3Q5XA

Structure of proteasome tether
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
193
structure length
193
Chain Sequence
b'ARQLPVGEQLPLSRLLQYSDKQQLFTILLQCVEKHPDLARDIRGILPAPSMDTCVETLRKLLINLNDSFPYGGDKRGDYAFNRIREKYMAVLHALNDMVPCYLPPYSTCFEKNITFLDAATNVVHELPEFHNPNHNVYKSQAYYELTGAWLVVLRQLEDRPVVPLLPLEELEEHNKTSQNRMEEALNYLKQLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein cut8
publication title Structure of Proteasome Tether
rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
total genus 62
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2010-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08559 Cut8 Cut8, nuclear proteasome tether protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3q5xA00
3Q5XA 3Q5WA
chains in the Genus database with same CATH superfamily
2XQ4A 4HE8A 3HKDE 4QWNB 4ZOLE 4HFCA 4F6RC 4JI5T 4U3CA 4PFOA 3UFEA 2ZM0A 3HA4A 5KDMC 2ODVA 4KBMB 3UQ4A 3ZYMA 3ZC1A 3H3AA 2V6XA 3LFMA 2X0HA 2JQHA 4U33A 4DUZT 4NUVA 5JDFA 2WSSV 2IIUA 3ZJ2A 3KBTA 1Y64B 4C91A 3AE5A 2A72A 4ZEYA 2V26A 5FP3A 3MKDA 1MNDA 2XM2A 4O8SA 2DWGA 1NAFA 3P7IA 1OEDA 4QHOA 4CQIA 4U7IA 3B5MA 4EAHA 5L3CB 1YKEB 5HAXA 2VK9A 3FZHB 3F57A 4TV9E 3JCFA 4JLEA 1Z8UA 2EHOD 4AQFC 2XSBA 4UR9A 1IAPA 5HXCA 2YDRA 4H9RC 4I4TE 4H9OC 2CHOA 5FXWA 4WBNE 3NRXA 5ABFB 3E0ZA 3PV0F 3ZT6A 2QGSA 4GK0E 5JH7E 2PJQA 4QX8B 1LVKA 3JAEA 4GYSA 2FJDA 2NTYA 2CBJA 4A98A 3R6NA 4O2AE 1HNXT 2DWKA 2BVMA 2VKHA 4DR1T 2ZLYA 3SFDA 4QXBB 5JRCA 1JNZA 2DNXA 4IDNA 1M62A 4JI0T 2YN6A 3I0OA 2W4XA 5FXZA 1IJ6A 2D9DA 1WLXA 5CGMA 2RA1A 1U5PA 4DNDA 3AE4A 5L4EA 2QRXA 4BJNA 2EHOC 2WAUA 3E22E 2HPJA 1VRBA 1T8BA 2JRKA 1CHUA 2LM9A 4XZCA 1UX5A 3AEFA 4YHHT 2MAWA 2XHEB 3UU6A 3X1DA 2AXDS 2H88A 1HFAA 4NIQA 2H7OA 4HEAA 4IREA 3ABVA 4YSXA 1YQ3A 4IDQA 3ZCJA 1V9DA 1FMWA 1UUSA 3AE6A 4KP3C 5FL0A 4TWFA 4PK5A 2LKHA 3JC6C 1QLBA 4GKKT 3UUMA 4U31A 4P0BA 5IUXA 2FJEA 3EHZA 4CN1A 4U74A 2XQ3A 2NW9A 3CX6B 3TLWA 3ZSTA 4B3TT 2LRKA 4ZS2A 5LHGB 1MNEA 3L39A 4BAYB 4KUMB 1N32T 5C2TA 3AAEB 1WR6A 4HFHA 4LF8T 2D0UA 2PFVA 2YU2A 4ADZA 1B7TA 4OX9T 4DV0T 3AVSA 3HI2A 3PTRB 2CXFA 5CA1E 3NRYA 5CFBA 3Q5DA 4YLHA 3Q5XA 4DMWA 2V7JA 5LHHB 2IW5B 4IGUA 2BVLA 2VVNA 2X9HA 3RF1A 1MMGA 2V7IA 1IJ5A 4QXCB 2W00A 2UUAT 3AA7B 4UEMA 2W66A 3LG7A 4YJ2E 3GN5B 5LG4A 3MACA 4U2YA 4AKLA 4I50E 3AA1B 4YFSA 4YHJA 2WCAA 2E8IA 1HNZT 1YD8G 2V7LA 2YINA 2SPCA 1LVFA 5F3JA 4COFA 4ZI2D 2X9XA 2OLTA 1J5WA 4P1NA 4H9QC 4A97A 5JDQA 1BR2A 4K0KT 2VKDA 1YKHB 2M6BA 3CVRA 3RIUC 2VASA 5JR9A 3LK42 3C4ZA 3ZMSB 5ABEA 2J4GA 3CWZB 5JVDE 4P09A 4G2AA 4QX7B 4OHFA 1KK7A 5LGNB 2J1DG 4UVAB 1XMQT 4YT0A 4Z91A 4NXNT 5FYMA 4LFBT 3J9X1 3QC9A 3BK9A 3N2OA 5JREA 5HEHA 4KI0F 1T72A 3ZN1B 4HTEA 4X1KE 1SHZC 3ZMUB 2WY2A 2DL1A 4TV8E 3RYFE 3N9QA 3QOFA 2E2AA 2XUEA 1N34T 3OKQA 4JI3T 2CRBA 2CLYC 3QNUA 2YEVC 4TNWA 5HXRA 3L09A 3WAKA 1ZP0A 2KLQA 2V7KA 3RHWA 3P4QA 4ILUA 4DV4T 1OWAA 2CWOA 5IHYA 2LHNA 2LE8A 5FXXA 4ZI2C 4QH1A 2WMNA 2JMKA 1VOMA 4DV7T 4ILBA 2WS3A 2CBIA 5E0OA 2W0GA 5L3BB 5JDLA 1H7CA 2NOXA 3T1YT 3PU8A 4JYAT 3LDQB 3EAMA 4KX6A 1SUMB 3GMIA 2LSKA 4QH5A 3D0TA 5TAOA 4IE7A 4DBRA 3AEDA 4DUYT 1YXRA 4WBOA 2CE7A 5ETWA 5JRCB 5KX5E 3ETVA 3AE3A 5LB7B 2P9BA 3RC3A 2XY8B 3KVBA 5BMVE 1KNZA 1QSDA 2XAJB 2V5DA 2XAGB 3OPCA 5FXVA 2C0SA 2LSGA 2V6YA 4ZZCA 3I9WA 3ZMZB 3TLSA 4AKHA 4MLKA 2YDQA 2LT3A 2WDRA 4IE6A 5HWYA 5FVLA 1FIOA 4MFRA 1ZV4X 3RGLA 4X1IE 2HN1A 2I6HA 2XPKA 3PDYA 2RP4A 3ZSSA 3EDVA 3RYIE 3WI3A 5JDNA 3HKCE 2UXXB 2LRLA 5AQOB 3PJAA 5DJQC 2FBWA 3ZMTB 2VB6A 4NXMT 4ZI3C 2E9XB 3TLTA 3IHRA 5L3FB 5AQQB 2K9AA 2RPAA 3MJXA 4UF0B 1I94T 4U7YA 4IDOA 4EGWA 1CUNA 3F31A 3CMLA 3MK7C 4O4LE 2KWIB 2ZMAA 2OA5A 4EEDA 2GK9A 3RIAA 4B3RT 3PUGA 5J2UE 4AQGA 1XNRT 2XM1A 3FXEB 3AXJA 4IE0A 1BR1A 2A2FX 2NP9A 4FI5A 3CKDA 3FZLB 3QK6A 2BS3A 5M4YA 3N9OA 4DMVA 3F2EA 5HEJA 2LOPA 3PE0A 4O4JE 3AB3B 2I59A 2JIWA 3C4WA 3P8CD 4GK5E 5KMGP 3AE9A 2YU1A 2FJBA 3RC8A 2XQ8A 1E1HB 5EK3A 4KHPT 2HH7A 1GQEA 4YSZA 2KINB 4BJMA 1NWMX 2BKOA 3ZEFB 5AQTB 3U78A 2IDOB 4DV1T 3EUHA 2IHR1 4UELA 3UU4A 4UIGA 2V7MA 4ISSA 3VKGA 5LMNT 4AKRB 2DHRA 2BG9B 4HFEA 5LXTE 1JNRA 3ETUA 3OVUA 4XBFB 1BR4A 2KWHA 1MIWA 2NW7A 3NBXX 3JC6D 3BQIA 3FBZA 3LK2B 2KZ7B 4JI7T 3ZYLA 3VKHA 4HN9A 2V8SV 4CXWA 2WZIA 4EZHA 4EYUA 1WYCA 5HEOA 2C5IT 2ODUA 2ZM6T 4YSYA 4DV6T 5F5WA 4YTPA 5LBMA 1SA0E 1UCUA 3CQXC 3FHNA 4NUUA 2MBGA 3RKGA 2XJ7A 4L9IA 4TNVA 2WWUA 5C8YE 3AA0B 3ZJ1A 3P4WA 3CX7B 2ACXA 4AQFA 4O4HE 3N9LA 5HXEA 4WW0A 2WDVA 2MOZA 2D2SA 3FZFB 2X66A 5HXSA 1Y01A 3I9YA 4HFIA 3I0QA 4YTMA 3PJAJ 1EZ3A 5LG3A 4UXNB 3AVRA 2XQ5A 5A1LA 2UXCT 1D0YA 4DR5T 3H37A 4HFBA 4MALA 1WCRA 5ABHA 1LKXA 4I55E 5J0ZA 4HWIB 2NTXA 1J1JA 4KHZF 5CB4E 2VKOA 4IE5A 4WZXA 4H9PC 5AQPB 3UU5A 1OEDE 4AISA 4EZ4A 2Q9QB 4J2CA 3QUJA 3PU3A 2B1EA 2M67A 3ONXA 3KBUA 2C5JA 3JADA 4IT4A 2LLYA 2HHHT 5LA6E 4E7ZA 4EYYR 1S94A 3CQGB 4V1Av 4JI8T 3AEAA 1ZEEA 5AQNB 2CMRA 1OXZA 2K5BB 5LP6E 3DJBA 1S35A 2EHOA 4CI3B 4HKAA 5HCMA 3SRZA 3VHLA 3KV4A 1W09A 2WB5A 1MMAA 2VL0A 2UUCT 4WNKA 2L3LA 2XQYA 2XAQB 5L47A 1XZYA 1FMVA 3IA3A 2M6IA 3MZKB 1IZNB 1L0VA 3GWHA 4GKJT 1D1AA 3UU8A 1HG2A 3M3ZB 3EVYA 4HFVA 4CI2B 2N9DA 2J47A 2BS2A 5ABFA 3PUZF 5FY1A 4HWHA 5HCJA 4IHJE 1R8IA 3CPZA 4B3MT 3P4SA 2JPFA 4AQYT 1Z0PA 3N9NA 3AE7A 3PUYF 3PUQA 1HG5A 2X9WA 3MXZA 3ZT5A 2Q9QC 2WMOA 2LJLA 3QB5A 4CN4A 3T8OA 3K3NA 4PAGA 5JDMA 1US7B 3RPUA 1X79A 3NKZA 4PJJA 2W61A 3N9PA 5HXHA 3OTOT 3LBXA 5J1GA 4JI4T 3RYCE 4DR6T 1HNWT 4ZZBA 2XSAA 1WRDA 3UUNA 3T1HT 3UU3A 2LEHA 5AQKB 2L9QA 4GOUA 3RRCA 1OEDB 2D0TA 3RQWA 4Q25A 4F8HA 2ZM2A 4Z90A 2VKJA 2Y48B 2W67A 3FBLA 3CX8B 4PJNA 2UUBT 4YY3T 1MIYA 3KV6A 1G8XA 2XZEA 4NPPA 2UXDT 1HX8A 4YJ3E 2NWBA 3ESLA 2X9YA 3ANWA 4IDPA 3B13A 4C90A 3IEEA 2YDSA 4X64T 3Q2MA 1XWMA 5HEUA 3K3QC 4ZI3D 5FKYA 5DQWA 3R84B 2BBJA 2XAFB 2YK0A 3C4XA 5AQRB 4IL4A 3RIUA 5FNVE 3HR0A 3RQUA 2VQFT 5LOVE 1IBLT 2VQET 3RKOA 3C50A 3TKLB 2J62A 2LOSA 1UK5A 2WP9A 3A8YC 2CXLA 1X9BA 3RLFF 1UGOA 2BG9E 4X62T 4ILAA 1G73A 2LSYA 4UVCB 3Q9DA 2F4VT 3KINB 5FVKA 2DLRA 3C64A 2UXBT 2MTQA 2W2UA 2E5LT 5HYAA 2WM9A 3H3MA 2XQ9A 4PW8A 5LGUB 4ASKA 2XQ6A 4DR3T 3VR9A 3AE1A 4DO0A 1WR0A 1OEDC 4TWHA 3TLVA 2CCQA 3W15B 3IF8B 4X5TA 2X67A 4EXTA 1IBMT 2PG8A 2WQYA 4B6XA 3OBVE 1ZOYA 4TUYE 3PUAA 1XDOA 3ZKRA 3UUXB 1J5ET 2Y6XA 2DCFA 3N5LA 2VURA 5GONE 3FXDB 4LMKA 4HWDA 3NZQA 3K3OA 3I1AA 5JQGE 2PTFA 3V5UA 5JTGA 4QKNA 4TZ4C 2H3RA 2IC6A 2A9UA 2WBLA 3S4UA 2BKNA 4EV6A 5JDHA 4L5GA 3FZMB 2V5CA 5DABA 3RRWA 3M65A 4JI1T 1XNQT 2E9XD 5LCYA 3OJAA 3NWIA 3PURA 3AECA 4LFCT 4JUYA 4Z8XA 5CJ5A 4LF5T 4ERRA 3MA9A 1HF8A 4GYRA 4HWCA 3EI0A 4LFAT 4EIWA 4AKIA 4HGAA 3ZN0B 1D1CA 2CA5A 5H6QB 4P0AA 2VWAA 2HPLA 1HCIA 2N1GA 3VR8A 1O3XA 3FB2A 3UT5E 3ZC0A 4AXPA 2D5UA 4L0RA 2CHNA 1FJGT 4OYJA 4G63A 4IE4A 2W63A 2EHOB 2LM2A 4JV5T 4LF7T 4GIWA 4AKGA 3RH3A 5C3JA 5IWAT 1D0ZA 3N9MA 1SE7A 4IIJE 3LSVA 4QXHB 2YKSA 1HTJF 2KMFA 3P4RA 1HR0T 4JI2T 2C5KT 2R6GF 3L3PA 3NZPA 4ILCA 2E9XC 4U2ZA 2FJAA 4OYKA 3UQ7A 5AQLB 1W0AA 1ZHCA 3N2KE 4PJMA 3PUXF 3PUWF 1I6ZA 2BDEA 2JJ9A 4DV3T 5FY0A 2XTLA 5L3EB 5FMNA 2XAHB 3J7Yq 4H9NC 3AEBA 4PFPA 3AAAB 2WDQA 3UUBA 3AE2A 4B3ST 5JR9B 3RIFA 4ZHQE 4CZZB 4XAXB 1HS7A 3O4XE 5L2LA 1W0BA 2KT9A 3LBXB 4DR4T 1T98A 4UV9B 2CWYA 5BR8T 1D0XA 3RX6A 1N36T 1XMOT 2BKPA 4FJOA 4H63V 1NEKA 4OK0A 4DIDB 3KV5A 1ZKEA 2MPKA 4DR2T 2ES0A 3BQKA 5ADXL 5F8PA 1MMNA 4X65T 3ZYKA 5JDGA 1WYBA 3RYHE 4U72A 3A5XA 2Y8DA 4IDZA 3WAJA 4LMJA 3IBPA 2JQQA 2WU2A 2BG9C 3TLUA 2JMHA 4HFDA 4ANJA 5LJNA 4DV2T 2I0MA 2K24A 4QH4A 4DR7T 2E9XA 3KDSE 2N2NA 2CEAA 4PNIA 2YOEA 4UF0A 2QA7A 4I43B 3ANWB 1FEWA 3ZMVB 2Q9QD 2IMLA 3CIRA 4JEHB 1W9RA 3AAIA 5AQJB 4YXDA 2CPTA 2IC9A 2WZHA 4X20E 3OYZA 2UXNB 3ZCIA 1IBKT 5FL1A 1KF6A 5JR9C 3Q5WA 5AFUL 2UU9T 2QVAA 4PJLA 5LNKA 5CA0E 5FY7A 4CI1B 3O1JA 3PUVF 2LKGA 2VVSA 2AE9A 3AEEA 4IL9A 2Z6EA 5J2TE 2XQAA 2WU5A 5DQVA 4DVDA 2K3WA 5AQFB 3Q5EA 2ACZA 1VCTA 2KXPB 4E7SA 1T7SA 1WFDA 2V6YB 4PK6A 3U3IA 3UTKA 5HEGA 2H7VC 2QYWA 4K0UA 3ZLIA 2BG9A 2CLYB 5AQGB 2B76A 2CXDA 2WWVA 4WYVA 4LF6T 2X51A 4JI6T 3BQLA 2X0LB 4TX5A 3FZKB 3PUSA 3K8PC 2NR4A 1UURA 4LMLA 3C51A 5L3DB 2XQ7A 3C98B 2JQKA 2E5VA 3HL6A 5AQIB 3V5SA 4UVBB 4PK4A 3CK6A 5AQHB 3O1IA 1M7KA 1KEYA 3K1SA 2X68A 3ONLC 2LSIA 3EDUA 4CXYA 2NW8A 3KV9A 4DBQA 2BBHA 3O9XA 2PBIA 1YQ4A 4A56A 3RI5A 5LJMA 3N2GE 1E7PA 3B57A 4ZS3A 3AXJB 1UX4A 1QUUA 4HWFA 2A3DA 2IUBA 3HKEE 3VRAA 1VCSA 3AE8A 4DV5T 1N33T 2W62A 2VL8A 4BA9A 1E2AA 5EK4A 5LHIB 5LMUT 3VRBA 2OV9A 4ZI7E 1U4QA 4X66T 4MBQA 5L4HA 4ZXLA 2X0YA 2HN2A 4N78D 4LF9T 1KNPA 3UULA 3O1HA 3SWHA 2L8KA 2LSJA 5KXJA 2LHRA 5AQVB 3SS1A 5LGTB 4AI6A 5AQSB 2MYSA 1KNRA 4MHCA 1HX1B 3LK3B 4ISTA 2V1DB 3NVOA 2Q9QA 3DTOA 3GA8A 1DU2A 3G06A 3SFEA 3VU7H 2FUPA 3P50A 1XDPA 3E08A 4YTNA 3KFWX 3ONJA 4CN6A 3A7MA 4X1YE 5AQMB 5LBQB 3KVAA 4UV8B 3ZPOA 5ABGA 4LF4T 1AJ3A 4TN7B 2ZM8A 5L3GB 1MMDA 2KNDA 4H9SE 1MIVA 4OFZA 3OYXA 2DI4A 1NENA 4CXXA 4I0UA 5HWXA 2IAKA 2BZBA 5H6RB 5IYZE 5EK2A 2BS4A 4TWDA 3HKBE 1D1BA 3JAFA 4M1PA 1KFYA 5LYJE 3LJCA 4EB6E 5AQUB 3AA6B 2JQ9A 4JEUB 3UFGA 4O4IE 3L8RA 2XASB 4EEBA 2H89A 2KSRA 1BR0A 3EABA 3ZT7A 4H63H 3DP7A 2CM0A 4AIUA 3SOLA 4JBWF 3P4PA 3GN5A 5EZYE 4EOZB 3QB5K 3AEGA 3CQCB 4O2BE 2G0UA 4A5XA 2K48A 1LRZA 1YW0A 4KMCA
chains in the Genus database with same CATH topology
1S94A 3CQGB 4HE8A 2BDEA 4V1Av 2JJ9A 3HKDE 1ZEEA 5FY0A 4QWNB 2XTLA 2CMRA 1OXZA 2K5BB 4ZOLE 5L3EB 5LP6E 3DJBA 1S35A 5FMNA 4F6RC 2EHOA 4TV8E 2XAHB 4CI3B 4HKAA 3RYFE 3J7Yq 4H9NC 4PFPA 3SRZA 3N9QA 3AAAB 4PFOA 3VHLA 3KV4A 3UFEA 5JR9B 2XUEA 3OKQA 1MMAA 2ZM0A 3HA4A 5KDMC 2ODVA 4KBMB 2CLYC 4ZHQE 4WNKA 2YEVC 4XAXB 3ZYMA 2L3LA 3O4XE 2XQYA 4CZZB 1HS7A 5HXRA 2XAQB 3L09A 5L2LA 3WAKA 3ZC1A 3H3AA 3LFMA 1FMVA 2KLQA 2V7KA 2KT9A 3LBXB 4ILUA 1OWAA 2CWOA 3MZKB 1IZNB 1T98A 3GWHA 2LHNA 4NUVA 5IHYA 2WSSV 2LE8A 4UV9B 5FXXA 5JDFA 1D1AA 4ZI2C 2CWYA 2WMNA 3ZJ2A 2JMKA 1VOMA 1HG2A 1D0XA 3EVYA 3RX6A 3KBTA 4HFVA 5E0OA 2N9DA 4CI2B 1Y64B 4FJOA 4C91A 4H63V 2W0GA 5L3BB 5JDLA 4OK0A 1H7CA 2NOXA 3KV5A 1ZKEA 5FY1A 2A72A 2ES0A 3BQKA 5ADXL 4IHJE 2V26A 3PU8A 5F8PA 3CPZA 1MMNA 5FP3A 3MKDA 1MNDA 2JPFA 4O8SA 2DWGA 1NAFA 1Z0PA 3ZYKA 5JDGA 3GMIA 3N9NA 2LSKA 3P7IA 1WYBA 4QHOA 3RYHE 4U72A 4CQIA 3A5XA 3PUQA 1HG5A 2Y8DA 4EAHA 4IDZA 5L3CB 1YKEB 2X9WA 5HAXA 2VK9A 3D0TA 3MXZA 3WAJA 2Q9QC 3IBPA 2WMOA 4IE7A 5TAOA 2JQQA 2LJLA 4DBRA 3F57A 4TV9E 3T8OA 3K3NA 4WBOA 2JMHA 4PAGA 4ANJA 5JDMA 5LJNA 2CE7A 1US7B 4JLEA 5ETWA 2EHOD 2K24A 5JRCB 5KX5E 4AQFC 2E9XA 3KDSE 3RPUA 2N2NA 2CEAA 3ETVA 4PNIA 1IAPA 5HXCA 1X79A 2P9BA 4H9RC 4I4TE 3RC3A 3KVBA 4PJJA 2W61A 1QSDA 3N9PA 4H9OC 5BMVE 5HXHA 1KNZA 3LBXA 2XAJB 4UF0A 5J1GA 2QA7A 4I43B 3ANWB 2XAGB 1FEWA 3ZMVB 3RYCE 5FXWA 2Q9QD 4WBNE 5FXVA 3NRXA 2C0SA 2LSGA 3I9WA 3E0ZA 3ZMZB 4JEHB 3AAIA 4AKHA 1WRDA 4MLKA 3UUNA 2IC9A 2LT3A 4X20E 3OYZA 4IE6A 5HWYA 2QGSA 2UXNB 2LEHA 1FIOA 2L9QA 4GK0E 4MFRA 4GOUA 5JH7E 2PJQA 1ZV4X 3ZCIA 4QX8B 1LVKA 4GYSA 4X1IE 3RRCA 2NTYA 2D0TA 5JR9C 3Q5WA 5AFUL 3PDYA 3R6NA 4PJLA 2RP4A 5LNKA 5CA0E 3EDVA 5FY7A 3RYIE 3WI3A 2ZM2A 4O2AE 5JDNA 2VKJA 2Y48B 3HKCE 2DWKA 2BVMA 3FBLA 4CI1B 3O1JA 2UXXB 3CX8B 5DJQC 4PJNA 3ZMTB 1MIYA 2VB6A 3KV6A 4ZI3C 2VKHA 2E9XB 2Z6EA 2ZLYA 1G8XA 3IHRA 5J2TE 4QXBB 5JRCA 5L3FB 1HX8A 2DNXA 2K9AA 4YJ3E 2NWBA 3MJXA 4UF0B 5DQVA 4DVDA 3ESLA 2X9YA 1CUNA 3F31A 3I0OA 2KXPB 4E7SA 3ANWA 5FXZA 1IJ6A 3CMLA 1WLXA 3B13A 4PK6A 3MK7C 4O4LE 2RA1A 2KWIB 1U5PA 4C90A 3U3IA 3IEEA 2ZMAA 3UTKA 3Q2MA 2OA5A 2H7VC 4K0UA 3K3QC 3ZLIA 4ZI3D 4DNDA 2GK9A 5DQWA 3PUGA 5J2UE 4AQGA 3R84B 4BJNA 2XAFB 2YK0A 3C4XA 2EHOC 3FXEB 2CLYB 2WAUA 4IE0A 3E22E 5FNVE 1BR1A 2A2FX 2NP9A 3HR0A 4FI5A 3CKDA 5LOVE 2HPJA 1VRBA 2CXDA 3C50A 3QK6A 3RKOA 3TKLB 5M4YA 2JRKA 2LM9A 2LOSA 4XZCA 2X51A 1UX5A 3N9OA 3BQLA 2X0LB 4TX5A 4DMVA 2CXLA 3F2EA 2XHEB 3PUSA 3K8PC 1HFAA 2LOPA 3PE0A 4O4JE 2H7OA 3AB3B 4HEAA 2I59A 3C51A 1G73A 3C4WA 3P8CD 4GK5E 3C98B 2YU1A 5KMGP 5L3DB 2LSYA 4UVCB 3RC8A 3Q9DA 3HL6A 3V5SA 4UVBB 1E1HB 4PK4A 3O1IA 5EK3A 3KINB 2HH7A 3ZCJA 1V9DA 1FMWA 2DLRA 3C64A 2KINB 4BJMA 2MTQA 2X68A 4KP3C 2LSIA 1NWMX 4PK5A 3EDUA 3ZEFB 5HYAA 2WM9A 4CXYA 2NW8A 3U78A 4PW8A 3KV9A 3JC6C 3EUHA 4DBQA 5LGUB 4UELA 4ASKA 4UIGA 3UUMA 4DO0A 3O9XA 2V7MA 4ISSA 4P0BA 3VKGA 2PBIA 4AKRB 4A56A 2DHRA 5LJMA 2CCQA 3N2GE 3W15B 3B57A 3IF8B 4ZS3A 5LXTE 2X67A 4EXTA 2PG8A 4B6XA 3OBVE 1UX4A 4U74A 1QUUA 2NW9A 4TUYE 3CX6B 2A3DA 3ETUA 3HKEE 4XBFB 1BR4A 3PUAA 2KWHA 4ZS2A 1MIWA 2NW7A 5LHGB 2W62A 1MNEA 3UUXB 4BAYB 2Y6XA 2VL8A 3NBXX 3JC6D 3BQIA 4BA9A 3FBZA 2DCFA 4KUMB 3N5LA 5EK4A 5LHIB 3LK2B 2KZ7B 5GONE 3FXDB 4ZI7E 3NZQA 3K3OA 3I1AA 3AAEB 1WR6A 1U4QA 5JQGE 2D0UA 3V5UA 2PFVA 4QKNA 3ZYLA 2YU2A 4TZ4C 3VKHA 4ADZA 1B7TA 2H3RA 2IC6A 4HN9A 4MBQA 4CXWA 2WBLA 3S4UA 4N78D 3AVSA 5JDHA 3UULA 3HI2A 3PTRB 4L5GA 3O1HA 2CXFA 4EZHA 5DABA 3RRWA 3SWHA 2L8KA 3M65A 2LSJA 5CA1E 4EYUA 1WYCA 2LHRA 3NRYA 2C5IT 2E9XD 2ODUA 5LCYA 3OJAA 3SS1A 3PURA 5LGTB 4AI6A 4JUYA 4Z8XA 2MYSA 4MHCA 3Q5XA 4YLHA 4DMWA 3LK3B 2V7JA 4ISTA 2V1DB 5LBMA 4ERRA 5LHHB 1SA0E 1UCUA 3CQXC 3FHNA 3MA9A 4NUUA 2IW5B 1HF8A 2MBGA 4GYRA 4IGUA 4L9IA 2BVLA 2X9HA 2Q9QA 3DTOA 3GA8A 2WWUA 4EIWA 5C8YE 1MMGA 2V7IA 3AA0B 3VU7H 1IJ5A 4QXCB 2W00A 3ZJ1A 4AKIA 3AA7B 3CX7B 3E08A 4UEMA 3KFWX 4HGAA 2ACXA 3LG7A 3ZN0B 4AQFA 4O4HE 1D1CA 4X1YE 2CA5A 4YJ2E 5H6QB 3N9LA 3GN5B 5HXEA 4P0AA 2VWAA 5LG4A 4WW0A 5LBQB 3MACA 4AKLA 4I50E 2MOZA 3KVAA 4UV8B 3AA1B 3ZPOA 4YFSA 2D2SA 2HPLA 4YHJA 1HCIA 2N1GA 1AJ3A 1O3XA 2E8IA 2X66A 4TN7B 5HXSA 2ZM8A 5L3GB 1YD8G 3FB2A 3I9YA 1MMDA 3I0QA 3UT5E 2D5UA 4AXPA 3ZC0A 2V7LA 2KNDA 1EZ3A 2YINA 2SPCA 4L0RA 1LVFA 4UXNB 4H9SE 3AVRA 5F3JA 4OYJA 1MIVA 5A1LA 4OFZA 2X9XA 3OYXA 4G63A 4ZI2D 4IE4A 2DI4A 2W63A 1D0YA 2EHOB 4H9QC 4CXXA 3H37A 5HWXA 2IAKA 2BZBA 4MALA 5JDQA 1BR2A 5H6RB 1LKXA 4GIWA 4I55E 5IYZE 5EK2A 4AKGA 3HKBE 1D1BA 2NTXA 3RH3A 2VKDA 5CB4E 1YKHB 1D0ZA 2VKOA 4IE5A 3CVRA 3N9MA 2VASA 5JR9A 4H9PC 3LK42 4M1PA 3C4ZA 3ZMSB 5LYJE 4EZ4A 3LJCA 4EB6E 2Q9QB 3CWZB 4J2CA 4IIJE 5JVDE 4P09A 3AA6B 4G2AA 3QUJA 4QX7B 4JEUB 4OHFA 4O4IE 1KK7A 5LGNB 4QXHB 3PU3A 2J1DG 2XASB 4UVAB 2B1EA 1HTJF 2KMFA 1BR0A 2M67A 3ONXA 4H63H 2C5KT 3DP7A 3KBUA 2CM0A 3L3PA 5FYMA 3J9X1 3QC9A 3BK9A 3SOLA 3NZPA 2C5JA 3N2OA 3GN5A 5EZYE 2E9XC 4EOZB 5JREA 3CQCB 4OYKA 3ZN1B 4O2BE 2G0UA 4HTEA 1ZHCA 3N2KE 4X1KE 4PJMA 1SHZC 2K48A 1LRZA 5LA6E 3ZMUB 1YW0A 4E7ZA 4EYYR 4KMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5X A;  3Q5W A; 
#chains in the Genus database with same CATH topology
 2XQ4 A;  4HE8 A;  3HKD E;  4QWN B;  4ZOL E;  4HFC A;  4F6R C;  4JI5 T;  4U3C A;  4PFO A;  3UFE A;  2ZM0 A;  3HA4 A;  5KDM C;  2ODV A;  4KBM B;  3UQ4 A;  3ZYM A;  3ZC1 A;  3H3A A;  2V6X A;  3LFM A;  2X0H A;  2JQH A;  4U33 A;  4DUZ T;  4NUV A;  5JDF A;  2WSS V;  2IIU A;  3ZJ2 A;  3KBT A;  1Y64 B;  4C91 A;  3AE5 A;  2A72 A;  4ZEY A;  2V26 A;  5FP3 A;  3MKD A;  1MND A;  2XM2 A;  4O8S A;  2DWG A;  1NAF A;  3P7I A;  1OED A;  4QHO A;  4CQI A;  4U7I A;  3B5M A;  4EAH A;  5L3C B;  1YKE B;  5HAX A;  2VK9 A;  3FZH B;  3F57 A;  4TV9 E;  3JCF A;  4JLE A;  1Z8U A;  2EHO D;  4AQF C;  2XSB A;  4UR9 A;  1IAP A;  5HXC A;  2YDR A;  4H9R C;  4I4T E;  4H9O C;  2CHO A;  5FXW A;  4WBN E;  3NRX A;  5ABF B;  3E0Z A;  3PV0 F;  3ZT6 A;  2QGS A;  4GK0 E;  5JH7 E;  2PJQ A;  4QX8 B;  1LVK A;  3JAE A;  4GYS A;  2FJD A;  2NTY A;  2CBJ A;  4A98 A;  3R6N A;  4O2A E;  1HNX T;  2DWK A;  2BVM A;  2VKH A;  4DR1 T;  2ZLY A;  3SFD A;  4QXB B;  5JRC A;  1JNZ A;  2DNX A;  4IDN A;  1M62 A;  4JI0 T;  2YN6 A;  3I0O A;  2W4X A;  5FXZ A;  1IJ6 A;  2D9D A;  1WLX A;  5CGM A;  2RA1 A;  1U5P A;  4DND A;  3AE4 A;  5L4E A;  2QRX A;  4BJN A;  2EHO C;  2WAU A;  3E22 E;  2HPJ A;  1VRB A;  1T8B A;  2JRK A;  1CHU A;  2LM9 A;  4XZC A;  1UX5 A;  3AEF A;  4YHH T;  2MAW A;  2XHE B;  3UU6 A;  3X1D A;  2AXD S;  2H88 A;  1HFA A;  4NIQ A;  2H7O A;  4HEA A;  4IRE A;  3ABV A;  4YSX A;  1YQ3 A;  4IDQ A;  3ZCJ A;  1V9D A;  1FMW A;  1UUS A;  3AE6 A;  4KP3 C;  5FL0 A;  4TWF A;  4PK5 A;  2LKH A;  3JC6 C;  1QLB A;  4GKK T;  3UUM A;  4U31 A;  4P0B A;  5IUX A;  2FJE A;  3EHZ A;  4CN1 A;  4U74 A;  2XQ3 A;  2NW9 A;  3CX6 B;  3TLW A;  3ZST A;  4B3T T;  2LRK A;  4ZS2 A;  5LHG B;  1MNE A;  3L39 A;  4BAY B;  4KUM B;  1N32 T;  5C2T A;  3AAE B;  1WR6 A;  4HFH A;  4LF8 T;  2D0U A;  2PFV A;  2YU2 A;  4ADZ A;  1B7T A;  4OX9 T;  4DV0 T;  3AVS A;  3HI2 A;  3PTR B;  2CXF A;  5CA1 E;  3NRY A;  5CFB A;  3Q5D A;  4YLH A;  3Q5X A;  4DMW A;  2V7J A;  5LHH B;  2IW5 B;  4IGU A;  2BVL A;  2VVN A;  2X9H A;  3RF1 A;  1MMG A;  2V7I A;  1IJ5 A;  4QXC B;  2W00 A;  2UUA T;  3AA7 B;  4UEM A;  2W66 A;  3LG7 A;  4YJ2 E;  3GN5 B;  5LG4 A;  3MAC A;  4U2Y A;  4AKL A;  4I50 E;  3AA1 B;  4YFS A;  4YHJ A;  2WCA A;  2E8I A;  1HNZ T;  1YD8 G;  2V7L A;  2YIN A;  2SPC A;  1LVF A;  5F3J A;  4COF A;  4ZI2 D;  2X9X A;  2OLT A;  1J5W A;  4P1N A;  4H9Q C;  4A97 A;  5JDQ A;  1BR2 A;  4K0K T;  2VKD A;  1YKH B;  2M6B A;  3CVR A;  3RIU C;  2VAS A;  5JR9 A;  3LK4 2;  3C4Z A;  3ZMS B;  5ABE A;  2J4G A;  3CWZ B;  5JVD E;  4P09 A;  4G2A A;  4QX7 B;  4OHF A;  1KK7 A;  5LGN B;  2J1D G;  4UVA B;  1XMQ T;  4YT0 A;  4Z91 A;  4NXN T;  5FYM A;  4LFB T;  3J9X 1;  3QC9 A;  3BK9 A;  3N2O A;  5JRE A;  5HEH A;  4KI0 F;  1T72 A;  3ZN1 B;  4HTE A;  4X1K E;  1SHZ C;  3ZMU B;  2WY2 A;  2DL1 A;  4TV8 E;  3RYF E;  3N9Q A;  3QOF A;  2E2A A;  2XUE A;  1N34 T;  3OKQ A;  4JI3 T;  2CRB A;  2CLY C;  3QNU A;  2YEV C;  4TNW A;  5HXR A;  3L09 A;  3WAK A;  1ZP0 A;  2KLQ A;  2V7K A;  3RHW A;  3P4Q A;  4ILU A;  4DV4 T;  1OWA A;  2CWO A;  5IHY A;  2LHN A;  2LE8 A;  5FXX A;  4ZI2 C;  4QH1 A;  2WMN A;  2JMK A;  1VOM A;  4DV7 T;  4ILB A;  2WS3 A;  2CBI A;  5E0O A;  2W0G A;  5L3B B;  5JDL A;  1H7C A;  2NOX A;  3T1Y T;  3PU8 A;  4JYA T;  3LDQ B;  3EAM A;  4KX6 A;  1SUM B;  3GMI A;  2LSK A;  4QH5 A;  3D0T A;  5TAO A;  4IE7 A;  4DBR A;  3AED A;  4DUY T;  1YXR A;  4WBO A;  2CE7 A;  5ETW A;  5JRC B;  5KX5 E;  3ETV A;  3AE3 A;  5LB7 B;  2P9B A;  3RC3 A;  2XY8 B;  3KVB A;  5BMV E;  1KNZ A;  1QSD A;  2XAJ B;  2V5D A;  2XAG B;  3OPC A;  5FXV A;  2C0S A;  2LSG A;  2V6Y A;  4ZZC A;  3I9W A;  3ZMZ B;  3TLS A;  4AKH A;  4MLK A;  2YDQ A;  2LT3 A;  2WDR A;  4IE6 A;  5HWY A;  5FVL A;  1FIO A;  4MFR A;  1ZV4 X;  3RGL A;  4X1I E;  2HN1 A;  2I6H A;  2XPK A;  3PDY A;  2RP4 A;  3ZSS A;  3EDV A;  3RYI E;  3WI3 A;  5JDN A;  3HKC E;  2UXX B;  2LRL A;  5AQO B;  3PJA A;  5DJQ C;  2FBW A;  3ZMT B;  2VB6 A;  4NXM T;  4ZI3 C;  2E9X B;  3TLT A;  3IHR A;  5L3F B;  5AQQ B;  2K9A A;  2RPA A;  3MJX A;  4UF0 B;  1I94 T;  4U7Y A;  4IDO A;  4EGW A;  1CUN A;  3F31 A;  3CML A;  3MK7 C;  4O4L E;  2KWI B;  2ZMA A;  2OA5 A;  4EED A;  2GK9 A;  3RIA A;  4B3R T;  3PUG A;  5J2U E;  4AQG A;  1XNR T;  2XM1 A;  3FXE B;  3AXJ A;  4IE0 A;  1BR1 A;  2A2F X;  2NP9 A;  4FI5 A;  3CKD A;  3FZL B;  3QK6 A;  2BS3 A;  5M4Y A;  3N9O A;  4DMV A;  3F2E A;  5HEJ A;  2LOP A;  3PE0 A;  4O4J E;  3AB3 B;  2I59 A;  2JIW A;  3C4W A;  3P8C D;  4GK5 E;  5KMG P;  3AE9 A;  2YU1 A;  2FJB A;  3RC8 A;  2XQ8 A;  1E1H B;  5EK3 A;  4KHP T;  2HH7 A;  1GQE A;  4YSZ A;  2KIN B;  4BJM A;  1NWM X;  2BKO A;  3ZEF B;  5AQT B;  3U78 A;  2IDO B;  4DV1 T;  3EUH A;  2IHR 1;  4UEL A;  3UU4 A;  4UIG A;  2V7M A;  4ISS A;  3VKG A;  5LMN T;  4AKR B;  2DHR A;  2BG9 B;  4HFE A;  5LXT E;  1JNR A;  3ETU A;  3OVU A;  4XBF B;  1BR4 A;  2KWH A;  1MIW A;  2NW7 A;  3NBX X;  3JC6 D;  3BQI A;  3FBZ A;  3LK2 B;  2KZ7 B;  4JI7 T;  3ZYL A;  3VKH A;  4HN9 A;  2V8S V;  4CXW A;  2WZI A;  4EZH A;  4EYU A;  1WYC A;  5HEO A;  2C5I T;  2ODU A;  2ZM6 T;  4YSY A;  4DV6 T;  5F5W A;  4YTP A;  5LBM A;  1SA0 E;  1UCU A;  3CQX C;  3FHN A;  4NUU A;  2MBG A;  3RKG A;  2XJ7 A;  4L9I A;  4TNV A;  2WWU A;  5C8Y E;  3AA0 B;  3ZJ1 A;  3P4W A;  3CX7 B;  2ACX A;  4AQF A;  4O4H E;  3N9L A;  5HXE A;  4WW0 A;  2WDV A;  2MOZ A;  2D2S A;  3FZF B;  2X66 A;  5HXS A;  1Y01 A;  3I9Y A;  4HFI A;  3I0Q A;  4YTM A;  3PJA J;  1EZ3 A;  5LG3 A;  4UXN B;  3AVR A;  2XQ5 A;  5A1L A;  2UXC T;  1D0Y A;  4DR5 T;  3H37 A;  4HFB A;  4MAL A;  1WCR A;  5ABH A;  1LKX A;  4I55 E;  5J0Z A;  4HWI B;  2NTX A;  1J1J A;  4KHZ F;  5CB4 E;  2VKO A;  4IE5 A;  4WZX A;  4H9P C;  5AQP B;  3UU5 A;  1OED E;  4AIS A;  4EZ4 A;  2Q9Q B;  4J2C A;  3QUJ A;  3PU3 A;  2B1E A;  2M67 A;  3ONX A;  3KBU A;  2C5J A;  3JAD A;  4IT4 A;  2LLY A;  2HHH T;  5LA6 E;  4E7Z A;  4EYY R;  1S94 A;  3CQG B;  4V1A v;  4JI8 T;  3AEA A;  1ZEE A;  5AQN B;  2CMR A;  1OXZ A;  2K5B B;  5LP6 E;  3DJB A;  1S35 A;  2EHO A;  4CI3 B;  4HKA A;  5HCM A;  3SRZ A;  3VHL A;  3KV4 A;  1W09 A;  2WB5 A;  1MMA A;  2VL0 A;  2UUC T;  4WNK A;  2L3L A;  2XQY A;  2XAQ B;  5L47 A;  1XZY A;  1FMV A;  3IA3 A;  2M6I A;  3MZK B;  1IZN B;  1L0V A;  3GWH A;  4GKJ T;  1D1A A;  3UU8 A;  1HG2 A;  3M3Z B;  3EVY A;  4HFV A;  4CI2 B;  2N9D A;  2J47 A;  2BS2 A;  5ABF A;  3PUZ F;  5FY1 A;  4HWH A;  5HCJ A;  4IHJ E;  1R8I A;  3CPZ A;  4B3M T;  3P4S A;  2JPF A;  4AQY T;  1Z0P A;  3N9N A;  3AE7 A;  3PUY F;  3PUQ A;  1HG5 A;  2X9W A;  3MXZ A;  3ZT5 A;  2Q9Q C;  2WMO A;  2LJL A;  3QB5 A;  4CN4 A;  3T8O A;  3K3N A;  4PAG A;  5JDM A;  1US7 B;  3RPU A;  1X79 A;  3NKZ A;  4PJJ A;  2W61 A;  3N9P A;  5HXH A;  3OTO T;  3LBX A;  5J1G A;  4JI4 T;  3RYC E;  4DR6 T;  1HNW T;  4ZZB A;  2XSA A;  1WRD A;  3UUN A;  3T1H T;  3UU3 A;  2LEH A;  5AQK B;  2L9Q A;  4GOU A;  3RRC A;  1OED B;  2D0T A;  3RQW A;  4Q25 A;  4F8H A;  2ZM2 A;  4Z90 A;  2VKJ A;  2Y48 B;  2W67 A;  3FBL A;  3CX8 B;  4PJN A;  2UUB T;  4YY3 T;  1MIY A;  3KV6 A;  1G8X A;  2XZE A;  4NPP A;  2UXD T;  1HX8 A;  4YJ3 E;  2NWB A;  3ESL A;  2X9Y A;  3ANW A;  4IDP A;  3B13 A;  4C90 A;  3IEE A;  2YDS A;  4X64 T;  3Q2M A;  1XWM A;  5HEU A;  3K3Q C;  4ZI3 D;  5FKY A;  5DQW A;  3R84 B;  2BBJ A;  2XAF B;  2YK0 A;  3C4X A;  5AQR B;  4IL4 A;  3RIU A;  5FNV E;  3HR0 A;  3RQU A;  2VQF T;  5LOV E;  1IBL T;  2VQE T;  3RKO A;  3C50 A;  3TKL B;  2J62 A;  2LOS A;  1UK5 A;  2WP9 A;  3A8Y C;  2CXL A;  1X9B A;  3RLF F;  1UGO A;  2BG9 E;  4X62 T;  4ILA A;  1G73 A;  2LSY A;  4UVC B;  3Q9D A;  2F4V T;  3KIN B;  5FVK A;  2DLR A;  3C64 A;  2UXB T;  2MTQ A;  2W2U A;  2E5L T;  5HYA A;  2WM9 A;  3H3M A;  2XQ9 A;  4PW8 A;  5LGU B;  4ASK A;  2XQ6 A;  4DR3 T;  3VR9 A;  3AE1 A;  4DO0 A;  1WR0 A;  1OED C;  4TWH A;  3TLV A;  2CCQ A;  3W15 B;  3IF8 B;  4X5T A;  2X67 A;  4EXT A;  1IBM T;  2PG8 A;  2WQY A;  4B6X A;  3OBV E;  1ZOY A;  4TUY E;  3PUA A;  1XDO A;  3ZKR A;  3UUX B;  1J5E T;  2Y6X A;  2DCF A;  3N5L A;  2VUR A;  5GON E;  3FXD B;  4LMK A;  4HWD A;  3NZQ A;  3K3O A;  3I1A A;  5JQG E;  2PTF A;  3V5U A;  5JTG A;  4QKN A;  4TZ4 C;  2H3R A;  2IC6 A;  2A9U A;  2WBL A;  3S4U A;  2BKN A;  4EV6 A;  5JDH A;  4L5G A;  3FZM B;  2V5C A;  5DAB A;  3RRW A;  3M65 A;  4JI1 T;  1XNQ T;  2E9X D;  5LCY A;  3OJA A;  3NWI A;  3PUR A;  3AEC A;  4LFC T;  4JUY A;  4Z8X A;  5CJ5 A;  4LF5 T;  4ERR A;  3MA9 A;  1HF8 A;  4GYR A;  4HWC A;  3EI0 A;  4LFA T;  4EIW A;  4AKI A;  4HGA A;  3ZN0 B;  1D1C A;  2CA5 A;  5H6Q B;  4P0A A;  2VWA A;  2HPL A;  1HCI A;  2N1G A;  3VR8 A;  1O3X A;  3FB2 A;  3UT5 E;  3ZC0 A;  4AXP A;  2D5U A;  4L0R A;  2CHN A;  1FJG T;  4OYJ A;  4G63 A;  4IE4 A;  2W63 A;  2EHO B;  2LM2 A;  4JV5 T;  4LF7 T;  4GIW A;  4AKG A;  3RH3 A;  5C3J A;  5IWA T;  1D0Z A;  3N9M A;  1SE7 A;  4IIJ E;  3LSV A;  4QXH B;  2YKS A;  1HTJ F;  2KMF A;  3P4R A;  1HR0 T;  4JI2 T;  2C5K T;  2R6G F;  3L3P A;  3NZP A;  4ILC A;  2E9X C;  4U2Z A;  2FJA A;  4OYK A;  3UQ7 A;  5AQL B;  1W0A A;  1ZHC A;  3N2K E;  4PJM A;  3PUX F;  3PUW F;  1I6Z A;  2BDE A;  2JJ9 A;  4DV3 T;  5FY0 A;  2XTL A;  5L3E B;  5FMN A;  2XAH B;  3J7Y q;  4H9N C;  3AEB A;  4PFP A;  3AAA B;  2WDQ A;  3UUB A;  3AE2 A;  4B3S T;  5JR9 B;  3RIF A;  4ZHQ E;  4CZZ B;  4XAX B;  1HS7 A;  3O4X E;  5L2L A;  1W0B A;  2KT9 A;  3LBX B;  4DR4 T;  1T98 A;  4UV9 B;  2CWY A;  5BR8 T;  1D0X A;  3RX6 A;  1N36 T;  1XMO T;  2BKP A;  4FJO A;  4H63 V;  1NEK A;  4OK0 A;  4DID B;  3KV5 A;  1ZKE A;  2MPK A;  4DR2 T;  2ES0 A;  3BQK A;  5ADX L;  5F8P A;  1MMN A;  4X65 T;  3ZYK A;  5JDG A;  1WYB A;  3RYH E;  4U72 A;  3A5X A;  2Y8D A;  4IDZ A;  3WAJ A;  4LMJ A;  3IBP A;  2JQQ A;  2WU2 A;  2BG9 C;  3TLU A;  2JMH A;  4HFD A;  4ANJ A;  5LJN A;  4DV2 T;  2I0M A;  2K24 A;  4QH4 A;  4DR7 T;  2E9X A;  3KDS E;  2N2N A;  2CEA A;  4PNI A;  2YOE A;  4UF0 A;  2QA7 A;  4I43 B;  3ANW B;  1FEW A;  3ZMV B;  2Q9Q D;  2IML A;  3CIR A;  4JEH B;  1W9R A;  3AAI A;  5AQJ B;  4YXD A;  2CPT A;  2IC9 A;  2WZH A;  4X20 E;  3OYZ A;  2UXN B;  3ZCI A;  1IBK T;  5FL1 A;  1KF6 A;  5JR9 C;  3Q5W A;  5AFU L;  2UU9 T;  2QVA A;  4PJL A;  5LNK A;  5CA0 E;  5FY7 A;  4CI1 B;  3O1J A;  3PUV F;  2LKG A;  2VVS A;  2AE9 A;  3AEE A;  4IL9 A;  2Z6E A;  5J2T E;  2XQA A;  2WU5 A;  5DQV A;  4DVD A;  2K3W A;  5AQF B;  3Q5E A;  2ACZ A;  1VCT A;  2KXP B;  4E7S A;  1T7S A;  1WFD A;  2V6Y B;  4PK6 A;  3U3I A;  3UTK A;  5HEG A;  2H7V C;  2QYW A;  4K0U A;  3ZLI A;  2BG9 A;  2CLY B;  5AQG B;  2B76 A;  2CXD A;  2WWV A;  4WYV A;  4LF6 T;  2X51 A;  4JI6 T;  3BQL A;  2X0L B;  4TX5 A;  3FZK B;  3PUS A;  3K8P C;  2NR4 A;  1UUR A;  4LML A;  3C51 A;  5L3D B;  2XQ7 A;  3C98 B;  2JQK A;  2E5V A;  3HL6 A;  5AQI B;  3V5S A;  4UVB B;  4PK4 A;  3CK6 A;  5AQH B;  3O1I A;  1M7K A;  1KEY A;  3K1S A;  2X68 A;  3ONL C;  2LSI A;  3EDU A;  4CXY A;  2NW8 A;  3KV9 A;  4DBQ A;  2BBH A;  3O9X A;  2PBI A;  1YQ4 A;  4A56 A;  3RI5 A;  5LJM A;  3N2G E;  1E7P A;  3B57 A;  4ZS3 A;  3AXJ B;  1UX4 A;  1QUU A;  4HWF A;  2A3D A;  2IUB A;  3HKE E;  3VRA A;  1VCS A;  3AE8 A;  4DV5 T;  1N33 T;  2W62 A;  2VL8 A;  4BA9 A;  1E2A A;  5EK4 A;  5LHI B;  5LMU T;  3VRB A;  2OV9 A;  4ZI7 E;  1U4Q A;  4X66 T;  4MBQ A;  5L4H A;  4ZXL A;  2X0Y A;  2HN2 A;  4N78 D;  4LF9 T;  1KNP A;  3UUL A;  3O1H A;  3SWH A;  2L8K A;  2LSJ A;  5KXJ A;  2LHR A;  5AQV B;  3SS1 A;  5LGT B;  4AI6 A;  5AQS B;  2MYS A;  1KNR A;  4MHC A;  1HX1 B;  3LK3 B;  4IST A;  2V1D B;  3NVO A;  2Q9Q A;  3DTO A;  3GA8 A;  1DU2 A;  3G06 A;  3SFE A;  3VU7 H;  2FUP A;  3P50 A;  1XDP A;  3E08 A;  4YTN A;  3KFW X;  3ONJ A;  4CN6 A;  3A7M A;  4X1Y E;  5AQM B;  5LBQ B;  3KVA A;  4UV8 B;  3ZPO A;  5ABG A;  4LF4 T;  1AJ3 A;  4TN7 B;  2ZM8 A;  5L3G B;  1MMD A;  2KND A;  4H9S E;  1MIV A;  4OFZ A;  3OYX A;  2DI4 A;  1NEN A;  4CXX A;  4I0U A;  5HWX A;  2IAK A;  2BZB A;  5H6R B;  5IYZ E;  5EK2 A;  2BS4 A;  4TWD A;  3HKB E;  1D1B A;  3JAF A;  4M1P A;  1KFY A;  5LYJ E;  3LJC A;  4EB6 E;  5AQU B;  3AA6 B;  2JQ9 A;  4JEU B;  3UFG A;  4O4I E;  3L8R A;  2XAS B;  4EEB A;  2H89 A;  2KSR A;  1BR0 A;  3EAB A;  3ZT7 A;  4H63 H;  3DP7 A;  2CM0 A;  4AIU A;  3SOL A;  4JBW F;  3P4P A;  3GN5 A;  5EZY E;  4EOZ B;  3QB5 K;  3AEG A;  3CQC B;  4O2B E;  2G0U A;  4A5X A;  2K48 A;  1LRZ A;  1YW0 A;  4KMC A; 
#chains in the Genus database with same CATH homology
 1S94 A;  3CQG B;  4HE8 A;  2BDE A;  4V1A v;  2JJ9 A;  3HKD E;  1ZEE A;  5FY0 A;  4QWN B;  2XTL A;  2CMR A;  1OXZ A;  2K5B B;  4ZOL E;  5L3E B;  5LP6 E;  3DJB A;  1S35 A;  5FMN A;  4F6R C;  2EHO A;  4TV8 E;  2XAH B;  4CI3 B;  4HKA A;  3RYF E;  3J7Y q;  4H9N C;  4PFP A;  3SRZ A;  3N9Q A;  3AAA B;  4PFO A;  3VHL A;  3KV4 A;  3UFE A;  5JR9 B;  2XUE A;  3OKQ A;  1MMA A;  2ZM0 A;  3HA4 A;  5KDM C;  2ODV A;  4KBM B;  2CLY C;  4ZHQ E;  4WNK A;  2YEV C;  4XAX B;  3ZYM A;  2L3L A;  3O4X E;  2XQY A;  4CZZ B;  1HS7 A;  5HXR A;  2XAQ B;  3L09 A;  5L2L A;  3WAK A;  3ZC1 A;  3H3A A;  3LFM A;  1FMV A;  2KLQ A;  2V7K A;  2KT9 A;  3LBX B;  4ILU A;  1OWA A;  2CWO A;  3MZK B;  1IZN B;  1T98 A;  3GWH A;  2LHN A;  4NUV A;  5IHY A;  2WSS V;  2LE8 A;  4UV9 B;  5FXX A;  5JDF A;  1D1A A;  4ZI2 C;  2CWY A;  2WMN A;  3ZJ2 A;  2JMK A;  1VOM A;  1HG2 A;  1D0X A;  3EVY A;  3RX6 A;  3KBT A;  4HFV A;  5E0O A;  2N9D A;  4CI2 B;  1Y64 B;  4FJO A;  4C91 A;  4H63 V;  2W0G A;  5L3B B;  5JDL A;  4OK0 A;  1H7C A;  2NOX A;  3KV5 A;  1ZKE A;  5FY1 A;  2A72 A;  2ES0 A;  3BQK A;  5ADX L;  4IHJ E;  2V26 A;  3PU8 A;  5F8P A;  3CPZ A;  1MMN A;  5FP3 A;  3MKD A;  1MND A;  2JPF A;  4O8S A;  2DWG A;  1NAF A;  1Z0P A;  3ZYK A;  5JDG A;  3GMI A;  3N9N A;  2LSK A;  3P7I A;  1WYB A;  4QHO A;  3RYH E;  4U72 A;  4CQI A;  3A5X A;  3PUQ A;  1HG5 A;  2Y8D A;  4EAH A;  4IDZ A;  5L3C B;  1YKE B;  2X9W A;  5HAX A;  2VK9 A;  3D0T A;  3MXZ A;  3WAJ A;  2Q9Q C;  3IBP A;  2WMO A;  4IE7 A;  5TAO A;  2JQQ A;  2LJL A;  4DBR A;  3F57 A;  4TV9 E;  3T8O A;  3K3N A;  4WBO A;  2JMH A;  4PAG A;  4ANJ A;  5JDM A;  5LJN A;  2CE7 A;  1US7 B;  4JLE A;  5ETW A;  2EHO D;  2K24 A;  5JRC B;  5KX5 E;  4AQF C;  2E9X A;  3KDS E;  3RPU A;  2N2N A;  2CEA A;  3ETV A;  4PNI A;  1IAP A;  5HXC A;  1X79 A;  2P9B A;  4H9R C;  4I4T E;  3RC3 A;  3KVB A;  4PJJ A;  2W61 A;  1QSD A;  3N9P A;  4H9O C;  5BMV E;  5HXH A;  1KNZ A;  3LBX A;  2XAJ B;  4UF0 A;  5J1G A;  2QA7 A;  4I43 B;  3ANW B;  2XAG B;  1FEW A;  3ZMV B;  3RYC E;  5FXW A;  2Q9Q D;  4WBN E;  5FXV A;  3NRX A;  2C0S A;  2LSG A;  3I9W A;  3E0Z A;  3ZMZ B;  4JEH B;  3AAI A;  4AKH A;  1WRD A;  4MLK A;  3UUN A;  2IC9 A;  2LT3 A;  4X20 E;  3OYZ A;  4IE6 A;  5HWY A;  2QGS A;  2UXN B;  2LEH A;  1FIO A;  2L9Q A;  4GK0 E;  4MFR A;  4GOU A;  5JH7 E;  2PJQ A;  1ZV4 X;  3ZCI A;  4QX8 B;  1LVK A;  4GYS A;  4X1I E;  3RRC A;  2NTY A;  2D0T A;  5JR9 C;  3Q5W A;  5AFU L;  3PDY A;  3R6N A;  4PJL A;  2RP4 A;  5LNK A;  5CA0 E;  3EDV A;  5FY7 A;  3RYI E;  3WI3 A;  2ZM2 A;  4O2A E;  5JDN A;  2VKJ A;  2Y48 B;  3HKC E;  2DWK A;  2BVM A;  3FBL A;  4CI1 B;  3O1J A;  2UXX B;  3CX8 B;  5DJQ C;  4PJN A;  3ZMT B;  1MIY A;  2VB6 A;  3KV6 A;  4ZI3 C;  2VKH A;  2E9X B;  2Z6E A;  2ZLY A;  1G8X A;  3IHR A;  5J2T E;  4QXB B;  5JRC A;  5L3F B;  1HX8 A;  2DNX A;  2K9A A;  4YJ3 E;  2NWB A;  3MJX A;  4UF0 B;  5DQV A;  4DVD A;  3ESL A;  2X9Y A;  1CUN A;  3F31 A;  3I0O A;  2KXP B;  4E7S A;  3ANW A;  5FXZ A;  1IJ6 A;  3CML A;  1WLX A;  3B13 A;  4PK6 A;  3MK7 C;  4O4L E;  2RA1 A;  2KWI B;  1U5P A;  4C90 A;  3U3I A;  3IEE A;  2ZMA A;  3UTK A;  3Q2M A;  2OA5 A;  2H7V C;  4K0U A;  3K3Q C;  3ZLI A;  4ZI3 D;  4DND A;  2GK9 A;  5DQW A;  3PUG A;  5J2U E;  4AQG A;  3R84 B;  4BJN A;  2XAF B;  2YK0 A;  3C4X A;  2EHO C;  3FXE B;  2CLY B;  2WAU A;  4IE0 A;  3E22 E;  5FNV E;  1BR1 A;  2A2F X;  2NP9 A;  3HR0 A;  4FI5 A;  3CKD A;  5LOV E;  2HPJ A;  1VRB A;  2CXD A;  3C50 A;  3QK6 A;  3RKO A;  3TKL B;  5M4Y A;  2JRK A;  2LM9 A;  2LOS A;  4XZC A;  2X51 A;  1UX5 A;  3N9O A;  3BQL A;  2X0L B;  4TX5 A;  4DMV A;  2CXL A;  3F2E A;  2XHE B;  3PUS A;  3K8P C;  1HFA A;  2LOP A;  3PE0 A;  4O4J E;  2H7O A;  3AB3 B;  4HEA A;  2I59 A;  3C51 A;  1G73 A;  3C4W A;  3P8C D;  4GK5 E;  3C98 B;  2YU1 A;  5KMG P;  5L3D B;  2LSY A;  4UVC B;  3RC8 A;  3Q9D A;  3HL6 A;  3V5S A;  4UVB B;  1E1H B;  4PK4 A;  3O1I A;  5EK3 A;  3KIN B;  2HH7 A;  3ZCJ A;  1V9D A;  1FMW A;  2DLR A;  3C64 A;  2KIN B;  4BJM A;  2MTQ A;  2X68 A;  4KP3 C;  2LSI A;  1NWM X;  4PK5 A;  3EDU A;  3ZEF B;  5HYA A;  2WM9 A;  4CXY A;  2NW8 A;  3U78 A;  4PW8 A;  3KV9 A;  3JC6 C;  3EUH A;  4DBQ A;  5LGU B;  4UEL A;  4ASK A;  4UIG A;  3UUM A;  4DO0 A;  3O9X A;  2V7M A;  4ISS A;  4P0B A;  3VKG A;  2PBI A;  4AKR B;  4A56 A;  2DHR A;  5LJM A;  2CCQ A;  3N2G E;  3W15 B;  3B57 A;  3IF8 B;  4ZS3 A;  5LXT E;  2X67 A;  4EXT A;  2PG8 A;  4B6X A;  3OBV E;  1UX4 A;  4U74 A;  1QUU A;  2NW9 A;  4TUY E;  3CX6 B;  2A3D A;  3ETU A;  3HKE E;  4XBF B;  1BR4 A;  3PUA A;  2KWH A;  4ZS2 A;  1MIW A;  2NW7 A;  5LHG B;  2W62 A;  1MNE A;  3UUX B;  4BAY B;  2Y6X A;  2VL8 A;  3NBX X;  3JC6 D;  3BQI A;  4BA9 A;  3FBZ A;  2DCF A;  4KUM B;  3N5L A;  5EK4 A;  5LHI B;  3LK2 B;  2KZ7 B;  5GON E;  3FXD B;  4ZI7 E;  3NZQ A;  3K3O A;  3I1A A;  3AAE B;  1WR6 A;  1U4Q A;  5JQG E;  2D0U A;  3V5U A;  2PFV A;  4QKN A;  3ZYL A;  2YU2 A;  4TZ4 C;  3VKH A;  4ADZ A;  1B7T A;  2H3R A;  2IC6 A;  4HN9 A;  4MBQ A;  4CXW A;  2WBL A;  3S4U A;  4N78 D;  3AVS A;  5JDH A;  3UUL A;  3HI2 A;  3PTR B;  4L5G A;  3O1H A;  2CXF A;  4EZH A;  5DAB A;  3RRW A;  3SWH A;  2L8K A;  3M65 A;  2LSJ A;  5CA1 E;  4EYU A;  1WYC A;  2LHR A;  3NRY A;  2C5I T;  2E9X D;  2ODU A;  5LCY A;  3OJA A;  3SS1 A;  3PUR A;  5LGT B;  4AI6 A;  4JUY A;  4Z8X A;  2MYS A;  4MHC A;  3Q5X A;  4YLH A;  4DMW A;  3LK3 B;  2V7J A;  4IST A;  2V1D B;  5LBM A;  4ERR A;  5LHH B;  1SA0 E;  1UCU A;  3CQX C;  3FHN A;  3MA9 A;  4NUU A;  2IW5 B;  1HF8 A;  2MBG A;  4GYR A;  4IGU A;  4L9I A;  2BVL A;  2X9H A;  2Q9Q A;  3DTO A;  3GA8 A;  2WWU A;  4EIW A;  5C8Y E;  1MMG A;  2V7I A;  3AA0 B;  3VU7 H;  1IJ5 A;  4QXC B;  2W00 A;  3ZJ1 A;  4AKI A;  3AA7 B;  3CX7 B;  3E08 A;  4UEM A;  3KFW X;  4HGA A;  2ACX A;  3LG7 A;  3ZN0 B;  4AQF A;  4O4H E;  1D1C A;  4X1Y E;  2CA5 A;  4YJ2 E;  5H6Q B;  3N9L A;  3GN5 B;  5HXE A;  4P0A A;  2VWA A;  5LG4 A;  4WW0 A;  5LBQ B;  3MAC A;  4AKL A;  4I50 E;  2MOZ A;  3KVA A;  4UV8 B;  3AA1 B;  3ZPO A;  4YFS A;  2D2S A;  2HPL A;  4YHJ A;  1HCI A;  2N1G A;  1AJ3 A;  1O3X A;  2E8I A;  2X66 A;  4TN7 B;  5HXS A;  2ZM8 A;  5L3G B;  1YD8 G;  3FB2 A;  3I9Y A;  1MMD A;  3I0Q A;  3UT5 E;  2D5U A;  4AXP A;  3ZC0 A;  2V7L A;  2KND A;  1EZ3 A;  2YIN A;  2SPC A;  4L0R A;  1LVF A;  4UXN B;  4H9S E;  3AVR A;  5F3J A;  4OYJ A;  1MIV A;  5A1L A;  4OFZ A;  2X9X A;  3OYX A;  4G63 A;  4ZI2 D;  4IE4 A;  2DI4 A;  2W63 A;  1D0Y A;  2EHO B;  4H9Q C;  4CXX A;  3H37 A;  5HWX A;  2IAK A;  2BZB A;  4MAL A;  5JDQ A;  1BR2 A;  5H6R B;  1LKX A;  4GIW A;  4I55 E;  5IYZ E;  5EK2 A;  4AKG A;  3HKB E;  1D1B A;  2NTX A;  3RH3 A;  2VKD A;  5CB4 E;  1YKH B;  1D0Z A;  2VKO A;  4IE5 A;  3CVR A;  3N9M A;  2VAS A;  5JR9 A;  4H9P C;  3LK4 2;  4M1P A;  3C4Z A;  3ZMS B;  5LYJ E;  4EZ4 A;  3LJC A;  4EB6 E;  2Q9Q B;  3CWZ B;  4J2C A;  4IIJ E;  5JVD E;  4P09 A;  3AA6 B;  4G2A A;  3QUJ A;  4QX7 B;  4JEU B;  4OHF A;  4O4I E;  1KK7 A;  5LGN B;  4QXH B;  3PU3 A;  2J1D G;  2XAS B;  4UVA B;  2B1E A;  1HTJ F;  2KMF A;  1BR0 A;  2M67 A;  3ONX A;  4H63 H;  2C5K T;  3DP7 A;  3KBU A;  2CM0 A;  3L3P A;  5FYM A;  3J9X 1;  3QC9 A;  3BK9 A;  3SOL A;  3NZP A;  2C5J A;  3N2O A;  3GN5 A;  5EZY E;  2E9X C;  4EOZ B;  5JRE A;  3CQC B;  4OYK A;  3ZN1 B;  4O2B E;  2G0U A;  4HTE A;  1ZHC A;  3N2K E;  4X1K E;  4PJM A;  1SHZ C;  2K48 A;  1LRZ A;  5LA6 E;  3ZMU B;  1YW0 A;  4E7Z A;  4EYY R;  4KMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...