIA 2W8ZA 1NKNA 2JO1A 4C46A 5C39A 4OGQB 2WZ7A 3G71P 3HD7B 4L76A 2QM8A 1JOCA 2K9JB 1YJWP 4QMAA 3VN0A 4GODA 1Y9BA 2Y0DA 1H0TA 1N8RQ 4IFDK 2YO2A 3I56P 2ITAA 4W7YA 1GW4A 2O01N 1N73A 1KORA 5H2FH 1FU1A 4PD4E 3QWOC 4YPCA 1KILB 1R5SA 4RJTA 4U3FG 1JCDA 4BRYB 3L70D 1NO4A 2YKQA 1URQB 2QVAA 2P67A 3IF4A 4LGDE 3W67A 1KB9E 1RE3A 2M0BA 1NH4A 3H1LG 3JCUH 3TSIA 1NTMG 3LIDA 1KFMA 2KLVA 3R8KA 3BASA 1L4AD 2KSJA 1NTKJ 1L4AB 1M1JB 3R4YA 4D6TJ 1PP9G 2RH0A 2QIWA 5AW2B 1FZCC 1R8DA 1NTMD 2R5BA 1FZCA 1LWUC 4Z1MH 2A45G 3ZDMA 1FZCB 1GMJA 4I7ZC 1WRGA 3H1IE 3HH0A 2WSFJ 3M9BA 2E76D 2N1TB 1S72P 1ZR4A 5KAXA 2RMZA 3H1HJ 3F89A 3CCRP 1J1EB 2G8YA 2QE7H 5CCGC 2OYIC 5K5GB 1LNQA 2ZJSE 3BCCG 4N78E 2FYNB 3MTUE 5I44A 4ASWA 1J1DC 5M1BA 1LT1A 3H1KJ 2Y9YA 1N73B 4B0YA 4H0LC 1NVOA 1T6AA 2LKMA 1SQVG 3OW2O 1S5LX 3H1IG 1PZQA 1GTWA 4DT0A 1IFNA 2IZ1A 2WPSA 2WQYC 4Y28J 3H1JJ 5I41B 1LTIC 2R3CA 1YBKA 2KXPB 2NRGA 5KJ7C 4N6JA 2H89C 4UB8H 1SQPD 3HD7A 1KYOH 2OYOA 3E7KA 3AECC 3TDKA 2J58A 1EDJA 2ZHHA 1KQLA 1LT9B 2ZXEB 2LXCB 3B5NA 3H1ID 4OH8B 5KAVA 1NTKE 5AVSB 1A02F 1BGYE 1SQVD 4DJGA 2OTKE 3AEDC 2IBZI 3OJAB 1X22A 1U7JA 3B5NC 3AEBC 4HKZH 4L75A 2HPCA 4H44B 2B88A 3BCCD 1USDA 2KNCB 3M0DC 2OYHB 5AW9B 1HWTC 3L70J 3HE5A 1RF1A 3FXEA 3HE4A 3H1IJ 1KB9H 3L74E 2BCCD 1NTMJ 3SWFA 1YITP 5CCGD 4U3FD 4GOFA 3NFQA 3H1HD 2KZJA 4Y99C 1SQXG 1KQFB 2BOWA 3Q3DA 5AVXB 2FYUJ 1PPJE 3GHGC 4WWIA 1KTMA 3HTKA 1T2KC 1URQD 1MFTA 1QL2A 3MUDA 1SQPJ 5TISE 3U59A 2A06D 2QSIA 1HGZA 2QJYB 2ZVOB 3AE5C 1SQPE 2N9YB 2R32A 3E0HA 1FS0E 1LTGC 3L37A 2OYHA 1AJYA 1BCCJ 2QRXA 2R3SA 3IN6A 3EZ7A 1NOHA 4CPGA 3TNUB 5CCHD 3Q5PA 3OAKA 3KZIH 1IK9A 1LJ2A 3Q1MA 2KZIA 3AE2C 5KTBA 1S5LH 3RK3C 3FWNA 2WITA 1QLED 2P7JA 5CJ4A 2W90A 3A0BH 3EFGA 3R8JA 3H1HE 4H44C 3FX0A 1SQQK 3KPEA 1BGYG 1SQBG 1EDKA 1Q7YQ 3EZ2A 2AEMA 1PGOA 1YHQP 1S9KE 4ZNCA 3CLQA 4BWNA 2Q9IA 2KK7A 3CXHH 2XKMA 1KILA 1N7SA 1KFNA 3EQ2A 3HRNA 5KAIE 2YIUC 1RQUA 3H1KG 4C7RA 3TGUE 2HLOA 1K05A 3F5HA 4I7ZB 2CK3H 1HGVA 2O3JA 1SVFA 2ZT9C 1BCCD 2FKWB 1XTCC 1DIPA 3G3ZA 2YKPA 2WSCJ 1X79B 3CWBG 2QJKC 1ZR2A 1FJKA 1IFJA 1DD3A 1VQNP 2HFED 1NAYA 1BGYJ 1L0NK 4U3FE 5GTHE 1KZUB 2QJKB 1L0NE 4PD4I 4NPFX 1OVRA 1RF1C 2Y0CA 2V7QH 1GD2E 1K04A 4WVZA 2XV5A 4R4EA 3CC7P 1OVVA 2J59M 2NPSC 3G9RA 1Q82Q 4D6TG 3CMEP 5AW0B 1NTME 5APQA 4OGQC 3KZIE 2OYIA 3BRVB 4JYBA 2PFXA 5APSA 1J1EC 5E79E 1VQMP 1IFIA 1JMMA 4EYYQ 3HUSC 2XNXA 2PGDA 4O9BA 3L35A 1P84I 1H8AA 3V2PA 1Q06A 3A0HH 3WUUA 3O6QA 3EZ6A 3CXHE 1AQTA 4EIJA 5AVWB 3CX5E 5CBNA 3BRTB 1IFMA 3L75G 5B66H 2GA1A 1NU1K 5APYA 2IZ0A 2M3EA 1SFCD 1SFCC 1NU1D 3HD7C 4N3YB 4XE5B 5KJ7D 1NTMK 3SSUA 1T3UA 2WPVB 4C7NB 3IFMA 1JY3N 3CCVP 2Q1KA 4MN4C 3AEAC 2WMMA 3SFDC 1SP4A 3C8VA 1VF5D 2FY8A 2YMYA 4OGQD 1NU1J 5KAFE 1PP9J 5GQQA 3SWKA 1KILE 2OARA 3B71A 1JM0A 3RL0B 2YO3A 5KLVJ 1NKZB 1EZVI 3AEGC 2Q6QA 1IJDB 2NPSA 3G4SP 2HYNA 3VTPC 1ZXGA 2K1AA 3AE6C 1E5WA 1L4AC 1K8AQ 1M1JC 2WPRA 3M0AA 5APUA 4PJ0E 4D6TD 1L4AA 1M1JA 1N86A 4PJ0H 1OW7A 1ZLLA 2A45I 2XZRA 1LTJB 3TGUJ 2MKVA 2KUBA 2B89A 3K5BA 2WPQA 4XA4A 3VMXA 4D6TE 3TYYA 2KP8A 1PL5A 3B49A 1JY3P 3KQGA 3O8ZA 5GTIE 3TGUG 1LTJA 4LHFA 1ZV8A 3MD0A 3L72D 2BCCG 1CI6A 2ZT9D 2IBZE 3IR9A 5KLIC 1BE3D 1QL1A 2FYUG 1Q86Q 1GU5A 2OYIB 5KAUA 4C7NA 1PM6A 1AFOA 3P8CD 4HB1A 2E76B 2N1TD 2K37A 2KLUA 1GK4A 1EXJA 4DZOA 4DOJA 2AXCA 1KQSO 3P32A 5AW8B 2WVRA 4R4LA 5KKZC 2E75C 4KJMA 1EQ7A 1RY3A 1PFIA 1LT9C 1SQBE 1EZVE 3CX5H 4IL6H 2O1KA 3H1JG 2J5UA 1QVFO 3B4SA 1SQBJ 4NPEA 1PGPA 1IZNB 3JC22 2GUVA 4UB6E 4WY4D 1ZN5A 5AVTB 1G2CA 3LW5H 3RK3E 4EDFA 5E01A 1DX7A 1LWUB 2ZXXA 3SFEC 5KAFH 3JCUE 2E74C 3L73J 3CMAP 1T2KD 1PP9D 5BVZA 2IYOA 1KQGB 1SQXE 2N1TA 1EXIA 2I1KA 2JJLA 3E1RA 1MV8A 1NTZD 1GW3A 3L72J 3L72G 4OWFA 2IFMA 1LTJC 3QAOA 2PP6A 3C1LA 2NPSB 2FYNC 3P8MC 4HJGH 3AE4C 4YTPC 4WLWA 2WSCH 2O01J 3HE4B 1YI2P 2WWWA 1YJ9P 1UIIA 3A0HE 3EZFA 2KCUA 1OMIA 2ZYGA 3CWBJ 1RQVA 3D6YA 3D71A 5KLVK 2AXTH 1H89A 1GL2A 1N73C 2IPPA 3CCEP 2OGUA 1G1JA 3L75E 1HVVA 3HUSB 1GL2B 2BASA 4I6MC 2XDJA 2K9YA 3LIEA 1Q07A 1NTZG 1BE3J 1SQBK 1KB9I 3FGAD 3ABVC 4GDOA 2D2CC 3WU2H 4H0LB 4PD4H 3D70A 3LW5J 4JF7A 3L74G 1K73Q 1H0TB 1G1IA 4EOTA 5B5EE 3MUDC 3AE9C 2KVVA 3CCQP 1LTAC 4W80A 1BCCG 1PV3A 5GTHH 1W5CE 1M90Q 2OYHC 1Q0AA 1RHZB 1KB9D 3WUVA 3AE3C 2W27A 5CCHC 1S5LE 2L5GB 3L71D 1NWQA 4N78D 1YTZI 2UWJE 2I8DA 3O6QB 1FBMA 1SFCA 2E5YA 2M5AB 1LTBC 1Q08A 3VOPA 2WTYA 2IX7C 2VZ4A 1FC2C 2ZHGA 2B9BA 1JYHA 1R8EA 3RK3D 2K88A 3H32B 1Z56A 2M8RA 3H6PA 1NJIQ 3B5NB 5CMZA 3RL0D 2D2CD 1NGMB 3L73D 1KYOD 2RN0A 1CZQA 3V4WA 4H0LD 2IBZG 2C0WA 2Q7CA 1JY2P 4H44D 2H8PD 4IL6X 3UCSA 1S2EA 3CC4P 2Z4EA 3FWLA 1GZLA 2A06E 1Y47A 3A5TA 4I1LA 5D8CA 3WU2E 2NZ2A 3BCCE 3A0BE 1NTZJ 3MGNA 1AVYA 1ZRTD 1L0LK 2Q3IA 4NPDA 3RBZA 2E76C 2CPSA 1WT6A 3GF7A 2JEEA 1NAFA 2IDBA 2Y9ZA 1DEBA 5KAWA 3S1KA 2QJYC 1JY2N 1MUUA 3CWBD 1JNMA 1EDLA 1Q90D 2IYPA 2QJPB 4HH2A 2ZVNB 1SQXK 2YKOA 2JDIH 4IL6E 1URQC 3L73G 2PRRA 2QJPC 1KN7A 2A45H 1NTZK 3WMM0 2ZAEB 1J2JB 5L8RJ 1KYOE 1FZGA 4B86A 1KILD 2R44A 1LT9A 5D90A 5APTA 2I1JA 2YNYA 3Q2YA 3CPWO 4JPZB 3B8EB 3AE1C 1AVOA 5KKZB 2MJZA 2KI7B 3CC2P 2SPZA 1VQ7P 3P7KA 1SQQE 4ZMDA 1VF5B 3TK1A 1HUCA 3GF3A 2AEJA 3C9IA 1K9MQ 1GDTA 1W2BO 1FJPA 2P1JA 1PPJG 4JQ0D 2FFDB 1JY2O 2KOGA 1VQ9P 2WT7A 3II6A 4IOIH 3QH9A 1IC2A 1N7SC 3BCCJ 2FFDC 2W6BA 1OW6A 2HODB 2O1JA 4W7ZA 4Y99B 3T97B 1D7MA 3H1JD 1J1DB 2FXPA 3V5BA 1NTKG 4RKUJ 5CCHA 1AQ5A 1N7SB 1SQVJ 1FZFA 1JEKA 4GIFA 1OW8A 1M7LA 1OIPA 1VQ4P 4UB8E 1Y6UA 4L74A 1KYOI 2C9NY 1EDIA 1SS1A 2E43A 3VMZA 4TLFA 4GKGA 2RKLA 1E79H 2ZYAA 3JSVC 5APVA 2BCCJ 1IFDA 1ZOYC 5APXA 2HPCB 3H1LD 1BE3G 4K3AA 1GL2C 2QG4A 3V2RA 1RH5B 1ZP0C 3VMYA 3M0DA 5CHXA 5GTIH 1VQOP 3PTZA 1VQ6P 1GL2D 4R24B 3CWBE 1M57D 1KILC 3S9OA 1BSHA 4PV1D 4K35A 5CCGA 3EZ9A 4A7PA 1ZW0A 2W83C 1AA0A 1L0NG 1KV4A 1CI6B 3L75J 3HUSA 2FYUE 1NTKK 1SQQJ 3H1KE 5AW6B 2DW3A 1BDCA 1MKMA 4HYTB 1IO4A 3NMDA 4U3FJ 3Q5SA 5AW5B 1IFPA 1BCCE 2JKVA 2BEQD 2E75B 3ITKA 4ASVA 3L70G 3CCUP 4AYZA 2HVAA 2QM7A 2Z5HA 1NTKD 2YXQB 2HG5D 2YIUB 4KHXA 3V6IA 1SQBD 2E74B 1RH6A 1RF0A 2FYZA 3H1LJ 1LP1B 1LTSC 2R5DA 4TT3H 2B87B 3H1LE 1U7MA 3A3YB 1YTZT 1JTHB 4LC1A 4WB4A 1U57A 5AW1B 1D5YA 4R22B 3MZWB 3CXHI 2C9LY 4H13D 1JTHA 4IFFA 1NU1G 1FOSF 1YQ3C 2FYUK 3GG2A 5B66E 3MIWA 1SQQG 4GOEA 1EC5A 5KLVG 3L75D 3AEEC 4J2NA 1VDFA 2FYUD 2OTLP 1BDDA 5AVQB 3IAOA 1LTTC 2XU6A 3RGUA 1VL2A 4OVNF 1SQXJ 1P84E 5E79H 2H88C 3CXHD 1OWAA 3OA7A 2W6AA 3RK3B 1SLQA 5KLIB 3P8CE 2QEXP 1X8YA 3AE7C 4JBZA 1H88A 4AYZB 3EWKA 3L74D 1HTLC 1S3JA 3H32A 5DJTB 1NYHA 3LURA 1KC8Q 3RBXA 1NU1E 1LGHB 1JO5A 3PRJA 2Q5UA 4GT1A 1T3JA 5B5EH 3L4FA 1FZEA 5KLVE 2M5AA 3RK2D 2WT7B 2NPSD 3GLMA 1LWUA 5AW7B 3U1AA 2QA4P 2E42A 4BXLA 4L73A 1M56D 1SFCB 1S4XA 3U1CA 2Z5IA 2WSSH 3MP7B 3BVHA 1IK7A 2IBZD 5AVYB 3GHGB 1DEEG 3VYIA 3GHGA 2Y0EA 3NXSA 1OFCX 3G6EP 1YIJP 1Q81Q 3GP4A 2Q3EA 3V2QA 1QX8A 1FE6A 1JB0J 3PHLA 5TISH 2LXBA 1RF1B 1SQQD 1OZHA 2OTJP 1PPJD 1A02J 1L0LJ 5KJ7A 2N1TC 4KT0J 4A1MA 1MFZA 1HJBA 4AQRD 1EZVG 1MZ9A 3VMAA 3L71G 5BU8B 2P10A 3N7NA 1AV1A 1OXZA 4LLHA 3M9QA 1QGKB 1CSBA 3HTKB 1SQPK 1YJNP 4I2LC 1OVUA 2DG6A 1GK6A 1KMIZ 2IFNA 2JWDA 1PIXA 2P58A 3TGUD 1SQXD 1T8ZA 2GM4A 3Q5RA 3V4QA 2D2CB 1PP9E 2V7QJ 1QEXA 2M3BA 1PGJA 3AE8C 3RK2B 1FZBA 1Q05A 3FXDA 1ZRTE 4R4MA 4UB6H 1UIXA 3RK2C 4ZKPA 3N4XA 1SQVK 1NTZE 1VQLP 3CCJP 3CCLP 2G3AA 3L74J 2JMLA 1FDOA 2KB7P 3GK6A 3T97A 2V4HA 4IFMA 1KD1Q 5KCBA 3KXDA 2KYVA 1XTGB 3S4RA 3CX5D 1L0ND 4YXWH 4AYCA 2WSEJ 2YXRB 4RO0A 5BU5A 1SQPG 3CD6P 3CCSP 3RL0g 2W6JH 4RESB 5CBOA 2C0XA 2P2UA 2H43A 3L36A 2E74D 1RE4C 1BGYD 1BSNA 1RF0C 1EZVD 5AVVB 5AW4B 1N7SD 1VQPP 3CI9A 4BRYA 2H7HA 3EFFK 3CL3D 2B87A 5EFWB 1L2PA 3KYQA 2N9BA 3KHUA 3SWYA 2KIKA 1JUNA 2GOVA 2KNCA 2E5TA 2WSFH 1L0LG 1N7LA 4H13B 1YYCA 2O01H 2YMKA 3TF5A 3M91A 2HODA 3PH0A 1FAVA 1YQ4C 3H25A 1L0LD 2PAJA 4U7JA 3CX5I 3H1JE 3VP8A 2K3RA 3MHVA 3D6ZA 1Q09A 5AVUB 2FFDA 4XFJA 2E75D 3M06A 3GPVA 1USEA 1VQKP 1FOSE 1SQVE 5KATA 3L73E 3M9HA 1Q2NA 4EI2A 3PJSK 3CCMP 1BOWA 5CJ0A 1RE3C 1X9VA 2JP3A 5AVZB 1R5LA 4WY4B 4PD4D 3PLNA 1QVGO 2AEFA 3NTNA 1JY3O 3L71J 1N2DC 1HH0A 2OQQA 2BCCE 1FZAA 2A06G 1WMKA 3L71E 3TNUA 3L70E 2CPBA 3A2AA 3UIAA 2FBWC 3AEFC 4YXDC 1URQA 1VQ8P 2L91A 2JR8A 2POHA 2OG0A 2ZT9B 3WUTA 2WSEH 3E1IA 4AUWA 2XNDH 1L0NJ 4PV1C 1VQ5P 1JMBA 1DD4A 3W68A 1DH3A 2FXOA 3H1KD 2IEFA 4PV1B 1OX3A 1S1CX 1P84H 2HR3A 3H1HG 1LX8A 4DCKA 1BE3E 1Y8AA 4WBAA
chains in the Genus database with same CATH topology
4J2NA 1YQ4C 2BOWA 1VF5B 2G3AA 3H25A 3EZ9A 4B0YA 2JMLA 3Q3DA 4U7JA 1KORA 4H0LC 3IAOA 1FDOA 3FGAD 3ABVC 3GF3A 5D8CA 1OW7A 3GK6A 1JBGA 2NZ2A 3RK3E 3D6ZA 1VL2A 4GDOA 1KTMA 1Q09A 2D2CC 5E01A 1S5LX 1VF5C 5KCBA 2MKVA 4XFJA 1Q06A 3GP4A 2YIUC 4H0LB 2E75D 3SFEC 3D70A 1RQUA 3LW5J 3O6QA 3EZ6A 2WQYC 1JB0J 3GPVA 2E74C 1ZMEC 2E76C 4Y28J 2H88C 1K05A 5I41B 4I7ZB 3AE9C 5KATA 2KVVA 1MKMA 2QSIA 1OW6A 2WSEJ 3AE5C 1KQGB 1PL5A 3B49A 2ZT9C 3GF7A 2H89C 1PV3A 3T97B 1BOWA 1DIPA 2IDBA 3E0HA 1EXIA 3Q5SA 3R8KA 1Q0AA 2FXPA 3AE7C 3AECC 4RKUJ 2BEQD 4KT0J 5KAWA 4LHFA 3RL0g 4A1MA 2WSCJ 3R4YA 2JP3A 2E75B 1AJYA 2QJYC 3AE3C 2QJKC 2ZHHA 4AYZB 3EWKA 2ZT9D 3GMAA 4AYZA 5KLIC 2P10A 2QIWA 1OW8A 1DD3A 1TU3F 2HVAA 1Q90D 1R8DA 3IN6A 3EZ7A 5KAUA 3QAOA 1NYHA 4H13C 3LURA 1Y6UA 4Z1MH 1PM6A 5KAVA 2WPVB 3Q5PA 2OQQA 1HJ0A 2E74D 2BEZF 2E74B 1RH6A 1Q08A 1WMKA 2E76B 2FYNC 3AEDC 3AEAC 3SFDC 3Q1MA 2DG6A 1HF9A 2VZ4A 1KMIZ 1GMJA 3AE4C 3AE2C 2QJPC 1VF5D 1EXJA 2FBWC 4WLWA 3AEFC 2O01J 3C8VA 4I7ZC 4YTPC 4DCZA 4YXDC 3AEBC 1PIXA 2ZHGA 3GLMA 1K04A 3HH0A 2OG0A 4WLSA 4OGQD 2ZT9B 1JYHA 4R4EA 1R8EA 4H44B 4TT3H 5GQQA 2WSFJ 3EZFA 2KCUA 1FDIA 3Q5RA 1KILE 2E76D 3G9RA 5L8RJ 2JO1A 1ZOYC 2D2CB 4OGQB 3B71A 5KAXA 1OMIA 2V7QJ 3R8JA 4R4LA 5KKZC 4PV1C 2E75C 2GOVA 3AE8C 1RQVA 3AEGC 5D90A 1U57A 1D5YA 3D6YA 1Q05A 4H44C 4R22B 1DD4A 2D2CD 3D71A 3Q2YA 1NGMB 1ZP0C 2G8YA 1ZRTE 1Y9BA 4H13D 4R4MA 4OGQC 3AE1C 4H13B 1YQ3C 2IEFA 4PV1B 1UIXA 2J5UA 1S1CX 2YMKA 4H0LD 1LX8A 4R24B 3EZ2A 4H44D 1IK7A 3AE6C 4IL6X 3UCSA 3S9OA 5I44A 2K9YA 4PV1D 3AEEC 1Q07A 5M1BA 1KQFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J2N A;  1R8D A;  2BOW A;  5KAU A;  3QAO A;  5KAT A;  5KAX A;  2HVA A;  3LUR A;  3R8J A;  4R4L A;  2JML A;  4B0Y A;  3Q3D A;  5KAV A;  2GOV A;  3IAO A;  3Q5P A;  2OQQ A;  5D90 A;  3B49 A;  1D5Y A;  5D8C A;  3D6Y A;  1Q05 A;  4R22 B;  3T97 B;  1Q08 A;  1JBG A;  3D71 A;  3Q2Y A;  1DIP A;  1BOW A;  3GK6 A;  3E0H A;  1EXI A;  3Q5S A;  3D6Z A;  3Q1M A;  1Q0A A;  2DG6 A;  1Q09 A;  2VZ4 A;  3R8K A;  4R4M A;  5E01 A;  1EXJ A;  4WLW A;  5KAW A;  4A1M A;  5KCB A;  1Q06 A;  3GP4 A;  2ZHG A;  2J5U A;  3D70 A;  3HH0 A;  2ZHH A;  4WLS A;  4AYZ B;  4R24 B;  1JYH A;  4R4E A;  1R8E A;  5GQQ A;  3GPV A;  4AYZ A;  2KCU A;  3UCS A;  5I44 A;  5I41 B;  3Q5R A;  1Q07 A;  3G9R A; 
#chains in the Genus database with same CATH topology
 1JCC A;  3BAT A;  2LR2 A;  3KDP B;  5APW A;  2JWA A;  1S9K D;  1JBG A;  3I5C A;  1VF5 C;  5AVR B;  3RL0 C;  1HBW A;  3HD7 D;  3I55 P;  5TJH A;  5H2F E;  4JYC A;  1ZME C;  2KSE A;  1W2E A;  1VPC A;  1P84 D;  4M3L A;  4ZKU A;  3HE5 B;  1CW5 A;  3USS A;  3B5N D;  1NHL A;  3PP5 A;  2FXM A;  3VP9 A;  2KS1 A;  2GUS A;  1GU4 A;  1M1K Q;  4WY4 A;  3R2P A;  2KS1 B;  3GMA A;  1RE4 A;  5DJU B;  1TU3 F;  2VRS A;  4H13 C;  1L0L E;  1LP1 A;  3V2N A;  1HJ0 A;  2BEZ F;  4WY4 C;  5AW3 B;  1FDM A;  2ZFC A;  1HF9 A;  1G2C B;  2ZYD A;  2AXT E;  3GW6 A;  3L72 E;  4DCZ A;  1PGQ A;  4WLS A;  5KLV D;  1M8O B;  3A7O A;  5KAI H;  1X0T A;  2K9J A;  1FDI A;  2W8Z A;  1NKN A;  2JO1 A;  4C46 A;  5C39 A;  4OGQ B;  2WZ7 A;  3G71 P;  3HD7 B;  4L76 A;  2QM8 A;  1JOC A;  2K9J B;  1YJW P;  4QMA A;  3VN0 A;  4GOD A;  1Y9B A;  2Y0D A;  1H0T A;  1N8R Q;  4IFD K;  2YO2 A;  3I56 P;  2ITA A;  4W7Y A;  1GW4 A;  2O01 N;  1N73 A;  1KOR A;  5H2F H;  1FU1 A;  4PD4 E;  3QWO C;  4YPC A;  1KIL B;  1R5S A;  4RJT A;  4U3F G;  1JCD A;  4BRY B;  3L70 D;  1NO4 A;  2YKQ A;  1URQ B;  2QVA A;  2P67 A;  3IF4 A;  4LGD E;  3W67 A;  1KB9 E;  1RE3 A;  2M0B A;  1NH4 A;  3H1L G;  3JCU H;  3TSI A;  1NTM G;  3LID A;  1KFM A;  2KLV A;  3R8K A;  3BAS A;  1L4A D;  2KSJ A;  1NTK J;  1L4A B;  1M1J B;  3R4Y A;  4D6T J;  1PP9 G;  2RH0 A;  2QIW A;  5AW2 B;  1FZC C;  1R8D A;  1NTM D;  2R5B A;  1FZC A;  1LWU C;  4Z1M H;  2A45 G;  3ZDM A;  1FZC B;  1GMJ A;  4I7Z C;  1WRG A;  3H1I E;  3HH0 A;  2WSF J;  3M9B A;  2E76 D;  2N1T B;  1S72 P;  1ZR4 A;  5KAX A;  2RMZ A;  3H1H J;  3F89 A;  3CCR P;  1J1E B;  2G8Y A;  2QE7 H;  5CCG C;  2OYI C;  5K5G B;  1LNQ A;  2ZJS E;  3BCC G;  4N78 E;  2FYN B;  3MTU E;  5I44 A;  4ASW A;  1J1D C;  5M1B A;  1LT1 A;  3H1K J;  2Y9Y A;  1N73 B;  4B0Y A;  4H0L C;  1NVO A;  1T6A A;  2LKM A;  1SQV G;  3OW2 O;  1S5L X;  3H1I G;  1PZQ A;  1GTW A;  4DT0 A;  1IFN A;  2IZ1 A;  2WPS A;  2WQY C;  4Y28 J;  3H1J J;  5I41 B;  1LTI C;  2R3C A;  1YBK A;  2KXP B;  2NRG A;  5KJ7 C;  4N6J A;  2H89 C;  4UB8 H;  1SQP D;  3HD7 A;  1KYO H;  2OYO A;  3E7K A;  3AEC C;  3TDK A;  2J58 A;  1EDJ A;  2ZHH A;  1KQL A;  1LT9 B;  2ZXE B;  2LXC B;  3B5N A;  3H1I D;  4OH8 B;  5KAV A;  1NTK E;  5AVS B;  1A02 F;  1BGY E;  1SQV D;  4DJG A;  2OTK E;  3AED C;  2IBZ I;  3OJA B;  1X22 A;  1U7J A;  3B5N C;  3AEB C;  4HKZ H;  4L75 A;  2HPC A;  4H44 B;  2B88 A;  3BCC D;  1USD A;  2KNC B;  3M0D C;  2OYH B;  5AW9 B;  1HWT C;  3L70 J;  3HE5 A;  1RF1 A;  3FXE A;  3HE4 A;  3H1I J;  1KB9 H;  3L74 E;  2BCC D;  1NTM J;  3SWF A;  1YIT P;  5CCG D;  4U3F D;  4GOF A;  3NFQ A;  3H1H D;  2KZJ A;  4Y99 C;  1SQX G;  1KQF B;  2BOW A;  3Q3D A;  5AVX B;  2FYU J;  1PPJ E;  3GHG C;  4WWI A;  1KTM A;  3HTK A;  1T2K C;  1URQ D;  1MFT A;  1QL2 A;  3MUD A;  1SQP J;  5TIS E;  3U59 A;  2A06 D;  2QSI A;  1HGZ A;  2QJY B;  2ZVO B;  3AE5 C;  1SQP E;  2N9Y B;  2R32 A;  3E0H A;  1FS0 E;  1LTG C;  3L37 A;  2OYH A;  1AJY A;  1BCC J;  2QRX A;  2R3S A;  3IN6 A;  3EZ7 A;  1NOH A;  4CPG A;  3TNU B;  5CCH D;  3Q5P A;  3OAK A;  3KZI H;  1IK9 A;  1LJ2 A;  3Q1M A;  2KZI A;  3AE2 C;  5KTB A;  1S5L H;  3RK3 C;  3FWN A;  2WIT A;  1QLE D;  2P7J A;  5CJ4 A;  2W90 A;  3A0B H;  3EFG A;  3R8J A;  3H1H E;  4H44 C;  3FX0 A;  1SQQ K;  3KPE A;  1BGY G;  1SQB G;  1EDK A;  1Q7Y Q;  3EZ2 A;  2AEM A;  1PGO A;  1YHQ P;  1S9K E;  4ZNC A;  3CLQ A;  4BWN A;  2Q9I A;  2KK7 A;  3CXH H;  2XKM A;  1KIL A;  1N7S A;  1KFN A;  3EQ2 A;  3HRN A;  5KAI E;  2YIU C;  1RQU A;  3H1K G;  4C7R A;  3TGU E;  2HLO A;  1K05 A;  3F5H A;  4I7Z B;  2CK3 H;  1HGV A;  2O3J A;  1SVF A;  2ZT9 C;  1BCC D;  2FKW B;  1XTC C;  1DIP A;  3G3Z A;  2YKP A;  2WSC J;  1X79 B;  3CWB G;  2QJK C;  1ZR2 A;  1FJK A;  1IFJ A;  1DD3 A;  1VQN P;  2HFE D;  1NAY A;  1BGY J;  1L0N K;  4U3F E;  5GTH E;  1KZU B;  2QJK B;  1L0N E;  4PD4 I;  4NPF X;  1OVR A;  1RF1 C;  2Y0C A;  2V7Q H;  1GD2 E;  1K04 A;  4WVZ A;  2XV5 A;  4R4E A;  3CC7 P;  1OVV A;  2J59 M;  2NPS C;  3G9R A;  1Q82 Q;  4D6T G;  3CME P;  5AW0 B;  1NTM E;  5APQ A;  4OGQ C;  3KZI E;  2OYI A;  3BRV B;  4JYB A;  2PFX A;  5APS A;  1J1E C;  5E79 E;  1VQM P;  1IFI A;  1JMM A;  4EYY Q;  3HUS C;  2XNX A;  2PGD A;  4O9B A;  3L35 A;  1P84 I;  1H8A A;  3V2P A;  1Q06 A;  3A0H H;  3WUU A;  3O6Q A;  3EZ6 A;  3CXH E;  1AQT A;  4EIJ A;  5AVW B;  3CX5 E;  5CBN A;  3BRT B;  1IFM A;  3L75 G;  5B66 H;  2GA1 A;  1NU1 K;  5APY A;  2IZ0 A;  2M3E A;  1SFC D;  1SFC C;  1NU1 D;  3HD7 C;  4N3Y B;  4XE5 B;  5KJ7 D;  1NTM K;  3SSU A;  1T3U A;  2WPV B;  4C7N B;  3IFM A;  1JY3 N;  3CCV P;  2Q1K A;  4MN4 C;  3AEA C;  2WMM A;  3SFD C;  1SP4 A;  3C8V A;  1VF5 D;  2FY8 A;  2YMY A;  4OGQ D;  1NU1 J;  5KAF E;  1PP9 J;  5GQQ A;  3SWK A;  1KIL E;  2OAR A;  3B71 A;  1JM0 A;  3RL0 B;  2YO3 A;  5KLV J;  1NKZ B;  1EZV I;  3AEG C;  2Q6Q A;  1IJD B;  2NPS A;  3G4S P;  2HYN A;  3VTP C;  1ZXG A;  2K1A A;  3AE6 C;  1E5W A;  1L4A C;  1K8A Q;  1M1J C;  2WPR A;  3M0A A;  5APU A;  4PJ0 E;  4D6T D;  1L4A A;  1M1J A;  1N86 A;  4PJ0 H;  1OW7 A;  1ZLL A;  2A45 I;  2XZR A;  1LTJ B;  3TGU J;  2MKV A;  2KUB A;  2B89 A;  3K5B A;  2WPQ A;  4XA4 A;  3VMX A;  4D6T E;  3TYY A;  2KP8 A;  1PL5 A;  3B49 A;  1JY3 P;  3KQG A;  3O8Z A;  5GTI E;  3TGU G;  1LTJ A;  4LHF A;  1ZV8 A;  3MD0 A;  3L72 D;  2BCC G;  1CI6 A;  2ZT9 D;  2IBZ E;  3IR9 A;  5KLI C;  1BE3 D;  1QL1 A;  2FYU G;  1Q86 Q;  1GU5 A;  2OYI B;  5KAU A;  4C7N A;  1PM6 A;  1AFO A;  3P8C D;  4HB1 A;  2E76 B;  2N1T D;  2K37 A;  2KLU A;  1GK4 A;  1EXJ A;  4DZO A;  4DOJ A;  2AXC A;  1KQS O;  3P32 A;  5AW8 B;  2WVR A;  4R4L A;  5KKZ C;  2E75 C;  4KJM A;  1EQ7 A;  1RY3 A;  1PFI A;  1LT9 C;  1SQB E;  1EZV E;  3CX5 H;  4IL6 H;  2O1K A;  3H1J G;  2J5U A;  1QVF O;  3B4S A;  1SQB J;  4NPE A;  1PGP A;  1IZN B;  3JC2 2;  2GUV A;  4UB6 E;  4WY4 D;  1ZN5 A;  5AVT B;  1G2C A;  3LW5 H;  3RK3 E;  4EDF A;  5E01 A;  1DX7 A;  1LWU B;  2ZXX A;  3SFE C;  5KAF H;  3JCU E;  2E74 C;  3L73 J;  3CMA P;  1T2K D;  1PP9 D;  5BVZ A;  2IYO A;  1KQG B;  1SQX E;  2N1T A;  1EXI A;  2I1K A;  2JJL A;  3E1R A;  1MV8 A;  1NTZ D;  1GW3 A;  3L72 J;  3L72 G;  4OWF A;  2IFM A;  1LTJ C;  3QAO A;  2PP6 A;  3C1L A;  2NPS B;  2FYN C;  3P8M C;  4HJG H;  3AE4 C;  4YTP C;  4WLW A;  2WSC H;  2O01 J;  3HE4 B;  1YI2 P;  2WWW A;  1YJ9 P;  1UII A;  3A0H E;  3EZF A;  2KCU A;  1OMI A;  2ZYG A;  3CWB J;  1RQV A;  3D6Y A;  3D71 A;  5KLV K;  2AXT H;  1H89 A;  1GL2 A;  1N73 C;  2IPP A;  3CCE P;  2OGU A;  1G1J A;  3L75 E;  1HVV A;  3HUS B;  1GL2 B;  2BAS A;  4I6M C;  2XDJ A;  2K9Y A;  3LIE A;  1Q07 A;  1NTZ G;  1BE3 J;  1SQB K;  1KB9 I;  3FGA D;  3ABV C;  4GDO A;  2D2C C;  3WU2 H;  4H0L B;  4PD4 H;  3D70 A;  3LW5 J;  4JF7 A;  3L74 G;  1K73 Q;  1H0T B;  1G1I A;  4EOT A;  5B5E E;  3MUD C;  3AE9 C;  2KVV A;  3CCQ P;  1LTA C;  4W80 A;  1BCC G;  1PV3 A;  5GTH H;  1W5C E;  1M90 Q;  2OYH C;  1Q0A A;  1RHZ B;  1KB9 D;  3WUV A;  3AE3 C;  2W27 A;  5CCH C;  1S5L E;  2L5G B;  3L71 D;  1NWQ A;  4N78 D;  1YTZ I;  2UWJ E;  2I8D A;  3O6Q B;  1FBM A;  1SFC A;  2E5Y A;  2M5A B;  1LTB C;  1Q08 A;  3VOP A;  2WTY A;  2IX7 C;  2VZ4 A;  1FC2 C;  2ZHG A;  2B9B A;  1JYH A;  1R8E A;  3RK3 D;  2K88 A;  3H32 B;  1Z56 A;  2M8R A;  3H6P A;  1NJI Q;  3B5N B;  5CMZ A;  3RL0 D;  2D2C D;  1NGM B;  3L73 D;  1KYO D;  2RN0 A;  1CZQ A;  3V4W A;  4H0L D;  2IBZ G;  2C0W A;  2Q7C A;  1JY2 P;  4H44 D;  2H8P D;  4IL6 X;  3UCS A;  1S2E A;  3CC4 P;  2Z4E A;  3FWL A;  1GZL A;  2A06 E;  1Y47 A;  3A5T A;  4I1L A;  5D8C A;  3WU2 E;  2NZ2 A;  3BCC E;  3A0B E;  1NTZ J;  3MGN A;  1AVY A;  1ZRT D;  1L0L K;  2Q3I A;  4NPD A;  3RBZ A;  2E76 C;  2CPS A;  1WT6 A;  3GF7 A;  2JEE A;  1NAF A;  2IDB A;  2Y9Z A;  1DEB A;  5KAW A;  3S1K A;  2QJY C;  1JY2 N;  1MUU A;  3CWB D;  1JNM A;  1EDL A;  1Q90 D;  2IYP A;  2QJP B;  4HH2 A;  2ZVN B;  1SQX K;  2YKO A;  2JDI H;  4IL6 E;  1URQ C;  3L73 G;  2PRR A;  2QJP C;  1KN7 A;  2A45 H;  1NTZ K;  3WMM 0;  2ZAE B;  1J2J B;  5L8R J;  1KYO E;  1FZG A;  4B86 A;  1KIL D;  2R44 A;  1LT9 A;  5D90 A;  5APT A;  2I1J A;  2YNY A;  3Q2Y A;  3CPW O;  4JPZ B;  3B8E B;  3AE1 C;  1AVO A;  5KKZ B;  2MJZ A;  2KI7 B;  3CC2 P;  2SPZ A;  1VQ7 P;  3P7K A;  1SQQ E;  4ZMD A;  1VF5 B;  3TK1 A;  1HUC A;  3GF3 A;  2AEJ A;  3C9I A;  1K9M Q;  1GDT A;  1W2B O;  1FJP A;  2P1J A;  1PPJ G;  4JQ0 D;  2FFD B;  1JY2 O;  2KOG A;  1VQ9 P;  2WT7 A;  3II6 A;  4IOI H;  3QH9 A;  1IC2 A;  1N7S C;  3BCC J;  2FFD C;  2W6B A;  1OW6 A;  2HOD B;  2O1J A;  4W7Z A;  4Y99 B;  3T97 B;  1D7M A;  3H1J D;  1J1D B;  2FXP A;  3V5B A;  1NTK G;  4RKU J;  5CCH A;  1AQ5 A;  1N7S B;  1SQV J;  1FZF A;  1JEK A;  4GIF A;  1OW8 A;  1M7L A;  1OIP A;  1VQ4 P;  4UB8 E;  1Y6U A;  4L74 A;  1KYO I;  2C9N Y;  1EDI A;  1SS1 A;  2E43 A;  3VMZ A;  4TLF A;  4GKG A;  2RKL A;  1E79 H;  2ZYA A;  3JSV C;  5APV A;  2BCC J;  1IFD A;  1ZOY C;  5APX A;  2HPC B;  3H1L D;  1BE3 G;  4K3A A;  1GL2 C;  2QG4 A;  3V2R A;  1RH5 B;  1ZP0 C;  3VMY A;  3M0D A;  5CHX A;  5GTI H;  1VQO P;  3PTZ A;  1VQ6 P;  1GL2 D;  4R24 B;  3CWB E;  1M57 D;  1KIL C;  3S9O A;  1BSH A;  4PV1 D;  4K35 A;  5CCG A;  3EZ9 A;  4A7P A;  1ZW0 A;  2W83 C;  1AA0 A;  1L0N G;  1KV4 A;  1CI6 B;  3L75 J;  3HUS A;  2FYU E;  1NTK K;  1SQQ J;  3H1K E;  5AW6 B;  2DW3 A;  1BDC A;  1MKM A;  4HYT B;  1IO4 A;  3NMD A;  4U3F J;  3Q5S A;  5AW5 B;  1IFP A;  1BCC E;  2JKV A;  2BEQ D;  2E75 B;  3ITK A;  4ASV A;  3L70 G;  3CCU P;  4AYZ A;  2HVA A;  2QM7 A;  2Z5H A;  1NTK D;  2YXQ B;  2HG5 D;  2YIU B;  4KHX A;  3V6I A;  1SQB D;  2E74 B;  1RH6 A;  1RF0 A;  2FYZ A;  3H1L J;  1LP1 B;  1LTS C;  2R5D A;  4TT3 H;  2B87 B;  3H1L E;  1U7M A;  3A3Y B;  1YTZ T;  1JTH B;  4LC1 A;  4WB4 A;  1U57 A;  5AW1 B;  1D5Y A;  4R22 B;  3MZW B;  3CXH I;  2C9L Y;  4H13 D;  1JTH A;  4IFF A;  1NU1 G;  1FOS F;  1YQ3 C;  2FYU K;  3GG2 A;  5B66 E;  3MIW A;  1SQQ G;  4GOE A;  1EC5 A;  5KLV G;  3L75 D;  3AEE C;  4J2N A;  1VDF A;  2FYU D;  2OTL P;  1BDD A;  5AVQ B;  3IAO A;  1LTT C;  2XU6 A;  3RGU A;  1VL2 A;  4OVN F;  1SQX J;  1P84 E;  5E79 H;  2H88 C;  3CXH D;  1OWA A;  3OA7 A;  2W6A A;  3RK3 B;  1SLQ A;  5KLI B;  3P8C E;  2QEX P;  1X8Y A;  3AE7 C;  4JBZ A;  1H88 A;  4AYZ B;  3EWK A;  3L74 D;  1HTL C;  1S3J A;  3H32 A;  5DJT B;  1NYH A;  3LUR A;  1KC8 Q;  3RBX A;  1NU1 E;  1LGH B;  1JO5 A;  3PRJ A;  2Q5U A;  4GT1 A;  1T3J A;  5B5E H;  3L4F A;  1FZE A;  5KLV E;  2M5A A;  3RK2 D;  2WT7 B;  2NPS D;  3GLM A;  1LWU A;  5AW7 B;  3U1A A;  2QA4 P;  2E42 A;  4BXL A;  4L73 A;  1M56 D;  1SFC B;  1S4X A;  3U1C A;  2Z5I A;  2WSS H;  3MP7 B;  3BVH A;  1IK7 A;  2IBZ D;  5AVY B;  3GHG B;  1DEE G;  3VYI A;  3GHG A;  2Y0E A;  3NXS A;  1OFC X;  3G6E P;  1YIJ P;  1Q81 Q;  3GP4 A;  2Q3E A;  3V2Q A;  1QX8 A;  1FE6 A;  1JB0 J;  3PHL A;  5TIS H;  2LXB A;  1RF1 B;  1SQQ D;  1OZH A;  2OTJ P;  1PPJ D;  1A02 J;  1L0L J;  5KJ7 A;  2N1T C;  4KT0 J;  4A1M A;  1MFZ A;  1HJB A;  4AQR D;  1EZV G;  1MZ9 A;  3VMA A;  3L71 G;  5BU8 B;  2P10 A;  3N7N A;  1AV1 A;  1OXZ A;  4LLH A;  3M9Q A;  1QGK B;  1CSB A;  3HTK B;  1SQP K;  1YJN P;  4I2L C;  1OVU A;  2DG6 A;  1GK6 A;  1KMI Z;  2IFN A;  2JWD A;  1PIX A;  2P58 A;  3TGU D;  1SQX D;  1T8Z A;  2GM4 A;  3Q5R A;  3V4Q A;  2D2C B;  1PP9 E;  2V7Q J;  1QEX A;  2M3B A;  1PGJ A;  3AE8 C;  3RK2 B;  1FZB A;  1Q05 A;  3FXD A;  1ZRT E;  4R4M A;  4UB6 H;  1UIX A;  3RK2 C;  4ZKP A;  3N4X A;  1SQV K;  1NTZ E;  1VQL P;  3CCJ P;  3CCL P;  2G3A A;  3L74 J;  2JML A;  1FDO A;  2KB7 P;  3GK6 A;  3T97 A;  2V4H A;  4IFM A;  1KD1 Q;  5KCB A;  3KXD A;  2KYV A;  1XTG B;  3S4R A;  3CX5 D;  1L0N D;  4YXW H;  4AYC A;  2WSE J;  2YXR B;  4RO0 A;  5BU5 A;  1SQP G;  3CD6 P;  3CCS P;  3RL0 g;  2W6J H;  4RES B;  5CBO A;  2C0X A;  2P2U A;  2H43 A;  3L36 A;  2E74 D;  1RE4 C;  1BGY D;  1BSN A;  1RF0 C;  1EZV D;  5AVV B;  5AW4 B;  1N7S D;  1VQP P;  3CI9 A;  4BRY A;  2H7H A;  3EFF K;  3CL3 D;  2B87 A;  5EFW B;  1L2P A;  3KYQ A;  2N9B A;  3KHU A;  3SWY A;  2KIK A;  1JUN A;  2GOV A;  2KNC A;  2E5T A;  2WSF H;  1L0L G;  1N7L A;  4H13 B;  1YYC A;  2O01 H;  2YMK A;  3TF5 A;  3M91 A;  2HOD A;  3PH0 A;  1FAV A;  1YQ4 C;  3H25 A;  1L0L D;  2PAJ A;  4U7J A;  3CX5 I;  3H1J E;  3VP8 A;  2K3R A;  3MHV A;  3D6Z A;  1Q09 A;  5AVU B;  2FFD A;  4XFJ A;  2E75 D;  3M06 A;  3GPV A;  1USE A;  1VQK P;  1FOS E;  1SQV E;  5KAT A;  3L73 E;  3M9H A;  1Q2N A;  4EI2 A;  3PJS K;  3CCM P;  1BOW A;  5CJ0 A;  1RE3 C;  1X9V A;  2JP3 A;  5AVZ B;  1R5L A;  4WY4 B;  4PD4 D;  3PLN A;  1QVG O;  2AEF A;  3NTN A;  1JY3 O;  3L71 J;  1N2D C;  1HH0 A;  2OQQ A;  2BCC E;  1FZA A;  2A06 G;  1WMK A;  3L71 E;  3TNU A;  3L70 E;  2CPB A;  3A2A A;  3UIA A;  2FBW C;  3AEF C;  4YXD C;  1URQ A;  1VQ8 P;  2L91 A;  2JR8 A;  2POH A;  2OG0 A;  2ZT9 B;  3WUT A;  2WSE H;  3E1I A;  4AUW A;  2XND H;  1L0N J;  4PV1 C;  1VQ5 P;  1JMB A;  1DD4 A;  3W68 A;  1DH3 A;  2FXO A;  3H1K D;  2IEF A;  4PV1 B;  1OX3 A;  1S1C X;  1P84 H;  2HR3 A;  3H1H G;  1LX8 A;  4DCK A;  1BE3 E;  1Y8A A;  4WBA A; 
#chains in the Genus database with same CATH homology
 4J2N A;  1YQ4 C;  2BOW A;  1VF5 B;  2G3A A;  3H25 A;  3EZ9 A;  4B0Y A;  2JML A;  3Q3D A;  4U7J A;  1KOR A;  4H0L C;  3IAO A;  1FDO A;  3FGA D;  3ABV C;  3GF3 A;  5D8C A;  1OW7 A;  3GK6 A;  1JBG A;  2NZ2 A;  3RK3 E;  3D6Z A;  1VL2 A;  4GDO A;  1KTM A;  1Q09 A;  2D2C C;  5E01 A;  1S5L X;  1VF5 C;  5KCB A;  2MKV A;  4XFJ A;  1Q06 A;  3GP4 A;  2YIU C;  4H0L B;  2E75 D;  3SFE C;  3D70 A;  1RQU A;  3LW5 J;  3O6Q A;  3EZ6 A;  2WQY C;  1JB0 J;  3GPV A;  2E74 C;  1ZME C;  2E76 C;  4Y28 J;  2H88 C;  1K05 A;  5I41 B;  4I7Z B;  3AE9 C;  5KAT A;  2KVV A;  1MKM A;  2QSI A;  1OW6 A;  2WSE J;  3AE5 C;  1KQG B;  1PL5 A;  3B49 A;  2ZT9 C;  3GF7 A;  2H89 C;  1PV3 A;  3T97 B;  1BOW A;  1DIP A;  2IDB A;  3E0H A;  1EXI A;  3Q5S A;  3R8K A;  1Q0A A;  2FXP A;  3AE7 C;  3AEC C;  4RKU J;  2BEQ D;  4KT0 J;  5KAW A;  4LHF A;  3RL0 g;  4A1M A;  2WSC J;  3R4Y A;  2JP3 A;  2E75 B;  1AJY A;  2QJY C;  3AE3 C;  2QJK C;  2ZHH A;  4AYZ B;  3EWK A;  2ZT9 D;  3GMA A;  4AYZ A;  5KLI C;  2P10 A;  2QIW A;  1OW8 A;  1DD3 A;  1TU3 F;  2HVA A;  1Q90 D;  1R8D A;  3IN6 A;  3EZ7 A;  5KAU A;  3QAO A;  1NYH A;  4H13 C;  3LUR A;  1Y6U A;  4Z1M H;  1PM6 A;  5KAV A;  2WPV B;  3Q5P A;  2OQQ A;  1HJ0 A;  2E74 D;  2BEZ F;  2E74 B;  1RH6 A;  1Q08 A;  1WMK A;  2E76 B;  2FYN C;  3AED C;  3AEA C;  3SFD C;  3Q1M A;  2DG6 A;  1HF9 A;  2VZ4 A;  1KMI Z;  1GMJ A;  3AE4 C;  3AE2 C;  2QJP C;  1VF5 D;  1EXJ A;  2FBW C;  4WLW A;  3AEF C;  2O01 J;  3C8V A;  4I7Z C;  4YTP C;  4DCZ A;  4YXD C;  3AEB C;  1PIX A;  2ZHG A;  3GLM A;  1K04 A;  3HH0 A;  2OG0 A;  4WLS A;  4OGQ D;  2ZT9 B;  1JYH A;  4R4E A;  1R8E A;  4H44 B;  4TT3 H;  5GQQ A;  2WSF J;  3EZF A;  2KCU A;  1FDI A;  3Q5R A;  1KIL E;  2E76 D;  3G9R A;  5L8R J;  2JO1 A;  1ZOY C;  2D2C B;  4OGQ B;  3B71 A;  5KAX A;  1OMI A;  2V7Q J;  3R8J A;  4R4L A;  5KKZ C;  4PV1 C;  2E75 C;  2GOV A;  3AE8 C;  1RQV A;  3AEG C;  5D90 A;  1U57 A;  1D5Y A;  3D6Y A;  1Q05 A;  4H44 C;  4R22 B;  1DD4 A;  2D2C D;  3D71 A;  3Q2Y A;  1NGM B;  1ZP0 C;  2G8Y A;  1ZRT E;  1Y9B A;  4H13 D;  4R4M A;  4OGQ C;  3AE1 C;  4H13 B;  1YQ3 C;  2IEF A;  4PV1 B;  1UIX A;  2J5U A;  1S1C X;  2YMK A;  4H0L D;  1LX8 A;  4R24 B;  3EZ2 A;  4H44 D;  1IK7 A;  3AE6 C;  4IL6 X;  3UCS A;  3S9O A;  5I44 A;  2K9Y A;  4PV1 D;  3AEE C;  1Q07 A;  5M1B A;  1KQF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...