3Q67A

Human aldose reductase c298s mutant in complex with nadp+ in space group p212121
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
316
structure length
316
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVSALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title The role of Cys-298 in aldose reductase function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 102
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3q67A00
4DBUA 4H8NA 4IJCA 1RY8A 4IJRA 3KRBA 2IPWA 3M64A 3LENA 3UZZA 3WBXA 1Q5MA 1LQAA 4LB3A 3UGRA 2HVNA 4XO6A 2F38A 3COTA 3H4GA 4JQ1A 1Z8AA 1R38A 1Z89A 4NKCA 2R9RA 3F7JA 1T41A 2PDUA 2FGBA 1MI3A 2HDJA 5C7HA 5HNTA 2ACUA 4JQ3A 4F40A 2P5NA 1YE4A 1LWIA 2WZTA 4GABA 2FZBA 3G1RA 2PDJA 4XO7A 3UZYA 4JTRA 3R7MA 1ADSA 4PRRA 3T42A 3BUVA 2VDGA 1T40A 1K8CA 3UZWA 4ICCX 4ZFCA 3ONCA 2ACSA 5LIUX 3Q67A 4I5XA 2FZ8A 1ZQ5A 2IKHA 4LAUA 2BGQA 1PZ0A 2R24A 1EXBA 2I17A 2ISFA 5AZ0A 3UP8A 4JTDA 2PDBA 2PDCA 3B3DA 2PDWA 3NTYA 1S2CA 3Q65A 2QXWA 4JTAA 2BP1A 3WG6A 2A79A 3CV7A 4GQGA 4RPQA 4YVPA 3CMFA 2IKIA 4R9OA 1S2AA 4JTQA 1VP5A 4PUUA 3V0UA 1EL3A 3DOPA 4YVVA 1Q13A 3WBYA 4OTKA 2HV5A 1PZ1A 3CAVA 4FALA 3H7RA 2DUXA 4HMNA 5JH1A 4EXAA 3V0SA 3R43A 4WDXA 4XZIA 4AUBA 3C3UA 2PF8A 3EAUA 4YS1A 5LIKX 2IPFA 1RY0A 2INZA 2IPJA 1ZGDA 2DV0A 2J8TA 3H7UA 3RX2A 1MRQA 1AZ1A 3ERPA 3BV7A 3P2VA 1EKOA 1XF0A 1HQTA 3LZ5A 4PR4A 3FX4A 3GHUA 4H7CA 4GQ0A 3MC5A 2PDIA 2PDYA 1VBJA 3FJNA 1AH3A 3CV6A 5HA7A 3QKZA 1PYFA 2NVCA 1A80A 1AZ2A 4LB4A 1C9WA 5KETA 1XJBA 3LQGA 4Q7BA 3BCJA 1QWKA 4DZ5A 4XZNX 4XAPA 2ACQA 4XVDA 4JQ2A 1PWLA 3R6IA 3ONBA 4FAMA 2IS7A 3EB3A 1AFSA 4MHBA 1AH0A 1EF3A 4HBKA 4QX4A 1X98A 1UR3M 4PRTA 2PDMA 3UZXA 2PDKA 2PDHA 3N6QA 3UWEA 1XGDA 4L1WA 2FVLA 3V36A 3R8GA 4YVXA 2I16A 4QBXA 3R58A 3LBOA 3M4HA 4WDTA 1SM9A 1FRBA 2WZMA 4XVEA 1ZUAX 4ASTA 5M2FX 3R94A 4QR6A 1RALA 2PDFA 2PDXA 2CLPA 2PFHA 2PDLA 1JEZA 1IEIA 1YNQA 4WDWA 1J96A 3GHRA 3LZ3A 3V35A 3GHSA 5LIXX 4QXIA 2PD5A 1Z9AA 4JIHA 2C91A 4IGSA 2INEA 3WCZA 4JQAA 4GCAA 4Q3MA 3M0IA 4JIIX 2PDQA 2PZNA 3GHTA 1MZRA 3LNMA 4XZHA 1S1RA 5AZ1A 3N2TA 2F2KA 2PDGA 3LQLA 4LBRA 3UYIA 2IPGA 4FA3A 2HEJA 1X96A 3U2CA 4WEVX 1X97A 2IKGA 3CAQA 1QRQA 3VXGA 1YE6A 3UG8A 1IHIA 3WBWA 1OG6A 1PWMA 4EXBA 4GA8A 4WGHA 2PEVA 3EB4A 4GIEA 4JQ4A 3G5EA 4DBWA 3D3FA 4LAZA 3GUGA 1HW6A 4PUWA 2BGSA 2PD9A 1S1PA 3CASA 2NVDA 3DN5A 3LN3A 2AGTA 4YU1A 2HE8A 2FZDA 4XK2A 5DANA 2FZ9A 1YNPA 4FZIA 3UFYA 1AH4A 3LUTA 2IQ0A 3R8HA 4L1XA 5LIWX 3V0TA 4XZMX 4WDUA 3O0KA 4XZLX 2HE5A 4DBSA 3RX3A 4G5DA 1M9HA 3RX4A 2ACRA 2PDNA 3MB9A 4GACA 1Z3NA 5HNUA 2IKJA 2ALRA 4JTCA 1GVEA 2IQDA 2DUZA 4LBSA 1US0A 5LIYX 4JIRA 4WRHA 2HVOA 3O3RA 3LD5A 2PDPA 4PMJA 3LEPA 1ZSXA 3BURA 3S3GA 5JH2A
chains in the Genus database with same CATH superfamily
5C70A 1XH2A 3S9YA 5CC7A 1LF1A 1SQ7A 1W3LA 2G3IA 3NJ3A 2YB1A 1O95A 3TKFA 1MW1A 5FIPA 3EKZA 1IT0A 1OT2A 1Z44A 3LHZA 3BLFA 3ATYA 2PWUA 2PMQA 1UH4A 2HXUA 2QCMA 1C91A 4XO6A 3W1TA 1ONEA 2DORA 3BQ6A 3E1F1 4PBGA 4HYVA 4D6GA 1F5ZA 4KIRA 3PWAA 2NX1A 4MGGA 3QC3A 5I00A 3Q58A 2NVAA 2P8CA 4OFCA 1Q7QA 1GG1A 3IPWA 4LYQA 1CBGA 2HWGA 4XIAA 3UYCA 5HNTA 2AMXA 3ENLA 1XD0A 2DZVA 3A9BA 5FJRA 4F40A 2P5NA 4H2HA 4MB5A 1D7FA 4MG4A 3UQNA 1QAPA 1SJDA 1XLDA 2REQB 4NZJA 3G1RA 1MYRA 2ZXDA 3PPFA 3DC0A 3QLDA 4QCFA 1F7BA 3PZ9A 3N3TA 5HAOA 4C1NB 2VR2A 1T40A 4UR7A 4ZFCA 4K7VA 4MFEA 2PU1A 2XJ7A 3FDKA 5HMFA 2D24A 3AFBA 4KT2A 5I02A 3CIXA 3PTKA 4B5WA 4CD6A 1OX6A 3C4UA 2OFJA 3ZVHA 4W86A 2UY3A 1YIXA 3LRKA 1BRLA 1CXEA 3QR0A 1O68A 4DY1A 1S46A 1JZ6A 2VCAA 1FWJC 5K7JA 3O1NA 3CNYA 1GT8A 1GQLA 4PTNA 1OK6A 5LXEA 1Q13A 1KTNA 4K6AA 1C8VA 2J47A 4Q4SA 3WL1A 4WXZA 5D2XA 1PCWA 3BMVA 3OU8A 4RXFA 4HNUA 4QRNA 1P5BA 3TSDA 4HZ7A 1CB7B 2DDXA 4AUBA 1IEWA 1XCFA 3WJSA 4GJJA 4CQ9A 3P81A 2BSLA 5A6JA 4G8TA 4UQEA 4C1KA 2NT1A 4F79A 2DV0A 2BXZA 3HQNA 4I90A 3KTSA 1JZ3A 1EJVC 1SW3A 4A3RA 1QCWA 5D09A 3VC6A 2XIBA 1V02E 4KCWA 3CYVA 4JKKA 3I3DA 4G7FA 4EIVA 1DJZA 4HN8A 3B8TA 5AOUA 1KR0A 5CSYA 2V8ZA 1OZMA 2XM2A 4DO5A 2BFGA 3B9EA 4IQDA 5I3FA 3W88A 4H8HA 1JGMA 5FSEC 4XZNX 3E0FA 1XW8A 4U10A 3N4FA 1VBUA 3DG6A 6REQB 3LXCA 1V6VA 2XPKA 1QHPA 2XINA 4G1NA 5ABHA 3VGFA 3WLOA 4JTEA 1T8QA 4M80A 2F2HA 1P0EA 5ECUA 3KL3A 3N15A 1EA0A 3C0JA 1A0DA 3LYEA 1LM1A 3CL6A 3VO0A 3FAWA 5EMYA 3DBNA 4A4AA 1JFXA 4FR6A 3MSYA 3S5NA 3M0KA 1ZNNA 3W1QA 1JUEA 2QPXA 2VC6A 2WMFA 1EEXA 3WIJA 4LYRA 4XVEA 2V81A 1B30A 4AZCA 1E0TA 3R94A 2J8GA 3IARA 2PDFA 1DJQA 4UFJA 2WC7A 3GXFA 2A2IA 3MI6A 4B4HA 4O4VA 2ZFAA 1ZP4A 4RPPA 4EACA 3NXFA 1CGUA 4K1WA 2VHLA 1DIDA 4PTWA 2E5CA 1QTWA 3GB6A 1TPVA 4EK7A 4J3VA 1BEUA 2FHBA 4X9SA 4DJDC 3PBGA 2ISSA 4QHRA 3MZNA 1AW2A 1HIZA 4DWSD 3PC0A 3TYEA 2BY1A 1TSIA 3LTPA 2F2KA 4IP7A 5GQBA 1UKOA 3E12A 3S5ZA 4IUGA 4S2CA 2OQLA 1R3TA 4UNLA 1JJKA 5I3JA 4TMCA 3W7QA 1QI0A 2FH6A 3RLUA 4F0RA 4AX7A 1Q6LA 2D2GA 1VJIA 3QMRA 5E6ZA 1OFEA 3LDVA 1OG6A 1I45A 2BGNE 3QTGA 1Y7VA 4FX7A 2A0NA 4I7VA 1UH3A 4CNSA 2RJGA 3GUWA 4Z2LA 1QPQA 2PTZA 4LAZA 3SRFA 3GVGA 4O8AA 3IRSA 2WV8A 4Y7EA 1Q8JA 3W00A 2ZXAA 4BQ3A 3OVRA 4JX5A 4IFKB 2WSKA 1LL7A 2P88A 3G0SA 2DZTA 2GJLA 4J3TA 5BCAA 5FL0A 3H2CA 4HNLA 4X63A 1IXPA 2HNEA 1V02A 2XZ7A 3EMZA 3CV1A 3T44A 1GQKA 4Y96A 5HJLA 2FHFA 2NQ9A 3GQYA 2GYIA 3UPBA 2VGBA 3EWCA 1THFD 1UJQA 4ZXOA 4ADSA 4WDUA 3O0KA 2W66A 4XZLX 4L61A 3CU2A 1FWDC 1I6NA 4L9ZA 4MLJA 4C6OA 4RE2A 1NWTA 4ONVA 5HNUA 4CN6A 4DO6A 4W7UA 1Q3NA 3TLQA 3RJXA 5G4WA 1P6WA 3IGHX 4BI6A 4B92A 1VHCA 2I14A 2CBJA 5JIPA 3W2LA 1L6SA 4UR9A 1EIXA 5I07A 1AD1A 1DTUA 4ZBCA 3BURA 1S39A 4DUVA 4ATWA 1XV8A 1PBGA 3KRBA 1PKMA 4H7ZA 4AC7C 2IPWA 3SFWA 1H0IA 1DQWA 3W70A 4L6OA 2QCDB 3L21A 1L2QA 4X0VA 5HPCA 1A5NC 3W2MA 1EDTA 4Q8UA 3W7LA 3WQOA 2ZIDA 4PGLA 4XV0A 3WFLA 2CBIA 1BWVA 3IGSA 3M41A 2WBGA 3FGCA 5EL1A 1EP3A 4FOUA 1WBJA 2FPTA 1XLCA 3OQ8A 2J9XA 3PP7A 1NWRA 4IG2B 3WDJA 5CG0A 1T41A 3PZVA 3H2NA 4ZOCA 2ADAA 2YLLA 3WLHA 4URIA 2OT1A 5I79A 2GSJA 4QSFA 4DJDD 3UBPC 2R8WA 2VD8A 4RJEA 4EPKA 1FCQA 6ALDA 3FFSA 1V0KA 3KBSA 3GNRA 2FFIA 1K8CA 3FYOA 4HB7A 1GW1A 2ACSA 1QPOA 3ALFA 3MU7A 4GJ1A 3CUGA 3W23A 2R24A 2PU0A 4CN1A 3SCSA 1WCGA 2PGRA 2ISFA 2HMCA 5LZLA 2EPHA 3BVJA 1UMLA 3P82A 4W88A 4DJFD 2JALA 5I3GA 1DORA 2PDCA 1FDZA 4WF7A 1XFCA 3OZYA 4G7EB 2WK2A 3M1ZA 4LEQA 3WG6A 1RK5A 2FYMA 3GXTA 4Q8TA 3VIKA 1CGTA 3CMFA 1XRFA 1MZHA 1CLKA 1KXTA 1LJYA 3IEBA 3F5KA 2A7RA 4PSRA 3OJGA 2GVLA 3SJ3A 5HR7A 3CHEA 4A05A 3CQ0A 1OK4A 4HT3A 2EJAA 3H2EA 3CC1A 2JEPA 1HVXA 1H62A 4MY9A 1UMYA 3W7GA 3CIWA 1MO0A 3VZYA 2DUXA 4KW2A 1TJ2A 3V16A 3L4UA 4WXYA 1XR2A 5GJNA 4DXKA 4I9MA 3BTNA 1O4UA 1XQLA 1OX4B 5D8WA 4Z42C 4YS1A 1V6WA 3MUXA 3GNXA 4I3GA 2GK1B 3RILA 1BYAA 4U33A 4BEUA 4CNOA 5FSDC 4NF7A 4NXKA 4A3HA 3QYQA 1VENA 1HQTA 1RP8A 1GYLA 1DV7A 1FH7A 3K1GA 1HUVA 3STCA 3VGHA 3WMLA 1CIUA 1SU5A 1PYMA 1DEDA 1VZWA 4GI8A 4YLWA 4PMYA 3VIMA 3HJEA 2ZVIA 3S6TA 1TO3A 4XBJA 5REQA 4OOZA 3GDMA 4Q7BA 3L23A 1F3TA 2NLIA 3VCNA 4OV4A 4AYGA 4H9TA 4JY9A 5C0QA 1FP8A 2D3LA 4JX4A 1LRNA 1VGAA 4IFRA 4R27A 2CZDA 4NASA 4IGNA 2V5CA 2BHZA 1JXJA 1AMKA 1X98A 3RLGA 4TX9A 3CMGA 3S2CA 2ANUA 1GPWA 3L4WA 1JFHA 1KM0A 1T8XA 3FNDA 3GFZA 3R11A 1GW9A 4YNGA 1I2RA 1TV7A 1M68A 3E0VA 2E3ZA 5C9WA 5T8GA 3R25A 4ZXLA 1MNZA 2FGZA 3QTPA 1YNQA 3V35A 4AEFA 1Z9AA 4TXEA 4AIUA 4ZE5A 1NH6A 1TYGA 2FJKA 3G1DA 1IGSA 3W1AA 4GCAA 2QCNA 4DPPA 4JIIX 4DAIA 1MNSA 2E6AA 4HK6A 2CPUA 1PS9A 3WK0A 3KL0A 4TO8A 1S1RA 1GKPA 3URAA 3R0UA 1RLCL 2WJFA 2WZHA 4W9TA 1IT8A 1CLXA 4GXMA 3AUJA 4AXKA 2VNCA 4YTTA 4O11A 1XKYA 3CT2A 4C6DA 3NL3A 3WBWA 3P67A 3AS3A 3AWOA 4C6CA 1VYRA 3ARSA 3HPXA 2WPBA 3R2GA 4O54A 4JQ4A 4K8EA 1SJBA 2P76A 3M7SA 3NAVA 3JS3A 1LCOA 3W02A 4XX6A 2OZ8A 2V3DA 2BVWA 2YR1A 4DBWA 4QAWA 1EOKA 4AIOA 1IYXA 2Z1BA 1RCXB 4JDBA 4GGBA 1JDCA 3VNJA 1S2VA 1I1XA 2ZUSA 1E0UA 1D3HA 2J74A 3MHGA 1PKLA 3URNA 1CXLA 3PZMA 2VURA 4A35A 3W2UA 3BG9A 3XISA 1B4EA 5A5WA 1X7IA 3T0CA 2DZWA 5H8MA 4UTFA 4O52A 1PCKA 5FJTA 1UJPA 5LYRA 5T9CE 4EXQA 3EWXA 1RVKA 4JFSA 2V63A 1NWSA 3FJLA 4Q6XA 3KOZA 5FEXA 4XD4A 5IFPA 3N19B 2D73A 3MUIA 4J28A 1Y5VA 4JKLA 1KBJA 3MHUA 1XRTA 4R7OA 3VIGA 4JIRA 4WRHA 1EGMA 4G9PA 1Y0EA 4XAFA 2CESA 2PS2A 1QVBA 3G3MA 2VVSA 3VOIA 4DAFA 3A64A 3L9CA 4X60A 4E3TA 4LUTA 2NUXA 3SO7A 4KGLA 1Q7ZA 1SSGA 1W8SA 4B5UA 2YFNA 4OBRA 1KCKA 3IIZA 3CUHA 1KB3A 1NARA 2DFAA 3OYXA 4C1LA 2GOUA 3QFEA 3UVAA 4UTIA 4ZO8A 2PRLA 3E38A 3L2MA 1S2TA 4AISA 4GD0A 4KFOA 3L4TA 2JKEA 1ME7A 1TTQA 2Y88A 4NNAA 3SCRA 3TE9A 3TQVA 1H7PA 2MANA 2HVNA 2XZ9A 5B80A 3HQ1A 1RQEA 4CUCA 1DHPA 2GDVA 1UP0A 2I9UA 4NIRA 3S6DA 2WVVB 1YTEA 1KWGA 5LNRA 2NT0A 5IBXC 1XLGA 4RNHA 1MI3A 3DENA 1V79A 2I57A 1V93A 1MFUA 3M0LA 4XWUA 4Y9PA 2VEPA 3UG4A 2OU4A 3DH7A 2ZRXA 3PJTA 4D8LA 4F3HA 4K8GA 5D4YA 3L4XA 1Q6DA 1TR9A 2VEFA 3R1ZA 1YDOA 3T42A 3TAOA 2WMGA 5AVHA 3LU2A 3TJIA 4LVGA 1UQZA 1VAHA 1T6MA 3STGA 4M8UA 1F07A 4B91A 2QCFA 4IPPA 3KWSA 3IJIA 3W1LA 3IJQA 4M7SA 1F3WA 4BQ5A 3SURA 2O9PA 2RDWA 1BVWA 4NG3A 2PLMA 1P0DA 3P84A 4Q4PA 3W7EA 2B7NA 3SUWA 3JZEA 3D5HA 3CLMA 1MEWA 4U5IA 1QATA 2BVTA 3C0QA 3BL3A 4OTKA 4LVDA 1Z7AA 4YJ5A 1GZJA 2NV9A 3P62A 1YNYA 5C71A 1LBLA 4W89A 4DI9A 1ZJHA 2G5WA 3U0HA 2Y4SA 1KFCA 4IMGA 4I7UA 2J9ZA 3VNLA 1RY0A 5EMKA 1NELA 2HVMA 1ZGDA 3B8UA 3L4ZA 3IRDA 1X39A 1MEIA 1KW1A 5AC8A 3BV7A 5KTLA 2WM0A 4LNYA 2J9YA 2GJPA 3LZ5A 3IIVA 1NOWA 1A5BA 4Q8VA 2HS6A 4HNOA 1UWTA 5TF0A 2DSKA 7A3HA 1VIWA 1E5NA 1JGIA 3QW3A 5I3IA 4R85A 4H6EA 1XDLA 1UD3A 1QMLA 1XXXA 2QCHA 1C8YA 4IMAA 4FXRA 3WQ6A 5I77A 5CBJA 2WSYA 7ENLA 5BMWA 2YA1A 3LPPA 2QAPA 4ZB2A 1EEPA 4DNMA 2DY3A 3H2AA 3W3OA 2B4GA 3DZ1A 2WWCA 5AHFA 4GFIA 1Q2RA 4AWUA 2Y63A 1OJXA 1W5OA 5F4XA 4JOMA 1WKFA 1I2OA 3TUUA 4UTTA 1E6RA 3UWEA 3QV8A 1TRIA 3UCDA 3CHDA 3REQA 1JRBA 4GBDA 1I2NA 1JDFA 5IRPA 3W7DA 4LXFA 3AOFA 3ABRA 5J04A 1XKJA 2PWDA 5E6YA 3W2NA 3ZVIA 1XYBA 2TMDA 3NXLA 2Q3OA 4UFHA 4QR6A 3NSNA 3WEOA 3AHXA 2MUCA 1QDSA 3BCFA 2YCLA 4CD7A 4HK7A 2G95A 1IEIA 3LHUA 2C71A 1NIUA 1UKTA 3VE7A 1Z32X 3MVIA 4QG9A 1WNOA 4JTTA 2C16A 3A21A 3VIHA 4FNUA 2W79A 2QDEA 3O6YX 3WD2A 1QNQA 3IAPA 4JQAA 4A8LA 5AYBA 3DUGA 5HATA 2UY5A 1Y5WA 3B8DA 1FWGC 1UIPA 3MP4A 1GOKA 4LC6A 4JY8A 1OZQA 1PHWA 5DMLA 1VFSA 1JZ7A 2Z1KA 3UG8A 1ONXA 4ZCWA 2GGEA 3TAKA 5DO8A 4NP7A 4QG6A 1KM4A 4GA8A 2HNHA 2DSUA 2OKTA 1V7YA 4JHZA 5DCBA 4OBTA 4GC4A 1HL2A 5EPDA 5K3VA 3DU0A 2D2HA 4M6VA 3IGXA 9XIMA 2CLHA 1M04A 2HPMA 3TZNA 1F76A 1SR0A 1E6PA 1JG9A 3ELFA 2R1PA 1AJZA 2Z1XA 1G7VA 3GUGA 1GUVA 1ZAIA 1ZZMA 2ZBTA 5FJUA 4LYKA 2ZZ3A 1BXCA 3SRKA 1ENUA 4H1ZA 3RM9A 1ZPTA 1WYIA 3S42A 4J2MA 5D04C 5AC7A 3DFPA 3RIKA 2D2OA 4WSHA 3MUZ1 4TV5A 3AIUA 1TVNA 2AKZA 2XSAA 4JL2A 1X6NA 1EUAA 2E67A 9CGTA 1P7TA 4PYSA 4AYSA 3PNZA 3GNPA 3LV6A 4FNPA 3M7WA 4ZTYA 1GJUA 2VQUA 5DMMA 1H4PA 4NUWA 3MJYA 1RHCA 3MSRA 3KVKA 3EWWA 3VNZA 3RX3A 1KR1A 3VPLA 5DX7A 4PCFA 1GHSA 3OQEA 5G2HA 1O7AA 5L9FA 1SUXA 3T8QA 1TB3A 4L64A 3B4UA 2A4AA 1U1JA 1FWSA 1RPKA 3FJ4A 3C2YA 2XN1A 1I8JA 1YDYA 2XWEA 1FQ0A 1LWHA 1TX2A 3CL7A 3PTMA 1ZB5A 4F66A 4ZOBA 3L5MA 4DBUA 3SADA 3AU2A 4K2SA 1EOMA 3HA1A 3TZFA 5TQLA 2KZHA 2WVSA 3I3EA 3SN0A 4LALA 4MZ8A 2E8YA 4LUIA 2DVTA 3STEA 1VCGA 3K30A 1F6YA 5FEWA 4LB3A 3HIJA 3ZS4A 2F38A 3CK5A 4TX6A 4JTSA 1JPHA 2R1MA 3IUIA 3CUZA 3F4WA 2PWHA 1B4KA 1V08A 4AB4A 4XZBA 3F7JA 4I9AA 3N2XA 3P14A 1F6PA 3W4RA 3O2LA 4GABA 1JPDX 4HSOA 2FZBA 1GHRA 2OQHA 4TTGA 2X40A 3FN9A 2VX4A 3PPCA 1UR8A 3E0IA 4BWLA 4G1KA 4ATLA 4PRRA 3QKEA 4QM1A 4LANA 3WQPA 3AI0A 3ONCA 5GNZA 3PM6A 1AL8A 1PZ0A 1KNWA 1TREA 1V0NA 5KMYA 5DY2A 5CG7A 1OFRA 4PFHA 3B3DA 4D6JA 3TIMA 3YPIA 4KEUA 3UU0A 2XVPA 4GZIA 1V6TA 5A8NA 3PPHA 2BP1A 4YVPA 1TA3B 1FHVA 3NSMA 4PN2A 2Y8VA 1H7WA 2JKPA 4IIHA 4ZTXA 1VPYA 5LNWA 2X8RA 3ARZA 5GNYA 3HQOA 4D6EA 2OJPA 4CNPA 3MHFA 3CIVA 3MANA 2V2CA 4DHGA 1QPNA 3TOYA 1B3XA 4JAWA 4Z08A 1XLIA 5EGRA 1IIHA 4AEOA 1XLMA 4D8AA 1JCYA 5E70A 2EGZA 2DIEA 2BBFA 1PKNA 3ATZA 5CJMA 4ZO9A 3QW4B 3VU2A 1XCXA 1QU4A 1YPXA 2OG9A 2ZZ5A 4DBEA 4RE0A 1M01A 4IP5A 3AHYA 4JPGA 1EC8A 3MC5A 3UR5A 1UWQA 4AZHA 3PJXA 1VEMA 4NSBA 3GZ3A 2A3EA 2A3AA 4ACYA 5CPLA 3GS6A 3BG3A 4DM2A 2ZUVA 2NUYA 5C2GA 3LQGA 1E6XM 3WD0A 1D2KA 2ACQA 1A5KC 4L4LA 3GU1A 3AIRA 2IS7A 3PZTA 3WMSA 3AYRA 1QO2A 3S2LA 3OA5A 5HUPA 1W1VA 4F8XA 3P80A 3QV6A 4JHMA 3CQIA 3Q37A 3W38A 3WQVA 5B7ZA 3C6CA 4YXGA 2V2DA 2EKGA 1E6SM 2HRWA 3NQDA 3E2QA 2JIWA 5JBEA 4F48A 4ZENA 1ZP3A 3WENA 2TRSA 4IOTA 3UY8A 2WWDA 3ITXA 3TDFA 1IEQA 5M2FX 3TC6A 4JICA 3WNLA 3RPTA 1RALA 5H6HA 1XIDA 3P93A 3W27A 1BSIA 1DXEA 2Z4GA 4HA3A 4GIAA 3SCUA 4PC8A 2OWCA 3DXIA 4WGXA 2A7PA 1PV8A 4WDWA 4J9JA 4DF1A 2POTA 5BMXA 3AXXA 3BAXA 1QHOA 2VDHA 3U6WA 2KX9A 4REQA 3WF4A 2WJZA 1J9YA 3M0ZA 2E5DA 4XTDA 4R33A 1B90A 3NNTA 3GDBA 2PZ0A 4BF5A 3AYTA 3W9ZA 2G50A 4V28A 4FK9A 3S8HA 3L68A 1S5NA 1SFJA 4QQ3A 1TPFA 4JBRA 3BAJA 4ZR8A 1X6UA 3TXZA 4TIMA 3QQ1A 3NVDA 2PDGA 3CUJA 3RPDA 1X7FA 3CO8A 3EWBX 3UT0A 4MPKA 1PDYA 4DF2A 1KGXA 3T9PA 5A8MA 4AVNA 1YE6A 1IQ8A 3LI0A 4S38A 2Z6JA 1LRQA 5PTDA 4MLRA 1RP9A 4WGHA 1M41A 1KTBA 4GQBA 1JCXA 1TPUA 4JYEA 2BG5A 2DIJA 2CETA 2Y0FA 1MQRA 4US6A 1R46A 4LVBA 4HMDA 4Y9OA 1F9CA 2PD9A 1DBTA 2W92A 3C0SA 3CAKA 5DT7A 3VX0A 4UQAA 4YU1A 3TSMA 1TIMA 3I6EA 1JVNA 4JCMA 2FMNA 4CQ8A 2HE8A 3EEGA 4NAEB 2OT0A 2E25A 5LGXA 4TOQA 1A5OC 3H6OA 2BVYA 1KQZA 2EJ1A 3GU2A 2PLCA 5FAGA 2TYSA 3MYPA 4UR8A 3MO4A 1U22A 4RDZA 1QOQA 1HNYA 2JF6A 4O1DA 2WHKA 5A6BA 2HE5A 3QPEA 3OA3A 1M9HA 5G2IA 4E8DA 1G4SA 3ARWA 3K1DA 1HJSA 5JUVA 2IKJA 1TZ9A 2P10A 2CYGA 3NEVA 2FPVA 2Z26A 4MNMA 2Y7EA 2PWFA 3UWYA 1KM1A 4MZYA 3E9AA 2VENA 4E4PA 1XP3A 4F0SA 3H8AA 2R91A 3CHCA 4IISA 3GXMA 4MNJA 5F1UA 1G4EA 4CQAA 3QHMA 2WQDA 1H1NA 3ZT5A 2ASHA 2PC8A 4PSPA 4LV4A 3W85A 2VCCA 3WBXA 1U1HA 4MUZA 1SFTA 3CV2A 2Y7GA 4FMVA 3V7PA 3SIZA 2VO5A 2ZICA 2EG6A 3AS0A 1S5WA 3WH9A 3ARRA 1ME9A 4C7DA 4D72A 1Z89A 5AHLA 1H51A 3B8IA 4DVOA 1A5AA 1ZAHA 3ITTA 2RGLA 7TAAA 2DZUA 3FKRA 3QZEA 2VX6A 1F3EA 1UWIA 2GJXA 5I78A 3M47A 5IHRA 5C7HA 2WKLA 5T26A 1UW9A 1QO5A 3TOPA 3E2VA 1UWSA 2J7GA 1FWEC 3P0WA 1CLVA 1MMFA 3O6DA 1XDJA 2XH2A 3IJ6A 1W37A 2UY2A 4JTRA 3MA8A 4XUYA 3OTRA 1JAKA 4WY0A 3N17A 3MS8A 3T55A 5HULA 1WDWA 4BQ4A 3BSGA 1MUMA 2FZ8A 4NZ4A 4M7TA 4PMVA 3WMCA 4QJ1A 1PDZA 2FLIA 4JNYA 2CXGA 3ES7A 1R9ZA 3NQFA 4IMFA 5CQ1A 4LYPA 4U5KA 3CMJA 3MDWA 3DFNA 4R7WA 1LOLA 3RLHA 4OVXA 2BXVA 3T2OA 1FDYA 1YXYA 3B9NA 3GG7A 4AZBA 5D2WA 4GYPC 4HU8A 1FTXA 1HZYA 3V0UA 3T2QA 4AF0A 3VZZA 1C90A 3C61A 4Q8WA 3ZOAA 4FB7A 2HV5A 3MKVA 2C15A 1X1NA 2WBKA 2OELA 1TE1A 4XIMA 5LA0A 3QBUA 3NCOA 1MXSA 1BPLB 1OGSA 1JZ4A 3INPA 1XL9A 3R43A 5HQLA 4B15A 1LROA 4ML4A 3AIQA 5EA9A 2PF8A 3ZLGA 3AMDA 6PTDA 3G0UA 3EX4A 3M44A 1W17A 4O28A 3ZLFA 3H7UA 3LTYA 3PZOA 3ERPA 3PNUA 4K7YA 3P8IA 5H91A 2YB4A 3CBWA 1TV2A 4JN7A 2C1GA 3DCPA 1EJTC 5CGMA 4QDWA 3HG5A 2Q8XA 4C65A 2CHRA 4GXWA 1R0MA 4RKAA 1GVFA 4YN5A 1E1CB 2V3GA 1E9ZB 3KBNA 1ZTVA 4DN1A 2O9RA 2VOMA 4K39A 2EBNA 3OO2A 2OEKA 5DFAA 4DZ5A 4HU3A 4OV9A 4XAPA 1XCWA 3A3WA 4CQBA 1G6CA 4KEMA 2P0IA 4JQ2A 1V7AA 2VX7A 4IQEA 2ABBA 2I1OA 2XDFA 1G1YA 3E0WA 3EB3A 3V4BA 3HFTA 1J12A 1E0XA 2HCVA 4B5TA 2PDMA 4AZGA 2FTYA 2PTWA 5FACA 4LT9A 2GUYA 3NPXA 5AFDA 4UOQA 3CZEA 3T0BA 1SYTA 3V36A 4JZ5A 1ADDA 2D22A 3GR7A 1NDYA 1EJRC 4D6DA 4J3UA 1QPKA 2YCKX 4UZUA 4JIEA 2Q8LA 6XIAA 3AZTA 4JR5A 1M65A 2YL8A 3N34A 1JDDA 4GCXA 4EANA 3W1RA 3LCGA 4RZ6A 7TIMA 3CYJA 2ZUTA 3VGDA 4P7NA 3B9OA 4RNIA 2QW5A 2DZBA 3OLDA 2H3BA 1BQGA 2GQ8A 3IANA 1QW9A 2DJXA 4UTLA 3TU9A 4D9PA 1DJYA 3WH8A 2B31A 4HYRA 1NQ6A 3HJZA 2YIHA 4MNLA 3AC0A 2RHGA 1W1YA 1XYAA 3KTCA 3OVQA 5F2GA 3FW6A 5H2ZA 1MZRA 1TTJA 1QASA 1ICPA 3IV3A 8XIAA 4UTTC 5H8PA 5AHNA 4Z2GA 1EPXA 1T7LA 2HEJA 4J3ZA 4F4RA 3GG1A 4Q7IA 1QXLA 4S3CA 1K3UA 4NAFA 3TXVA 4DWSA 3R13A 1SZNA 1C29A 3AHVA 5EB8A 1NF0A 1OQFA 3EA1A 4GI9A 4HCHA 1TPEA 3WH7A 3WF0A 4FOJA 3LA4A 1BD0A 1W56A 1LT7A 2W4XA 3T4WA 1VPXA 4AWEA 1UCWA 3QOKA 1ITXA 3FJ6A 2OSYA 3EB4A 2GDUA 2DZAA 4PULA 1JRCA 4IMCA 1HFBA 3OIXA 1V3IA 4NJGA 1LLOA 4YTSA 3KBWA 4OU1A 3TYAA 4PB4A 2PUZA 1EHNA 2QJHA 3LI1A 4NRRA 3K13A 1EYWA 2X2GA 3GNDA 3T78A 2A3BA 3BO9A 1HP5A 4CN4A 2PPGA 3CASA 5DN1A 1OFBA 4H9YA 1OCQA 1V4YA 1UYQA 1EBGA 3BAIA 2VP8A 3LPOA 4FF5A 1QW8A 5EKYA 2HJPA 3WNNA 4G56A 2DSZA 2ZC8A 3O6AA 3GXNA 3W01A 3ZVHB 1JUBA 1GWJA 1BGAA 1RA0A 1BRLB 3B0UX 1YLVA 2H3DA 1W1TA 1W3HA 5C9RA 1E3ZA 2OQYA 1LUCA 1WDDA 2OEJA 5CGQA 1Q85A 3GFYA 2BZNA 2VR5A 4JTJA 1B0IA 2IQDA 5A6TC 3N6JA 3PZIA 3H54A 2XH7A 4N9EA 4PUJA 3BLEA 1VFFA 3VKKA 2NW0A 1UD5A 3GFXA 5HWMA 2NWRA 4LRSA 1FCUA 4AU0A 2C19A 4PMJA 3LEPA 2CLOA 4Q4QA 1MXDA 3RUBL 4Y2WA 2ESCA 3BAYA 4DBDA 3VGBA 2DJLA 3EMQA 2NLYA 4H8NA 4F0HA 4LH8A 5CBBA 3AMCA 3LSCA 2JEQA 3KHDA 3OLGA 5A6KA 5A1AA 4C7FA 1R9YA 2VOTA 1UA7A 2WLZA 4WSKA 1IF2A 1TV4A 1LQAA 3PVFA 1OC7A 4R34A 1M53A 1B3OA 2E1DA 3GH4A 4HMEA 4AD3A 1L8PA 3W7OA 1ZBCA 1F3XA 3BJTA 1PAMA 1JI2A 4PBFA 1TPC1 4JEJA 1BXBA 4JQ3A 2NQ5A 6REQA 4O1FA 1TZ7A 2BOGX 2VXNA 1QNVA 1JI1A 2PDJA 3H2FA 5CZKA 5BXTA 2D20A 4J2PA 4J5NA 2CZEA 2ZUMA 3UZWA 1NF7A 1DHKA 2R94A 3N9KA 1XSIA 3URQA 5FF7A 1OM0A 1VRXA 4HPNA 1W5PA 3O63A 1M5WA 1O94A 1FXQA 2WM1A 2J7DA 1J01A 1V6UA 4O18A 3DX5A 2PDWA 1TCMA 2ZE0A 2FHCA 1OF8A 3CUXA 3HO8A 3BZGA 1CI1A 4DJFA 3ZWTA 3I7RA 2DT1A 1XI3A 1SFLA 4PUUA 3AZRA 2FJUB 4AZCB 1RSCA 1J4EA 4GY0A 4ZSTA 4NZ5A 2VL4A 4GPNA 5I3KA 3TYDA 4I7WA 4NILA 1XD1A 4P8UA 3BPWA 2I5IA 2BY2A 3VNDA 3HBLA 5F1VA 1DQXA 1KBBA 4FS9A 5LNVA 5JH1A 4JTLA 4EXAA 2E1WA 3Q94A 4WVXA 1JAEA 3PBYA 1QUMA 4KWSA 1TWZA 4BWLC 1HKIA 2C3ZA 4LRTA 5LXXA 3RGTA 2INZA 2WNQA 4EWJA 3RX2A 4IIGA 3H12A 1K03A 3JU2A 1XQKA 1V3KA 2XTKA 3SCQA 5FF2A 2QVNA 2HS8A 4OUIA 1DP0A 5E0FA 4BEQA 3BSHA 1TG7A 4E0CA 2C8NA 5IM51 2EPOA 2G3NA 3BDKA 3TYCA 1Q6OA 2R1NA 2NQZA 4L9XA 2HROA 4M81A 4JN8A 9RUBA 2FB3A 1QOPA 3OBEA 4GNJA 4A8RA 4WKHA 1VFMA 4JYDA 3EGJA 2ON3A 1LG1A 3QR1A 1R3RA 3UA4A 3IVTA 1WAWA 1R2TA 2JFEX 3PAJA 1BYBA 1CNVA 4UQDA 2PDKA 2ZTKA 4CD5A 4UTMA 1XGDA 5CGTA 4KBXA 2Y5SA 4YVXA 3RFAA 2PLJA 3M16A 4Q8QA 3KL5A 5IFTA 1WZKA 3EX2A 3G8EA 1XISA 3WFZA 4NL1A 3B8WA 1EIBA 1OFOA 3DECA 1V8EA 5CPSA 3B9DA 4O14A 4H9VA 3FA4A 3UJRA 1W9DM 4K8HA 4ILSA 3C86A 4ZQNA 1SPQA 1GONA 2QIWA 1LOQA 5FF0A 1TJPA 2E28A 3D47A 4AD1A 3WCZA 1KWKA 1XLJA 3WDIA 2AL2A 4Q3MA 3SGUA 4F0KA 3QHOA 1UD6A 3SR7A 2PZNA 3LXBA 1F05A 3SECA 1BVNP 5HXMA 4QLLA 4CD8A 5G4EA 1K6WA 4O1AA 5CZ0A 1ITUA 3GHTA 1G7UA 3M0HA 3DEQA 5HUOA 1EZWA 4FEZA 2IPGA 3WF2A 4FA3A 3W26A 2G41A 2D0HA 4Q7NA 3B9AA 4ZE4A 3O05A 3NDZA 3IJDA 1CWYA 4GIRA 1KTCA 1XUZA 4HSHA 1A49A 4B3LA 3FGCB 1B3ZA 1W2PA 4N9CA 3NGJA 1S38A 2CW6A 2J78A 2WZIA 1MEHA 2W67A 3MP5A 5H8UA 2Q09A 4B90A 1B57A 1N2VA 1HVQA 3KS5A 3F4CA 1UKPA 4ZOEA 3HG2A 1RBOB 4MWAB 1KLZA 1HW6A 5JMUA 2VFHA 3N2BA 3DN5A 1BTMA 1UZ1A 3N3MA 1V51A 4IX2A 5CPOA 2QUMA 2V67A 4Y9AA 3T09A 3AXIA 2NUWA 3SUVA 1KV8A 3GC4A 3N73A 4YHGA 5HWNA 1OFQA 4M0XA 2BNJA 2DP3A 2J7EA 4LAMA 4WOQA 1TWDA 3K4WA 1R3YA 3RITA 3PZNA 4JGDA 3UERA 1E0WA 3GAYA 2FH8A 3SRDA 3A13A 4AY1A 1E43A 4J40A 3NEHA 3WDQA 1WXZA 1J6OA 4MJ4A 3HMJG 4ERIA 2QHAA 5I0DA 3O06A 2DT2A 4XQ6A 2ZX9A 2QS8A 1GZGA 2QCLA 1OX4A 2DSVA 2O4QA 1MVYA 2BOEX 1TWSA 3ZSSA 3AYSA 4GVIA 1T0OA 1YPFA 4JTFA 1HT6A 4GKTA 3EWYA 5IOBA 3QY7A 1OINA 4H00A 3F4DA 4D6IA 3PSWA 1OCJA 4UTUA 3BLPX 1J2BA 1OC5A 2VZSA 4XBSA 2Z00A 3PBVA 1DJHA 4NNCA 1DQUA 1X1OA 2A5HA 2WYSA 4PB3A 3GE7A 2OLHA 3NURA 1TIWA 1ZBVA 2Z6IA 1AK5A 1UOZA 3H4GA 2E7FA 3W37A 1LYXA 1XBXA 2Q8ZA 3HF3A 2EHHA 1XM3A 1Z69A 2GGHA 1IZCA 1UWAA 4BI5A 3QPZA 1JYVA 2FDSA 5REQB 3SQLA 1TTPA 5CAHA 1W3JA 1ICSA 3TTYA 1OIMA 1ZRQA 1XBYA 3NQGA 3AU6A 1ELSA 3OIHA 4K3ZA 1H0GA 1ISXA 3AAMA 1YXCA 3LLDA 1F4HA 1UP2A 5E0KA 5LIUX 3BMXA 1A5MC 1JQXA 2A3CA 3D6NA 3WUEA 4MFDA 4OHQA 3N4AA 2VD9A 4HJFA 4HPJA 6ENLA 2OEMA 5G2WA 2PDBA 1FFQA 2PAJA 2E9LA 1L6GA 2ZZ1A 1FHDA 3BK0A 1RQHA 3NTYA 3I65A 4HGXA 1DKWA 2WHJA 1KFJA 1XHGA 4R7JA 1OADA 3MUY1 3LMZA 3BLIA 3CV7A 1E56A 3FHAA 3U3HA 1JYXA 2XVNA 1H5YA 4C6QA 3JR2A 4HZ8A 3BICA 4RPQA 1TE6A 1PIGA 1R3QA 5K2ZA 4Z2HA 1KA9F 2Y70A 2ZZ6A 1QNOA 4RE4A 1U5VA 1A3WA 1PZ1A 4DEFA 3P7YA 5I6SA 4Y8FA 1OYCA 1RQBA 1US2A 3HMCA 1HJUA 2QJJA 2WC4A 3DHFA 3KCLA 2V82A 4K37A 4LC8A 2P3EA 4NQ1A 4TR9A 2IW0A 2BXYA 5IDZA 4GX8A 5HPOA 4EX4A 1H09A 1G69A 1EUNA 1TKKA 2QGYA 2ZRWA 4FX6M 4V15A 2V0TA 1BYCA 1XLBA 1XF0A 2F9RA 4PUNA 1H7OA 4YIWA 2QYGA 4GQ0A 4UC5A 2WMIA 1E51A 3POHA 2ZQ0A 1AH3A 1R3SA 1LQ2A 2DZXA 2Y89A 3M0MA 3EOOA 1R8LA 2OSWA 2BMBA 1XIMA 5AYZA 2FDMA 1ME8A 4LWWA 2UZ9A 5AN7A 5TNVA 5DRCA 3G1AA 3QZ6A 1OYAA 5D02A 1A5LC 1NOUA 1LQ0A 5I3HA 3RN6A 2ZX6A 3CXOA 4AMAA 3C2VA 4KRUA 2P8BA 1EYEA 1FWFC 5D03A 1GQJA 4UXDA 2ZRVA 3EX3A 3V1HA 4Q6JA 3UZXA 5AC6A 3BOLA 3ITVA 3G1SA 4YCOA 3N6QA 4J3WA 5CCZA 4Z2KA 2B0MA 2WQPA 3EYPA 2WJDA 4R5EA 3ZXWA 4Z1BA 2GGGA 3MSGA 1V5XA 3LBOA 3UWZA 4W7WA 3NZ1A 1PZ3A 4WDTA 3VCRA 4RXGA 1WE5A 1P0NA 2UWFA 1PTGA 3G3DA 5IBXA 5M03A 1XRSA 4CCCA 3H23A 1XSKA 1FH9A 3VD4A 4UB9A 3NQ6A 1WBHA 2PFHA 3TR2A 2XFRA 4YHEA 2Y7DA 4S3KA 5D05A 4LUSA 2VZVA 3GW3A 1SSDA 2GQ3A 3WF1A 2GOKA 5AHIA 1WV2A 2PD5A 4B2DA 4NI3A 4N2YA 4P8XA 1XRVA 4R88A 4Q8MA 4GO8A 5DMYA 4LUTB 2CFFA 3M0XA 4Q33A 2VKZG 3IUDA 3SCNA 4A6GA 1F8MA 4FHAA 1JXKA 2Z2UA 4GGHA 3HGRA 3LQLA 1GGOA 4FNRA 1H49A 4C6NA 2B7OA 3SIMA 4W8LA 1J79A 3W7JA 1GEHA 4L4PA 3CAQA 1NY1A 3FEQA 1VR6A 1IHIA 3VOCA 1S5MA 1VLWA 3ZR6A 2CITA 2HBVA 1TQXA 3W53A 2YDRA 3II1A 2OZ0A 1TPWA 3VNIA 2FMOA 1QHZA 4QQUA 5F2IA 3CS2A 1CENA 3TCSA 4DJEC 5A6MA 3OVPA 3EXRA 4MJMA 3AO0A 1LL4A 1KRBC 1YRRA 3UY7A 2ZUUA 2Y7FA 4MJ2A 2PRMA 4PZVA 4ML9A 3FXYA 5BNKA 2BTMA 3Q45A 2FB2A 2O0TA 2YOCA 4FOKA 2GVJA 2H90A 1ZY9A 2FZ9A 1JD7A 1GVOA 1WDPA 2GPTA 3CJPA 1C9DA 1PHQA 4WY0F 1TMHA 1KLYA 1WB0A 1W2VA 3KBVA 4QLJA 4JDYA 2DVUA 4DWSC 4NNBA 2E9MA 1ALDA 1U2YA 3RXZA 4GYJA 2VZOA 4G5DA 4F2TA 3MB9A 4V2XA 1TELA 2NQHA 3BWWA 1GVEA 3L2LA 4HU0A 1Q8AA 1AW5A 1M6JA 1XIGA 2DUZA 1GVSA 3M43A 2HVOA 3QN3A 4YYCA 2DSWA 2Y61A 3LD5A 3L7RA 1TJRA 4HZMA 3DFHA 4H6RA 2RAGA 5A8OA 3TQPA 3LHYA 3S3GA 1JF5A 3EXTA 5FJOA 5BW6A 2PP0A 1XX1A 3N4EA 3VOJA 3NZRA 1R5YA 2F61A 5TIMA 3TA6A 3M64A 4ENLA 3KWXA 4M1BA 3QQWA 5I06A 3TFCA 2DZSA 1Q5MA 4RW3A 9XIAA 2DGAA 2DH3A 4ZB0A 5KZ6A 1N8FA 3T8LA 4FLQA 3COTA 5DMNA 2PI6A 4IXXA 3W7CA 3VINA 1UQYA 4LPCA 3UWWA 3VA8A 4DUXA 3W71A 2FGBA 2HDJA 1GTEA 4DQWA 1OY0A 3T05A 1D8WA 4JN6A 1UBPC 2V3FA 4NHVA 5C54A 4LW7A 2OLAA 3DG7A 2BS9A 5DCEA 1HJQA 3BUVA 3NUKA 3U48A 6CGTA 4MMWA 1LBFA 1A50A 1JQVA 3V5CA 2QLYA 2UV8G 1BVZA 1Z42A 3ARPA 1EXBA 1KCLA 2X05A 3U5UA 1XIJA 3CT7A 4UIOA 4JTDA 3NQVA 2NZLA 4XAZA 2H9AA 4QEHA 2YBVA 1X6LA 1S2CA 3REQB 3Q65A 2VYOA 4KCUA 2Z27A 1PE1A 2VDIA 4IPIA 5ENLA 1EX5A 4Q4OA 5HANA 2IKIA 1NTHA 3I4EA 4JTQA 1VP5A 5BOFA 2NSXA 3S2JA 3MMTA 2E9BA 3NO5A 3WQ5A 4C6BA 4DJED 1QW7A 1VLIA 3A3HA 1PL9A 3ORWA 3HQPA 2YCLB 4PMRA 1K9FA 1XWYA 3FK4A 4JTUA 3RU6A 4HOWA 3H7RA 1A0CA 2YSWA 1LG2A 1Q66A 3CH9A 2CZ5A 3WKZA 4AZIA 2BLEA 3C3UA 4MAVA 1E4LA 2XN0A 3P8JA 2ABAA 2OWWA 3NIYA 2F8QA 1MW2A 1B9BA 3FDGA 1OCBA 3MMUA 2X0YA 4GRSA 2RDTA 1Q7MA 2DQWA 1GOXA 3CLWA 4ZL1A 1PIFA 2TSYA 4ALDA 2NQJA 1KXQA 3GHUA 3FSUA 2ZRYA 2ODOA 1L8NA 3W22A 3CV6A 3M5VA 4K36A 1OF6A 5A69A 1UZHA 2F6XA 2PP1A 3HG4A 4DJFC 4IGMA 4J4KA 2A85A 3WDPP 5K9DA 1AD4A 4P7OA 3NDOA 4RNJA 4UTJA 1W0MA 1UR4A 2OLSA 4FLOA 3ITOA 1J0ZA 4TVCA 3ZYZA 1OCNA 1K9DA 2JBMA 3RO6A 3PZGA 4LUJA 3SBFA 1R2RA 2J27A 3NM3A 1E0VA 2OWXA 1REQA 4WJEA 3AJ7A 1J18A 2FZNA 3QF0A 3U9IA 3ITGA 2PDHA 3QRHA 5LA2A 4C6MA 4PFMA 1Q6GA 2E8ZA 2V2HA 1F6KA 2V5DA 3SSJA 3DHUA 4IQJA 4H04A 4GFSA 1P7TB 1EO7A 4I6KA 4NT0A 1GJWA 1IR1A 3B0YA 3DDMA 3TH6A 2ZXBA 1Q6EA 2E5BA 1F61A 2D0FA 5J8LA 3OZOA 2E6DA 3AMLA 4LQ1A 5CJ5A 3ZJ6A 5KITA 1CYGA 3UESA 5A2AA 2C79A 1FCBA 2YLAA 1CXHA 1OT1A 1QBAA 4QG8A 3A24A 4O53A 3AXMA 2VRKA 1JF6A 4O0ZA 3WQFA 3PB2A 3SJNA 2EPLX 2F7FA 3WBAA 1FOBA 1J0YA 1KBKA 3AROA 2CKSA 1OIFA 2Q3RA 5LHEA 4EF9A 3OYZA 3CM4A 1NM9A 3KOWA 1U5JA 3R4IA 3CHFA 5DF0A 3TV8A 2ZZ7A 3GD6A 2V5LA 4BKNA 4KEZA 4BJHA 2VRJA 1MWOA 3K46A 3KVLA 1ITQA 1GYNA 2QQ6A 3N1AA 3POCA 3RK8A 1XDMA 4RL3A 2WAGA 3BE7A 1SR9A 3O6CA 4CVWA 5D9PA 4O13A 3UWQA 3G6LA 3N18A 3VK5A 1RVGA 3OB8A 3KEHA 4ZGYA 3CAWA 2X42A 3VIIA 4WZHA 1H60A 1JCTA 2INFA 2PURA 2D23A 2ZTJA 3I4KA 3BOXA 2QV5A 3KVMA 4YCPA 4PTDA 4FNTA 1JD9A 3C52A 3NA8A 1KFWA 3LXAA 4PA8A 3FEMA 1G01A 2QMKA 3QV9A 2AL1A 3TJ4A 3WO8A 4C6FA 2ZX7A 4W93A 3DKJA 3VDCA 4Q8PA 3CTLA 1K7XA 3W1NA 4NX5A 1BTCA 2Z24A 4XK2A 4CU7A 5HINA 1I4NA 1SJCA 2RDUA 4DM1A 4H6KA 3R8HA 1FY6A 3E0LA 4M56A 4FXSA 2VX5A 4JXCA 3BMWA 3HZ3A 5LNSA 3ANYA 4PEKA 1XSJA 1YXDA 1R3WA 1FWAC 4PEEA 1EC7A 4UNIA 5A8GA 2POZA 5C55A 2CLLA 2GVGA 4CCDA 2RDXA 5BROA 2WVTA 3UG3A 4NI8A 4B5VA 3LRMA 2PDPA 1OHLA 3LHTA 2E77A 4DXVA 3WH6A 3TW6A 3PK7A 1EO5A 2IXVA 1A3HA 3AHZA 4MZ1A 1E6QM 3WN6A 3EPMA 1DOSA 3DYMA 1FDJA 4N0RA 4DXXA 3BGGA 3WQ4A 3NVTA 4RZ4A 1LOSA 2QPSA 3GWQA 4GI6A 4UMCA 3RHGA 3SCOA 4NY2A 2P1FA 1P48A 4AW7A 1FX6A 1V6XA 2VR4A 4X0NA 4H01A 3I6RA 3W28A 2WVUA 1OB0A 1XPGA 1N8WA 4AWTA 3GC5A 3S6OA 4XAYA 4HNCA 3BXWA 2AKMA 4FNQA 1YE4A 1LWIA 2QJNA 3WFAA 3DC8A 4X2RA 2WZTA 2BV9A 1HO1A 3GTFA 5HMSA 1QNSA 4QAIA 3NWRA 3N2OA 3WD1A 3UCCA 3WEZA 1XICA 3QM3A 5BXPA 1OD8A 1ODUA 5AKQA 4GUHA 5AHEA 4R53A 1XYMA 1AUSL 3CHVA 3CB3A 1IEVA 3TTSA 2FTPA 2X16A 3ABZA 4DELA 4H8UA 1DWJM 4H9UA 1TUFA 4MKSA 1CGXA 3M0VA 4O1EA 4YPJA 5GJMA 3PJUA 2ZDSA 1V0LA 3HPZA 4PUKA 4GQGA 4JFUA 4S3EA 2WZEA 2R82A 5I3DA 3GYCA 1DJIA 1WUEA 4WKAA 2YXOA 1KM6A 1B31A 1DVJA 3VNMA 1VBRA 1YKWA 2YGYA 5F4WA 4L80A 1E4NA 1IT7A 1YHTA 1POJA 3GU9A 5H1WA 1SFSA 1E1FA 1P1MA 2DIKA 4PRWA 1B9ZA 3W7MA 1J10A 3LCFA 3TW7A 2CLKA 7CGTA 3EA2A 2EPNA 2Z2AA 3BW3A 4AIEA 3NG3A 2QJMA 2R14A 4HNVA 1CXFA 2VEGA 1JCNA 4HHPA 1MRQA 2C13A 2EEXA 4UTWC 3P2VA 3VD5A 1EKOA 1KGWA 3S5SA 4GLEA 3GXDA 4JD4A 2A6NA 5LNUA 3IJLA 4OBSA 1VF8A 1E1EA 1XLFA 3B4YA 4LCSA 2XWDA 1E5JA 1VCFA 3B0VC 1PSCA 1RZMA 4XUGA 5CC5A 4U2ZA 1OGBA 5BRPA 3W1MA 2NVCA 4LB4A 4AHOA 1J0HA 2GJRA 4A2SA 1Q65A 4A3UA 2XM1A 1KXVA 1AQMA 2J8FA 1FFRA 1RBAA 1FUYA 3WF3A 1QK2A 1XINA 1XBZA 2G8ZA 1SZGA 2X09A 1W1PA 4CVUA 2YJQA 1KBIA 1QWGA 1VFHA 1ITCA 5AC4A 5C2XA 1HKVA 2OPJA 1CGWA 5T91A 2BHUA 1CXIA 4IJBA 3AIVA 1XIIA 3AWNA 3MT1A 5G4HC 3UZJA 2CIPA 3UVIA 4AVFA 3A4XA 3GVRA 4XAGA 1I0DA 1TX0A 4MPQA 4HA1A 1GOMA 4A8IA 5ABTA 4WX2A 1JDAA 4OECA 3UGVA 3MI3A 1EGZA 1ZUAX 4B9ZA 3LBMA 2JKAA 3QXBA 3G1YA 2GVYA 4M6QA 3OVGA 3AMGA 1P1XA 3ECQA 4GBUA 4EP8C 2QR6A 2WSRA 3QJAA 5MF5A 1J96A 3LSBA 3QGKC 4EVZA 4QXIA 3ALGA 2VCBA 3NQAA 1HXJA 2QT3A 2XGIA 3KOFA 4LU0A 4TX8A 4X61A 1D8CA 3LHWA 2Z29A 3RM8A 5C2CA 3LNMA 5IHSA 5AZ1A 3VIPA 1GK8A 1AVAA 3APYA 5B7YA 1YBQA 4UCGA 1XC6A 1BKHA 4BF9A 1UZDA 1RD6A 2ZYFA 3ZZ1A 3PS7A 2JF7A 2VFGA 3MO7A 5D9MA 3VD3A 1G4PA 1X97A 3EWDA 3PN8A 2Y85A 1XLKA 4JNMA 1TJ0A 2X1RA 3GNNA 4GYPA 1IXOA 4W5UA 5FD0A 3CQJA 3NDYA 2OKOA 3PHAA 3GBDA 3RPMA 4MOZA 3CZJA 3DERA 3IJ7A 1XLHA 5DRIA 3U5YA 3TMQA 4LS2A 3WMBA 1NP0A 2GJXB 2GUBA 2OB3A 4IH3A 4L4OA 2QF7A 3TJLA 3EEZA 2PCQA 1E15A 3O9NA 4KWVA 3P74A 3S83A 3GTIA 4F9JA 1SVDA 5BZAA 4HYWA 3UR2A 4H41A 4C6KA 4EPEC 1ZBWA 3I7QA 1E6NA 4WY0B 4EKJA 2WXDM 3BOFA 4I5RA 4ZSUA 3VKBA 3LCXA 4U28A 3LOTA 2FZDA 4CD4A 3VAVA 4UWMA 5C5YA 1GYMA 3E3HA 3W75A 2BX7A 2GZXA 1DPMA 3ICJA 3SQSA 1RH9A 1B1YA 1AL7A 3CPUA 4JIPA 2Y1HA 1V3JA 4I9TA 3UXAA 2PDNA 4GACA 5CLTA 4B9YA 5ABEA 3MPGA 4U3CA 2WLYA 4FPSA 1FWWA 3EOLA 3WBEA 1A4MA 3EPNA 3TN6A 1VKFA 3DI1A 3IAQA 3KP1A 3R0KA 2G3JA 4ZFMA 3B0PA 2OTDA 4IJRA 5J5DA 1AQ0A 4P7LA 1VEPA 3SB0A 5C9XA 3E5BA 3GTHA 3HPSA 1HX0A 5LA1A 4FO4A 2GLKA 3G1XA 3VOGA 1VD6A 3W81A 2QUNA 4IIDA 3TN5A 3TR9A 1Z6KA 4ADTA 4HVXA 1OVDA 3VTRA 3K2GA 1BYDA 1F4AA 4HN4A 3IIOA 3TA9A 2V5JA 4F2BA 2VT0A 4DUWA 2R9RA 1UKQA 1JDEA 4M24A 2PDUA 4KRTA 4GHRA 3KRUA 2CCRA 4GZEA 4C5YA 3HPAA 4S3BA 1D9EA 3SN4A 3NZGA 3HTWA 3J7HA 5DY3A 1P4CA 1PZ2A 2ZUWA 4IPLA 1HKKA 3I68A 3WQWA 1F73A 4MM1A 1ADSA 3NPUA 4GC3A 2YW3A 4QGCA 3W6LA 1XFBA 5C6MA 4NZ3A 3MI2A 5BU6A 3W7KA 4KIEA 3Q67A 4I5XA 1M03A 4EWND 5BU9A 3NR0A 3H26A 2I17A 2A3LA 3K8KA 3L0NA 3THQA 3VD7A 5KZEA 3LV5A 3T0AA 3E2RA 4H9XA 3WJWA 2CZVA 4O8RA 3WY1A 1GOIA 2Q02A 4QJ3B 4R9OA 4ZO6A 3EWUA 4PMZA 4LY8A 2WC3A 4HU4A 2WHMA 3FKKA 3WBYA 2PWEA 4BY3A 1UC5A 3FOKA 4DB7A 3R12A 2WNZA 4M82A 3S9ZA 1LP6A 4B2DD 4LEFA 1IE7C 4F0MA 4S3DA 4HMNA 1OD0A 1UUQA 4P5UA 4LX4A 1QI5A 3EOEA 5KZMA 5E93A 4UUIA 5LIKX 4DZHA 3TYZA 3PUGA 2J6VA 4Q4RA 4L4MA 1U83A 3LCIA 4HP5A 5CXPA 2VZUA 4D1IA 1YQ2A 4Z1CA 4PMDA 1ECEA 2V5KA 2WCGA 4A3QA 3L4VA 5FKYA 1KRAC 2Q6ZA 4NAFB 3TSBA 4DWSB 4IHCA 1DIEA 2E6FA 1VFTA 1HJWA 2CERA 5HA7A 4GINA 4EOUA 3DFOA 4S2BA 2H8ZA 4CLMA 2ISVA 3EB2A 2IUZA 1A80A 1EDGA 1C9WA 3KE0A 3LBCA 1IWPA 2QZRA 1LLWA 1N8IA 1HKMA 4AD2A 1TV5A 3DFYA 5HMEA 4AX6A 2XG9A 3BLLA 3FCPA 4Z1DA 5HBFA 4I8YA 1S5VA 2ZA1A 3WLIA 1GORA 4B3KA 3HN3A 4MIMA 3G6MA 4CNNA 1UR3M 3TFXA 1H2JA 5EMLA 1FP9A 3OLIA 5IDIA 1KM3A 1DWGM 1B3WA 5F2LA 1Y65A 2FVLA 3EPOA 1XYZA 1A0EA 3APGA 3ANUA 1I75A 1B2YA 1R86A 3A6OA 1KRMA 2Z2BA 3MCNA 2OX1A 2YYUA 3NL5A 3FA3A 1QT1A 3N04A 1JZ2A 1UPMB 3H24A 1SM9A 3PWGA 4C91A 2D69A 5AY7A 1US3A 4XZ9A 2CLPA 4WCJA 1TQJA 1VH7A 1LUCB 4RE3A 5D30A 4AD0A 1OFDA 3N2MA 1JEZA 3WLPA 3LZ3A 4GUFA 2AAMA 1C7SA 5T9BG 3PR2A 3ARXA 3UJEA 2VM8A 3MV11 5AYYA 5FESA 1VPQA 3BGJA 3CWOX 3NOEA 4LJ3A 4DUOA 4TVUA 4Q22A 1XBVA 1FH8A 1R2SA 1GQNA 4QE1A 2V6AA 3KCJA 4TU1A 4Y9MA 4P8WA 1JZ5A 4XSMA 5MKGA 4MAZA 4LAOA 3P3BA 3SUSA 1UR9A 3ZSTA 4KCTA 3AIWA 1V77A 2PA6A 5AECA 3THAA 2NQLA 3IK2A 1UWRA 3WQEA 3K5XA 4Q8OA 2OYMA 4GX9A 4QITA 1V6YA 1V0MA 1XG4A 4H4IA 3M46A 3T1GA 3MZ2A 3KBMA 3TX9A 1EB3A 3QY6A 4O16A 4LY4A 4GH3A 1W1ZA 1PO9A 1TR1A 3IUHA 2QNEA 3O16A 4CU6A 4OKDA 1CXKA 3BCDA 1E9LA 3CH0A 3SGGA 4GYKA 2VVNA 1H41A 1AG1O 3GH7A 4U3AA 1ISYA 1S1PA 3VGEA 4U4MA 1UP3A 4NX0A 4V33A 4D71A 4YTRA 4MSSA 4AZ5A 1EF2A 2CWNA 3I7SA 4KWUA 3T2PA 2HQAA 4ACZA 3TK7A 1NQKA 3JRKA 1FCVA 5XIAA 1YNPA 3AISA 4ERGA 2XIIA 1DTNA 3WELA 4GZJA 2IQ0A 1GEQA 1PEZA 4IIFA 1U1UA 3BV4A 4MNKA 1HL8A 3LLXA 1CCWB 3E2SA 4P8VA 2QCCA 2C18A 4MVAA 5AYIA 1JNEA 3N13A 1GOQA 4G6CA 3L2IA 3L0GA 4JTCA 5JXQA 5DT5A 3FAXA 3SDOA 5M17A 3TN4A 2WKJA 1TWIA 3WYZA 1VB9A 2YBUA 3UR8A 2Y8KA 1W1A1 4OWGA 4MWAE 1ZBKA 2ZWYA 2O7SA 2QJGA 2R1KA 2W61A 5JH2A 1D7KA 2YZ5A 5E5CA 3EDJA 3W7RA 3S5YA 3LENA 1Y8BA 4E4UA 1F74A 1P43A 3GR4A 3TNBA 3AYVA 2J4GA 5FF4A 2XH0A 2AAAA 3W76A 2VWTA 2A1YA 4J7RA 2C0HA 1LTDA 3IWPA 4QISA 4BI7A 3B8VA 4LVAA 1PX8A 5CZTA 1L2UA 4J27A 3MWAA 2B7PA 1E73M 2QUVA 2J7BA 1H7NA 1UR0A 2WPGA 3KVJA 1FWBC 1TTIA 4QDMA 1ML1A 3GTNA 1VRDA 3VFCA 4IP4A 1YADA 3P0XA 3W84A 3TNOA 4AFYA 4CGTA 3EOUA 3E74A 3LCWA 5ABFA 3KOYA 1RD5A 2G96A 5E1QA 3DIPA 4ORIA 2OZTA 1K8YA 3RU8X 1B5TA 3VMOA 3L5AA 3KLKA 4X2PA 4B5XA 3TQKA 4GMEA 2NV2A 1WO2A 1YX1A 1TWWA 5AZ0A 3UP8A 4XKYA 4ZZ9A 5FI8A 4AIBA 1CT5A 2QGHA 1W31A 3NPVA 5CPQA 2PBOA 2QXWA 3BSMA 3N9SA 3NO3A 1PTAA 3WX7A 3C5QA 2DW6A 5I09A 4BS0A 2XFFA 1C3FA 3LCLA 4JHOA 1HJXA 4N9BA 4GWEA 2CLEA 2PLKA 1OEPA 2PGWA 3S47A 4YVVA 1E71M 1EBHA 2JQXA 2ISDA 1DJGA 1SO3A 7XIMA 1GKRA 4LCRA 4N6EA 4NZCA 3VM5A 1C8QA 1QK0A 2VGIA 4QNEA 1A5UA 4PCNA 5D2TA 2E0PA 3QYSA 2ZUNA 1H11A 1NVMA 4XZIA 5FA5A 3OGVA 3QQ0A 5E0CA 3UETA 2P53A 4CQCA 4N6FA 3MWCA 4IPNB 2AL2B 5A6AA 2YYTA 2AQOA 5D2VA 4JNZA 2Y5JA 4W87A 4Z1YA 4FIRA 4US5D 3EDFA 1QI2A 3CB8A 3GRIA 4IFOA 4GKLA 3FX4A 6A3HA 3XIMA 3GDKA 4NRSA 2V9DA 3GW0A 3IK4A 3WLRA 1UROA 4GIYA 4N9DA 3P61A 4WD0A 3TWAA 1RUSA 3AMKA 1MFVA 2VGGA 5CKSA 2AOSA 4PTMA 1S3HA 2XSXA 1ONWA 3Q4DA 4O0QA 4CEXC 4PL1A 3WJXA 3VZXA 5KZDA 4MWAA 3UWUA 2AQWA 3R6IA 1W3NA 3ONBA 2J7HA 1UR2A 4ZQPA 2GQAA 5TAOA 3AIEA 4H19A 1WP6A 4QX4A 4IXHA 5D32A 3UJ2A 2D0GA 1GVIA 3BC9A 4HHHA 3XINA 4GG9A 4UQ9A 2WMJA 3TN3A 1PIIA 4JCLA 1Z48A 4C60A 1MRAA 3G77A 4H3DA 4TQTA 3WK3A 3HGSA 3THDA 4QBXA 4DX3A 4BFAA 3M4HA 4L56A 3L12A 1FA2A 2V5BA 3RCNA 3UNTA 2JK2A 5KSWA 3C2OA 4GYFA 4NYYA 4N42A 4IQLA 1UB3A 3QC0A 3EX6A 1EP1A 1E4MM 4HOXA 2WNWA 1LBMA 3EKGA 2OXNA 3PBWA 1HGYA 3M6YA 2I5GA 4Z0JA 1SMAA 1X8FA 2C91A 4XTIA 1FKWA 5GPRA 2FVKA 4A2RA 3LB0A 4GH1A 2ATMA 2J6XA 3PG9A 4ZQMA 1S5TA 3PPGA 1H7XA 3QGAC 3OZPA 3GKFA 4HTYA 2CZFA 4JS3A 2J66A 4UQCA 2DUAA 2ZCGA 3N2TA 4JTIA 4M6PA 3KFTA 1JL8A 2Y24A 3VKJA 2CEQA 1UIOA 3WUFA 3W1UA 2ONEA 5A6SA 2NXGA 2X41A 3I10A 4W5ZA 3UXKA 2CLFA 4AC1X 2J7CA 3VXGA 4GY7A 5LHFA 3LTSA 2ZADA 2OYKA 1EFZA 2VFEA 4EXBA 3PTQA 3DYOA 2PC4A 4GIEA 8RUCA 4GXPA 3NFUA 3ANVA 5C9UA 2BY3A 4A29A 2GUUA 1W3IA 3RRAA 1WXYA 3QY8A 3E49A 2VFIA 1HF6A 1I2QA 3NQBA 2BGSA 3QSTA 4XB3A 2XISA 3T0DA 2W5FA 4JTKA 4N7QA 5M1TA 3GTXA 2X30A 2DT3A 3MTWA 1K70A 4PTVA 2EXOA 3CPRA 4KETA 1WOBA 5CC6A 1O66A 1KGUA 5AHMA 2HTMA 5K9CA 2WSQA 3LPGA 3SY8A 2VEIA 4AVOA 1WZLA 5D8ZA 4BR1A 3GIYA 4FZIA 5CAKA 3LRLA 4GO9A 1OFAA 2OGYA 3IJ9A 4ZVJA 4FLRA 3TYUA 5I7GA 3GR8A 3CWNA 2WMHA 2XU2A 1ZENA 2J13A 1RBLA 2I7GA 1YTDA 1DWHM 4HNTA 1Z3NA 1XGEA 4RUBA 2L5HA 2ALRA 2X0SA 2AQVA 3TC3A 4LBSA 1US0A 2YDQA 1M3UA 3PY2A 4D6HA 3UA3A 3GDLA 1W9XA 3C2RA 3OLEA 2WOQA 4N02A 3VIOA 3MBDA 3ZJ8A 4AD5A 3WSUA 4HA0A 1XLAA 3NO1A 2GWGA 4PH6A 1VC4A 2JIEA 1H7RA 3UZZA 4Q4KA 2YDSA 1R30A 3H4WA 3AIBA 4K38A 4HCLA 1S3TC 5JVLA 2VMFA 3W25A 3KTXA 3W6MA 2FKPA 4EPBC 1Q63A 2EAWA 3W73A 3W86A 3F1QA 3VUSA 3M9YA 4FF7A 2WMIB 5I23A 4QJ4B 1EGVA 1IGWA 4EF8A 1DXIA 5KEZA 1ZL1A 4DLFA 4S1FA 5DELA 1SJAA 1UC4A 1K9EA 1FWRA 2A3HA 3DFQA 3S2MA 2F6UA 7REQA 3B8SA 2QV4A 1QOXA 3SUUA 1W9UA 2FIQA 2DVXA 4PUDA 5XINA 1B3VA 3GM8A 2WNNA 1UASA 1PX3A 1UHVA 5EFDA 1JR1A 1HG3A 3W07A 8A3HA 2NX9A 1FWIC 3AICA 4X3ZA 3I3BA 2BHYA 3UCQA 5EMUA 4GVFA 2G3MA 3GXIA 1S2UA 4UMAA 2IKHA 1KKRA 4Z17A 5HOSA 1EX1A 1KM2A 4M19A 4O50A 1WQ5A 4WLCA 3WLKX 2RJHA 1KQYA 1D3CA 3THUA 4JTAA 3CUFA 1YTKA 2OR2A 2EG7A 5AYXA 4EPDC 1WUFA 4D6FA 3GVQA 3R89A 2G4FA 5E9XA 3DOPA 4LBUA 4MKVA 1A53A 4L6DA 3QFWA 4Y90A 3U7BA 1UG6A 4UQBA 3BAWA 1UD8A 3CAVA 1SW7A 1AA1B 1YEYA 2V68A 4QFUA 4DJEA 2DQXA 1K1DA 4ZEPA 4LUSB 3VYLA 1TRDA 4F0LA 4E8CA 4WDXA 4TV6A 4HPGA 2CHNA 3VUPA 3U4FA 1MQPA 3SY1A 4BCEA 3G8RA 3LLFA 4NJJA 3L67A 4D6CA 4M29A 4QS6A 1MXGA 1IIGA 1Q6RA 3V5FA 5CZJA 5G1MA 1ZAJA 4O0KA 3BLDA 3LCHA 1XYCA 3IVUA 1PTDA 3FLUA 2ZVRA 2O4MA 3EOSA 5A2CA 3TQ0A 1JZ8A 5G1YA 2RUSA 1J5TA 1ZALA 3HFYA 4RCXA 4IPJA 3QKZA 1V3HA 2JGYA 1PYFA 2WW5A 3VOHA 1WZAA 5KETA 1C8XA 3KRZA 2V38A 3SAZA 4HHMA 1POKA 1TMLA 1G9HA 2REQA 3L66A 1FBAA 4XVDA 1M7PA 3BZJA 3M0JA 5A2BA 4PB5A 1Y5XA 4CKQA 5A8QA 5K4ZA 2GWNA 4C1NA 5IXEA 3RMEA 5M3WA 1E9YB 1QNPA 1JYNA 1PUDA 4HBKA 1NOFA 2Y5EA 3WL0A 4MJZA 1EJUC 4D2JA 1ZCCA 2YFOA 4PMXA 4ROQA 2QEZA 3DI0A 4JEQA 4L5ZA 1TZZA 3R5EA 4LSBA 1ZCOA 1RXOB 1U30A 3PSVA 2VC5A 4NYUA 3VILA 1ZHAA 1WDSA 3ABSA 3N14A 3W24A 1FRBA 3SCWA 4XD3A 2NXIA 2CU0A 3NQEA 4NJIA 4YTQA 5ABGA 3WD4A 3W29A 1O5XA 3ZJKA 4C7GA 2RFGA 3F5JA 1IXQA 1UD2A 2I5QA 3GHRA 2E09A 4O1CA 3VGGA 3T81A 4WHBA 2WCAA 3IIPA 5BXRA 5FCZA 1SZEA 2YPIA 4INFA 1W9VA 4BK9A 2ZRZA 1EDQA 2QUUA 1RA5A 3WUGA 2J75A 5CPTA 1QI4A 3C56A 3F4NA 3S1UA 4MB3A 3DGRA 4XZHA 3WJYA 4A21A 4AWSA 5D9OA 3JZUA 3GC2A 3STFA 3CQHA 4RNFA 1AQFA 4PTXA 3LS9A 4R9XA 1W5NA 2QPUA 5FJPA 1C7TA 1EXPA 4MKNA 4B3ZA 1FWTA 1KRCC 3UWVA 1TJ1A 3H70A 1HTIA 4ZA0A 3MVTA 4PCSA 2QAFA 3WNMA 5JBFA 4ICMA 4CCEA 1ISWA 4Q4MA 4FXJA 1DWFM 4DI8A 1FWNA 3CUIA 1MQQA 3FS2A 4HJWA 1RJRA 3DGBA 2AGTA 3U2ZA 5D9NA 4DLMA 3FA5A 1Q6FA 2YXXA 2WB5A 3C2FA 3LMYA 3DBPA 2G0WA 3LHVA 3PWIA 2PBGA 1WOAA 3LUTA 1LRTA 3VDHA 2H9AB 4O12A 1DIOA 4X9YA 5EMJA 3VNYA 5LIWX 3ITCA 2JE8A 3LK6A 4H6QA 4AG0A 3MP3A 5TBOA 1EJXC 3N29A 4FR1A 1TVPA 1JNDA 3OOQA 1XC4A 4NJKA 2YZRA 1EJWC 2G37A 2HBXA 2DU2A 2AGKA 1LDCA 4OE7A 1PVNA 3VOFA 2BOFX 4BA0A 3O3RA 2FFCA 3S1GA 3C0LA 1FHUA 3RNDA 2G4JA 4B5SA 5XIMA 4DWDA 4AZ6A 1K6AA 1RLDA 3LX9A 3W0KA 4KERA 2YBTA 4I5UA 3S1XA 3TMLA 2W91A 5CH9A 3RRXA 4QTGA 4OIFA 2PP3A 3GAKA 3W74A 1VFOA 4QS5A 3OGSA 4O10A 3UGRA 3PFRA 1P6CA 3QV7A 4MYXA 4PMUA 4LS0A 3QMSA 4KEVA 3USZA 3E96A 2IQTA 4AD4A 1VJZA 2QKFA 3A5VA 2CBVA 3CTTA 2HK0A 3MY9A 5CJNA 1PB0A 3O8AA 4DIAA 4LUYA 4E5TA 3D0CA 1XIFA 3WQ8A 2W9MA 2X1TA 4PODA 1XIEA 3UZYA 1R85A 3R7MA 3KP0A 4FI4A 4IFKA 3TVAA 1GCYA 4JYFA 1HKJA 2FZMA 4EAMA 2XN2A 3S9IA 4LGXA 3ZJ7A 1R47A 3M5ZA 1REQB 1KFEA 1CEOA 5F2MA 1EQPA 4AXNA 4GE8A 2BGQA 1EJSC 3O0FA 4CEUC 2TPSA 4O15A 4K1GA 3RCYA 2W63A 4IWWA 5D2YA 1RV8A 3SY5A 1WKYA 3MUAA 3OP2A 2CWXA 2SFPA 2X1SA 2XHYA 1LWJA 4MY8A 4YL2A 3MKCA 2X0HA 1NFGA 3W1XA 1S2AA 4GUJA 4L1GA 4MB4A 1EZ2A 5A94A 4M1RA 1TV3A 5EU9A 3DHPA 3AALA 1CZ1A 4GVGA 1PJ9A 4YMZA 3ZIZA 3S0CA 2X7WA 3A3XA 3PBUA 1J0JA 3N6HA 4FALA 3MMDA 3WLJA 4Y8EA 4RDYA 5JU6A 1VEOA 4JL1A 3OEXA 2KAUC 2OZ3A 4IL2A 4JKMA 4E2OA 4O19A 3NGFA 2XIQA 4Y6GA 1DJXA 2ZX5A 3D46A 4C6LA 1F2JA 2QCDA 1W1B1 3VKAA 2J8TA 5D38A 3A9IA 3MW7A 3VDBA 1A4LA 1J11A 3W7IA 5EBUA 3EMCA 4PR4A 2PWGA 4H7CA 5HDRA 2A6LA 4B4FA 3SUTA 1BGGA 2PDYA 5KINA 3R79A 4IG2A 4JFTA 3KW3A 3ARVA 1ISZA 3U4AA 4AY7A 2XFYA 5FEZA 5DBUA 4QE5A 4KGJA 1H1YA 1AZ2A 1EP2A 3P5ZA 4IICA 3ABXA 3HURA 1QWKA 4E2BA 4ZODA 1GJPA 3FV9A 5DQPA 1VBHA 1PWLA 3WUBA 4AY8A 3IACA 2J88A 4U31A 4FLSA 3VMPA 1KFKA 4QDPA 4MHBA 3HGJA 2CLIA 2VUYA 1P0BA 1B54A 3GIPA 4PRTA 5JBDA 4DNHA 1H3GA 4B5NA 4RLIA 3VIJA 3ZFHA 3C8FA 2TAAA 1W9PA 3V75A 1B3YA 4L1WA 5K4XA 1HL9A 2OGJA 1JCJA 2J25A 3BJFA 1RPXA 4QLKA 4G7EA 3BAKA 4WIWA 3QPYA 3R58A 2DW7A 1JYWA 3T0TA 2RH9A 3GXPA 5F7UA 3T4CA 3VI2A 5I2UA 3BLOA 4GUIA 2VC7A 4IMDA 2W6RA 2F6KA 3VABA 1ECQA 2CBUA 2PDXA 3HV9A 3UF9A 4CQDA 2VC9A 3G2GA 5CSRA 5C8BB 2Z1VA 2W62A 4WK9A 3M5XA 3W87A 1M7XA 1DWIM 2Y6ZA 4MWAC 3SW6A 4JIHA 3PBMA 4GI4A 3GIQA 2XYLA 4KESA 4M51A 4UCFA 1OYBA 4KWWA 3A12A 5K9XA 2GK1A 2PTYA 3FXGA 1XPYA 2BB0A 2Z28A 3W7HA 3LNPA 2Z0IA 2WANA 3N11A 2XUCA 1YPIA 3UYIA 1X8CA 4PL2A 4IF2A 1G94A 3NM1A 5CPNA 3RR1A 3U2CA 3DHDA 1DYSA 3VDGA 4NXSA 2GL5A 8TIMA 3DESA 5GVJA 3DFSA 3GVWA 2Y8UA 4DZAA 3OGRA 1W6TA 3CZ8A 1MDLA 2PEVA 2VFFA 3JW7A 4W4QA 2QDDA 1XG3A 1E4IA 4RDVA 3MBFA 3D3AA 5HWJA 1KFBA 3U8GA 4O4WA 3G5EA 1BWKA 2DPEA 1I0BA 1PX4A 1W5MA 4V1YA 4HD5A 4PUWA 1H1ZA 2EO7A 1OFPA 2I9EA 3C2EA 1YW1A 3LN3A 3WQDA 3VCCA 3F2BA 3P5YA 2QCGA 3PJWA 1XIHA 3VMNA 3F2DA 3EX1A 1EHAA 3K8MA 4UTWA 3BANA 3B04A 2YL5A 4Z2IA 2ZXQA 3AQUA 2RGMA 1AH4A 5C7VA 2JGQA 4WKFA 3WLNA 4HPHA 3ARYA 4FIQA 1AJ0A 2NV1A 4L1XA 1M7OA 4S23A 1K4GA 3HV8A 4GUGA 1R6WA 2OMAA 3RMJA 2VI0A 1BXNA 2EPKX 5ECVA 4DBSA 1UUMA 2NWSA 3BW2A 3VFLA 4UOZA 3K4AA 7ODCA 2ACRA 3LY0A 3VDAA 5CEWA 5GJPA 2XIJA 1NAL1 1H5VA 4I6VA 3RLVA 1G5AA 3KDNA 1L6FA 3TROA 5LIYX 3UPMA 3WDRA 4Z1AA 2PODA 5EMMA 3QSRA 3WEMA 3W82A 3DKLA 1NWUA 1Q45A 1V3MA 1H61A 1O5QA 1OGGA 1ZLPA 3HB9A 3G18A 1RCOB 1GOOA 3KRSA 3T40A 5HJXA 1GG0A 1S2WA 1R87A 1MW0A 4XSLA 1KCZA 2QF8A 4W8BA 3MQTA 4LFYA 4WQ6A 3RR4A 1ESWA 3PZUA 2G97A 2HXTA 4KCVA 1TCDA 3WNKA 1LLZA 2G3FA 4GZ7A 2WMKA 1DWAM 1R38A 1HO4A 1OABA 3SZ8A 3PFMA 5BWFA 2CLMA 2X1UA 1SO5A 1HKWA 4MWAD 3KXQA 2LLEA 1GOWA 1YDVA 2UY4A 4C6IA 4H2CA 3DG3A 3R0DA 1ZJIA 1HP4A 2J7FA 4C6JA 1WX0A 5HR6A 3RF9A 3NQ8A 4PE8A 4QNWA 1ZQ5A 3MV01 2DZPA 4HZ6A 3CZKA 4LAUA 3M07A 3U57A 1T96A 3M5YA 2ZRUA 4JFWA 1EJ7L 5TD4A 2QUTA 2O7QA 3FHQA 1QPRA 3C8NA 3OBAA 4LF2A 2GGIA 3PAOA 3PUOA 4IZGA 2QULA 4QSHA 1ADOA 4KKXA 2E4TA 4BZYA 4D1JA 3LGGA 3VE9A 2OVLA 2A79A 2DH2A 3ZR4A 2R1LA 4ECLA 4YYFA 1VJSA 4PUMA 1EL3A 1M7JA 3TLLA 3U7VA 1CB2A 4LCQA 1JCLA 3AJXA 2PTDA 3FY1A 1H50A 5CZSA 1MDRA 5I03A 3FVDA 1VFLA 2MNRA 4E2VA 1IV8A 1J0KA 2FPYA 5CPMA 1KXHA 3UJFA 3G1FA 3V0SA 4P61A 3B97A 3EAUA 1XUUA 2E6YA 1T5AA 5CC3A 3SN1A 4HNNA 1UUOA 4YWIA 3PULA 3MSDA 1P0KA 2ZA2A 2W0UA 1YBQB 2F84A 3S1VA 1RJPA 2J24A 1TUXA 3HGOA 1VBJA 2ALDA 2WVVA 1W3TA 1UPPA 3MJMA 3L4YA 1A5CA 1JPKA 5FL1A 1TFVA 2ZX8A 4AAJA 3BG5A 3SCVA 3T08A 4NJHA 3A4WA 3BCJA 3PUEA 4HA4A 3KM8A 3MYOA 5BWAA 4HHLA 3PG8A 5MHBA 1V03A 2OX4A 4S39A 2YCIX 3ZMRA 2PCEA 3OPSA 2P50A 2YXGA 2PSNA 1AH0A 2HSAA 1EF3A 1SW0A 3NZQA 3WQCA 2DEPA 5EBAA 4GNKB 2ICSA 3FYPA 2XFWA 4ZOAA 1PKYA 1ZFJA 1BWLA 2IMRA 4E3VA 3P60A 3QEZA 3R8GA 1G0CA 1KO0A 2PTXA 2HISA 4E38A 1SO6A 4I9JA 3SM0A 3UJSA 2PWVA 1WPCA 3TYBA 3V1PA 4XISA 4ASTA 3KUMA 1SMDA 4CCZA 3L65A 4LS1A 5E09A 4IL0A 4ZQOA 3NOYA 4Y9NA 3F03K 2PDLA 5BOOA 1L6WA 4AMCA 2QMJA 3MCOA 2PGEA 1CPUA 3ISIX 4UZSA 2YDAA 5CBIA 1GVQA 4ICNA 3OODA 4UNKA 4D8ZA 3GY1A 4N4PA 2A7NA 6TIMA 4I8DA 3M0IA 2PDQA 4K68A 4GQQA 2I56A 4KF1A 1Q4NX 3TONA 2XVGA 1JUKA 3QLLA 3JVAA 3HG3A 4RDWA 4R3UA 4EAYA 3BLKA 3WLLA 1X96A 1RK6A 2OODA 4WEVX 2Z7KA 4TMBA 1QRQA 1OG0A 1NJJA 4MADA 3H7VA 4NU7A 4A8NA 1W5QA 1AW1A 1EC9A 1PWMA 3GVVA 4MDOA 3W7PA 2RKXA 5LKYA 1SZFA 1SGJA 1UBSA 2Y62A 3ZT6A 1O1HA 4E6MA 3IV8A 1AQHA 3MCMA 4GY1A 2ZE3A 3RDKA 4LVFA 5D33A 4KFNA 1U33A 3D3FA 3GSMA 1CX9A 3BQ5A 2WKGA 4Z2JA 2NSOA 2XH4A 2GDQA 3NYZA 1EWDA 3H21A 1XYLA 3UZ5A 4BHYA 3GDRA 4RZ5A 3N12A 4ATDA 5A8PA 2XSBA 2VTFA 3VX1A 1Z41A 6XIMA 5DANA 2BY0A 5HJYA 1DE6A 3E02A 2Y2WA 4FSAA 3MMWA 4CNTA 2QDGA 3ITLA 2Z1SA 1Q6QA 2R6OA 3N25A 1CGYA 4XZMX 1E3XA 3H22A 5U7SA 3CO4A 3UD6A 1KC7A 4A22A 3M6DA 4RW5A 4HOZA 3RX4A 3GLCA 5A3HA 3KCOA 4HQVA 3ZM8A 5HQEA 3WQGA 4GOAA 3G24A 3EZ4A 2OCZA 1Q4WA 3NQ7A 4LOCA 4GJIA 4UTHA 4PCPA 3JUGA 1EPVA 4L9YA 3TCEA 1O5KA 3AHTA 1ZSXA 1UZ4A 3AS1A 1D3GA 1J8VA 3NQCA 5BRQA 1GPFA 2IXUA 3H55A 1RY8A 3ME3A 3V3WA 4ZQRA 1VIZA 4LNCA 4QROA 3KS6A 1GNXA 1KV5A 1RJQA 5GNXA 1EWEA 4MY1A 1W32A 1ZU8A 4ZO7A 3H2MA 1CTNA 1TPH1 1E9IA 4DF0A 3S2NA 3MDUA 4PUEA 3QR3A 3W7NA 1M1BA 3AUOA 2OYLA 4ERAA 3ZT7A 4NKCA 3V18A 2XGZA 3OHIA 2ACUA 3QGVA 3OG3A 5BYWA 2UBPC 3H53A 4WOZA 2ZC1A 4KH2A 2XIOA 3UPWA 4TVDA 1XLEA 3GG8A 4QCEA