3Q63A

X-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
132
structure length
132
Chain Sequence
RTVVVERQISHPPEKLWRALTQPHLIEEWLMKNDFKPAVGHRFNISADWGGVLDCEVLAVEPNKTLSYTWNLAHQDPAFDLRSVVTFTLTPTPTGTHLRMEQSGFRPDQRRAYGGAKMGWPQFFEKLEQLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mll2253 protein
publication title X-ray crystal structure of protein MLL2253 from Mesorhizobium loti, Northeast Structural Genomics Consortium Target MlR404.
rcsb
source organism Mesorhizobium loti
molecule tags Structural genomics, unknown function
total genus 34
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08327 AHSA1 Activator of Hsp90 ATPase homolog 1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3q63A00
2Q3QA 2D4RA 3PUTA 3RT0C 2L65A 4LG5A 1JSSA 1B6FA 3CNWA 3KAYA 4JHHA 3TL1A 5E4MA 2N4BA 4MAPA 4A81A 4FPWA 3UJLA 3NMVA 1XUVA 4IH0A 4MNSA 3NS2A 2REZA 2LGHA 3KDJA 4DSCA 1LN1A 3R6PA 4REIA 1LN2A 3H3QA 4XRTA 4A84A 2I9YA 3ELIA 3P9VA 5JNNA 4JHIA 4DS8A 1XN5A 4OICA 1T27A 4XRWA 3NMTA 2PSOA 4Z3LA 2BK0A 2M47A 3KAZA 1E09A 3NEGA 2K5GA 3NJ0A 2RERA 4JDLA 3P51A 2E3MA 4C94A 2NN5A 4A86A 3WG8A 4A87A 2GKDA 4JDAA 3KDIA 4C9IA 5E4DA 4JHGA 3OQUA 1BTVA 1UW5A 3UQHA 4IGXA 3C0VA 3OTLA 2NS9A 3H3TA 3KDHA 4Y31A 1QMRA 5BRLA 2L8OA 4GY9A 4A8VA 2K7HA 2Z9YA 3F08A 4BK6A 1XDFA 4BK7A 3OJIA 4IHRA 2LEQA 2LCGA 3NJOA 1H2OA 1LLTA 2FFSA 3FO5A 1X53A 2E3OA 3QSZA 2FLHA 5C9YA 2KF2A 4R7KA 2A1LA 3OH8A 5E46A 4PSBA 5AMWA 5I9JA 4A8UA 4IGWA 3E85A 1VJHA 4A80A 1LN3A 4BKCA 4A88A 2MOUA 2E3RA 3KLXA 3Q63A 4A83A 4C9CA 3IE5A 3IJTA 3JRQB 3NI8A 3KL1A 2LF2A 3NEFA 4M9BA 1KCMA 1Z94A 2LDKA 4REHA 3K90A 2L9PA 3Q6AA 5I8FA 1ICXA 1IFVA 1XFSA 4RYVA 2E3QA 4IGYA 2VNEA 4IGVA 4LGBA 3RD6A 3KB0A 2EJXA 2KCZA 4LGAA 2PCSA 2N4AA 2IL5A 3H3RA 3P0LA 4B9RA 2RESA 2M89A 3ZVUA 4BKDA 1EM2A 3KB3A 2LAKA 1XN6A 3TVQA 4N3EA 2LPXA 2LE1A 2QPVA 4REJA 4M9WA 4LA7A 3UIDA 4WVOA 3W9KA 4DSBA 2VQ5A 2E3SA 1FSKA 2KEWA 3NJ1A 4QIPA 1TW0A 2LIOA 3GGNA 4IH2A 3RT2A 4A85A 3QN1A 3W9RA 4Q0KA 2R55A 2E3PA 4A8GA 4N0GC 5E4BA 3NMHA 3K3KA 1TXCA 1FM4A 2Z9ZA 3H3SA 1BV1A 2QIMA 1T17A 2LUZA 3PU2A 4MA6A 3NMNA 2E3NA 3JRSA 3TVRA 2WQLA 3TFZA 2KTEA 3NMPA 5JO2A 3Q64A 3NR4A 5JO1A 4BTZA 1ZXFA
chains in the Genus database with same CATH superfamily
2Q3QA 2D4RA 3GTEA 3PUTA 3RT0C 4N41A 2L65A 4LG5A 1JSSA 1B6FA 3CNWA 3KAYA 4JHHA 3TL1A 3GOBA 5E4MA 2N4BA 4MAPA 4A81A 4FPWA 3UJLA 3NMVA 1XUVA 4IH0A 4MNSA 3NS2A 2REZA 2LGHA 3KDJA 4DSCA 1LN1A 4NCAA 3R6PA 4REIA 1LN2A 3HO1A 3H3QA 4XRTA 4A84A 2I9YA 3ELIA 3P9VA 5JNNA 4JHIA 3HJFA 4DS8A 1XN5A 4OICA 1T27A 4XRWA 3NMTA 2PSOA 4E6FA 4Z3LA 2BK0A 2M47A 3KAZA 1E09A 3NEGA 2K5GA 3NJ0A 2RERA 4JDLA 3P51A 2E3MA 4C94A 2NN5A 4A86A 3WG8A 4A87A 2GKDA 4JDAA 3KDIA 4C9IA 4NCBA 5E4DA 4JHGA 3OQUA 1BTVA 1UW5A 3UQHA 3GKEA 4IGXA 3C0VA 3OTLA 2NS9A 3H3TA 3KDHA 4Y31A 1QMRA 5BRLA 2L8OA 4GY9A 4A8VA 2K7HA 2Z9YA 3F08A 4BK6A 1XDFA 4BK7A 3OJIA 4IHRA 2LEQA 2LCGA 3NJOA 1H2OA 1LLTA 2FFSA 3FO5A 3GL2A 4QDFB 1X53A 2E3OA 3GB4A 2FLHA 3QSZA 2KF2A 4R7KA 5C9YA 2A1LA 3OH8A 5E46A 4PSBA 5AMWA 5I9JA 4A8UA 4IGWA 3GTSA 3E85A 3NQNA 3F73A 1VJHA 4A80A 3DLBA 3DLHA 1LN3A 4BKCA 4A88A 2MOUA 2E3RA 3KLXA 3Q63A 4A83A 4C9CA 3IE5A 3IJTA 3JRQB 3NI8A 3KL1A 2LAFA 2LF2A 3NEFA 4M9BA 1KCMA 4JHYA 1Z94A 2LDKA 4REHA 3K90A 2L9PA 3Q6AA 5I8FA 1ICXA 1IFVA 1XFSA 4RYVA 2E3QA 4IGYA 2VNEA 4IGVA 4LGBA 3RD6A 3KB0A 2EJXA 2KCZA 4LGAA 2PCSA 2N4AA 2IL5A 3H3RA 3P0LA 4QDFA 2RESA 2M89A 3ZVUA 4B9RA 4BKDA 1EM2A 3HK2A 3HM9A 3KB3A 2LAKA 3HXMA 1XN6A 3TVQA 3GL0A 2LPXA 4N3EA 2LE1A 2QPVA 5EKQC 4REJA 4KPYA 4N76A 4M9WA 4LA7A 3UIDA 4WVOA 3HVRA 3W9KA 4DSBA 2VQ5A 2E3SA 1FSKA 2KEWA 3NJ1A 4QIPA 1TW0A 2LIOA 3GGNA 4IH2A 2YH6A 3RT2A 4A85A 3QN1A 3W9RA 4Q0KA 2R55A 2E3PA 4QDCA 4N0GC 4A8GA 5E4BA 3NMHA 3K3KA 1TXCA 1FM4A 4QDDA 2Z9ZA 3H3SA 1BV1A 2QIMA 1T17A 2LUZA 3PU2A 4MA6A 3NMNA 3TGOC 2E3NA 3JRSA 3TVRA 2WQLA 2ZYLA 3TFZA 2KTEA 3NMPA 5JO2A 3Q64A 3NR4A 4N47A 5JO1A 4QCKA 4BTZA 1ZXFA
chains in the Genus database with same CATH topology
2Q3QA 2D4RA 3GTEA 3PUTA 3RT0C 4N41A 2L65A 4LG5A 1JSSA 1B6FA 3CNWA 3KAYA 4JHHA 3TL1A 3GOBA 5E4MA 2N4BA 4MAPA 4A81A 4FPWA 3UJLA 3NMVA 1XUVA 4IH0A 4MNSA 3NS2A 2REZA 2LGHA 3KDJA 4DSCA 1LN1A 4NCAA 3R6PA 4REIA 1LN2A 3HO1A 3H3QA 4XRTA 4A84A 2I9YA 3ELIA 3P9VA 5JNNA 4JHIA 3HJFA 4DS8A 1XN5A 4OICA 1T27A 4XRWA 3NMTA 2PSOA 4E6FA 4Z3LA 2BK0A 2M47A 3KAZA 1E09A 3NEGA 2K5GA 3NJ0A 2RERA 4JDLA 3P51A 2E3MA 4C94A 2NN5A 4A86A 3WG8A 4A87A 2GKDA 4JDAA 3KDIA 4C9IA 4NCBA 5E4DA 4JHGA 3OQUA 1BTVA 1UW5A 3UQHA 3GKEA 4IGXA 3C0VA 3OTLA 2NS9A 3H3TA 3KDHA 4Y31A 1QMRA 5BRLA 2L8OA 4GY9A 4A8VA 2K7HA 2Z9YA 3F08A 4BK6A 1XDFA 4BK7A 3OJIA 4IHRA 2LEQA 2LCGA 3NJOA 1H2OA 1LLTA 2FFSA 3FO5A 3GL2A 4QDFB 1X53A 2E3OA 3GB4A 2FLHA 3QSZA 2KF2A 4R7KA 5C9YA 2A1LA 3OH8A 5E46A 4PSBA 5AMWA 5I9JA 4A8UA 4IGWA 3GTSA 3E85A 3NQNA 3F73A 1VJHA 4A80A 3DLBA 3DLHA 1LN3A 4BKCA 4A88A 2MOUA 2E3RA 3KLXA 3Q63A 4A83A 4C9CA 3IE5A 3IJTA 3JRQB 3NI8A 3KL1A 2LAFA 2LF2A 3NEFA 4M9BA 1KCMA 4JHYA 1Z94A 2LDKA 4REHA 3K90A 2L9PA 3Q6AA 5I8FA 1ICXA 1IFVA 1XFSA 4RYVA 2E3QA 4IGYA 2VNEA 4IGVA 4LGBA 3RD6A 3KB0A 2EJXA 2KCZA 4LGAA 2PCSA 2N4AA 2IL5A 3H3RA 3P0LA 4QDFA 2RESA 2M89A 3ZVUA 4B9RA 4BKDA 1EM2A 3HK2A 3HM9A 3KB3A 2LAKA 3HXMA 1XN6A 3TVQA 3GL0A 2LPXA 4N3EA 2LE1A 2QPVA 5EKQC 4REJA 4KPYA 4N76A 4M9WA 4LA7A 3UIDA 4WVOA 3HVRA 3W9KA 4DSBA 2VQ5A 2E3SA 1FSKA 2KEWA 3NJ1A 4QIPA 1TW0A 2LIOA 3GGNA 4IH2A 2YH6A 3RT2A 4A85A 3QN1A 3W9RA 4Q0KA 2R55A 2E3PA 4QDCA 4N0GC 4A8GA 5E4BA 3NMHA 3K3KA 1TXCA 1FM4A 4QDDA 2Z9ZA 3H3SA 1BV1A 2QIMA 1T17A 2LUZA 3PU2A 4MA6A 3NMNA 3TGOC 2E3NA 3JRSA 3TVRA 2WQLA 2ZYLA 3TFZA 2KTEA 3NMPA 5JO2A 3Q64A 3NR4A 4N47A 5JO1A 4QCKA 4BTZA 1ZXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q3Q A;  2D4R A;  3PUT A;  3RT0 C;  2L65 A;  4LG5 A;  1JSS A;  1B6F A;  3CNW A;  3KAY A;  4JHH A;  3TL1 A;  5E4M A;  2N4B A;  4MAP A;  4A81 A;  4FPW A;  3UJL A;  3NMV A;  1XUV A;  4IH0 A;  4MNS A;  3NS2 A;  2REZ A;  2LGH A;  3KDJ A;  4DSC A;  1LN1 A;  3R6P A;  4REI A;  1LN2 A;  3H3Q A;  4XRT A;  4A84 A;  2I9Y A;  3ELI A;  3P9V A;  5JNN A;  4JHI A;  4DS8 A;  1XN5 A;  4OIC A;  1T27 A;  4XRW A;  3NMT A;  2PSO A;  4Z3L A;  2BK0 A;  2M47 A;  3KAZ A;  1E09 A;  3NEG A;  2K5G A;  3NJ0 A;  2RER A;  4JDL A;  3P51 A;  2E3M A;  4C94 A;  2NN5 A;  4A86 A;  3WG8 A;  4A87 A;  2GKD A;  4JDA A;  3KDI A;  4C9I A;  5E4D A;  4JHG A;  3OQU A;  1BTV A;  1UW5 A;  3UQH A;  4IGX A;  3C0V A;  3OTL A;  2NS9 A;  3H3T A;  3KDH A;  4Y31 A;  1QMR A;  5BRL A;  2L8O A;  4GY9 A;  4A8V A;  2K7H A;  2Z9Y A;  3F08 A;  4BK6 A;  1XDF A;  4BK7 A;  3OJI A;  4IHR A;  2LEQ A;  2LCG A;  3NJO A;  1H2O A;  1LLT A;  2FFS A;  3FO5 A;  1X53 A;  2E3O A;  3QSZ A;  2FLH A;  5C9Y A;  2KF2 A;  4R7K A;  2A1L A;  3OH8 A;  5E46 A;  4PSB A;  5AMW A;  5I9J A;  4A8U A;  4IGW A;  3E85 A;  1VJH A;  4A80 A;  1LN3 A;  4BKC A;  4A88 A;  2MOU A;  2E3R A;  3KLX A;  3Q63 A;  4A83 A;  4C9C A;  3IE5 A;  3IJT A;  3JRQ B;  3NI8 A;  3KL1 A;  2LF2 A;  3NEF A;  4M9B A;  1KCM A;  1Z94 A;  2LDK A;  4REH A;  3K90 A;  2L9P A;  3Q6A A;  5I8F A;  1ICX A;  1IFV A;  1XFS A;  4RYV A;  2E3Q A;  4IGY A;  2VNE A;  4IGV A;  4LGB A;  3RD6 A;  3KB0 A;  2EJX A;  2KCZ A;  4LGA A;  2PCS A;  2N4A A;  2IL5 A;  3H3R A;  3P0L A;  4B9R A;  2RES A;  2M89 A;  3ZVU A;  4BKD A;  1EM2 A;  3KB3 A;  2LAK A;  1XN6 A;  3TVQ A;  4N3E A;  2LPX A;  2LE1 A;  2QPV A;  4REJ A;  4M9W A;  4LA7 A;  3UID A;  4WVO A;  3W9K A;  4DSB A;  2VQ5 A;  2E3S A;  1FSK A;  2KEW A;  3NJ1 A;  4QIP A;  1TW0 A;  2LIO A;  3GGN A;  4IH2 A;  3RT2 A;  4A85 A;  3QN1 A;  3W9R A;  4Q0K A;  2R55 A;  2E3P A;  4A8G A;  4N0G C;  5E4B A;  3NMH A;  3K3K A;  1TXC A;  1FM4 A;  2Z9Z A;  3H3S A;  1BV1 A;  2QIM A;  1T17 A;  2LUZ A;  3PU2 A;  4MA6 A;  3NMN A;  2E3N A;  3JRS A;  3TVR A;  2WQL A;  3TFZ A;  2KTE A;  3NMP A;  5JO2 A;  3Q64 A;  3NR4 A;  5JO1 A;  4BTZ A;  1ZXF A; 
#chains in the Genus database with same CATH topology
 2Q3Q A;  2D4R A;  3GTE A;  3PUT A;  3RT0 C;  4N41 A;  2L65 A;  4LG5 A;  1JSS A;  1B6F A;  3CNW A;  3KAY A;  4JHH A;  3TL1 A;  3GOB A;  5E4M A;  2N4B A;  4MAP A;  4A81 A;  4FPW A;  3UJL A;  3NMV A;  1XUV A;  4IH0 A;  4MNS A;  3NS2 A;  2REZ A;  2LGH A;  3KDJ A;  4DSC A;  1LN1 A;  4NCA A;  3R6P A;  4REI A;  1LN2 A;  3HO1 A;  3H3Q A;  4XRT A;  4A84 A;  2I9Y A;  3ELI A;  3P9V A;  5JNN A;  4JHI A;  3HJF A;  4DS8 A;  1XN5 A;  4OIC A;  1T27 A;  4XRW A;  3NMT A;  2PSO A;  4E6F A;  4Z3L A;  2BK0 A;  2M47 A;  3KAZ A;  1E09 A;  3NEG A;  2K5G A;  3NJ0 A;  2RER A;  4JDL A;  3P51 A;  2E3M A;  4C94 A;  2NN5 A;  4A86 A;  3WG8 A;  4A87 A;  2GKD A;  4JDA A;  3KDI A;  4C9I A;  4NCB A;  5E4D A;  4JHG A;  3OQU A;  1BTV A;  1UW5 A;  3UQH A;  3GKE A;  4IGX A;  3C0V A;  3OTL A;  2NS9 A;  3H3T A;  3KDH A;  4Y31 A;  1QMR A;  5BRL A;  2L8O A;  4GY9 A;  4A8V A;  2K7H A;  2Z9Y A;  3F08 A;  4BK6 A;  1XDF A;  4BK7 A;  3OJI A;  4IHR A;  2LEQ A;  2LCG A;  3NJO A;  1H2O A;  1LLT A;  2FFS A;  3FO5 A;  3GL2 A;  4QDF B;  1X53 A;  2E3O A;  3GB4 A;  2FLH A;  3QSZ A;  2KF2 A;  4R7K A;  5C9Y A;  2A1L A;  3OH8 A;  5E46 A;  4PSB A;  5AMW A;  5I9J A;  4A8U A;  4IGW A;  3GTS A;  3E85 A;  3NQN A;  3F73 A;  1VJH A;  4A80 A;  3DLB A;  3DLH A;  1LN3 A;  4BKC A;  4A88 A;  2MOU A;  2E3R A;  3KLX A;  3Q63 A;  4A83 A;  4C9C A;  3IE5 A;  3IJT A;  3JRQ B;  3NI8 A;  3KL1 A;  2LAF A;  2LF2 A;  3NEF A;  4M9B A;  1KCM A;  4JHY A;  1Z94 A;  2LDK A;  4REH A;  3K90 A;  2L9P A;  3Q6A A;  5I8F A;  1ICX A;  1IFV A;  1XFS A;  4RYV A;  2E3Q A;  4IGY A;  2VNE A;  4IGV A;  4LGB A;  3RD6 A;  3KB0 A;  2EJX A;  2KCZ A;  4LGA A;  2PCS A;  2N4A A;  2IL5 A;  3H3R A;  3P0L A;  4QDF A;  2RES A;  2M89 A;  3ZVU A;  4B9R A;  4BKD A;  1EM2 A;  3HK2 A;  3HM9 A;  3KB3 A;  2LAK A;  3HXM A;  1XN6 A;  3TVQ A;  3GL0 A;  2LPX A;  4N3E A;  2LE1 A;  2QPV A;  5EKQ C;  4REJ A;  4KPY A;  4N76 A;  4M9W A;  4LA7 A;  3UID A;  4WVO A;  3HVR A;  3W9K A;  4DSB A;  2VQ5 A;  2E3S A;  1FSK A;  2KEW A;  3NJ1 A;  4QIP A;  1TW0 A;  2LIO A;  3GGN A;  4IH2 A;  2YH6 A;  3RT2 A;  4A85 A;  3QN1 A;  3W9R A;  4Q0K A;  2R55 A;  2E3P A;  4QDC A;  4N0G C;  4A8G A;  5E4B A;  3NMH A;  3K3K A;  1TXC A;  1FM4 A;  4QDD A;  2Z9Z A;  3H3S A;  1BV1 A;  2QIM A;  1T17 A;  2LUZ A;  3PU2 A;  4MA6 A;  3NMN A;  3TGO C;  2E3N A;  3JRS A;  3TVR A;  2WQL A;  2ZYL A;  3TFZ A;  2KTE A;  3NMP A;  5JO2 A;  3Q64 A;  3NR4 A;  4N47 A;  5JO1 A;  4QCK A;  4BTZ A;  1ZXF A; 
#chains in the Genus database with same CATH homology
 2Q3Q A;  2D4R A;  3GTE A;  3PUT A;  3RT0 C;  4N41 A;  2L65 A;  4LG5 A;  1JSS A;  1B6F A;  3CNW A;  3KAY A;  4JHH A;  3TL1 A;  3GOB A;  5E4M A;  2N4B A;  4MAP A;  4A81 A;  4FPW A;  3UJL A;  3NMV A;  1XUV A;  4IH0 A;  4MNS A;  3NS2 A;  2REZ A;  2LGH A;  3KDJ A;  4DSC A;  1LN1 A;  4NCA A;  3R6P A;  4REI A;  1LN2 A;  3HO1 A;  3H3Q A;  4XRT A;  4A84 A;  2I9Y A;  3ELI A;  3P9V A;  5JNN A;  4JHI A;  3HJF A;  4DS8 A;  1XN5 A;  4OIC A;  1T27 A;  4XRW A;  3NMT A;  2PSO A;  4E6F A;  4Z3L A;  2BK0 A;  2M47 A;  3KAZ A;  1E09 A;  3NEG A;  2K5G A;  3NJ0 A;  2RER A;  4JDL A;  3P51 A;  2E3M A;  4C94 A;  2NN5 A;  4A86 A;  3WG8 A;  4A87 A;  2GKD A;  4JDA A;  3KDI A;  4C9I A;  4NCB A;  5E4D A;  4JHG A;  3OQU A;  1BTV A;  1UW5 A;  3UQH A;  3GKE A;  4IGX A;  3C0V A;  3OTL A;  2NS9 A;  3H3T A;  3KDH A;  4Y31 A;  1QMR A;  5BRL A;  2L8O A;  4GY9 A;  4A8V A;  2K7H A;  2Z9Y A;  3F08 A;  4BK6 A;  1XDF A;  4BK7 A;  3OJI A;  4IHR A;  2LEQ A;  2LCG A;  3NJO A;  1H2O A;  1LLT A;  2FFS A;  3FO5 A;  3GL2 A;  4QDF B;  1X53 A;  2E3O A;  3GB4 A;  2FLH A;  3QSZ A;  2KF2 A;  4R7K A;  5C9Y A;  2A1L A;  3OH8 A;  5E46 A;  4PSB A;  5AMW A;  5I9J A;  4A8U A;  4IGW A;  3GTS A;  3E85 A;  3NQN A;  3F73 A;  1VJH A;  4A80 A;  3DLB A;  3DLH A;  1LN3 A;  4BKC A;  4A88 A;  2MOU A;  2E3R A;  3KLX A;  3Q63 A;  4A83 A;  4C9C A;  3IE5 A;  3IJT A;  3JRQ B;  3NI8 A;  3KL1 A;  2LAF A;  2LF2 A;  3NEF A;  4M9B A;  1KCM A;  4JHY A;  1Z94 A;  2LDK A;  4REH A;  3K90 A;  2L9P A;  3Q6A A;  5I8F A;  1ICX A;  1IFV A;  1XFS A;  4RYV A;  2E3Q A;  4IGY A;  2VNE A;  4IGV A;  4LGB A;  3RD6 A;  3KB0 A;  2EJX A;  2KCZ A;  4LGA A;  2PCS A;  2N4A A;  2IL5 A;  3H3R A;  3P0L A;  4QDF A;  2RES A;  2M89 A;  3ZVU A;  4B9R A;  4BKD A;  1EM2 A;  3HK2 A;  3HM9 A;  3KB3 A;  2LAK A;  3HXM A;  1XN6 A;  3TVQ A;  3GL0 A;  2LPX A;  4N3E A;  2LE1 A;  2QPV A;  5EKQ C;  4REJ A;  4KPY A;  4N76 A;  4M9W A;  4LA7 A;  3UID A;  4WVO A;  3HVR A;  3W9K A;  4DSB A;  2VQ5 A;  2E3S A;  1FSK A;  2KEW A;  3NJ1 A;  4QIP A;  1TW0 A;  2LIO A;  3GGN A;  4IH2 A;  2YH6 A;  3RT2 A;  4A85 A;  3QN1 A;  3W9R A;  4Q0K A;  2R55 A;  2E3P A;  4QDC A;  4N0G C;  4A8G A;  5E4B A;  3NMH A;  3K3K A;  1TXC A;  1FM4 A;  4QDD A;  2Z9Z A;  3H3S A;  1BV1 A;  2QIM A;  1T17 A;  2LUZ A;  3PU2 A;  4MA6 A;  3NMN A;  3TGO C;  2E3N A;  3JRS A;  3TVR A;  2WQL A;  2ZYL A;  3TFZ A;  2KTE A;  3NMP A;  5JO2 A;  3Q64 A;  3NR4 A;  4N47 A;  5JO1 A;  4QCK A;  4BTZ A;  1ZXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...