3Q5XA

Structure of proteasome tether
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
193
structure length
193
Chain Sequence
ARQLPVGEQLPLSRLLQYSDKQQLFTILLQCVEKHPDLARDIRGILPAPSMDTCVETLRKLLINLNDSFPYGGDKRGDYAFNRIREKYMAVLHALNDMVPCYLPPYSTCFEKNITFLDAATNVVHELPEFHNPNHNVYKSQAYYELTGAWLVVLRQLEDRPVVPLLPLEELEEHNKTSQNRMEEALNYLKQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein cut8
publication title Structure of Proteasome Tether
rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
total genus 62
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2010-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08559 Cut8 Cut8, nuclear proteasome tether protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3q5xA00
3Q5WA 3Q5XA
chains in the Genus database with same CATH superfamily
3SFEA 2BG9B 5LJMA 2X9XA 1YW0A 2BS3A 2VKJA 4U72A 2Q9QC 2WY2A 4CXWA 3RYIE 2C5IT 4TN7B 4ZS3A 1B7TA 3KDSE 5AQGB 5HXSA 4X1YE 3O9XA 3KFWX 4P1NA 4Q25A 1HG5A 2NTYA 4P0AA 3NZPA 2PG8A 3TLVA 3X1DA 3RH3A 1FMWA 3C51A 4IE6A 4M1PA 5L3FB 1E1HB 4EV6A 4ZZCA 2I59A 4YSZA 3AVRA 2DWGA 3ZCIA 3JADA 2KWIB 2E9XB 1U4QA 3ZMVB 4JI7T 1S35A 4JYAT 4IDZA 3RIAA 4H9NC 3UU3A 4AQFA 4UF0B 4MLKA 3PJAJ 3AAAB 2NTXA 2YK0A 3G06A 5JRCB 3MJXA 2WWUA 2ZM6T 1KNZA 2A2FX 5LCYA 2C0SA 2WM9A 4KBMB 3AAEB 3ZMUB 1XNQT 4ZOLE 4DMVA 3LDQB 1N32T 4DMWA 2UUAT 2LJLA 2CEAA 5LMUT 3EI0A 3CWZB 3JC6C 2CBJA 3QUJA 2LOPA 4PJMA 3W15B 3A7MA 5AQQB 4O4JE 1IJ5A 5HEOA 1U5PA 4DV5T 4OK0A 4UR9A 2J1DG 4GYRA 2LKGA 2RP4A 3N9MA 4DV3T 2VQFT 3R6NA 3FZMB 3EUHA 2NR4A 1LVKA 3M3ZB 3CPZA 3AAIA 2ZM0A 4ILCA 3UU4A 4HFEA 2HHHT 5LA6E 3CX6B 2A72A 4FI5A 4Z91A 1WR0A 5LMNT 2BKPA 1HNXT 4WBOA 2PBIA 5F5WA 3Q2MA 1MMGA 5JDLA 3LK3B 1BR0A 1HNWT 4YTNA 5LGNB 2UU9T 4AI6A 3MA9A 1IBMT 5TAOA 2WDQA 1HF8A 3ZT7A 3K3QC 2HH7A 4UEMA 2X0HA 3CX8B 3PUZF 2XQYA 1VRBA 3HKCE 3N5LA 3ZJ2A 2UXDT 2D5UA 5JDQA 4V1Av 5BR8T 2NW8A 2YDQA 3C98B 1OEDB 3UUNA 4ASKA 5KDMC 5DQVA 4QX7B 4PW8A 4ILAA 2K9AA 4DUZT 4PJLA 5KX5E 2KZ7B 4NXNT 5LHHB 1D1AA 2OV9A 3NBXX 3RKGA 3IEEA 1KEYA 5L3BB 4TV8E 3AA0B 5AQRB 2BS4A 4O2BE 4EXTA 3AE6A 4B3MT 5FYMA 1MIWA 3VRAA 3PUXF 2YDSA 3LJCA 3F31A 2JQKA 4QX8B 1N33T 5JDFA 4I43B 1SHZC 3P4QA 2XAFB 2J62A 4IDQA 5LB7B 2KINB 5KXJA 2WDRA 1YXRA 4PAGA 3WAJA 1DU2A 4LF7T 2JRKA 1UX5A 3UTKA 4E7SA 4EGWA 1M7KA 1XZYA 1ZHCA 4YJ3E 1XWMA 4IGUA 4AKLA 3EVYA 4PJJA 1H7CA 4ISSA 4PNIA 1W09A 2EHOB 3MKDA 4ADZA 2ZM2A 2E8IA 3KV4A 4ILBA 5LGUB 2LSYA 5JDGA 3CMLA 5EK4A 4YTMA 3HKEE 2V7KA 5JH7E 3UUXB 2LKHA 3KBUA 1YQ4A 4NIQA 3O1IA 3RGLA 5HCMA 3KVAA 5LXTE 2CLYB 4ZI3D 1ZEEA 2XZEA 1VOMA 4U7YA 3ZPOA 4XAXB 2XUEA 4O4IE 1HX8A 4KMCA 1WR6A 4ZZBA 2UXXB 3QOFA 1QSDA 3PE0A 2CMRA 4EEBA 3UUMA 3P4WA 4JI8T 2QVAA 2ZM8A 1QUUA 5F3JA 3HKDE 1OEDC 4EB6E 3QK6A 3BQIA 3HR0A 4LFAT 3IHRA 4CN1A 3PU8A 2N1GA 4KP3C 4EEDA 2IDOB 5FY0A 3PTRB 4I0UA 5JDHA 1J5ET 5CA0E 2XY8B 3TLWA 4HFCA 5AQMB 4LFBT 5AQLB 4AQYT 3I9WA 3RYHE 5HCJA 4ZI7E 3LK2B 3FHNA 4DBQA 3AE4A 3N2OA 1MMDA 3RQWA 2Y48B 1M62A 3O4XE 4MBQA 1XNRT 2VKDA 2DCFA 4DV1T 5LBMA 4B3ST 3KV9A 2XM1A 5H6QB 1W9RA 1HFAA 5IHYA 3Q9DA 3JC6D 5AQKB 1E2AA 4PK5A 3UT5E 3T1HT 3RPUA 3LSVA 2MAWA 2IUBA 4O8SA 2EHOC 4IHJE 3AXJB 2WMOA 4X66T 1MIYA 3P4PA 4YHJA 1Y64B 3S4UA 3E0ZA 5JDNA 2WU5A 4LF6T 2BBHA 2R6GF 4TNVA 4U3CA 3P8CD 3P7IA 3C50A 5LP6E 3A8YC 3UQ7A 4P0BA 5FXZA 5AQTB 4XZCA 4DR3T 5JDMA 5FVKA 4AKRB 4OX9T 2RPAA 1IBLT 4EAHA 4H9RC 2CHOA 5L3DB 1IJ6A 5LHIB 3MK7C 3PUVF 4GK0E 1GQEA 3AEGA 4TWFA 2FBWA 4G63A 4GOUA 2V5DA 3A5XA 3AE3A 5JVDE 3WAKA 5JTGA 4WNKA 2XSAA 3GN5A 1YD8G 2WCAA 2XAQB 4X20E 2FJAA 2W67A 2X9WA 3FB2A 1WCRA 2V26A 3T1YT 4L9IA 1IBKT 1KNPA 2YU2A 4CN6A 2UUBT 4BJNA 4A97A 4YTPA 1XDOA 2Y8DA 3CKDA 1N36T 5JR9C 4CN4A 4Z8XA 1UUSA 3ZCJA 4A98A 2NWBA 5HWXA 3ZEFB 3SS1A 4LMKA 3NRYA 5IWAT 4DR4T 4X1KE 4LF5T 1NENA 4HWCA 4JV5T 2MTQA 3AEAA 4IDNA 3NRXA 3P4RA 4B3TT 4JI4T 1J1JA 3AA7B 3D0TA 1QLBA 4O4HE 2BDEA 4X1IE 3UU6A 2MPKA 1LVFA 2ODUA 4LFCT 3ZN1B 4A56A 2XAGB 5HEHA 2H3RA 3FXDB 3UU5A 5F8PA 3DP7A 3ANWA 2LRLA 2N2NA 1I94T 2VB6A 3PUYF 4DBRA 4CXYA 3L8RA 1O3XA 2VL0A 4CQIA 3PURA 4G2AA 1MMAA 3GA8A 3Q5XA 1FIOA 4U2ZA 2XAHB 2ACZA 4YLHA 3IF8B 3CVRA 2G0UA 3DTOA 5AQVB 1UGOA 3NWIA 2LE8A 3VRBA 3TLSA 2MOZA 1UCUA 5HEUA 2JQQA 2V6XA 4KX6A 3PDYA 3FZFB 2GK9A 1G8XA 2KWHA 2BG9C 4DIDB 2KNDA 1Z8UA 2OA5A 1LRZA 4B6XA 3RLFF 3AB3B 1XDPA 2UXNB 2K24A 4GKKT 5FXXA 2FJBA 2DNXA 4HFBA 3ZYMA 4N78D 2XQAA 2QYWA 4FJOA 1I6ZA 3RC3A 5LHGB 2HN2A 1R8IA 4CI2B 2YEVC 3CQCB 4HKAA 3TKLB 4U31A 2ZLYA 2A3DA 2WDVA 2LSIA 1YKEB 2WQYA 4UELA 4A5XA 3V5UA 4HN9A 4CI1B 2NW7A 3EABA 3OTOT 4IE4A 4JBWF 5E0OA 2E9XC 4ZS2A 1KNRA 1XMQT 4EZ4A 4LF9T 2XJ7A 2D2SA 2VKOA 5HXEA 2W63A 2WS3A 3K3OA 3BQKA 2CRBA 3FZLB 4TWDA 4CXXA 4IL9A 2V7LA 4H9PC 4H9OC 4X64T 4I55E 2XASB 4DR1T 4DV2T 3ETVA 3UFGA 5HEGA 2V8SV 5FL0A 4ZEYA 2IIUA 4JEHB 3FZKB 2X68A 2HPLA 2EHOD 2CXDA 1WYBA 3MACA 5DABA 1MNEA 2LM2A 2CWOA 3LBXA 3Q5EA 3C64A 2KSRA 4IL4A 3U78A 5FY7A 1W0BA 1X79A 1YQ3A 2D0TA 2V5CA 3C4ZA 2KMFA 2V6YA 2FJEA 3K8PC 4ILUA 3NVOA 2KLQA 4LMJA 4OYJA 3RIUC 4IE7A 5M4YA 2WWVA 5CFBA 5ABFA 5IYZE 3SFDA 3EHZA 5L3EB 4WYVA 1BR2A 2BBJA 4ERRA 4JI1T 2K48A 4UV8B 3VKGA 4TWHA 2B1EA 3SRZA 5ABHA 4UF0A 3GN5B 2ES0A 3AEDA 2OLTA 5FKYA 2H7OA 2B76A 3J7Yq 4UVBB 2D9DA 4DV0T 1T72A 2W61A 1NEKA 3QB5K 2W62A 3B57A 5J2UE 2Q9QD 2XSBA 4F6RC 4DR2T 4BJMA 4DVDA 3VHLA 3PU3A 3SWHA 1HTJF 3T8OA 4EOZB 4IDOA 5LNKA 1OXZA 1SUMB 3VKHA 3EDVA 3I1AA 3L39A 5IUXA 4PFPA 5LBQB 5HXHA 4X62T 2JIWA 5ABGA 2H88A 3M65A 5AQUB 3IA3A 1KFYA 4DV4T 2VQET 5CA1E 4TUYE 3HI2A 4YHHT 1Z0PA 3OPCA 4HWIB 3ANWB 2IW5B 2F4VT 4NXMT 2W00A 2LEHA 4JEUB 2CCQA 3ZSSA 4UVCB 2WZHA 2KXPB 2DL1A 2M67A 4B3RT 4JI6T 1BR1A 3F57A 4PFOA 4GK5E 5CB4E 4HFHA 4BAYB 4X5TA 2LLYA 2LSKA 1MMNA 3OVUA 4PJNA 5HXRA 4OFZA 4JUYA 1VCTA 1LKXA 3JAEA 4PK4A 3JCFA 1L0VA 4QXCB 3RI5A 5AFUL 4QXBB 4DV6T 1JNZA 3RRWA 3RRCA 4QXHB 2DI4A 2X0LB 3KV6A 3RIFA 5H6RB 4JI0T 4JI5T 4HFDA 5EZYE 1UX4A 4OYKA 1HS7A 2Z6EA 2LRKA 5KMGP 4PK6A 3R84B 3PUQA 1OEDA 4GYSA 4TNWA 2D0UA 3F2EA 4U2YA 3ZC1A 3K3NA 2CLYC 5L4HA 2K3WA 4YFSA 5CGMA 2YOEA 4IREA 4HWFA 3VU7H 2FJDA 3KVBA 5FXWA 3P4SA 3N2KE 2DLRA 1X9BA 3KINB 2CXFA 4JI2T 5J2TE 2UXBT 4CI3B 3AA6B 3E22E 3ESLA 3O1HA 4AQFC 2E9XD 3V5SA 3AEEA 2VURA 1Y01A 2W0GA 1EZ3A 3I0QA 1KF6A 1VCSA 2WSSV 2JJ9A 3I0OA 3CQXC 3AEFA 5FVLA 4L0RA 1BR4A 2EHOA 2XAJB 1ZV4X 3Q5WA 3L3PA 4H63H 2I6HA 4MFRA 4OHFA 3LBXB 4YY3T 5L47A 2L3LA 3FZHB 3ZJ1A 2XTLA 3TLUA 2CWYA 4ZI3C 5AQFB 3ZT5A 3H3MA 2V6YB 3GMIA 3RYCE 2XQ8A 4YSYA 4QKNA 2MYSA 2DHRA 2WP9A 4K0UA 4O4LE 1HNZT 3AE1A 3WI3A 4GKJT 5AQPB 3ZT6A 4HTEA 3N9OA 3O1JA 4ZI2C 5ABFB 5J1GA 3N9QA 5FP3A 4AIUA 3AECA 3SOLA 2JMKA 4JI3T 3VR9A 4IT4A 4O2AE 2MBGA 1HX1B 3AE5A 3Q5DA 4AISA 4BA9A 4DR5T 4DR6T 3AE9A 5LG3A 4DR7T 3LFMA 2WAUA 1D0YA 4ANJA 2XQ6A 4EYUA 2ODVA 3RF1A 1D1BA 5L3CB 5LOVE 5EK3A 2YKSA 3C4XA 4U7IA 2V7MA 2LSJA 2Q9QA 4J2CA 4C90A 5C3JA 2VKHA 3RYFE 3KV5A 2VL8A 3DJBA 5JR9A 5HYAA 2BG9E 3PV0F 2V7IA 5A1LA 2IC9A 2WU2A 4H63V 4QH1A 3UUBA 4YXDA 5AQIB 1FEWA 1HCIA 2JQ9A 3JAFA 2BS2A 5AQJB 5FNVE 4IDPA 4NUVA 4DO0A 3UQ4A 5HWYA 2XQ7A 2E5VA 2LSGA 4NUUA 4WW0A 4TV9E 2UXCT 2CA5A 4HE8A 2Y6XA 2NOXA 5LJNA 2W4XA 2JPFA 3ZMZB 5FMNA 5FY1A 2X9YA 3BQLA 3CK6A 2QA7A 1WLXA 3AXJA 2L8KA 2LHNA 4HFIA 1JNRA 5FXVA 3AE2A 1T7SA 1J5WA 1E7PA 5AQHB 4AKHA 2H7VC 4WBNE 1KK7A 2WB5A 3GWHA 3C4WA 3PUGA 3B13A 2W2UA 2CM0A 4LMLA 3HL6A 1ZOYA 1NAFA 3CQGB 5L4EA 2RA1A 3EDUA 5AQNB 5HAXA 4KHZF 4AKIA 4CZZB 2FUPA 4H9QC 1D0XA 4ZHQE 4EIWA 3OYZA 3B5MA 4NPPA 3PJAA 3RX6A 2C5JA 5DJQC 4QH5A 4DUYT 3KBTA 2PJQA 4EZHA 4L5GA 1XMOT 1S94A 1WFDA 4ZXLA 3ETUA 2BG9A 3LG7A 5AQSB 1T8BA 2YDRA 2CHNA 4IE0A 2CPTA 2XHEB 1AJ3A 1MIVA 4YSXA 4UV9B 1V9DA 2X51A 3ZLIA 4HEAA 3ZYLA 2YU1A 2A9UA 5ADXL 2X9HA 1W0AA 3FXEB 3K1SA 4I4TE 4TX5A 4COFA 3LK42 2X67A 2E5LT 1FJGT 2BKOA 5ETWA 2DWKA 3UFEA 5GONE 4LF8T 2PTFA 3PUWF 2HN1A 4ISTA 3FBLA 4GIWA 4EYYR 4P09A 4KI0F 2LM9A 1US7B 3NKZA 4QWNB 4AXPA 4E7ZA 4KHPT 4X65T 4HGAA 4Z90A 5ABEA 1WYCA 2JQHA 4HWDA 2E9XA 4QHOA 4IE5A 3ZYKA 4K0KT 2XPKA 2XQ5A 3CX7B 1HG2A 2LT3A 2E2AA 2X0YA 5JRCA 2ZMAA 4I50E 2KT9A 4YT0A 1G73A 2BVLA 3FBZA 3RKOA 5EK2A 5L3GB 1MNDA 5HEJA 1SA0E 1D1CA 3QC9A 3N2GE 3ZC0A 3ZMTB 3MXZA 5CJ5A 2M6BA 4F8HA 3RHWA 3N9LA 2P9BA 4DV7T 1CUNA 3QB5A 4H9SE 5JREA 3TLTA 3CIRA 2UUCT 5DQWA 1NWMX 1OEDE 2HPJA 3ZMSB 2CXLA 2VVNA 3QNUA 2N9DA 3EAMA 4AQGA 2QGSA 2WMNA 2VWAA 3I9YA 3AE8A 2BZBA 1OWAA 3RIUA 3OKQA 1ZKEA 3P50A 2SPCA 4MHCA 5L2LA 4HWHA 3AE7A 2WBLA 3OJAA 2J47A 3AA1B 3PUAA 1FMVA 2L9QA 4ZI2D 2K5BB 4YJ2E 4JLEA 5JQGE 5FL1A 4UIGA 2VK9A 3ZN0B 3UU8A 3OYXA 3ONLC 2J4GA 5HXCA 1N34T 2CE7A 2NP9A 2Q9QB 4MALA 5C8YE 2W66A 4UVAB 3ZSTA 2V7JA 2ACXA 5JR9B 2YN6A 2NW9A 2M6IA 1CHUA 2IAKA 5BMVE 5LYJE 3N9PA 3AEBA 1UURA 5LGTB 1D0ZA 4U33A 2XQ9A 2JMHA 2XM2A 2YINA 2X66A 4UXNB 3H3AA 3RC8A 4LF4T 1T98A 2BKNA 3N9NA 2VVSA 5LG4A 2I0MA 3HKBE 2WZIA 2AXDS 3J9X1 3HA4A 3E08A 1HR0T 2BVMA 2PFVA 4XBFB 1UK5A 2QRXA 3MZKB 3OBVE 2LHRA 2XQ4A 3UULA 3ZKRA 4QH4A 3PUSA 1IZNB 2IMLA 2CBIA 4U74A 4WZXA 2LOSA 5J0ZA 4KUMB 3L09A 2H89A 4C91A 3VR8A 2IC6A 4TZ4C 3BK9A 3AVSA 5AQOB 2IHR1 3ONJA 4IIJE 5C2TA 1SE7A 3ABVA 3ONXA 2C5KT 3NZQA 3RQUA 2V1DB 4AKGA 3IBPA 2VASA 1ZP0A 1WRDA 3U3IA 2AE9A 4HFVA 2XQ3A 4DNDA 3H37A 1YKHB 1IAPA
chains in the Genus database with same CATH topology
3U78A 4KP3C 5FY7A 1X79A 5FY0A 3PTRB 2D0TA 4NUVA 4DO0A 3C4ZA 2KMFA 5HWYA 5LJMA 5JDHA 3K8PC 2X9XA 4ILUA 5CA0E 1YW0A 2KLQA 2VKJA 4OYJA 2LSGA 4IE7A 3I9WA 4U72A 2Q9QC 5M4YA 4NUUA 4WW0A 4TV9E 3RYHE 4ZI7E 2CA5A 4HE8A 5IYZE 4CXWA 2Y6XA 3LK2B 2NOXA 3RYIE 5LJNA 2JPFA 3ZMZB 2C5IT 5FMNA 3FHNA 4TN7B 4DBQA 5FY1A 4ZS3A 1B7TA 2X9YA 3BQLA 2QA7A 3N2OA 1MMDA 1WLXA 5L3EB 2Y48B 1BR2A 2L8KA 3KDSE 2LHNA 3O4XE 4MBQA 4ERRA 5HXSA 4X1YE 3O9XA 5FXVA 3KFWX 2K48A 2VKDA 4UV8B 3VKGA 2DCFA 2B1EA 5LBMA 3SRZA 1HG5A 4UF0A 2NTYA 3GN5B 4P0AA 2ES0A 3KV9A 2H7VC 4AKHA 4WBNE 1KK7A 5H6QB 3NZPA 1HFAA 5IHYA 3Q9DA 3JC6D 3GWHA 2PG8A 3C4WA 3PUGA 4PK5A 3RH3A 3B13A 1FMWA 2H7OA 2CM0A 3J7Yq 3C51A 4UVBB 4IE6A 3HL6A 1NAFA 4M1PA 5L3FB 1E1HB 3CQGB 3UT5E 3RPUA 2W61A 2W62A 3B57A 5J2UE 2Q9QD 2I59A 2RA1A 4O8SA 4F6RC 2EHOC 3EDUA 3AVRA 2DWGA 4IHJE 5HAXA 2WMOA 3ZCIA 2KWIB 2E9XB 1U4QA 3ZMVB 4AKIA 1S35A 4CZZB 4H9QC 4BJMA 4DVDA 3VHLA 1D0XA 3PU3A 3SWHA 4IDZA 4ZHQE 1HTJF 1MIYA 4H9NC 4AQFA 3T8OA 3OYZA 4EIWA 4UF0B 4YHJA 4MLKA 3RX6A 1Y64B 3S4UA 2C5JA 3E0ZA 4EOZB 3AAAB 5JDNA 5DJQC 3KBTA 2PJQA 4EZHA 2NTXA 5LNKA 1OXZA 4L5GA 1S94A 2YK0A 5JRCB 3EDVA 3VKHA 3ETUA 3MJXA 3I1AA 2WWUA 3LG7A 3P8CD 3P7IA 3C50A 4PFPA 5LP6E 5LBQB 5HXHA 4P0BA 5FXZA 4IE0A 1KNZA 4XZCA 5JDMA 2XHEB 2A2FX 3M65A 5LCYA 2C0SA 1MIVA 1AJ3A 4UV9B 1V9DA 2WM9A 2X51A 3ZLIA 4AKRB 4HEAA 3ZYLA 4KBMB 2YU1A 4EAHA 4H9RC 3AAEB 5CA1E 5ADXL 4TUYE 2X9HA 3ZMUB 3HI2A 4ZOLE 5L3DB 4DMVA 3FXEB 1IJ6A 5LHIB 1Z0PA 3MK7C 4GK0E 3ANWB 4TX5A 4I4TE 2IW5B 3LK42 2X67A 4DMWA 2W00A 2LEHA 4JEUB 2LJLA 2CCQA 4UVCB 2CEAA 5ETWA 2DWKA 4G63A 4GOUA 3UFEA 5GONE 3A5XA 5JVDE 3WAKA 3CWZB 2KXPB 3JC6C 4WNKA 2M67A 3GN5A 3QUJA 1YD8G 4ISTA 2LOPA 3FBLA 1BR1A 2XAQB 3F57A 4PJMA 4GK5E 4GIWA 4PFOA 4X20E 3W15B 5CB4E 4EYYR 2X9WA 3FB2A 4O4JE 1IJ5A 2V26A 4P09A 4BAYB 1U5PA 4L9IA 2YU2A 2LM9A 4OK0A 4BJNA 1US7B 2J1DG 4QWNB 4AXPA 4GYRA 4E7ZA 2RP4A 3N9MA 2LSKA 2Y8DA 3CKDA 5JR9C 1MMNA 4HGAA 4PJNA 4Z8XA 5HXRA 3ZCJA 4OFZA 3R6NA 1WYCA 2NWBA 3EUHA 5HWXA 2E9XA 3ZEFB 4JUYA 3SS1A 4QHOA 1LVKA 4IE5A 3NRYA 3ZYKA 3CPZA 3AAIA 4X1KE 2ZM0A 3CX7B 1LKXA 2MTQA 4PK4A 5LA6E 3CX6B 2A72A 4FI5A 4QXCB 1HG2A 2LT3A 3NRXA 5AFUL 5JRCA 2ZMAA 4QXBB 4I50E 2KT9A 1G73A 2BVLA 3FBZA 3RKOA 3RRWA 3RRCA 4QXHB 5EK2A 5L3GB 2DI4A 3AA7B 3D0TA 4O4HE 1MNDA 2X0LB 3KV6A 2BDEA 1SA0E 1D1CA 3QC9A 3N2GE 4WBOA 5H6RB 3ZC0A 2PBIA 4X1IE 3ZMTB 5EZYE 3Q2MA 1LVFA 1MMGA 3MXZA 1UX4A 5JDLA 3LK3B 4OYKA 2ODUA 3ZN1B 1BR0A 1HS7A 2Z6EA 4A56A 2XAGB 2H3RA 5KMGP 4PK6A 3FXDB 3R84B 3N9LA 3PUQA 2P9BA 5F8PA 1CUNA 3DP7A 4H9SE 3ANWA 5JREA 2N2NA 4GYSA 5LGNB 2VB6A 4AI6A 3MA9A 5DQWA 1NWMX 4DBRA 2D0UA 3F2EA 4CXYA 5TAOA 1O3XA 3ZC1A 3K3NA 2HPJA 4CQIA 3ZMSB 2CXLA 3PURA 4G2AA 1HF8A 1MMAA 2CLYC 3GA8A 2N9DA 3K3QC 1FIOA 2HH7A 3Q5XA 4UEMA 4AQGA 4YFSA 2XAHB 3CX8B 4YLHA 2QGSA 2XQYA 1VRBA 3IF8B 3CVRA 2WMNA 3HKCE 2VWAA 3N5LA 3I9YA 3ZJ2A 2D5UA 2G0UA 2BZBA 1OWAA 5JDQA 3VU7H 3KVBA 3DTOA 4V1Av 3OKQA 5FXWA 1ZKEA 2NW8A 3C98B 2SPCA 4MHCA 5L2LA 2LE8A 3N2KE 3UUNA 2DLRA 4ASKA 5KDMC 3OJAA 2WBLA 5DQVA 4QX7B 4PW8A 3KINB 2K9AA 3AA1B 2MOZA 1UCUA 3PUAA 1FMVA 2CXFA 4PJLA 5KX5E 2L9QA 4ZI2D 2K5BB 2KZ7B 4YJ2E 2JQQA 4JLEA 5J2TE 5LHHB 4CI3B 3AA6B 5JQGE 1D1AA 3NBXX 3IEEA 3E22E 3PDYA 3ESLA 4UIGA 2VK9A 3O1HA 3ZN0B 4AQFC 2E9XD 3V5SA 5L3BB 2GK9A 3OYXA 4TV8E 3AA0B 1G8XA 2W0GA 4O2BE 4EXTA 1EZ3A 3I0QA 5HXCA 5FYMA 1MIWA 2KWHA 2WSSV 2CE7A 2NP9A 2KNDA 2JJ9A 2Q9QB 4MALA 5C8YE 3I0OA 3CQXC 4UVAB 2OA5A 3LJCA 2V7JA 1LRZA 4B6XA 3F31A 2ACXA 4L0RA 1BR4A 5JR9B 2NW9A 3AB3B 2EHOA 4QX8B 2XAJB 2IAKA 5JDFA 5BMVE 2UXNB 1ZV4X 2K24A 3N9PA 3Q5WA 5LYJE 3L3PA 4I43B 1SHZC 5FXXA 5LGTB 4H63H 4MFRA 4OHFA 1D0ZA 3LBXB 2DNXA 3ZYMA 2XAFB 4N78D 2KINB 2L3LA 4FJOA 3RC3A 2JMHA 4PAGA 3WAJA 2JRKA 2YINA 2X66A 1UX5A 3H3AA 4UXNB 3ZJ1A 5LHGB 2XTLA 3RC8A 1T98A 3N9NA 3UTKA 4E7SA 2CWYA 4ZI3C 4CI2B 5LG4A 2YEVC 3CQCB 3HKBE 1ZHCA 4YJ3E 3GMIA 4HKAA 3J9X1 4IGUA 3RYCE 3TKLB 4AKLA 3HA4A 3EVYA 3E08A 2ZLYA 4PJJA 4QKNA 2MYSA 2A3DA 1H7CA 2DHRA 2BVMA 4ISSA 2EHOB 2LSIA 2PFVA 4K0UA 4PNIA 4O4LE 1YKEB 3MKDA 4XBFB 4UELA 4ADZA 3WI3A 3MZKB 2ZM2A 3V5UA 4HN9A 3OBVE 2E8IA 3KV4A 4HTEA 3N9OA 4CI1B 2LHRA 5LGUB 2LSYA 3UULA 2NW7A 3O1JA 4ZI2C 5JDGA 3PUSA 5J1GA 4IE4A 3CMLA 1IZNB 3N9QA 5FP3A 4U74A 3SOLA 5EK4A 2JMKA 2LOSA 4O2AE 5E0OA 2MBGA 2E9XC 4KUMB 3HKEE 2V7KA 4ZS2A 4BA9A 3L09A 5JH7E 3UUXB 4EZ4A 2D2SA 3KBUA 2WAUA 3LFMA 4C91A 1D0YA 2VKOA 4ANJA 5HXEA 2W63A 4EYUA 3O1IA 3KVAA 2IC6A 5LXTE 4TZ4C 2CLYB 2ODVA 3K3OA 4ZI3D 3BQKA 1ZEEA 1VOMA 3ZPOA 4CXXA 1D1BA 5L3CB 4XAXB 5LOVE 5EK3A 3BK9A 2XUEA 3C4XA 4O4IE 2V7LA 4H9PC 1HX8A 3AVSA 4KMCA 1WR6A 2V7MA 2LSJA 4H9OC 4I55E 2Q9QA 2UXXB 1QSDA 4J2CA 4C90A 2XASB 3PE0A 2CMRA 2VKHA 3ETVA 3RYFE 3UUMA 3KV5A 2VL8A 4IIJE 3DJBA 5JR9A 5HYAA 4JEHB 3ONXA 2ZM8A 1QUUA 2C5KT 2V7IA 2X68A 5A1LA 2IC9A 3NZQA 4H63V 5F3JA 2V1DB 4AKGA 3IBPA 2HPLA 2VASA 2EHOD 3HKDE 2CXDA 1WYBA 3MACA 5DABA 1MNEA 4EB6E 1WRDA 1FEWA 3U3IA 2CWOA 3QK6A 3LBXA 4HFVA 1HCIA 3BQIA 4DNDA 3C64A 3HR0A 5FNVE 3IHRA 3PU8A 3H37A 1YKHB 1IAPA 2N1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5W A;  3Q5X A; 
#chains in the Genus database with same CATH topology
 3SFE A;  2BG9 B;  5LJM A;  2X9X A;  1YW0 A;  2BS3 A;  2VKJ A;  4U72 A;  2Q9Q C;  2WY2 A;  4CXW A;  3RYI E;  2C5I T;  4TN7 B;  4ZS3 A;  1B7T A;  3KDS E;  5AQG B;  5HXS A;  4X1Y E;  3O9X A;  3KFW X;  4P1N A;  4Q25 A;  1HG5 A;  2NTY A;  4P0A A;  3NZP A;  2PG8 A;  3TLV A;  3X1D A;  3RH3 A;  1FMW A;  3C51 A;  4IE6 A;  4M1P A;  5L3F B;  1E1H B;  4EV6 A;  4ZZC A;  2I59 A;  4YSZ A;  3AVR A;  2DWG A;  3ZCI A;  3JAD A;  2KWI B;  2E9X B;  1U4Q A;  3ZMV B;  4JI7 T;  1S35 A;  4JYA T;  4IDZ A;  3RIA A;  4H9N C;  3UU3 A;  4AQF A;  4UF0 B;  4MLK A;  3PJA J;  3AAA B;  2NTX A;  2YK0 A;  3G06 A;  5JRC B;  3MJX A;  2WWU A;  2ZM6 T;  1KNZ A;  2A2F X;  5LCY A;  2C0S A;  2WM9 A;  4KBM B;  3AAE B;  3ZMU B;  1XNQ T;  4ZOL E;  4DMV A;  3LDQ B;  1N32 T;  4DMW A;  2UUA T;  2LJL A;  2CEA A;  5LMU T;  3EI0 A;  3CWZ B;  3JC6 C;  2CBJ A;  3QUJ A;  2LOP A;  4PJM A;  3W15 B;  3A7M A;  5AQQ B;  4O4J E;  1IJ5 A;  5HEO A;  1U5P A;  4DV5 T;  4OK0 A;  4UR9 A;  2J1D G;  4GYR A;  2LKG A;  2RP4 A;  3N9M A;  4DV3 T;  2VQF T;  3R6N A;  3FZM B;  3EUH A;  2NR4 A;  1LVK A;  3M3Z B;  3CPZ A;  3AAI A;  2ZM0 A;  4ILC A;  3UU4 A;  4HFE A;  2HHH T;  5LA6 E;  3CX6 B;  2A72 A;  4FI5 A;  4Z91 A;  1WR0 A;  5LMN T;  2BKP A;  1HNX T;  4WBO A;  2PBI A;  5F5W A;  3Q2M A;  1MMG A;  5JDL A;  3LK3 B;  1BR0 A;  1HNW T;  4YTN A;  5LGN B;  2UU9 T;  4AI6 A;  3MA9 A;  1IBM T;  5TAO A;  2WDQ A;  1HF8 A;  3ZT7 A;  3K3Q C;  2HH7 A;  4UEM A;  2X0H A;  3CX8 B;  3PUZ F;  2XQY A;  1VRB A;  3HKC E;  3N5L A;  3ZJ2 A;  2UXD T;  2D5U A;  5JDQ A;  4V1A v;  5BR8 T;  2NW8 A;  2YDQ A;  3C98 B;  1OED B;  3UUN A;  4ASK A;  5KDM C;  5DQV A;  4QX7 B;  4PW8 A;  4ILA A;  2K9A A;  4DUZ T;  4PJL A;  5KX5 E;  2KZ7 B;  4NXN T;  5LHH B;  1D1A A;  2OV9 A;  3NBX X;  3RKG A;  3IEE A;  1KEY A;  5L3B B;  4TV8 E;  3AA0 B;  5AQR B;  2BS4 A;  4O2B E;  4EXT A;  3AE6 A;  4B3M T;  5FYM A;  1MIW A;  3VRA A;  3PUX F;  2YDS A;  3LJC A;  3F31 A;  2JQK A;  4QX8 B;  1N33 T;  5JDF A;  4I43 B;  1SHZ C;  3P4Q A;  2XAF B;  2J62 A;  4IDQ A;  5LB7 B;  2KIN B;  5KXJ A;  2WDR A;  1YXR A;  4PAG A;  3WAJ A;  1DU2 A;  4LF7 T;  2JRK A;  1UX5 A;  3UTK A;  4E7S A;  4EGW A;  1M7K A;  1XZY A;  1ZHC A;  4YJ3 E;  1XWM A;  4IGU A;  4AKL A;  3EVY A;  4PJJ A;  1H7C A;  4ISS A;  4PNI A;  1W09 A;  2EHO B;  3MKD A;  4ADZ A;  2ZM2 A;  2E8I A;  3KV4 A;  4ILB A;  5LGU B;  2LSY A;  5JDG A;  3CML A;  5EK4 A;  4YTM A;  3HKE E;  2V7K A;  5JH7 E;  3UUX B;  2LKH A;  3KBU A;  1YQ4 A;  4NIQ A;  3O1I A;  3RGL A;  5HCM A;  3KVA A;  5LXT E;  2CLY B;  4ZI3 D;  1ZEE A;  2XZE A;  1VOM A;  4U7Y A;  3ZPO A;  4XAX B;  2XUE A;  4O4I E;  1HX8 A;  4KMC A;  1WR6 A;  4ZZB A;  2UXX B;  3QOF A;  1QSD A;  3PE0 A;  2CMR A;  4EEB A;  3UUM A;  3P4W A;  4JI8 T;  2QVA A;  2ZM8 A;  1QUU A;  5F3J A;  3HKD E;  1OED C;  4EB6 E;  3QK6 A;  3BQI A;  3HR0 A;  4LFA T;  3IHR A;  4CN1 A;  3PU8 A;  2N1G A;  4KP3 C;  4EED A;  2IDO B;  5FY0 A;  3PTR B;  4I0U A;  5JDH A;  1J5E T;  5CA0 E;  2XY8 B;  3TLW A;  4HFC A;  5AQM B;  4LFB T;  5AQL B;  4AQY T;  3I9W A;  3RYH E;  5HCJ A;  4ZI7 E;  3LK2 B;  3FHN A;  4DBQ A;  3AE4 A;  3N2O A;  1MMD A;  3RQW A;  2Y48 B;  1M62 A;  3O4X E;  4MBQ A;  1XNR T;  2VKD A;  2DCF A;  4DV1 T;  5LBM A;  4B3S T;  3KV9 A;  2XM1 A;  5H6Q B;  1W9R A;  1HFA A;  5IHY A;  3Q9D A;  3JC6 D;  5AQK B;  1E2A A;  4PK5 A;  3UT5 E;  3T1H T;  3RPU A;  3LSV A;  2MAW A;  2IUB A;  4O8S A;  2EHO C;  4IHJ E;  3AXJ B;  2WMO A;  4X66 T;  1MIY A;  3P4P A;  4YHJ A;  1Y64 B;  3S4U A;  3E0Z A;  5JDN A;  2WU5 A;  4LF6 T;  2BBH A;  2R6G F;  4TNV A;  4U3C A;  3P8C D;  3P7I A;  3C50 A;  5LP6 E;  3A8Y C;  3UQ7 A;  4P0B A;  5FXZ A;  5AQT B;  4XZC A;  4DR3 T;  5JDM A;  5FVK A;  4AKR B;  4OX9 T;  2RPA A;  1IBL T;  4EAH A;  4H9R C;  2CHO A;  5L3D B;  1IJ6 A;  5LHI B;  3MK7 C;  3PUV F;  4GK0 E;  1GQE A;  3AEG A;  4TWF A;  2FBW A;  4G63 A;  4GOU A;  2V5D A;  3A5X A;  3AE3 A;  5JVD E;  3WAK A;  5JTG A;  4WNK A;  2XSA A;  3GN5 A;  1YD8 G;  2WCA A;  2XAQ B;  4X20 E;  2FJA A;  2W67 A;  2X9W A;  3FB2 A;  1WCR A;  2V26 A;  3T1Y T;  4L9I A;  1IBK T;  1KNP A;  2YU2 A;  4CN6 A;  2UUB T;  4BJN A;  4A97 A;  4YTP A;  1XDO A;  2Y8D A;  3CKD A;  1N36 T;  5JR9 C;  4CN4 A;  4Z8X A;  1UUS A;  3ZCJ A;  4A98 A;  2NWB A;  5HWX A;  3ZEF B;  3SS1 A;  4LMK A;  3NRY A;  5IWA T;  4DR4 T;  4X1K E;  4LF5 T;  1NEN A;  4HWC A;  4JV5 T;  2MTQ A;  3AEA A;  4IDN A;  3NRX A;  3P4R A;  4B3T T;  4JI4 T;  1J1J A;  3AA7 B;  3D0T A;  1QLB A;  4O4H E;  2BDE A;  4X1I E;  3UU6 A;  2MPK A;  1LVF A;  2ODU A;  4LFC T;  3ZN1 B;  4A56 A;  2XAG B;  5HEH A;  2H3R A;  3FXD B;  3UU5 A;  5F8P A;  3DP7 A;  3ANW A;  2LRL A;  2N2N A;  1I94 T;  2VB6 A;  3PUY F;  4DBR A;  4CXY A;  3L8R A;  1O3X A;  2VL0 A;  4CQI A;  3PUR A;  4G2A A;  1MMA A;  3GA8 A;  3Q5X A;  1FIO A;  4U2Z A;  2XAH B;  2ACZ A;  4YLH A;  3IF8 B;  3CVR A;  2G0U A;  3DTO A;  5AQV B;  1UGO A;  3NWI A;  2LE8 A;  3VRB A;  3TLS A;  2MOZ A;  1UCU A;  5HEU A;  2JQQ A;  2V6X A;  4KX6 A;  3PDY A;  3FZF B;  2GK9 A;  1G8X A;  2KWH A;  2BG9 C;  4DID B;  2KND A;  1Z8U A;  2OA5 A;  1LRZ A;  4B6X A;  3RLF F;  3AB3 B;  1XDP A;  2UXN B;  2K24 A;  4GKK T;  5FXX A;  2FJB A;  2DNX A;  4HFB A;  3ZYM A;  4N78 D;  2XQA A;  2QYW A;  4FJO A;  1I6Z A;  3RC3 A;  5LHG B;  2HN2 A;  1R8I A;  4CI2 B;  2YEV C;  3CQC B;  4HKA A;  3TKL B;  4U31 A;  2ZLY A;  2A3D A;  2WDV A;  2LSI A;  1YKE B;  2WQY A;  4UEL A;  4A5X A;  3V5U A;  4HN9 A;  4CI1 B;  2NW7 A;  3EAB A;  3OTO T;  4IE4 A;  4JBW F;  5E0O A;  2E9X C;  4ZS2 A;  1KNR A;  1XMQ T;  4EZ4 A;  4LF9 T;  2XJ7 A;  2D2S A;  2VKO A;  5HXE A;  2W63 A;  2WS3 A;  3K3O A;  3BQK A;  2CRB A;  3FZL B;  4TWD A;  4CXX A;  4IL9 A;  2V7L A;  4H9P C;  4H9O C;  4X64 T;  4I55 E;  2XAS B;  4DR1 T;  4DV2 T;  3ETV A;  3UFG A;  5HEG A;  2V8S V;  5FL0 A;  4ZEY A;  2IIU A;  4JEH B;  3FZK B;  2X68 A;  2HPL A;  2EHO D;  2CXD A;  1WYB A;  3MAC A;  5DAB A;  1MNE A;  2LM2 A;  2CWO A;  3LBX A;  3Q5E A;  3C64 A;  2KSR A;  4IL4 A;  3U78 A;  5FY7 A;  1W0B A;  1X79 A;  1YQ3 A;  2D0T A;  2V5C A;  3C4Z A;  2KMF A;  2V6Y A;  2FJE A;  3K8P C;  4ILU A;  3NVO A;  2KLQ A;  4LMJ A;  4OYJ A;  3RIU C;  4IE7 A;  5M4Y A;  2WWV A;  5CFB A;  5ABF A;  5IYZ E;  3SFD A;  3EHZ A;  5L3E B;  4WYV A;  1BR2 A;  2BBJ A;  4ERR A;  4JI1 T;  2K48 A;  4UV8 B;  3VKG A;  4TWH A;  2B1E A;  3SRZ A;  5ABH A;  4UF0 A;  3GN5 B;  2ES0 A;  3AED A;  2OLT A;  5FKY A;  2H7O A;  2B76 A;  3J7Y q;  4UVB B;  2D9D A;  4DV0 T;  1T72 A;  2W61 A;  1NEK A;  3QB5 K;  2W62 A;  3B57 A;  5J2U E;  2Q9Q D;  2XSB A;  4F6R C;  4DR2 T;  4BJM A;  4DVD A;  3VHL A;  3PU3 A;  3SWH A;  1HTJ F;  3T8O A;  4EOZ B;  4IDO A;  5LNK A;  1OXZ A;  1SUM B;  3VKH A;  3EDV A;  3I1A A;  3L39 A;  5IUX A;  4PFP A;  5LBQ B;  5HXH A;  4X62 T;  2JIW A;  5ABG A;  2H88 A;  3M65 A;  5AQU B;  3IA3 A;  1KFY A;  4DV4 T;  2VQE T;  5CA1 E;  4TUY E;  3HI2 A;  4YHH T;  1Z0P A;  3OPC A;  4HWI B;  3ANW B;  2IW5 B;  2F4V T;  4NXM T;  2W00 A;  2LEH A;  4JEU B;  2CCQ A;  3ZSS A;  4UVC B;  2WZH A;  2KXP B;  2DL1 A;  2M67 A;  4B3R T;  4JI6 T;  1BR1 A;  3F57 A;  4PFO A;  4GK5 E;  5CB4 E;  4HFH A;  4BAY B;  4X5T A;  2LLY A;  2LSK A;  1MMN A;  3OVU A;  4PJN A;  5HXR A;  4OFZ A;  4JUY A;  1VCT A;  1LKX A;  3JAE A;  4PK4 A;  3JCF A;  1L0V A;  4QXC B;  3RI5 A;  5AFU L;  4QXB B;  4DV6 T;  1JNZ A;  3RRW A;  3RRC A;  4QXH B;  2DI4 A;  2X0L B;  3KV6 A;  3RIF A;  5H6R B;  4JI0 T;  4JI5 T;  4HFD A;  5EZY E;  1UX4 A;  4OYK A;  1HS7 A;  2Z6E A;  2LRK A;  5KMG P;  4PK6 A;  3R84 B;  3PUQ A;  1OED A;  4GYS A;  4TNW A;  2D0U A;  3F2E A;  4U2Y A;  3ZC1 A;  3K3N A;  2CLY C;  5L4H A;  2K3W A;  4YFS A;  5CGM A;  2YOE A;  4IRE A;  4HWF A;  3VU7 H;  2FJD A;  3KVB A;  5FXW A;  3P4S A;  3N2K E;  2DLR A;  1X9B A;  3KIN B;  2CXF A;  4JI2 T;  5J2T E;  2UXB T;  4CI3 B;  3AA6 B;  3E22 E;  3ESL A;  3O1H A;  4AQF C;  2E9X D;  3V5S A;  3AEE A;  2VUR A;  1Y01 A;  2W0G A;  1EZ3 A;  3I0Q A;  1KF6 A;  1VCS A;  2WSS V;  2JJ9 A;  3I0O A;  3CQX C;  3AEF A;  5FVL A;  4L0R A;  1BR4 A;  2EHO A;  2XAJ B;  1ZV4 X;  3Q5W A;  3L3P A;  4H63 H;  2I6H A;  4MFR A;  4OHF A;  3LBX B;  4YY3 T;  5L47 A;  2L3L A;  3FZH B;  3ZJ1 A;  2XTL A;  3TLU A;  2CWY A;  4ZI3 C;  5AQF B;  3ZT5 A;  3H3M A;  2V6Y B;  3GMI A;  3RYC E;  2XQ8 A;  4YSY A;  4QKN A;  2MYS A;  2DHR A;  2WP9 A;  4K0U A;  4O4L E;  1HNZ T;  3AE1 A;  3WI3 A;  4GKJ T;  5AQP B;  3ZT6 A;  4HTE A;  3N9O A;  3O1J A;  4ZI2 C;  5ABF B;  5J1G A;  3N9Q A;  5FP3 A;  4AIU A;  3AEC A;  3SOL A;  2JMK A;  4JI3 T;  3VR9 A;  4IT4 A;  4O2A E;  2MBG A;  1HX1 B;  3AE5 A;  3Q5D A;  4AIS A;  4BA9 A;  4DR5 T;  4DR6 T;  3AE9 A;  5LG3 A;  4DR7 T;  3LFM A;  2WAU A;  1D0Y A;  4ANJ A;  2XQ6 A;  4EYU A;  2ODV A;  3RF1 A;  1D1B A;  5L3C B;  5LOV E;  5EK3 A;  2YKS A;  3C4X A;  4U7I A;  2V7M A;  2LSJ A;  2Q9Q A;  4J2C A;  4C90 A;  5C3J A;  2VKH A;  3RYF E;  3KV5 A;  2VL8 A;  3DJB A;  5JR9 A;  5HYA A;  2BG9 E;  3PV0 F;  2V7I A;  5A1L A;  2IC9 A;  2WU2 A;  4H63 V;  4QH1 A;  3UUB A;  4YXD A;  5AQI B;  1FEW A;  1HCI A;  2JQ9 A;  3JAF A;  2BS2 A;  5AQJ B;  5FNV E;  4IDP A;  4NUV A;  4DO0 A;  3UQ4 A;  5HWY A;  2XQ7 A;  2E5V A;  2LSG A;  4NUU A;  4WW0 A;  4TV9 E;  2UXC T;  2CA5 A;  4HE8 A;  2Y6X A;  2NOX A;  5LJN A;  2W4X A;  2JPF A;  3ZMZ B;  5FMN A;  5FY1 A;  2X9Y A;  3BQL A;  3CK6 A;  2QA7 A;  1WLX A;  3AXJ A;  2L8K A;  2LHN A;  4HFI A;  1JNR A;  5FXV A;  3AE2 A;  1T7S A;  1J5W A;  1E7P A;  5AQH B;  4AKH A;  2H7V C;  4WBN E;  1KK7 A;  2WB5 A;  3GWH A;  3C4W A;  3PUG A;  3B13 A;  2W2U A;  2CM0 A;  4LML A;  3HL6 A;  1ZOY A;  1NAF A;  3CQG B;  5L4E A;  2RA1 A;  3EDU A;  5AQN B;  5HAX A;  4KHZ F;  4AKI A;  4CZZ B;  2FUP A;  4H9Q C;  1D0X A;  4ZHQ E;  4EIW A;  3OYZ A;  3B5M A;  4NPP A;  3PJA A;  3RX6 A;  2C5J A;  5DJQ C;  4QH5 A;  4DUY T;  3KBT A;  2PJQ A;  4EZH A;  4L5G A;  1XMO T;  1S94 A;  1WFD A;  4ZXL A;  3ETU A;  2BG9 A;  3LG7 A;  5AQS B;  1T8B A;  2YDR A;  2CHN A;  4IE0 A;  2CPT A;  2XHE B;  1AJ3 A;  1MIV A;  4YSX A;  4UV9 B;  1V9D A;  2X51 A;  3ZLI A;  4HEA A;  3ZYL A;  2YU1 A;  2A9U A;  5ADX L;  2X9H A;  1W0A A;  3FXE B;  3K1S A;  4I4T E;  4TX5 A;  4COF A;  3LK4 2;  2X67 A;  2E5L T;  1FJG T;  2BKO A;  5ETW A;  2DWK A;  3UFE A;  5GON E;  4LF8 T;  2PTF A;  3PUW F;  2HN1 A;  4IST A;  3FBL A;  4GIW A;  4EYY R;  4P09 A;  4KI0 F;  2LM9 A;  1US7 B;  3NKZ A;  4QWN B;  4AXP A;  4E7Z A;  4KHP T;  4X65 T;  4HGA A;  4Z90 A;  5ABE A;  1WYC A;  2JQH A;  4HWD A;  2E9X A;  4QHO A;  4IE5 A;  3ZYK A;  4K0K T;  2XPK A;  2XQ5 A;  3CX7 B;  1HG2 A;  2LT3 A;  2E2A A;  2X0Y A;  5JRC A;  2ZMA A;  4I50 E;  2KT9 A;  4YT0 A;  1G73 A;  2BVL A;  3FBZ A;  3RKO A;  5EK2 A;  5L3G B;  1MND A;  5HEJ A;  1SA0 E;  1D1C A;  3QC9 A;  3N2G E;  3ZC0 A;  3ZMT B;  3MXZ A;  5CJ5 A;  2M6B A;  4F8H A;  3RHW A;  3N9L A;  2P9B A;  4DV7 T;  1CUN A;  3QB5 A;  4H9S E;  5JRE A;  3TLT A;  3CIR A;  2UUC T;  5DQW A;  1NWM X;  1OED E;  2HPJ A;  3ZMS B;  2CXL A;  2VVN A;  3QNU A;  2N9D A;  3EAM A;  4AQG A;  2QGS A;  2WMN A;  2VWA A;  3I9Y A;  3AE8 A;  2BZB A;  1OWA A;  3RIU A;  3OKQ A;  1ZKE A;  3P50 A;  2SPC A;  4MHC A;  5L2L A;  4HWH A;  3AE7 A;  2WBL A;  3OJA A;  2J47 A;  3AA1 B;  3PUA A;  1FMV A;  2L9Q A;  4ZI2 D;  2K5B B;  4YJ2 E;  4JLE A;  5JQG E;  5FL1 A;  4UIG A;  2VK9 A;  3ZN0 B;  3UU8 A;  3OYX A;  3ONL C;  2J4G A;  5HXC A;  1N34 T;  2CE7 A;  2NP9 A;  2Q9Q B;  4MAL A;  5C8Y E;  2W66 A;  4UVA B;  3ZST A;  2V7J A;  2ACX A;  5JR9 B;  2YN6 A;  2NW9 A;  2M6I A;  1CHU A;  2IAK A;  5BMV E;  5LYJ E;  3N9P A;  3AEB A;  1UUR A;  5LGT B;  1D0Z A;  4U33 A;  2XQ9 A;  2JMH A;  2XM2 A;  2YIN A;  2X66 A;  4UXN B;  3H3A A;  3RC8 A;  4LF4 T;  1T98 A;  2BKN A;  3N9N A;  2VVS A;  5LG4 A;  2I0M A;  3HKB E;  2WZI A;  2AXD S;  3J9X 1;  3HA4 A;  3E08 A;  1HR0 T;  2BVM A;  2PFV A;  4XBF B;  1UK5 A;  2QRX A;  3MZK B;  3OBV E;  2LHR A;  2XQ4 A;  3UUL A;  3ZKR A;  4QH4 A;  3PUS A;  1IZN B;  2IML A;  2CBI A;  4U74 A;  4WZX A;  2LOS A;  5J0Z A;  4KUM B;  3L09 A;  2H89 A;  4C91 A;  3VR8 A;  2IC6 A;  4TZ4 C;  3BK9 A;  3AVS A;  5AQO B;  2IHR 1;  3ONJ A;  4IIJ E;  5C2T A;  1SE7 A;  3ABV A;  3ONX A;  2C5K T;  3NZQ A;  3RQU A;  2V1D B;  4AKG A;  3IBP A;  2VAS A;  1ZP0 A;  1WRD A;  3U3I A;  2AE9 A;  4HFV A;  2XQ3 A;  4DND A;  3H37 A;  1YKH B;  1IAP A; 
#chains in the Genus database with same CATH homology
 3U78 A;  4KP3 C;  5FY7 A;  1X79 A;  5FY0 A;  3PTR B;  2D0T A;  4NUV A;  4DO0 A;  3C4Z A;  2KMF A;  5HWY A;  5LJM A;  5JDH A;  3K8P C;  2X9X A;  4ILU A;  5CA0 E;  1YW0 A;  2KLQ A;  2VKJ A;  4OYJ A;  2LSG A;  4IE7 A;  3I9W A;  4U72 A;  2Q9Q C;  5M4Y A;  4NUU A;  4WW0 A;  4TV9 E;  3RYH E;  4ZI7 E;  2CA5 A;  4HE8 A;  5IYZ E;  4CXW A;  2Y6X A;  3LK2 B;  2NOX A;  3RYI E;  5LJN A;  2JPF A;  3ZMZ B;  2C5I T;  5FMN A;  3FHN A;  4TN7 B;  4DBQ A;  5FY1 A;  4ZS3 A;  1B7T A;  2X9Y A;  3BQL A;  2QA7 A;  3N2O A;  1MMD A;  1WLX A;  5L3E B;  2Y48 B;  1BR2 A;  2L8K A;  3KDS E;  2LHN A;  3O4X E;  4MBQ A;  4ERR A;  5HXS A;  4X1Y E;  3O9X A;  5FXV A;  3KFW X;  2K48 A;  2VKD A;  4UV8 B;  3VKG A;  2DCF A;  2B1E A;  5LBM A;  3SRZ A;  1HG5 A;  4UF0 A;  2NTY A;  3GN5 B;  4P0A A;  2ES0 A;  3KV9 A;  2H7V C;  4AKH A;  4WBN E;  1KK7 A;  5H6Q B;  3NZP A;  1HFA A;  5IHY A;  3Q9D A;  3JC6 D;  3GWH A;  2PG8 A;  3C4W A;  3PUG A;  4PK5 A;  3RH3 A;  3B13 A;  1FMW A;  2H7O A;  2CM0 A;  3J7Y q;  3C51 A;  4UVB B;  4IE6 A;  3HL6 A;  1NAF A;  4M1P A;  5L3F B;  1E1H B;  3CQG B;  3UT5 E;  3RPU A;  2W61 A;  2W62 A;  3B57 A;  5J2U E;  2Q9Q D;  2I59 A;  2RA1 A;  4O8S A;  4F6R C;  2EHO C;  3EDU A;  3AVR A;  2DWG A;  4IHJ E;  5HAX A;  2WMO A;  3ZCI A;  2KWI B;  2E9X B;  1U4Q A;  3ZMV B;  4AKI A;  1S35 A;  4CZZ B;  4H9Q C;  4BJM A;  4DVD A;  3VHL A;  1D0X A;  3PU3 A;  3SWH A;  4IDZ A;  4ZHQ E;  1HTJ F;  1MIY A;  4H9N C;  4AQF A;  3T8O A;  3OYZ A;  4EIW A;  4UF0 B;  4YHJ A;  4MLK A;  3RX6 A;  1Y64 B;  3S4U A;  2C5J A;  3E0Z A;  4EOZ B;  3AAA B;  5JDN A;  5DJQ C;  3KBT A;  2PJQ A;  4EZH A;  2NTX A;  5LNK A;  1OXZ A;  4L5G A;  1S94 A;  2YK0 A;  5JRC B;  3EDV A;  3VKH A;  3ETU A;  3MJX A;  3I1A A;  2WWU A;  3LG7 A;  3P8C D;  3P7I A;  3C50 A;  4PFP A;  5LP6 E;  5LBQ B;  5HXH A;  4P0B A;  5FXZ A;  4IE0 A;  1KNZ A;  4XZC A;  5JDM A;  2XHE B;  2A2F X;  3M65 A;  5LCY A;  2C0S A;  1MIV A;  1AJ3 A;  4UV9 B;  1V9D A;  2WM9 A;  2X51 A;  3ZLI A;  4AKR B;  4HEA A;  3ZYL A;  4KBM B;  2YU1 A;  4EAH A;  4H9R C;  3AAE B;  5CA1 E;  5ADX L;  4TUY E;  2X9H A;  3ZMU B;  3HI2 A;  4ZOL E;  5L3D B;  4DMV A;  3FXE B;  1IJ6 A;  5LHI B;  1Z0P A;  3MK7 C;  4GK0 E;  3ANW B;  4TX5 A;  4I4T E;  2IW5 B;  3LK4 2;  2X67 A;  4DMW A;  2W00 A;  2LEH A;  4JEU B;  2LJL A;  2CCQ A;  4UVC B;  2CEA A;  5ETW A;  2DWK A;  4G63 A;  4GOU A;  3UFE A;  5GON E;  3A5X A;  5JVD E;  3WAK A;  3CWZ B;  2KXP B;  3JC6 C;  4WNK A;  2M67 A;  3GN5 A;  3QUJ A;  1YD8 G;  4IST A;  2LOP A;  3FBL A;  1BR1 A;  2XAQ B;  3F57 A;  4PJM A;  4GK5 E;  4GIW A;  4PFO A;  4X20 E;  3W15 B;  5CB4 E;  4EYY R;  2X9W A;  3FB2 A;  4O4J E;  1IJ5 A;  2V26 A;  4P09 A;  4BAY B;  1U5P A;  4L9I A;  2YU2 A;  2LM9 A;  4OK0 A;  4BJN A;  1US7 B;  2J1D G;  4QWN B;  4AXP A;  4GYR A;  4E7Z A;  2RP4 A;  3N9M A;  2LSK A;  2Y8D A;  3CKD A;  5JR9 C;  1MMN A;  4HGA A;  4PJN A;  4Z8X A;  5HXR A;  3ZCJ A;  4OFZ A;  3R6N A;  1WYC A;  2NWB A;  3EUH A;  5HWX A;  2E9X A;  3ZEF B;  4JUY A;  3SS1 A;  4QHO A;  1LVK A;  4IE5 A;  3NRY A;  3ZYK A;  3CPZ A;  3AAI A;  4X1K E;  2ZM0 A;  3CX7 B;  1LKX A;  2MTQ A;  4PK4 A;  5LA6 E;  3CX6 B;  2A72 A;  4FI5 A;  4QXC B;  1HG2 A;  2LT3 A;  3NRX A;  5AFU L;  5JRC A;  2ZMA A;  4QXB B;  4I50 E;  2KT9 A;  1G73 A;  2BVL A;  3FBZ A;  3RKO A;  3RRW A;  3RRC A;  4QXH B;  5EK2 A;  5L3G B;  2DI4 A;  3AA7 B;  3D0T A;  4O4H E;  1MND A;  2X0L B;  3KV6 A;  2BDE A;  1SA0 E;  1D1C A;  3QC9 A;  3N2G E;  4WBO A;  5H6R B;  3ZC0 A;  2PBI A;  4X1I E;  3ZMT B;  5EZY E;  3Q2M A;  1LVF A;  1MMG A;  3MXZ A;  1UX4 A;  5JDL A;  3LK3 B;  4OYK A;  2ODU A;  3ZN1 B;  1BR0 A;  1HS7 A;  2Z6E A;  4A56 A;  2XAG B;  2H3R A;  5KMG P;  4PK6 A;  3FXD B;  3R84 B;  3N9L A;  3PUQ A;  2P9B A;  5F8P A;  1CUN A;  3DP7 A;  4H9S E;  3ANW A;  5JRE A;  2N2N A;  4GYS A;  5LGN B;  2VB6 A;  4AI6 A;  3MA9 A;  5DQW A;  1NWM X;  4DBR A;  2D0U A;  3F2E A;  4CXY A;  5TAO A;  1O3X A;  3ZC1 A;  3K3N A;  2HPJ A;  4CQI A;  3ZMS B;  2CXL A;  3PUR A;  4G2A A;  1HF8 A;  1MMA A;  2CLY C;  3GA8 A;  2N9D A;  3K3Q C;  1FIO A;  2HH7 A;  3Q5X A;  4UEM A;  4AQG A;  4YFS A;  2XAH B;  3CX8 B;  4YLH A;  2QGS A;  2XQY A;  1VRB A;  3IF8 B;  3CVR A;  2WMN A;  3HKC E;  2VWA A;  3N5L A;  3I9Y A;  3ZJ2 A;  2D5U A;  2G0U A;  2BZB A;  1OWA A;  5JDQ A;  3VU7 H;  3KVB A;  3DTO A;  4V1A v;  3OKQ A;  5FXW A;  1ZKE A;  2NW8 A;  3C98 B;  2SPC A;  4MHC A;  5L2L A;  2LE8 A;  3N2K E;  3UUN A;  2DLR A;  4ASK A;  5KDM C;  3OJA A;  2WBL A;  5DQV A;  4QX7 B;  4PW8 A;  3KIN B;  2K9A A;  3AA1 B;  2MOZ A;  1UCU A;  3PUA A;  1FMV A;  2CXF A;  4PJL A;  5KX5 E;  2L9Q A;  4ZI2 D;  2K5B B;  2KZ7 B;  4YJ2 E;  2JQQ A;  4JLE A;  5J2T E;  5LHH B;  4CI3 B;  3AA6 B;  5JQG E;  1D1A A;  3NBX X;  3IEE A;  3E22 E;  3PDY A;  3ESL A;  4UIG A;  2VK9 A;  3O1H A;  3ZN0 B;  4AQF C;  2E9X D;  3V5S A;  5L3B B;  2GK9 A;  3OYX A;  4TV8 E;  3AA0 B;  1G8X A;  2W0G A;  4O2B E;  4EXT A;  1EZ3 A;  3I0Q A;  5HXC A;  5FYM A;  1MIW A;  2KWH A;  2WSS V;  2CE7 A;  2NP9 A;  2KND A;  2JJ9 A;  2Q9Q B;  4MAL A;  5C8Y E;  3I0O A;  3CQX C;  4UVA B;  2OA5 A;  3LJC A;  2V7J A;  1LRZ A;  4B6X A;  3F31 A;  2ACX A;  4L0R A;  1BR4 A;  5JR9 B;  2NW9 A;  3AB3 B;  2EHO A;  4QX8 B;  2XAJ B;  2IAK A;  5JDF A;  5BMV E;  2UXN B;  1ZV4 X;  2K24 A;  3N9P A;  3Q5W A;  5LYJ E;  3L3P A;  4I43 B;  1SHZ C;  5FXX A;  5LGT B;  4H63 H;  4MFR A;  4OHF A;  1D0Z A;  3LBX B;  2DNX A;  3ZYM A;  2XAF B;  4N78 D;  2KIN B;  2L3L A;  4FJO A;  3RC3 A;  2JMH A;  4PAG A;  3WAJ A;  2JRK A;  2YIN A;  2X66 A;  1UX5 A;  3H3A A;  4UXN B;  3ZJ1 A;  5LHG B;  2XTL A;  3RC8 A;  1T98 A;  3N9N A;  3UTK A;  4E7S A;  2CWY A;  4ZI3 C;  4CI2 B;  5LG4 A;  2YEV C;  3CQC B;  3HKB E;  1ZHC A;  4YJ3 E;  3GMI A;  4HKA A;  3J9X 1;  4IGU A;  3RYC E;  3TKL B;  4AKL A;  3HA4 A;  3EVY A;  3E08 A;  2ZLY A;  4PJJ A;  4QKN A;  2MYS A;  2A3D A;  1H7C A;  2DHR A;  2BVM A;  4ISS A;  2EHO B;  2LSI A;  2PFV A;  4K0U A;  4PNI A;  4O4L E;  1YKE B;  3MKD A;  4XBF B;  4UEL A;  4ADZ A;  3WI3 A;  3MZK B;  2ZM2 A;  3V5U A;  4HN9 A;  3OBV E;  2E8I A;  3KV4 A;  4HTE A;  3N9O A;  4CI1 B;  2LHR A;  5LGU B;  2LSY A;  3UUL A;  2NW7 A;  3O1J A;  4ZI2 C;  5JDG A;  3PUS A;  5J1G A;  4IE4 A;  3CML A;  1IZN B;  3N9Q A;  5FP3 A;  4U74 A;  3SOL A;  5EK4 A;  2JMK A;  2LOS A;  4O2A E;  5E0O A;  2MBG A;  2E9X C;  4KUM B;  3HKE E;  2V7K A;  4ZS2 A;  4BA9 A;  3L09 A;  5JH7 E;  3UUX B;  4EZ4 A;  2D2S A;  3KBU A;  2WAU A;  3LFM A;  4C91 A;  1D0Y A;  2VKO A;  4ANJ A;  5HXE A;  2W63 A;  4EYU A;  3O1I A;  3KVA A;  2IC6 A;  5LXT E;  4TZ4 C;  2CLY B;  2ODV A;  3K3O A;  4ZI3 D;  3BQK A;  1ZEE A;  1VOM A;  3ZPO A;  4CXX A;  1D1B A;  5L3C B;  4XAX B;  5LOV E;  5EK3 A;  3BK9 A;  2XUE A;  3C4X A;  4O4I E;  2V7L A;  4H9P C;  1HX8 A;  3AVS A;  4KMC A;  1WR6 A;  2V7M A;  2LSJ A;  4H9O C;  4I55 E;  2Q9Q A;  2UXX B;  1QSD A;  4J2C A;  4C90 A;  2XAS B;  3PE0 A;  2CMR A;  2VKH A;  3ETV A;  3RYF E;  3UUM A;  3KV5 A;  2VL8 A;  4IIJ E;  3DJB A;  5JR9 A;  5HYA A;  4JEH B;  3ONX A;  2ZM8 A;  1QUU A;  2C5K T;  2V7I A;  2X68 A;  5A1L A;  2IC9 A;  3NZQ A;  4H63 V;  5F3J A;  2V1D B;  4AKG A;  3IBP A;  2HPL A;  2VAS A;  2EHO D;  3HKD E;  2CXD A;  1WYB A;  3MAC A;  5DAB A;  1MNE A;  4EB6 E;  1WRD A;  1FEW A;  3U3I A;  2CWO A;  3QK6 A;  3LBX A;  4HFV A;  1HCI A;  3BQI A;  4DND A;  3C64 A;  3HR0 A;  5FNV E;  3IHR A;  3PU8 A;  3H37 A;  1YKH B;  1IAP A;  2N1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...