3Q5XA

Structure of proteasome tether
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
193
structure length
193
Chain Sequence
ARQLPVGEQLPLSRLLQYSDKQQLFTILLQCVEKHPDLARDIRGILPAPSMDTCVETLRKLLINLNDSFPYGGDKRGDYAFNRIREKYMAVLHALNDMVPCYLPPYSTCFEKNITFLDAATNVVHELPEFHNPNHNVYKSQAYYELTGAWLVVLRQLEDRPVVPLLPLEELEEHNKTSQNRMEEALNYLKQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Proteasome Tether
rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
molecule keywords Protein cut8
total genus 62
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2010-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08559 Cut8 Cut8, nuclear proteasome tether protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3q5xA00
3Q5XA 3Q5WA
chains in the Genus database with same CATH superfamily
2LHNA 4ERRA 3AA1B 3BK9A 1KNPA 1SHZC 3C64A 3K3QC 2IIUA 5HEOA 3X1DA 5JDQA 5JDNA 1HX8A 5JR9B 3PUWF 4DV6T 3UFEA 4LF5T 4Z91A 3NZPA 4JV5T 3PUZF 3J9X1 5JRCA 3EABA 5F5WA 4AISA 3JC6D 3ZLIA 2DCFA 4X66T 3ABVA 3VR9A 4AQYT 2F4VT 5CA0E 2VURA 3ZCIA 4IIJE 3MA9A 3FZMB 2A2FX 3W15B 4F8HA 2MYSA 2LRLA 3FZFB 1BR0A 4LMLA 2JQKA 4ILUA 2XAFB 4PJNA 1SUMB 5FY0A 2H88A 2Q9QA 3PUXF 4X20E 2LJLA 4IDZA 3UUNA 4YJ2E 5IUXA 4AQGA 5AQMB 4QXBB 2D0TA 3Q5XA 4MFRA 5FL1A 5L3BB 3K3NA 3N9MA 4LF4T 3ZMUB 2DWKA 2E9XD 1XZYA 2UXNB 5AQOB 4CXWA 3AA6B 3OKQA 2P9BA 3AE9A 4MBQA 1WRDA 3GA8A 4WBNE 3VKHA 3I9YA 3UFGA 1UUSA 3H3MA 3FXEB 3K8PC 2XUEA 2Z6EA 1WR6A 4EZHA 2WP9A 3RGLA 3SWHA 2XTLA 1KEYA 4KX6A 1MIVA 2D0UA 4MLKA 4DV0T 5LG3A 2K5BB 2V6YA 2CXFA 3O1JA 4L0RA 4IDQA 4TN7B 3JCFA 5J2UE 3EVYA 3ZMSB 2LOPA 4P1NA 5FKYA 1OEDB 4AQFC 2CXDA 3WAJA 4KI0F 3NVOA 4U33A 3RC8A 3ZEFB 4GIWA 4HTEA 2YU2A 4IREA 3HKDE 4PFOA 2UXCT 3ZPOA 4U31A 5HWXA 2WSSV 2IW5B 2UXBT 4LMJA 3PUGA 2V5CA 2JRKA 1ZP0A 4V1Av 3SS1A 4BAYB 2VASA 1OEDE 1T98A 2WDRA 4LFAT 2K9AA 4OK0A 5CJ5A 2HPJA 3ZJ2A 3RRCA 2PFVA 3T1HT 3P4RA 2Y48B 3ZYLA 1CUNA 3GMIA 4QX8B 4ZS3A 5DABA 2LEHA 3ZSTA 2A3DA 2VQFT 3CX8B 1JNZA 2V8SV 4X1YE 2Q9QB 3AE5A 3KVAA 3LG7A 3HKCE 4UVCB 5LGNB 4H63H 4L9IA 4X62T 4ILCA 3A8YC 2V7MA 3AE6A 5AQRB 4AIUA 3RQUA 3NBXX 4H63V 4ZZBA 3O4XE 5IWAT 1KNRA 2I0MA 4HWHA 1E2AA 3TLUA 3ZMZB 2JQHA 4WW0A 1HFAA 1YKHB 2X9YA 3QB5K 2UUBT 2ZM8A 3CQCB 2MPKA 3Q2MA 4B3TT 2XQ7A 5LBMA 3ZKRA 2KWIB 2YN6A 1IBMT 4AKHA 4J2CA 1UGOA 4DO0A 1FMWA 2XQ5A 1U4QA 2XJ7A 3P50A 1US7B 3ZYKA 5AQQB 4B3MT 5FY1A 3CPZA 5KX5E 4AKGA 2IC6A 3OYXA 3CK6A 3HI2A 4FJOA 4OHFA 5CB4E 4DV5T 2X0HA 5JR9A 2VKJA 3N2KE 3VRAA 1B7TA 2WWUA 4EEDA 4PJMA 5ABEA 1N32T 3AB3B 3OJAA 3CWZB 1QUUA 2HN2A 4AKRB 1T7SA 4DR7T 4G63A 1IZNB 2OV9A 3CQGB 3OPCA 2V7LA 3H3AA 3L09A 3P7IA 3Q9DA 3ESLA 2MAWA 4KHZF 4L5GA 2YDRA 4U3CA 4WBOA 2WQYA 2MTQA 4C91A 3QUJA 2WM9A 3AEEA 2XQ8A 2W63A 4PNIA 1W9RA 3O1HA 4JLEA 3UQ4A 1FEWA 3TLVA 1JNRA 3JC6C 4EIWA 2X68A 4CI1B 1AJ3A 2NWBA 4QH5A 4EAHA 3S4UA 2XQ3A 5DQVA 3OYZA 4K0KT 5AQTB 1J5ET 4U2ZA 4YSZA 2BKPA 2LLYA 4YHHT 3AEFA 2WAUA 3N9PA 4YT0A 3N5LA 3L3PA 2NR4A 4HFCA 4U2YA 2WB5A 1WR0A 3T8OA 4JI4T 3ZJ1A 1UX4A 4ZHQE 1HNWT 4HKAA 4IL4A 2BG9B 3P4WA 2XAQB 5KXJA 4TNWA 2DWGA 2LM9A 3MJXA 4ISSA 5FVKA 2I59A 3UU3A 2LSGA 3AEBA 2XQ6A 5JQGE 3CVRA 1FIOA 4DR5T 2W62A 1OEDC 2CE7A 1SA0E 3C98B 2X66A 2ES0A 3AAAB 1UCUA 1IJ5A 4P0AA 2KINB 2A9UA 3UUMA 2E9XC 4NPPA 2YKSA 3EHZA 3NZQA 5AQJB 5J0ZA 2XHEB 3PUVF 2UUCT 2VWAA 2K3WA 2ZM2A 3VHLA 3M65A 3VR8A 1E1HB 2XY8B 3ZC1A 5HXHA 4JI8T 2Y8DA 5ETWA 4P09A 3UU5A 1E7PA 4Q25A 4QX7B 2C5JA 4TUYE 5J1GA 2IHR1 1VRBA 3CIRA 3CQXC 1T72A 3BQIA 1WFDA 2YK0A 2E2AA 3E0ZA 3I1AA 4G2AA 4WYVA 1W0AA 2BS2A 2ODVA 5GONE 3TLTA 3UUXB 5ABGA 4JI5T 1XDOA 2XAJB 3MK7C 5JDLA 1M7KA 2G0UA 1J1JA 3LK42 3PV0F 1D0XA 1Y64B 2Q9QC 2V26A 4I4TE 4QKNA 3OBVE 3UU4A 5HEGA 1IJ6A 2K24A 5EK4A 4ASKA 3C4XA 5HEJA 2VKDA 4IHJE 3PUYF 4YLHA 1IBKT 1N33T 3GN5A 2E8IA 2ACZA 2WMOA 3BQKA 3FXDB 3IA3A 5L3CB 2LOSA 5DJQC 1QLBA 3H37A 1GQEA 1OXZA 2LT3A 3GWHA 3L8RA 4TV9E 4DR3T 4ANJA 5BR8T 5LNKA 3KV5A 2XSBA 4JI7T 5L2LA 3N2OA 2XQAA 4H9OC 4GK0E 2WU5A 3LK3B 2WZIA 5LBQB 3AA7B 5HXSA 4CN6A 2DI4A 3ONXA 2BKNA 2X0LB 3QC9A 2H3RA 4TWFA 3TLWA 3ZMVB 4CN4A 2LM2A 4EOZB 4QHOA 2QGSA 5JDHA 1XMOT 3JAFA 3ETVA 3SOLA 2C5KT 1YQ4A 4I43B 3HA4A 2WS3A 1N34T 1NWMX 2EHOC 5L4EA 3UTKA 5AQUB 1L0VA 1UK5A 2CEAA 4AQFA 1MMNA 5LG4A 2UU9T 3DJBA 2V5DA 1U5PA 1MIYA 4CXXA 4UV8B 4JI1T 3KV9A 1H7CA 3AAIA 3RIAA 4O8SA 4UXNB 1BR4A 4ILBA 2XQ9A 2LSYA 3ANWB 2ZMAA 2XAHB 4PJLA 3RYIE 2MOZA 4CI2B 4LMKA 2R6GF 3RRWA 1IAPA 3PU3A 4AKLA 2NOXA 2XZEA 3JAEA 2HHHT 3AXJB 2VVSA 4C90A 2IC9A 4EYYR 2B1EA 4IE4A 1YQ3A 2K48A 5AQIB 3AECA 1FJGT 5A1LA 1LVFA 1MNEA 1HF8A 2W0GA 5HWYA 4OYKA 4E7ZA 2FBWA 4DBRA 1ZHCA 1T8BA 3EDUA 5L3FB 2CLYC 1YXRA 4ZXLA 5JH7E 4LF7T 3ONLC 3NRXA 4BA9A 1V9DA 2IDOB 2WMNA 5LMUT 4Z8XA 3FZKB 4HE8A 3C4ZA 3M3ZB 4OFZA 4A98A 5FMNA 5AQFB 4B3ST 3AE7A 2YEVC 3D0TA 2M6BA 3LJCA 3RPUA 3RHWA 4YJ3E 2KNDA 2LSJA 4UELA 3RI5A 1N36T 2BG9A 2YINA 3BQLA 3C50A 3KINB 3PUAA 3QK6A 4UV9B 3ZT7A 2W67A 4UF0B 1WYCA 3F31A 2EHOD 2EHOA 3P4PA 5AQNB 3RF1A 4YY3T 2KSRA 2KXPB 4HWCA 4DV2T 2KMFA 1HNZT 1YD8G 3PUSA 4BJMA 3RC3A 3IBPA 5L3DB 1I6ZA 1ZKEA 5JREA 4IDNA 5HXRA 4I55E 4EYUA 4YSYA 1SE7A 5LJNA 4JYAT 4M1PA 5HYAA 1YKEB 2XQYA 2X9XA 2ACXA 3UU8A 4GK5E 3FBLA 5EZYE 4TZ4C 4H9NC 5ABFA 1WLXA 3AE3A 3AE1A 4FI5A 3ZMTB 5LGTB 5HXEA 4F6RC 2IMLA 4AKIA 3HKBE 1VOMA 3AXJA 4QXCB 2WBLA 5JVDE 2KZ7B 2HPLA 2J62A 4LF9T 2BBHA 1D1AA 2CBIA 3CKDA 4IE0A 2RPAA 2AE9A 2XQ4A 2Q9QD 3NKZA 2V7JA 5FY7A 5C8YE 5C2TA 4X65T 4DR4T 4TNVA 2L8KA 3O9XA 2BS3A 3CMLA 4HWDA 2YDQA 5AQKB 3GN5B 4HGAA 2AXDS 5FL0A 3SFEA 5LYJE 2X9WA 3N9OA 4EV6A 4DV3T 2BS4A 2JMKA 5AQPB 1KF6A 2NW9A 3RKOA 2C0SA 4WNKA 3RQWA 1HCIA 3MXZA 2N1GA 3Q5DA 3QNUA 4ZI2D 3B57A 4WZXA 1WYBA 4IDOA 4X5TA 3UQ7A 2N9DA 2PBIA 5FXZA 3VRBA 4CN1A 4E7SA 3RH3A 4H9SE 3HR0A 3OVUA 4KP3C 4ZI3D 2ZM0A 3AA0B 3DTOA 2HN1A 4ZOLE 2EHOB 2WWVA 5LXTE 1Z0PA 4UR9A 4ZEYA 4O4JE 3DP7A 3HKEE 4HEAA 4YTNA 2HH7A 4JI0T 2CA5A 2DNXA 2H89A 2E5VA 3JADA 4HFDA 4A97A 2LE8A 2W00A 1KNZA 1LKXA 1FMVA 2BG9E 2JJ9A 4KUMB 1EZ3A 4PK5A 5AQSB 4YXDA 2W4XA 3ANWA 3AVSA 3I0OA 5L3GB 2BG9C 2WDQA 4NUUA 5FXVA 4XBFB 4O2AE 4A5XA 2ZM6T 1KFYA 1R8IA 4NIQA 4KBMB 5ABFB 4PFPA 4CXYA 5HCMA 4JEUB 4DUYT 2VK9A 4DV1T 2BVLA 4GOUA 5FNVE 5F3JA 2V6XA 3G06A 3PJAA 2QVAA 4ILAA 2CM0A 4EEBA 2LKGA 2V7KA 4GKJT 2V7IA 1I94T 4JBWF 2DHRA 2WDVA 2GK9A 4B6XA 2VKOA 2C5IT 4COFA 3FHNA 4DV4T 2CCQA 4EXTA 3MZKB 3RIUA 2VKHA 2QYWA 2JQQA 3E22E 1VCSA 4PAGA 4Z90A 1MMDA 5FVLA 3L39A 2MBGA 2E5LT 1M62A 3E08A 1MMAA 3V5UA 4CZZB 3WAKA 2CXLA 4JI3T 4AI6A 4IE7A 4U74A 4UIGA 3EUHA 3RYFE 2WU2A 3B13A 3P8CD 3RKGA 1MNDA 4DV7T 5LP6E 2X51A 2V1DB 4O4HE 1UURA 4H9QC 4DMVA 3PE0A 2L3LA 2OLTA 3P4SA 3AEAA 2PG8A 3B5MA 3QB5A 4UF0A 3VU7H 1MMGA 2D9DA 4GYSA 2W66A 4YHJA 1W0BA 5HEUA 3PU8A 2CHNA 5AQGB 4IGUA 4HFVA 2VL0A 5LMNT 1ZOYA 4PK4A 4CI3B 2BKOA 4I50E 3IF8B 5F8PA 1UX5A 3LBXB 3R6NA 1HX1B 2QRXA 2FJAA 4JEHB 3RYHE 2VQET 5BMVE 5HAXA 2DLRA 4OX9T 3MACA 5L3EB 3C4WA 3PURA 4EGWA 1BR1A 4XAXB 3F57A 2SPCA 1D1CA 5AFUL 1DU2A 5CFBA 4JUYA 4A56A 4U7IA 1NENA 1HTJF 3PTRB 5JR9C 5FP3A 4X64T 3FB2A 3QOFA 4LF8T 4DBQA 3EAMA 2BZBA 4YTPA 4O4IE 3KV6A 3RYCE 1G73A 1D1BA 4ZI2C 4PK6A 3IEEA 3N9LA 3RIFA 3N9QA 2BDEA 3FBZA 3KV4A 2LSIA 5FXWA 3U78A 4EB6E 1KK7A 2NTYA 3ZYMA 1NEKA 4IE6A 5HCJA 4IDPA 2J1DG 4EZ4A 3A5XA 5ADXL 2UUAT 1J5WA 5C3JA 5TAOA 2UXDT 2D5UA 2KLQA 4QWNB 2A72A 3CX7B 4PJJA 2W2UA 3PJAJ 3ETUA 2KT9A 2XAGB 2L9QA 2RA1A 2VVNA 4U72A 5HEHA 5H6RB 3RLFF 3UT5E 4I0UA 5LHGB 4DR1T 3AE4A 4NUVA 2E9XA 5DQWA 3AE8A 4IT4A 3I0QA 5LJMA 4DR2T 2B76A 2NTXA 1O3XA 3P4QA 5AQHB 5H6QB 3LFMA 3CX6B 4UVBB 4HFHA 1MIWA 1CHUA 2YDSA 3RX6A 4KHPT 1X9BA 2W61A 5JDMA 5J2TE 3KFWX 3Q5EA 3EDVA 3J7Yq 5IHYA 5CGMA 2H7VC 3LBXA 2WY2A 3MKDA 5KMGP 3KBUA 4IE5A 2FUPA 3ZT5A 1HNXT 2QA7A 2OA5A 3N2GE 2DL1A 2IUBA 1YW0A 1WCRA 2KWHA 5LHHB 1HS7A 2LHRA 4QH4A 2J47A 3SFDA 3UUBA 3KDSE 3ZSSA 5FXXA 5L4HA 4HFIA 3Q5WA 2FJEA 2JQ9A 3WI3A 4U7YA 2UXXB 4H9PC 3AAEB 1S35A 4H9RC 2Y6XA 2XM1A 3V5SA 4ZS2A 4YTMA 5E0OA 2VB6A 4JI6T 3A7MA 2CWOA 3FZLB 3AE2A 3R84B 3UULA 3PDYA 4HWFA 1XMQT 3VKGA 5EK3A 2VL8A 3N9NA 4HFBA 2CPTA 3KBTA 2BVMA 3C51A 3AEDA 3LK2B 1HG5A 4K0UA 4ISTA 4TWHA 4UEMA 5IYZE 5M4YA 4DR6T 2CWYA 4ZI3C 3LDQB 2N2NA 4QXHB 5ABHA 3OTOT 2JIWA 3O1IA 2WZHA 4XZCA 4QH1A 3T1YT 4DMWA 4KMCA 4HN9A 2X0YA 3ZC0A 4ZZCA 4TWDA 2PJQA 5FYMA 1NAFA 4YFSA 5JTGA 3K3OA 5KDMC 1XDPA 2V6YB 1X79A 2J4GA 3FZHB 5AQVB 3AEGA 5HXCA 5LOVE 3UU6A 2E9XB 2JPFA 2X67A 1XNQT 3PUQA 1IBLT 1HG2A 4MALA 1LVKA 5JDFA 3HL6A 1W09A 2NW7A 4OYJA 3TLSA 4X1IE 2YU1A 2M67A 3ZN1B 2XASB 5JRCB 5L47A 5LHIB 4GYRA 3K1SA 2BBJA 4LF6T 2LSKA 4LFCT 4DUZT 2XPKA 3KVBA 3ZT6A 1HR0T 5AQLB 3I9WA 4GKKT 2XSAA 3ZN0B 1VCTA 1S94A 4NXNT 4JI2T 2I6HA 1D0YA 3EI0A 4O4LE 2ODUA 4X1KE 4ADZA 1OWAA 2LRKA 1D0ZA 1Y01A 2CBJA 4P0BA 2M6IA 2WCAA 3RIUC 4DIDB 1XNRT 1BR2A 1XWMA 4NXMT 1QSDA 3F2EA 2CLYB 5LB7B 2FJBA 4CQIA 4UVAB 2NP9A 4DNDA 4LFBT 2RP4A 4PW8A 3ONJA 4IL9A 4DVDA 5EK2A 2D2SA 3AVRA 4ZI7E 4B3RT 2FJDA 2CMRA 1ZV4X 3NRYA 3ZCJA 3SRZA 1LRZA 2CHOA 2H7OA 4N78D 4BJNA 5JDGA 2JMHA 3LSVA 3U3IA 5LCYA 2ZLYA 2NW8A 4AXPA 4HFEA 2YOEA 2LKHA 2PTFA 5CA1E 4MHCA 1Z8UA 2CRBA 3IHRA 5LA6E 3NWIA 4YSXA 1ZEEA 4HWIB 3TKLB 1G8XA 2XM2A 2X9HA 1OEDA 4O2BE 5LGUB 4TX5A 2IAKA 4TV8E
chains in the Genus database with same CATH topology
2LHNA 4ERRA 3AA1B 3BK9A 5JDQA 1SHZC 3C64A 3K3QC 5JDNA 5JR9B 1HX8A 3UFEA 3NZPA 5JRCA 3J9X1 3JC6D 3ZLIA 2DCFA 5CA0E 3ZCIA 4IIJE 3MA9A 2A2FX 3W15B 1BR0A 2MYSA 4ILUA 2XAFB 4PJNA 5FY0A 2Q9QA 4X20E 2LJLA 4IDZA 3UUNA 4YJ2E 4AQGA 4QXBB 2D0TA 3Q5XA 4MFRA 5L3BB 3K3NA 3N9MA 3ZMUB 2DWKA 2E9XD 2UXNB 4CXWA 3AA6B 3OKQA 2P9BA 4WBNE 4MBQA 1WRDA 3GA8A 3VKHA 3I9YA 3FXEB 3K8PC 2XUEA 2Z6EA 1WR6A 4EZHA 3SWHA 2XTLA 1MIVA 2D0UA 4MLKA 2K5BB 2CXFA 3O1JA 4L0RA 4TN7B 5J2UE 3EVYA 3ZMSB 2LOPA 4AQFC 3WAJA 2CXDA 3RC8A 3ZEFB 4HTEA 2YU2A 3HKDE 4PFOA 3ZPOA 5HWXA 2WSSV 2IW5B 3PUGA 2JRKA 4V1Av 3SS1A 4BAYB 2VASA 1T98A 2K9AA 4OK0A 2HPJA 3ZJ2A 3RRCA 2PFVA 2Y48B 3ZYLA 1CUNA 3GMIA 4QX8B 4ZS3A 5DABA 2LEHA 2A3DA 3CX8B 4X1YE 2Q9QB 3KVAA 3LG7A 4UVCB 3HKCE 5LGNB 4H63H 4L9IA 2V7MA 3NBXX 4H63V 3O4XE 3ZMZB 4WW0A 1HFAA 1YKHB 2X9YA 2ZM8A 3CQCB 3Q2MA 5LBMA 2KWIB 4AKHA 4J2CA 4DO0A 1FMWA 1U4QA 1US7B 3ZYKA 5FY1A 3CPZA 5KX5E 4AKGA 2IC6A 3OYXA 4FJOA 3HI2A 5CB4E 4OHFA 5JR9A 2VKJA 3N2KE 1B7TA 2WWUA 4PJMA 3AB3B 3OJAA 3CWZB 1QUUA 4AKRB 4G63A 1IZNB 3CQGB 3Q9DA 4QX7B 2V7LA 3H3AA 3L09A 3P7IA 4L5GA 3ESLA 4WBOA 2MTQA 4C91A 3QUJA 2WM9A 4PNIA 2W63A 3O1HA 4JLEA 1FEWA 3JC6C 4EIWA 2X68A 4CI1B 1AJ3A 2NWBA 4EAHA 3S4UA 5DQVA 3OYZA 2WAUA 3N9PA 3ZC0A 3N5LA 3L3PA 3T8OA 3ZJ1A 1UX4A 4ZHQE 4HKAA 2XAQB 2DWGA 2LM9A 3MJXA 4ISSA 2I59A 2LSGA 5JQGE 3CVRA 1FIOA 2W62A 2CE7A 3C98B 1SA0E 3M65A 2X66A 2ES0A 3AAAB 1UCUA 1IJ5A 4P0AA 2KINB 3UUMA 2E9XC 3NZQA 2XHEB 2VWAA 2ZM2A 3VHLA 5HXHA 1E1HB 3ZC1A 2Y8DA 5ETWA 4P09A 5J1GA 2C5JA 4TUYE 4DBRA 4EOZB 1VRBA 4G2AA 3CQXC 3BQIA 3E0ZA 2YK0A 3I1AA 4GIWA 2ODVA 5GONE 3UUXB 2XAJB 3MK7C 5JDLA 2G0UA 3LK42 4QKNA 1D0XA 1Y64B 2Q9QC 2V26A 4I4TE 4ASKA 3OBVE 1IJ6A 2K24A 5EK4A 3C4XA 2VKDA 4IHJE 4YLHA 3GN5A 2E8IA 2WMOA 3BQKA 3FXDB 5L3CB 2LOSA 5DJQC 3H37A 1OXZA 2LT3A 3GWHA 4TV9E 4ANJA 5LNKA 3KV5A 5L2LA 3N2OA 4H9OC 4GK0E 3LK3B 5LBQB 3AA7B 5HXSA 2DI4A 3ONXA 2X0LB 3QC9A 2H3RA 3ZMVB 4QHOA 2QGSA 5JDHA 3ETVA 3SOLA 2C5KT 4I43B 3HA4A 1NWMX 2EHOC 3UTKA 4AQFA 5LG4A 2CEAA 1MMNA 3DJBA 1U5PA 1MIYA 4CXXA 4UV8B 3KV9A 1H7CA 3AAIA 4O8SA 4UXNB 1BR4A 3RYIE 3ANWB 2LSYA 4PJLA 2ZMAA 2XAHB 4CI2B 2MOZA 3RRWA 1IAPA 3PU3A 4AKLA 2NOXA 4C90A 2IC9A 4EYYR 2B1EA 4IE4A 2K48A 5A1LA 1LVFA 1MNEA 1HF8A 2W0GA 5HWYA 4OYKA 4E7ZA 1ZHCA 3EDUA 5L3FB 2CLYC 5JH7E 3NRXA 4BA9A 1V9DA 2WMNA 4Z8XA 4HE8A 3C4ZA 4OFZA 5FMNA 2YEVC 3D0TA 3LJCA 3RPUA 4YJ3E 2KNDA 2LSJA 4UELA 2YINA 3PUAA 3BQLA 3C50A 3KINB 3QK6A 4UV9B 4UF0B 1WYCA 3F31A 2EHOD 2EHOA 2KXPB 2KMFA 1YD8G 3PUSA 4BJMA 3RC3A 3IBPA 5L3DB 1ZKEA 5JREA 5HXRA 4EYUA 4I55E 5LJNA 4M1PA 5HYAA 1YKEB 2XQYA 2X9XA 2ACXA 4GK5E 3FBLA 5EZYE 4TZ4C 4H9NC 1WLXA 4FI5A 3ZMTB 5LGTB 5HXEA 4F6RC 4AKIA 3HKBE 1VOMA 4QXCB 2WBLA 5JVDE 2KZ7B 2HPLA 3CKDA 1D1AA 4IE0A 5C8YE 2Q9QD 2V7JA 5FY7A 2L8KA 3O9XA 3CMLA 3GN5B 4HGAA 5LYJE 2X9WA 3N9OA 2JMKA 3RKOA 2NW9A 2C0SA 4WNKA 1HCIA 3MXZA 2N1GA 4ZI2D 3B57A 1WYBA 2N9DA 2PBIA 5FXZA 4E7SA 3RH3A 4H9SE 3HR0A 4ZI3D 4KP3C 2ZM0A 3AA0B 3DTOA 4ZOLE 2EHOB 5LXTE 1Z0PA 4O4JE 3DP7A 3HKEE 4HEAA 2HH7A 2CA5A 2DNXA 1KNZA 2LE8A 2W00A 1LKXA 1FMVA 2JJ9A 4KUMB 4PK5A 1EZ3A 3ANWA 3AVSA 3I0OA 5L3GB 4NUUA 5FXVA 4O2AE 4KBMB 4PFPA 4CXYA 4JEUB 2VK9A 2BVLA 4GOUA 5FNVE 5F3JA 2CM0A 2V7KA 2V7IA 2DHRA 2GK9A 4B6XA 2VKOA 2C5IT 3FHNA 2CCQA 4EXTA 3MZKB 2VKHA 3E22E 2JQQA 4PAGA 1MMDA 2MBGA 3E08A 1MMAA 3V5UA 4CZZB 3WAKA 2CXLA 4AI6A 4IE7A 4U74A 4UIGA 3EUHA 3RYFE 3B13A 3P8CD 1MNDA 5LP6E 2X51A 2V1DB 4O4HE 4H9QC 4DMVA 3PE0A 2L3LA 2PG8A 4UF0A 3VU7H 1MMGA 4GYSA 4YHJA 3PU8A 4IGUA 4HFVA 4PK4A 4CI3B 4I50E 5F8PA 3IF8B 3R6NA 1UX5A 3LBXB 3RYHE 4JEHB 5BMVE 5HAXA 2DLRA 3MACA 5L3EB 3C4WA 3PURA 1BR1A 4XAXB 3F57A 2SPCA 1D1CA 5AFUL 4JUYA 4A56A 5JR9C 1HTJF 3PTRB 5FP3A 3FB2A 4DBQA 2BZBA 4O4IE 3KV6A 3RYCE 1G73A 1D1BA 4ZI2C 4PK6A 3IEEA 3N9LA 3N9QA 2BDEA 3FBZA 3KV4A 2LSIA 5FXWA 3U78A 4EB6E 1KK7A 2NTYA 3ZYMA 4IE6A 2J1DG 4EZ4A 3A5XA 5ADXL 5TAOA 2D5UA 2KLQA 4QWNB 2A72A 3CX7B 4PJJA 3ETUA 2KT9A 2XAGB 2L9QA 2RA1A 4U72A 3UT5E 5H6RB 5LHGB 4NUVA 2E9XA 5DQWA 5LJMA 3I0QA 2NTXA 1O3XA 5H6QB 3LFMA 3CX6B 4UVBB 1MIWA 3RX6A 5JDMA 2W61A 5J2TE 3KFWX 3EDVA 3J7Yq 5IHYA 2H7VC 3LBXA 3MKDA 5KMGP 3KBUA 4IE5A 4XBFB 2QA7A 2OA5A 3N2GE 2KWHA 5LHHB 1YW0A 1HS7A 2LHRA 3KDSE 5FXXA 3Q5WA 3WI3A 2UXXB 4H9PC 3AAEB 1S35A 4H9RC 2Y6XA 3V5SA 4ZS2A 5E0OA 2VB6A 2CWOA 3R84B 3UULA 3VKGA 3PDYA 5EK3A 2VL8A 3N9NA 3KBTA 2BVMA 3C51A 3LK2B 1HG5A 4K0UA 4ISTA 4UEMA 5M4YA 5IYZE 2CWYA 4ZI3C 2N2NA 4QXHB 3O1IA 4XZCA 4DMWA 4KMCA 4HN9A 5FYMA 2PJQA 1NAFA 4YFSA 3K3OA 5KDMC 1X79A 5HXCA 5LOVE 2E9XB 2JPFA 2X67A 3PUQA 1HG2A 4MALA 1LVKA 5JDFA 3HL6A 4OYJA 2NW7A 4X1IE 2YU1A 2M67A 3ZN1B 2XASB 5JRCB 5LHIB 4GYRA 2LSKA 3KVBA 3I9WA 3ZN0B 1S94A 1D0YA 4ADZA 4O4LE 2ODUA 4X1KE 1OWAA 1D0ZA 4P0BA 1BR2A 1QSDA 3F2EA 2CLYB 4CQIA 4UVAB 2NP9A 4DNDA 2RP4A 4PW8A 4DVDA 5EK2A 2D2SA 3AVRA 4ZI7E 2CMRA 1ZV4X 3NRYA 3ZCJA 3SRZA 1LRZA 2H7OA 4N78D 4BJNA 5JDGA 2JMHA 3U3IA 5LCYA 2ZLYA 2NW8A 4AXPA 5CA1E 4MHCA 5LA6E 3IHRA 1ZEEA 3TKLB 1G8XA 2X9HA 4O2BE 5LGUB 4TX5A 2IAKA 4TV8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5X A;  3Q5W A; 
#chains in the Genus database with same CATH topology
 2LHN A;  4ERR A;  3AA1 B;  3BK9 A;  1KNP A;  1SHZ C;  3C64 A;  3K3Q C;  2IIU A;  5HEO A;  3X1D A;  5JDQ A;  5JDN A;  1HX8 A;  5JR9 B;  3PUW F;  4DV6 T;  3UFE A;  4LF5 T;  4Z91 A;  3NZP A;  4JV5 T;  3PUZ F;  3J9X 1;  5JRC A;  3EAB A;  5F5W A;  4AIS A;  3JC6 D;  3ZLI A;  2DCF A;  4X66 T;  3ABV A;  3VR9 A;  4AQY T;  2F4V T;  5CA0 E;  2VUR A;  3ZCI A;  4IIJ E;  3MA9 A;  3FZM B;  2A2F X;  3W15 B;  4F8H A;  2MYS A;  2LRL A;  3FZF B;  1BR0 A;  4LML A;  2JQK A;  4ILU A;  2XAF B;  4PJN A;  1SUM B;  5FY0 A;  2H88 A;  2Q9Q A;  3PUX F;  4X20 E;  2LJL A;  4IDZ A;  3UUN A;  4YJ2 E;  5IUX A;  4AQG A;  5AQM B;  4QXB B;  2D0T A;  3Q5X A;  4MFR A;  5FL1 A;  5L3B B;  3K3N A;  3N9M A;  4LF4 T;  3ZMU B;  2DWK A;  2E9X D;  1XZY A;  2UXN B;  5AQO B;  4CXW A;  3AA6 B;  3OKQ A;  2P9B A;  3AE9 A;  4MBQ A;  1WRD A;  3GA8 A;  4WBN E;  3VKH A;  3I9Y A;  3UFG A;  1UUS A;  3H3M A;  3FXE B;  3K8P C;  2XUE A;  2Z6E A;  1WR6 A;  4EZH A;  2WP9 A;  3RGL A;  3SWH A;  2XTL A;  1KEY A;  4KX6 A;  1MIV A;  2D0U A;  4MLK A;  4DV0 T;  5LG3 A;  2K5B B;  2V6Y A;  2CXF A;  3O1J A;  4L0R A;  4IDQ A;  4TN7 B;  3JCF A;  5J2U E;  3EVY A;  3ZMS B;  2LOP A;  4P1N A;  5FKY A;  1OED B;  4AQF C;  2CXD A;  3WAJ A;  4KI0 F;  3NVO A;  4U33 A;  3RC8 A;  3ZEF B;  4GIW A;  4HTE A;  2YU2 A;  4IRE A;  3HKD E;  4PFO A;  2UXC T;  3ZPO A;  4U31 A;  5HWX A;  2WSS V;  2IW5 B;  2UXB T;  4LMJ A;  3PUG A;  2V5C A;  2JRK A;  1ZP0 A;  4V1A v;  3SS1 A;  4BAY B;  2VAS A;  1OED E;  1T98 A;  2WDR A;  4LFA T;  2K9A A;  4OK0 A;  5CJ5 A;  2HPJ A;  3ZJ2 A;  3RRC A;  2PFV A;  3T1H T;  3P4R A;  2Y48 B;  3ZYL A;  1CUN A;  3GMI A;  4QX8 B;  4ZS3 A;  5DAB A;  2LEH A;  3ZST A;  2A3D A;  2VQF T;  3CX8 B;  1JNZ A;  2V8S V;  4X1Y E;  2Q9Q B;  3AE5 A;  3KVA A;  3LG7 A;  3HKC E;  4UVC B;  5LGN B;  4H63 H;  4L9I A;  4X62 T;  4ILC A;  3A8Y C;  2V7M A;  3AE6 A;  5AQR B;  4AIU A;  3RQU A;  3NBX X;  4H63 V;  4ZZB A;  3O4X E;  5IWA T;  1KNR A;  2I0M A;  4HWH A;  1E2A A;  3TLU A;  3ZMZ B;  2JQH A;  4WW0 A;  1HFA A;  1YKH B;  2X9Y A;  3QB5 K;  2UUB T;  2ZM8 A;  3CQC B;  2MPK A;  3Q2M A;  4B3T T;  2XQ7 A;  5LBM A;  3ZKR A;  2KWI B;  2YN6 A;  1IBM T;  4AKH A;  4J2C A;  1UGO A;  4DO0 A;  1FMW A;  2XQ5 A;  1U4Q A;  2XJ7 A;  3P50 A;  1US7 B;  3ZYK A;  5AQQ B;  4B3M T;  5FY1 A;  3CPZ A;  5KX5 E;  4AKG A;  2IC6 A;  3OYX A;  3CK6 A;  3HI2 A;  4FJO A;  4OHF A;  5CB4 E;  4DV5 T;  2X0H A;  5JR9 A;  2VKJ A;  3N2K E;  3VRA A;  1B7T A;  2WWU A;  4EED A;  4PJM A;  5ABE A;  1N32 T;  3AB3 B;  3OJA A;  3CWZ B;  1QUU A;  2HN2 A;  4AKR B;  1T7S A;  4DR7 T;  4G63 A;  1IZN B;  2OV9 A;  3CQG B;  3OPC A;  2V7L A;  3H3A A;  3L09 A;  3P7I A;  3Q9D A;  3ESL A;  2MAW A;  4KHZ F;  4L5G A;  2YDR A;  4U3C A;  4WBO A;  2WQY A;  2MTQ A;  4C91 A;  3QUJ A;  2WM9 A;  3AEE A;  2XQ8 A;  2W63 A;  4PNI A;  1W9R A;  3O1H A;  4JLE A;  3UQ4 A;  1FEW A;  3TLV A;  1JNR A;  3JC6 C;  4EIW A;  2X68 A;  4CI1 B;  1AJ3 A;  2NWB A;  4QH5 A;  4EAH A;  3S4U A;  2XQ3 A;  5DQV A;  3OYZ A;  4K0K T;  5AQT B;  1J5E T;  4U2Z A;  4YSZ A;  2BKP A;  2LLY A;  4YHH T;  3AEF A;  2WAU A;  3N9P A;  4YT0 A;  3N5L A;  3L3P A;  2NR4 A;  4HFC A;  4U2Y A;  2WB5 A;  1WR0 A;  3T8O A;  4JI4 T;  3ZJ1 A;  1UX4 A;  4ZHQ E;  1HNW T;  4HKA A;  4IL4 A;  2BG9 B;  3P4W A;  2XAQ B;  5KXJ A;  4TNW A;  2DWG A;  2LM9 A;  3MJX A;  4ISS A;  5FVK A;  2I59 A;  3UU3 A;  2LSG A;  3AEB A;  2XQ6 A;  5JQG E;  3CVR A;  1FIO A;  4DR5 T;  2W62 A;  1OED C;  2CE7 A;  1SA0 E;  3C98 B;  2X66 A;  2ES0 A;  3AAA B;  1UCU A;  1IJ5 A;  4P0A A;  2KIN B;  2A9U A;  3UUM A;  2E9X C;  4NPP A;  2YKS A;  3EHZ A;  3NZQ A;  5AQJ B;  5J0Z A;  2XHE B;  3PUV F;  2UUC T;  2VWA A;  2K3W A;  2ZM2 A;  3VHL A;  3M65 A;  3VR8 A;  1E1H B;  2XY8 B;  3ZC1 A;  5HXH A;  4JI8 T;  2Y8D A;  5ETW A;  4P09 A;  3UU5 A;  1E7P A;  4Q25 A;  4QX7 B;  2C5J A;  4TUY E;  5J1G A;  2IHR 1;  1VRB A;  3CIR A;  3CQX C;  1T72 A;  3BQI A;  1WFD A;  2YK0 A;  2E2A A;  3E0Z A;  3I1A A;  4G2A A;  4WYV A;  1W0A A;  2BS2 A;  2ODV A;  5GON E;  3TLT A;  3UUX B;  5ABG A;  4JI5 T;  1XDO A;  2XAJ B;  3MK7 C;  5JDL A;  1M7K A;  2G0U A;  1J1J A;  3LK4 2;  3PV0 F;  1D0X A;  1Y64 B;  2Q9Q C;  2V26 A;  4I4T E;  4QKN A;  3OBV E;  3UU4 A;  5HEG A;  1IJ6 A;  2K24 A;  5EK4 A;  4ASK A;  3C4X A;  5HEJ A;  2VKD A;  4IHJ E;  3PUY F;  4YLH A;  1IBK T;  1N33 T;  3GN5 A;  2E8I A;  2ACZ A;  2WMO A;  3BQK A;  3FXD B;  3IA3 A;  5L3C B;  2LOS A;  5DJQ C;  1QLB A;  3H37 A;  1GQE A;  1OXZ A;  2LT3 A;  3GWH A;  3L8R A;  4TV9 E;  4DR3 T;  4ANJ A;  5BR8 T;  5LNK A;  3KV5 A;  2XSB A;  4JI7 T;  5L2L A;  3N2O A;  2XQA A;  4H9O C;  4GK0 E;  2WU5 A;  3LK3 B;  2WZI A;  5LBQ B;  3AA7 B;  5HXS A;  4CN6 A;  2DI4 A;  3ONX A;  2BKN A;  2X0L B;  3QC9 A;  2H3R A;  4TWF A;  3TLW A;  3ZMV B;  4CN4 A;  2LM2 A;  4EOZ B;  4QHO A;  2QGS A;  5JDH A;  1XMO T;  3JAF A;  3ETV A;  3SOL A;  2C5K T;  1YQ4 A;  4I43 B;  3HA4 A;  2WS3 A;  1N34 T;  1NWM X;  2EHO C;  5L4E A;  3UTK A;  5AQU B;  1L0V A;  1UK5 A;  2CEA A;  4AQF A;  1MMN A;  5LG4 A;  2UU9 T;  3DJB A;  2V5D A;  1U5P A;  1MIY A;  4CXX A;  4UV8 B;  4JI1 T;  3KV9 A;  1H7C A;  3AAI A;  3RIA A;  4O8S A;  4UXN B;  1BR4 A;  4ILB A;  2XQ9 A;  2LSY A;  3ANW B;  2ZMA A;  2XAH B;  4PJL A;  3RYI E;  2MOZ A;  4CI2 B;  4LMK A;  2R6G F;  3RRW A;  1IAP A;  3PU3 A;  4AKL A;  2NOX A;  2XZE A;  3JAE A;  2HHH T;  3AXJ B;  2VVS A;  4C90 A;  2IC9 A;  4EYY R;  2B1E A;  4IE4 A;  1YQ3 A;  2K48 A;  5AQI B;  3AEC A;  1FJG T;  5A1L A;  1LVF A;  1MNE A;  1HF8 A;  2W0G A;  5HWY A;  4OYK A;  4E7Z A;  2FBW A;  4DBR A;  1ZHC A;  1T8B A;  3EDU A;  5L3F B;  2CLY C;  1YXR A;  4ZXL A;  5JH7 E;  4LF7 T;  3ONL C;  3NRX A;  4BA9 A;  1V9D A;  2IDO B;  2WMN A;  5LMU T;  4Z8X A;  3FZK B;  4HE8 A;  3C4Z A;  3M3Z B;  4OFZ A;  4A98 A;  5FMN A;  5AQF B;  4B3S T;  3AE7 A;  2YEV C;  3D0T A;  2M6B A;  3LJC A;  3RPU A;  3RHW A;  4YJ3 E;  2KND A;  2LSJ A;  4UEL A;  3RI5 A;  1N36 T;  2BG9 A;  2YIN A;  3BQL A;  3C50 A;  3KIN B;  3PUA A;  3QK6 A;  4UV9 B;  3ZT7 A;  2W67 A;  4UF0 B;  1WYC A;  3F31 A;  2EHO D;  2EHO A;  3P4P A;  5AQN B;  3RF1 A;  4YY3 T;  2KSR A;  2KXP B;  4HWC A;  4DV2 T;  2KMF A;  1HNZ T;  1YD8 G;  3PUS A;  4BJM A;  3RC3 A;  3IBP A;  5L3D B;  1I6Z A;  1ZKE A;  5JRE A;  4IDN A;  5HXR A;  4I55 E;  4EYU A;  4YSY A;  1SE7 A;  5LJN A;  4JYA T;  4M1P A;  5HYA A;  1YKE B;  2XQY A;  2X9X A;  2ACX A;  3UU8 A;  4GK5 E;  3FBL A;  5EZY E;  4TZ4 C;  4H9N C;  5ABF A;  1WLX A;  3AE3 A;  3AE1 A;  4FI5 A;  3ZMT B;  5LGT B;  5HXE A;  4F6R C;  2IML A;  4AKI A;  3HKB E;  1VOM A;  3AXJ A;  4QXC B;  2WBL A;  5JVD E;  2KZ7 B;  2HPL A;  2J62 A;  4LF9 T;  2BBH A;  1D1A A;  2CBI A;  3CKD A;  4IE0 A;  2RPA A;  2AE9 A;  2XQ4 A;  2Q9Q D;  3NKZ A;  2V7J A;  5FY7 A;  5C8Y E;  5C2T A;  4X65 T;  4DR4 T;  4TNV A;  2L8K A;  3O9X A;  2BS3 A;  3CML A;  4HWD A;  2YDQ A;  5AQK B;  3GN5 B;  4HGA A;  2AXD S;  5FL0 A;  3SFE A;  5LYJ E;  2X9W A;  3N9O A;  4EV6 A;  4DV3 T;  2BS4 A;  2JMK A;  5AQP B;  1KF6 A;  2NW9 A;  3RKO A;  2C0S A;  4WNK A;  3RQW A;  1HCI A;  3MXZ A;  2N1G A;  3Q5D A;  3QNU A;  4ZI2 D;  3B57 A;  4WZX A;  1WYB A;  4IDO A;  4X5T A;  3UQ7 A;  2N9D A;  2PBI A;  5FXZ A;  3VRB A;  4CN1 A;  4E7S A;  3RH3 A;  4H9S E;  3HR0 A;  3OVU A;  4KP3 C;  4ZI3 D;  2ZM0 A;  3AA0 B;  3DTO A;  2HN1 A;  4ZOL E;  2EHO B;  2WWV A;  5LXT E;  1Z0P A;  4UR9 A;  4ZEY A;  4O4J E;  3DP7 A;  3HKE E;  4HEA A;  4YTN A;  2HH7 A;  4JI0 T;  2CA5 A;  2DNX A;  2H89 A;  2E5V A;  3JAD A;  4HFD A;  4A97 A;  2LE8 A;  2W00 A;  1KNZ A;  1LKX A;  1FMV A;  2BG9 E;  2JJ9 A;  4KUM B;  1EZ3 A;  4PK5 A;  5AQS B;  4YXD A;  2W4X A;  3ANW A;  3AVS A;  3I0O A;  5L3G B;  2BG9 C;  2WDQ A;  4NUU A;  5FXV A;  4XBF B;  4O2A E;  4A5X A;  2ZM6 T;  1KFY A;  1R8I A;  4NIQ A;  4KBM B;  5ABF B;  4PFP A;  4CXY A;  5HCM A;  4JEU B;  4DUY T;  2VK9 A;  4DV1 T;  2BVL A;  4GOU A;  5FNV E;  5F3J A;  2V6X A;  3G06 A;  3PJA A;  2QVA A;  4ILA A;  2CM0 A;  4EEB A;  2LKG A;  2V7K A;  4GKJ T;  2V7I A;  1I94 T;  4JBW F;  2DHR A;  2WDV A;  2GK9 A;  4B6X A;  2VKO A;  2C5I T;  4COF A;  3FHN A;  4DV4 T;  2CCQ A;  4EXT A;  3MZK B;  3RIU A;  2VKH A;  2QYW A;  2JQQ A;  3E22 E;  1VCS A;  4PAG A;  4Z90 A;  1MMD A;  5FVL A;  3L39 A;  2MBG A;  2E5L T;  1M62 A;  3E08 A;  1MMA A;  3V5U A;  4CZZ B;  3WAK A;  2CXL A;  4JI3 T;  4AI6 A;  4IE7 A;  4U74 A;  4UIG A;  3EUH A;  3RYF E;  2WU2 A;  3B13 A;  3P8C D;  3RKG A;  1MND A;  4DV7 T;  5LP6 E;  2X51 A;  2V1D B;  4O4H E;  1UUR A;  4H9Q C;  4DMV A;  3PE0 A;  2L3L A;  2OLT A;  3P4S A;  3AEA A;  2PG8 A;  3B5M A;  3QB5 A;  4UF0 A;  3VU7 H;  1MMG A;  2D9D A;  4GYS A;  2W66 A;  4YHJ A;  1W0B A;  5HEU A;  3PU8 A;  2CHN A;  5AQG B;  4IGU A;  4HFV A;  2VL0 A;  5LMN T;  1ZOY A;  4PK4 A;  4CI3 B;  2BKO A;  4I50 E;  3IF8 B;  5F8P A;  1UX5 A;  3LBX B;  3R6N A;  1HX1 B;  2QRX A;  2FJA A;  4JEH B;  3RYH E;  2VQE T;  5BMV E;  5HAX A;  2DLR A;  4OX9 T;  3MAC A;  5L3E B;  3C4W A;  3PUR A;  4EGW A;  1BR1 A;  4XAX B;  3F57 A;  2SPC A;  1D1C A;  5AFU L;  1DU2 A;  5CFB A;  4JUY A;  4A56 A;  4U7I A;  1NEN A;  1HTJ F;  3PTR B;  5JR9 C;  5FP3 A;  4X64 T;  3FB2 A;  3QOF A;  4LF8 T;  4DBQ A;  3EAM A;  2BZB A;  4YTP A;  4O4I E;  3KV6 A;  3RYC E;  1G73 A;  1D1B A;  4ZI2 C;  4PK6 A;  3IEE A;  3N9L A;  3RIF A;  3N9Q A;  2BDE A;  3FBZ A;  3KV4 A;  2LSI A;  5FXW A;  3U78 A;  4EB6 E;  1KK7 A;  2NTY A;  3ZYM A;  1NEK A;  4IE6 A;  5HCJ A;  4IDP A;  2J1D G;  4EZ4 A;  3A5X A;  5ADX L;  2UUA T;  1J5W A;  5C3J A;  5TAO A;  2UXD T;  2D5U A;  2KLQ A;  4QWN B;  2A72 A;  3CX7 B;  4PJJ A;  2W2U A;  3PJA J;  3ETU A;  2KT9 A;  2XAG B;  2L9Q A;  2RA1 A;  2VVN A;  4U72 A;  5HEH A;  5H6R B;  3RLF F;  3UT5 E;  4I0U A;  5LHG B;  4DR1 T;  3AE4 A;  4NUV A;  2E9X A;  5DQW A;  3AE8 A;  4IT4 A;  3I0Q A;  5LJM A;  4DR2 T;  2B76 A;  2NTX A;  1O3X A;  3P4Q A;  5AQH B;  5H6Q B;  3LFM A;  3CX6 B;  4UVB B;  4HFH A;  1MIW A;  1CHU A;  2YDS A;  3RX6 A;  4KHP T;  1X9B A;  2W61 A;  5JDM A;  5J2T E;  3KFW X;  3Q5E A;  3EDV A;  3J7Y q;  5IHY A;  5CGM A;  2H7V C;  3LBX A;  2WY2 A;  3MKD A;  5KMG P;  3KBU A;  4IE5 A;  2FUP A;  3ZT5 A;  1HNX T;  2QA7 A;  2OA5 A;  3N2G E;  2DL1 A;  2IUB A;  1YW0 A;  1WCR A;  2KWH A;  5LHH B;  1HS7 A;  2LHR A;  4QH4 A;  2J47 A;  3SFD A;  3UUB A;  3KDS E;  3ZSS A;  5FXX A;  5L4H A;  4HFI A;  3Q5W A;  2FJE A;  2JQ9 A;  3WI3 A;  4U7Y A;  2UXX B;  4H9P C;  3AAE B;  1S35 A;  4H9R C;  2Y6X A;  2XM1 A;  3V5S A;  4ZS2 A;  4YTM A;  5E0O A;  2VB6 A;  4JI6 T;  3A7M A;  2CWO A;  3FZL B;  3AE2 A;  3R84 B;  3UUL A;  3PDY A;  4HWF A;  1XMQ T;  3VKG A;  5EK3 A;  2VL8 A;  3N9N A;  4HFB A;  2CPT A;  3KBT A;  2BVM A;  3C51 A;  3AED A;  3LK2 B;  1HG5 A;  4K0U A;  4IST A;  4TWH A;  4UEM A;  5IYZ E;  5M4Y A;  4DR6 T;  2CWY A;  4ZI3 C;  3LDQ B;  2N2N A;  4QXH B;  5ABH A;  3OTO T;  2JIW A;  3O1I A;  2WZH A;  4XZC A;  4QH1 A;  3T1Y T;  4DMW A;  4KMC A;  4HN9 A;  2X0Y A;  3ZC0 A;  4ZZC A;  4TWD A;  2PJQ A;  5FYM A;  1NAF A;  4YFS A;  5JTG A;  3K3O A;  5KDM C;  1XDP A;  2V6Y B;  1X79 A;  2J4G A;  3FZH B;  5AQV B;  3AEG A;  5HXC A;  5LOV E;  3UU6 A;  2E9X B;  2JPF A;  2X67 A;  1XNQ T;  3PUQ A;  1IBL T;  1HG2 A;  4MAL A;  1LVK A;  5JDF A;  3HL6 A;  1W09 A;  2NW7 A;  4OYJ A;  3TLS A;  4X1I E;  2YU1 A;  2M67 A;  3ZN1 B;  2XAS B;  5JRC B;  5L47 A;  5LHI B;  4GYR A;  3K1S A;  2BBJ A;  4LF6 T;  2LSK A;  4LFC T;  4DUZ T;  2XPK A;  3KVB A;  3ZT6 A;  1HR0 T;  5AQL B;  3I9W A;  4GKK T;  2XSA A;  3ZN0 B;  1VCT A;  1S94 A;  4NXN T;  4JI2 T;  2I6H A;  1D0Y A;  3EI0 A;  4O4L E;  2ODU A;  4X1K E;  4ADZ A;  1OWA A;  2LRK A;  1D0Z A;  1Y01 A;  2CBJ A;  4P0B A;  2M6I A;  2WCA A;  3RIU C;  4DID B;  1XNR T;  1BR2 A;  1XWM A;  4NXM T;  1QSD A;  3F2E A;  2CLY B;  5LB7 B;  2FJB A;  4CQI A;  4UVA B;  2NP9 A;  4DND A;  4LFB T;  2RP4 A;  4PW8 A;  3ONJ A;  4IL9 A;  4DVD A;  5EK2 A;  2D2S A;  3AVR A;  4ZI7 E;  4B3R T;  2FJD A;  2CMR A;  1ZV4 X;  3NRY A;  3ZCJ A;  3SRZ A;  1LRZ A;  2CHO A;  2H7O A;  4N78 D;  4BJN A;  5JDG A;  2JMH A;  3LSV A;  3U3I A;  5LCY A;  2ZLY A;  2NW8 A;  4AXP A;  4HFE A;  2YOE A;  2LKH A;  2PTF A;  5CA1 E;  4MHC A;  1Z8U A;  2CRB A;  3IHR A;  5LA6 E;  3NWI A;  4YSX A;  1ZEE A;  4HWI B;  3TKL B;  1G8X A;  2XM2 A;  2X9H A;  1OED A;  4O2B E;  5LGU B;  4TX5 A;  2IAK A;  4TV8 E; 
#chains in the Genus database with same CATH homology
 2LHN A;  4ERR A;  3AA1 B;  3BK9 A;  5JDQ A;  1SHZ C;  3C64 A;  3K3Q C;  5JDN A;  5JR9 B;  1HX8 A;  3UFE A;  3NZP A;  5JRC A;  3J9X 1;  3JC6 D;  3ZLI A;  2DCF A;  5CA0 E;  3ZCI A;  4IIJ E;  3MA9 A;  2A2F X;  3W15 B;  1BR0 A;  2MYS A;  4ILU A;  2XAF B;  4PJN A;  5FY0 A;  2Q9Q A;  4X20 E;  2LJL A;  4IDZ A;  3UUN A;  4YJ2 E;  4AQG A;  4QXB B;  2D0T A;  3Q5X A;  4MFR A;  5L3B B;  3K3N A;  3N9M A;  3ZMU B;  2DWK A;  2E9X D;  2UXN B;  4CXW A;  3AA6 B;  3OKQ A;  2P9B A;  4WBN E;  4MBQ A;  1WRD A;  3GA8 A;  3VKH A;  3I9Y A;  3FXE B;  3K8P C;  2XUE A;  2Z6E A;  1WR6 A;  4EZH A;  3SWH A;  2XTL A;  1MIV A;  2D0U A;  4MLK A;  2K5B B;  2CXF A;  3O1J A;  4L0R A;  4TN7 B;  5J2U E;  3EVY A;  3ZMS B;  2LOP A;  4AQF C;  3WAJ A;  2CXD A;  3RC8 A;  3ZEF B;  4HTE A;  2YU2 A;  3HKD E;  4PFO A;  3ZPO A;  5HWX A;  2WSS V;  2IW5 B;  3PUG A;  2JRK A;  4V1A v;  3SS1 A;  4BAY B;  2VAS A;  1T98 A;  2K9A A;  4OK0 A;  2HPJ A;  3ZJ2 A;  3RRC A;  2PFV A;  2Y48 B;  3ZYL A;  1CUN A;  3GMI A;  4QX8 B;  4ZS3 A;  5DAB A;  2LEH A;  2A3D A;  3CX8 B;  4X1Y E;  2Q9Q B;  3KVA A;  3LG7 A;  4UVC B;  3HKC E;  5LGN B;  4H63 H;  4L9I A;  2V7M A;  3NBX X;  4H63 V;  3O4X E;  3ZMZ B;  4WW0 A;  1HFA A;  1YKH B;  2X9Y A;  2ZM8 A;  3CQC B;  3Q2M A;  5LBM A;  2KWI B;  4AKH A;  4J2C A;  4DO0 A;  1FMW A;  1U4Q A;  1US7 B;  3ZYK A;  5FY1 A;  3CPZ A;  5KX5 E;  4AKG A;  2IC6 A;  3OYX A;  4FJO A;  3HI2 A;  5CB4 E;  4OHF A;  5JR9 A;  2VKJ A;  3N2K E;  1B7T A;  2WWU A;  4PJM A;  3AB3 B;  3OJA A;  3CWZ B;  1QUU A;  4AKR B;  4G63 A;  1IZN B;  3CQG B;  3Q9D A;  4QX7 B;  2V7L A;  3H3A A;  3L09 A;  3P7I A;  4L5G A;  3ESL A;  4WBO A;  2MTQ A;  4C91 A;  3QUJ A;  2WM9 A;  4PNI A;  2W63 A;  3O1H A;  4JLE A;  1FEW A;  3JC6 C;  4EIW A;  2X68 A;  4CI1 B;  1AJ3 A;  2NWB A;  4EAH A;  3S4U A;  5DQV A;  3OYZ A;  2WAU A;  3N9P A;  3ZC0 A;  3N5L A;  3L3P A;  3T8O A;  3ZJ1 A;  1UX4 A;  4ZHQ E;  4HKA A;  2XAQ B;  2DWG A;  2LM9 A;  3MJX A;  4ISS A;  2I59 A;  2LSG A;  5JQG E;  3CVR A;  1FIO A;  2W62 A;  2CE7 A;  3C98 B;  1SA0 E;  3M65 A;  2X66 A;  2ES0 A;  3AAA B;  1UCU A;  1IJ5 A;  4P0A A;  2KIN B;  3UUM A;  2E9X C;  3NZQ A;  2XHE B;  2VWA A;  2ZM2 A;  3VHL A;  5HXH A;  1E1H B;  3ZC1 A;  2Y8D A;  5ETW A;  4P09 A;  5J1G A;  2C5J A;  4TUY E;  4DBR A;  4EOZ B;  1VRB A;  4G2A A;  3CQX C;  3BQI A;  3E0Z A;  2YK0 A;  3I1A A;  4GIW A;  2ODV A;  5GON E;  3UUX B;  2XAJ B;  3MK7 C;  5JDL A;  2G0U A;  3LK4 2;  4QKN A;  1D0X A;  1Y64 B;  2Q9Q C;  2V26 A;  4I4T E;  4ASK A;  3OBV E;  1IJ6 A;  2K24 A;  5EK4 A;  3C4X A;  2VKD A;  4IHJ E;  4YLH A;  3GN5 A;  2E8I A;  2WMO A;  3BQK A;  3FXD B;  5L3C B;  2LOS A;  5DJQ C;  3H37 A;  1OXZ A;  2LT3 A;  3GWH A;  4TV9 E;  4ANJ A;  5LNK A;  3KV5 A;  5L2L A;  3N2O A;  4H9O C;  4GK0 E;  3LK3 B;  5LBQ B;  3AA7 B;  5HXS A;  2DI4 A;  3ONX A;  2X0L B;  3QC9 A;  2H3R A;  3ZMV B;  4QHO A;  2QGS A;  5JDH A;  3ETV A;  3SOL A;  2C5K T;  4I43 B;  3HA4 A;  1NWM X;  2EHO C;  3UTK A;  4AQF A;  5LG4 A;  2CEA A;  1MMN A;  3DJB A;  1U5P A;  1MIY A;  4CXX A;  4UV8 B;  3KV9 A;  1H7C A;  3AAI A;  4O8S A;  4UXN B;  1BR4 A;  3RYI E;  3ANW B;  2LSY A;  4PJL A;  2ZMA A;  2XAH B;  4CI2 B;  2MOZ A;  3RRW A;  1IAP A;  3PU3 A;  4AKL A;  2NOX A;  4C90 A;  2IC9 A;  4EYY R;  2B1E A;  4IE4 A;  2K48 A;  5A1L A;  1LVF A;  1MNE A;  1HF8 A;  2W0G A;  5HWY A;  4OYK A;  4E7Z A;  1ZHC A;  3EDU A;  5L3F B;  2CLY C;  5JH7 E;  3NRX A;  4BA9 A;  1V9D A;  2WMN A;  4Z8X A;  4HE8 A;  3C4Z A;  4OFZ A;  5FMN A;  2YEV C;  3D0T A;  3LJC A;  3RPU A;  4YJ3 E;  2KND A;  2LSJ A;  4UEL A;  2YIN A;  3PUA A;  3BQL A;  3C50 A;  3KIN B;  3QK6 A;  4UV9 B;  4UF0 B;  1WYC A;  3F31 A;  2EHO D;  2EHO A;  2KXP B;  2KMF A;  1YD8 G;  3PUS A;  4BJM A;  3RC3 A;  3IBP A;  5L3D B;  1ZKE A;  5JRE A;  5HXR A;  4EYU A;  4I55 E;  5LJN A;  4M1P A;  5HYA A;  1YKE B;  2XQY A;  2X9X A;  2ACX A;  4GK5 E;  3FBL A;  5EZY E;  4TZ4 C;  4H9N C;  1WLX A;  4FI5 A;  3ZMT B;  5LGT B;  5HXE A;  4F6R C;  4AKI A;  3HKB E;  1VOM A;  4QXC B;  2WBL A;  5JVD E;  2KZ7 B;  2HPL A;  3CKD A;  1D1A A;  4IE0 A;  5C8Y E;  2Q9Q D;  2V7J A;  5FY7 A;  2L8K A;  3O9X A;  3CML A;  3GN5 B;  4HGA A;  5LYJ E;  2X9W A;  3N9O A;  2JMK A;  3RKO A;  2NW9 A;  2C0S A;  4WNK A;  1HCI A;  3MXZ A;  2N1G A;  4ZI2 D;  3B57 A;  1WYB A;  2N9D A;  2PBI A;  5FXZ A;  4E7S A;  3RH3 A;  4H9S E;  3HR0 A;  4ZI3 D;  4KP3 C;  2ZM0 A;  3AA0 B;  3DTO A;  4ZOL E;  2EHO B;  5LXT E;  1Z0P A;  4O4J E;  3DP7 A;  3HKE E;  4HEA A;  2HH7 A;  2CA5 A;  2DNX A;  1KNZ A;  2LE8 A;  2W00 A;  1LKX A;  1FMV A;  2JJ9 A;  4KUM B;  4PK5 A;  1EZ3 A;  3ANW A;  3AVS A;  3I0O A;  5L3G B;  4NUU A;  5FXV A;  4O2A E;  4KBM B;  4PFP A;  4CXY A;  4JEU B;  2VK9 A;  2BVL A;  4GOU A;  5FNV E;  5F3J A;  2CM0 A;  2V7K A;  2V7I A;  2DHR A;  2GK9 A;  4B6X A;  2VKO A;  2C5I T;  3FHN A;  2CCQ A;  4EXT A;  3MZK B;  2VKH A;  3E22 E;  2JQQ A;  4PAG A;  1MMD A;  2MBG A;  3E08 A;  1MMA A;  3V5U A;  4CZZ B;  3WAK A;  2CXL A;  4AI6 A;  4IE7 A;  4U74 A;  4UIG A;  3EUH A;  3RYF E;  3B13 A;  3P8C D;  1MND A;  5LP6 E;  2X51 A;  2V1D B;  4O4H E;  4H9Q C;  4DMV A;  3PE0 A;  2L3L A;  2PG8 A;  4UF0 A;  3VU7 H;  1MMG A;  4GYS A;  4YHJ A;  3PU8 A;  4IGU A;  4HFV A;  4PK4 A;  4CI3 B;  4I50 E;  5F8P A;  3IF8 B;  3R6N A;  1UX5 A;  3LBX B;  3RYH E;  4JEH B;  5BMV E;  5HAX A;  2DLR A;  3MAC A;  5L3E B;  3C4W A;  3PUR A;  1BR1 A;  4XAX B;  3F57 A;  2SPC A;  1D1C A;  5AFU L;  4JUY A;  4A56 A;  5JR9 C;  1HTJ F;  3PTR B;  5FP3 A;  3FB2 A;  4DBQ A;  2BZB A;  4O4I E;  3KV6 A;  3RYC E;  1G73 A;  1D1B A;  4ZI2 C;  4PK6 A;  3IEE A;  3N9L A;  3N9Q A;  2BDE A;  3FBZ A;  3KV4 A;  2LSI A;  5FXW A;  3U78 A;  4EB6 E;  1KK7 A;  2NTY A;  3ZYM A;  4IE6 A;  2J1D G;  4EZ4 A;  3A5X A;  5ADX L;  5TAO A;  2D5U A;  2KLQ A;  4QWN B;  2A72 A;  3CX7 B;  4PJJ A;  3ETU A;  2KT9 A;  2XAG B;  2L9Q A;  2RA1 A;  4U72 A;  3UT5 E;  5H6R B;  5LHG B;  4NUV A;  2E9X A;  5DQW A;  5LJM A;  3I0Q A;  2NTX A;  1O3X A;  5H6Q B;  3LFM A;  3CX6 B;  4UVB B;  1MIW A;  3RX6 A;  5JDM A;  2W61 A;  5J2T E;  3KFW X;  3EDV A;  3J7Y q;  5IHY A;  2H7V C;  3LBX A;  3MKD A;  5KMG P;  3KBU A;  4IE5 A;  4XBF B;  2QA7 A;  2OA5 A;  3N2G E;  2KWH A;  5LHH B;  1YW0 A;  1HS7 A;  2LHR A;  3KDS E;  5FXX A;  3Q5W A;  3WI3 A;  2UXX B;  4H9P C;  3AAE B;  1S35 A;  4H9R C;  2Y6X A;  3V5S A;  4ZS2 A;  5E0O A;  2VB6 A;  2CWO A;  3R84 B;  3UUL A;  3VKG A;  3PDY A;  5EK3 A;  2VL8 A;  3N9N A;  3KBT A;  2BVM A;  3C51 A;  3LK2 B;  1HG5 A;  4K0U A;  4IST A;  4UEM A;  5M4Y A;  5IYZ E;  2CWY A;  4ZI3 C;  2N2N A;  4QXH B;  3O1I A;  4XZC A;  4DMW A;  4KMC A;  4HN9 A;  5FYM A;  2PJQ A;  1NAF A;  4YFS A;  3K3O A;  5KDM C;  1X79 A;  5HXC A;  5LOV E;  2E9X B;  2JPF A;  2X67 A;  3PUQ A;  1HG2 A;  4MAL A;  1LVK A;  5JDF A;  3HL6 A;  4OYJ A;  2NW7 A;  4X1I E;  2YU1 A;  2M67 A;  3ZN1 B;  2XAS B;  5JRC B;  5LHI B;  4GYR A;  2LSK A;  3KVB A;  3I9W A;  3ZN0 B;  1S94 A;  1D0Y A;  4ADZ A;  4O4L E;  2ODU A;  4X1K E;  1OWA A;  1D0Z A;  4P0B A;  1BR2 A;  1QSD A;  3F2E A;  2CLY B;  4CQI A;  4UVA B;  2NP9 A;  4DND A;  2RP4 A;  4PW8 A;  4DVD A;  5EK2 A;  2D2S A;  3AVR A;  4ZI7 E;  2CMR A;  1ZV4 X;  3NRY A;  3ZCJ A;  3SRZ A;  1LRZ A;  2H7O A;  4N78 D;  4BJN A;  5JDG A;  2JMH A;  3U3I A;  5LCY A;  2ZLY A;  2NW8 A;  4AXP A;  5CA1 E;  4MHC A;  5LA6 E;  3IHR A;  1ZEE A;  3TKL B;  1G8X A;  2X9H A;  4O2B E;  5LGU B;  4TX5 A;  2IAK A;  4TV8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...