3Q67A

Human aldose reductase c298s mutant in complex with nadp+ in space group p212121
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
316
structure length
316
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVSALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of Cys-298 in aldose reductase function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 102
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3q67A00
3C3UA 2PDJA 4XZNX 2INEA 3LZ3A 2WZMA 5JH2A 3LQGA 1SM9A 1XF0A 1XGDA 1Z9AA 2IS7A 3GUGA 1C9WA 1QWKA 4Q3MA 1VBJA 1K8CA 2CLPA 3R8GA 5LIXX 4YVVA 1AFSA 1AH3A 1J96A 2HVNA 3LD5A 4DBUA 2HDJA 4GQGA 1YNQA 3MC5A 3R7MA 4MHBA 2ACUA 3S3GA 3UG8A 3LENA 4JTDA 3Q67A 3GHTA 4ZFCA 2FZBA 1YE4A 3O0KA 1HW6A 1S1RA 4YS1A 3U2CA 2R9RA 1EKOA 4XK2A 4FALA 3V0TA 1X97A 3FX4A 1ZSXA 2VDGA 4PMJA 2PDXA 5HA7A 2C91A 3RX4A 3CASA 1XJBA 3M0IA 3LBOA 4JQ4A 3CV6A 4YU1A 2PDBA 4R9OA 3KRBA 3DN5A 5JH1A 4WEVX 2I17A 1Z8AA 2R24A 1PWLA 3H4GA 3DOPA 1ADSA 1JEZA 2AGTA 1RY0A 2PDUA 3WCZA 2IPWA 2IKJA 4JIHA 1PYFA 2IPFA 4WGHA 1UR3M 2ISFA 4F40A 2PD9A 1LQAA 3EAUA 3B3DA 4NKCA 3UZYA 2PDQA 1Z3NA 4XO6A 4LAZA 4HBKA 3H7UA 3LN3A 2FZDA 1RY8A 4JIRA 4QX4A 4RPQA 3QKZA 4QXIA 3CAVA 2HV5A 2HEJA 4IGSA 4LBRA 4XO7A 3RX3A 2DV0A 2PDKA 2FGBA 2P5NA 2PDLA 2PZNA 4OTKA 1R38A 4PR4A 1S1PA 4LB3A 5M2FX 4XZIA 4H8NA 2PDFA 4WDXA 4XVDA 3WBWA 1S2CA 2A79A 4DBWA 1MRQA 4WDTA 3V0SA 3Q65A 1RALA 1AH4A 4ASTA 4GA8A 3UYIA 4YVXA 5DANA 4LBSA 3G5EA 1M9HA 3N6QA 1S2AA 2PF8A 1IHIA 4H7CA 1ZGDA 2HE8A 5LIUX 1IEIA 4WDWA 1T41A 4GACA 1EF3A 4XZMX 2PDIA 4LAUA 3WBYA 2DUXA 4JTQA 1EXBA 3UZWA 3MB9A 3N2TA 2HVOA 4FA3A 3EB3A 3GHUA 3H7RA 4HMNA 4JQ3A 2PDYA 4L1XA 5KETA 4PUUA 2ACSA 3CAQA 1MZRA 2PDGA 1LWIA 2FZ8A 4IJCA 2INZA 4JQAA 1PZ0A 3CMFA 3F7JA 3M64A 2HE5A 4EXBA 1GVEA 2IPJA 3P2VA 2FVLA 2NVCA 5LIWX 1FRBA 1AZ1A 3BURA 4IJRA 4DZ5A 3LUTA 3R43A 4JQ2A 2IPGA 4JQ1A 3V0UA 3WG6A 3M4HA 4YVPA 2FZ9A 3V36A 3ONCA 4ICCX 4FAMA 1X98A 4PRRA 2IQDA 5AZ0A 1AH0A 2J8TA 2IKIA 1US0A 1YE6A 3ERPA 1X96A 2F38A 3BV7A 1A80A 2PDPA 3V35A 4I5XA 2ALRA 4AUBA 4WRHA 3R6IA 3R8HA 4GABA 4DBSA 3FJNA 3CV7A 2F2KA 2PDCA 3WBXA 2PD5A 2IKGA 2PDWA 1HQTA 1VP5A 3UZXA 4QR6A 5HNUA 3GHRA 3VXGA 3ONBA 2BP1A 2PEVA 2PDHA 1Z89A 4Q7BA 3LNMA 5HNTA 3UP8A 2NVDA 3NTYA 3LQLA 1EL3A 3UWEA 2ACQA 4GCAA 1ZQ5A 2IKHA 3O3RA 3GHSA 3BUVA 3LEPA 1MI3A 5LIYX 3G1RA 1Q13A 3R94A 2ACRA 4FZIA 4G5DA 1AZ2A 4L1WA 2IQ0A 4GIEA 2PDMA 3BCJA 2WZTA 4PUWA 1T40A 4LB4A 3R58A 4GQ0A 3UGRA 1Q5MA 4JTRA 3COTA 4XAPA 2I16A 2BGSA 3EB4A 3LZ5A 2PDNA 5AZ1A 3T42A 4QBXA 1PZ1A 1YNPA 2BGQA 4JIIX 4PRTA 4JTCA 2QXWA 1OG6A 3D3FA 1ZUAX 3UZZA 5LIKX 4EXAA 2DUZA 3RX2A 4JTAA 1PWMA 4XZHA 4XVEA 4WDUA 3UFYA 2PFHA 5C7HA 4XZLX 1QRQA
chains in the Genus database with same CATH superfamily
3GG1A 1HJXA 3HQOA 1XRFA 4U3CA 3DESA 4W7UA 3WD2A 1KO0A 3P0XA 3TTQA 1LL4A 1FH9A 2Q8ZA 3UCDA 1KBIA 4LYQA 1QCWA 8XIMA 5I00A 1GJPA 4BQ3A 2BY3A 3IK2A 3F4WA 3RRAA 2VDHA 4XB3A 3KLLA 1VAHA 3LHZA 4JL1A 2CHNA 3L23A 2JF6A 3M5XA 1LWHA 3R7MA 1B3WA 3W7EA 1VCFA 4N0RA 2VNCA 3ZJ6A 4DEFA 1ECQA 2QCMA 3QZAA 1QPQA 3KL5A 3CHFA 6REQB 4JD4A 4UQDA 1KM3A 3Q67A 3AIQA 3GUWA 1QW9A 4UFHA 4FNUA 2E6DA 2X8RA 4FALA 3GQYA 1MRAA 3CO4A 2NXHA 3C4UA 1WAUA 3VMOA 3AC0A 3A24A 2PGEA 4RE0A 3WDRA 1G4TA 4KRZA 4REQA 4LU0A 3H54A 4B9YA 1ZCCA 2Z24A 4CNSA 3AAMA 1DL3A 5IBXA 5ABFA 4IFKA 3IJIA 1L8PA 1G94A 3UJEA 1EFZA 3LXAA 5KITA 3M41A 5JMUA 2W67A 1ISVA 3W29A 1EHNA 4GYPC 1GOQA 3QFWA 4DWSB 3K5XA 1VFTA 2Y7FA 2YA1A 3ORWA 3TXZA 3STGA 3SCWA 3NXFA 2OX4A 1XV8A 4GY0A 4YHEA 2PDQA 1C3FA 1GEHA 4Q22A 3HN3A 3VD7A 1OD8A 3WUBA 3W7NA 1NP0A 1TTIA 4AMAA 3WNOA 4GBDA 1PDZA 4DXKA 4RPQA 3DFYA 2HV5A 3IUHA 3NCOA 1BWVA 1B4KA 1G0CA 3ANVA 4XAFA 2VENA 4QP0A 4BJHA 4DUWA 3SEPA 4J27A 3AU2A 3DI0A 3MU7A 2QUMA 2D2OA 3SDOA 4O57A 5D2YA 3U4FA 1DKWA 1Y5WA 1KLYA 2YIHA 3MY9A 2PDFA 2E9BA 1EO7A 4WDXA 1LLOA 5H8PA 4PB5A 2BXZA 2YZRA 2HXTA 3OA5A 5LGZA 3OQ8A 3B05A 3Q65A 3W1AA 2PLJA 3UYIA 3PP7A 3QQWA 3NDZA 2OZ3A 3KBVA 1EDTA 2WPBA 3QQ1A 6XIMA 3KBMA 3VIGA 2XVKA 4ZR8A 3KCJA 4I9JA 2DUXA 5HUPA 4P61A 4BI7A 4J4KA 2C79A 3KOWA 3EOUA 3PB0A 1BYBA 4HPGA 4GUJA 2UY3A 3M0JA 1OB0A 3H7RA 1CB2A 1EJVC 5A6MA 4OV4A 2VFEA 4HA4A 3OHMB 3OODA 2CLOA 4N9DA 3B8UA 5AC4A 2EG7A 3TLQA 1LWIA 1BF2A 2WSQA 3TAOA 2WSPA 5GVJA 1LF1A 3OOQA 1JRCA 4UFLA 3VZYA 5T9BG 5DFAA 2BASA 3M64A 1RP8A 2DJXA 1WUEA 1B0IA 3WQVA 1TWWA 1W9PA 2VT0A 3TJIA 3UY8A 3TYUA 5LIWX 3N73A 3BURA 3WEZA 1PHWA 1L6YA 5FIPA 4BI6A 3GVWA 1L0PA 4IJRA 4IMCA 4L61A 4DO5A 1BVWA 1K02A 1WKEA 1BQGA 4Z2LA 2A5HA 2VO5A 3BW2A 1FVPA 4MMWA 4US6A 2XVNA 4UBPC 2ZADA 4Q8QA 2V5CA 3LOTA 3SCQA 1AQFA 1Y5VA 4PRWA 2FZ9A 5AHEA 3BK0A 4I8YA 2DZBA 2HMCA 3NQDA 2WNWA 2X2YA 3W7DA 4QFUA 4AC7C 2VFGA 3GDLA 5CJMA 1HZYA 4Y7EA 3MMDA 4Z2HA 1QFEA 4LYKA 1OADA 4XTDA 1P7TA 1VFLA 2RJGA 2IW0A 4KPLA 5A2BA 1Z41A 3MTWA 1TV7A 3KOFA 1TG7A 4PMXA 4NZFA 1J8VA 2ISWA 1Q2SA 1HP5A 4D8AA 4IISA 1R2TA 4GIYA 3S9ZA 3NQMA 2WKJA 2ZVRA 5LNRA 4UFMA 5H6HA 2YL8A 2ZX6A 1FWRA 2DZSA 3GU1A 2V69A 1VEPA 1OCJA 2Y4SA 3PR2A 3LCHA 4JX4A 1P5BA 4ZSUA 4QR6A 4KT2A 2ZRYA 3Q2DA 4DQWA 1XSKA 3B40A 4XG1A 3IIXA 4AW7A 4QLJA 4IFKB 5G5IA 1QNVA 3U57A 1ZCOA 5KZMA 4GE8A 5AECA 1OK6A 4W7VA 2FHFA 3R2GA 1GG0A 1CLVA 3GWQA 5C70A 3DX5A 1LG2A 3VCCA 3RMJA 1MDLA 2WBKA 3ZR6A 4R53A 2ZXBA 1ZP4A 1QBAA 4S3DA 1ITUA 4O53A 3THAA 2VR2A 4IGHA 1J10A 1Q6OA 1TPEA 5JIWA 3TN3A 3PN8A 3A4WA 1UZ1A 3QGKC 1E55A 3GB6A 4NG3A 3LCIA 3QPYA 3PBMA 4ES4A 3ZJ7A 3O63A 3BLEA 3WFLA 3ZT7A 1O60A 1EEPA 1CXHA 3WDJA 1DPMA 4QGCA 5LNUA 3DFNA 1X6NA 4MJ2A 1C93A 1IEXA 2P53A 5E0CA 3B04A 1EPVA 2CW6A 5JVLA 3NR0A 3RLUA 4PRTA 3SY1A 3WNNA 4JTCA 2FHBA 2DH3A 3D47A 3S5NA 3RX2A 1EQCA 3SJNA 5HJLA 2YCLA 4RV3A 2X42A 1QMLA 3AXIA 3NSNA 2OYLA 4MWAC 1M6JA 3N13A 2XH2A 4NZJA 1M5WA 3SQMA 1Q4WA 4H00A 2XINA 4F0HA 3WF1A 1BYAA 3TJXA 1Y5XA 3LZ3A 3MSRA 1OT1A 4UTMA 3F2CA 2WC7A 3MUY1 3OGSA 5LHFA 2WNQA 3SSZA 3NM3A 4KEUA 4Z08A 3M1ZA 1ISWA 1NF0A 1VBJA 1L2UA 3DAQA 2O92A 2DT1A 1XGEA 1XLJA 3R11A 4YL2A 4IG2B 4LS2A 2QCDA 3A3XA 3FJLA 2WZHA 5HBFA 3T09A 3W70A 4NILA 1FQ0A 3VIOA 4WSHA 5BOOA 3AU6A 3MKVA 1CXKA 2W92A 3GC2A 3PAJA 2X41A 3RK8A 3VIFA 2C91A 3RUBL 1XJBA 4GMEA 4JN6A 1IR1A 1EWDA 3K4DA 1TV5A 5M1TA 3TC7A 2OTDA 5CBJA 4WXZA 2PTDA 1J0IA 1GKQA 1TMLA 1TYGA 4QM1A 1D8CA 1JF5A 3OEXA 3W83A 1ZAIA 3H4GA 1Q6CA 3THCA 3PWAA 2VEIA 3CT2A 4WR3A 1ME7A 2YXGA 4REQB 3M0KA 4M29A 3V7PA 1K7XA 5CJ5A 3OGVA 3L0KA 3E3HA 3SCTA 4WGHA 1GVSA 4XD4A 1J5TA 3KTCA 3P61A 4HMCA 4N6EA 5G1YA 4KWVA 4JTFA 2VC7A 2DZVA 4PN2A 3SI9A 1UMLA 1FTXA 5I5RA 5A95A 1SFSA 4HBKA 3VNDA 5CC7A 3UU0A 4JDBA 3L4TA 4IIBA 3IRDA 3CZLA 4QLLA 1ITCA 4O18A 4QXIA 4M0XA 3QMSA 2YOCA 4LF1A 3CO8A 4Q8NA 1QI2A 1KFEA 3DHFA 3IGXA 1YDYA 2FH8A 1DXFA 3L5AA 4QISA 2E8ZA 4BI5A 3OVQA 3B8VA 2VGIA 3E5PA 3MMUA 5DELA 4JNMA 3TCSA 1S2CA 1RR2A 1EYEA 3HGRA 4R88A 2WQPA 3QSTA 1E15A 3FGCA 4J3WA 3ZMRA 1SQ7A 1BFNA 3TW7A 1LROA 4DZAA 1JZ7A 2E5CA 4L6OA 1REQA 2DSWA 3BQ6A 3MCMA 2CHOA 2WJZA 2GQ8A 1DJXA 1NELA 4HU8A 1IHIA 3U2ZA 3UR2A 5D2VA 1XIEA 2J62A 4DXXA 5BRQA 1T41A 4Q8VA 1EF3A 2RJHA 5FI8A 4QS6A 1MXSA 1EP1A 3ZSSA 4JTQA 3RXZA 1Z6KA 3DZ1A 4QE5A 4H6KA 3SR7A 3RGTA 3FDKA 4D6JA 4FNRA 4LTSA 4WUIA 1Q45A 4MZ8A 1H63A 1OD0A 1PJ9A 1HO4A 4F2TA 1CGXA 3LM3A 2B7OA 2XH0A 4R7WA 1H11A 3VKAA 5C9UA 3UCQA 1IE7C 3LYEA 3QV6A 2INZA 4XD6A 4JQAA 4TX6A 2ADAA 1GOMA 2C0AA 3TQ0A 5BOEA 1C9DA 1XUUA 4O8RA 4A35A 4HZ7A 2I5GA 3W7HA 4AVFA 5J5RA 1MQRA 3UG4A 3LXBA 2OT1A 3P2VA 1D3GA 3NVDA 4DF2A 3BSHA 3FXGA 1N8FA 1O5RA 1V08A 1PS9A 4DF0A 2FZNA 4AY8A 4PC8A 4GO9A 3UNTA 4W89A 3NZRA 2E68A 3L2MA 3FHAA 3OZPA 3NURA 2VL4A 1UBSA 4LY8A 4KKXA 5D09A 3I10A 3GNRA 4QSHA 3GIPA 1XCXA 4DVOA 1JDEA 2CESA 3GK0A 1X96A 2WJEA 2Y1HA 3O1NA 3IEBA 3WH5A 4MG4A 4AWUA 4WRHA 2DP3A 2J75A 3R6IA 3BE7A 4EWJA 1XFBA 3HG2A 3AQUA 2PWHA 3TLLA 4HMEA 3UGVA 4A8NA 2FDMA 2VD8A 3NO5A 3VC5A 1TJRA 3HF3A 1LDCA 2HVMA 1A0CA 3GXPA 3MBDA 5JIPA 2PDHA 1JQVA 1SMAA 3ITYA 4DBDA 1Z89A 3PZNA 2D20A 3AMCA 4B2DA 3VOCA 5DRCA 6CGTA 4XV0A 3VDAA 2J7HA 1RSCA 1TELA 3L68A 4E2DA 4IX2A 3PHAA 5HOSA 4J40A 2AL2A 3A47A 3PJWA 1YQ2A 1ODZA 3DYOA 1HN1A 1EPXA 1R3VA 2CLLA 3G1XA 4LAOA 3INPA 3LSCA 4IIDA 3SRHA 2GK1B 2JKAA 5T8GA 4B5NA 1SJDA 2BB0A 3VZXA 2QJIA 4GIEA 1CGUA 3AHTA 5BROA 3KUMA 5AY7A 1TTPA 4LUSA 3W1UA 4W93A 3RJYA 2QAFA 1TPVA 3KP0A 1E71M 4L4MA 4X3ZA 3ZLFA 1MSSA 2AQWA 2V9DA 1IT0A 3O05A 4P7NA 3WLSA 1A5KC 4F0KA 4PTWA 5I6SA 4CNNA 1SO3A 1DJNA 4ZODA 4EXAA 5EY5A 2HNEA 3CTTA 4L80A 3KM8A 3KXQA 3NQ8A 2RDTA 3E2RA 4JX6A 1H09A 3UFYA 1XH1A 2YSWA 4O16A 3GRIA 4PTXA 1POKA 4ACZB 4GC3A 1R2RA 3UT0A 2ISDA 4U4MA 1EA9C 2HNHA 2CEQA 5KTLA 4HSOA 3RLVA 4EF9A 3S83A 3VFCA 2NWSA 3VM5A 5BYWA 3PBGA 3FKRA 3T78A 2OODA 4TO8A 5D2TA 2ICSA 1B3YA 4MWAB 3GVVA 2PRLA 4LV9A 5HULA 4W8AA 2D2JA 4IMDA 4YVVA 4LRTA 3TE9A 4DIAA 3C61A 2G41A 2GDUA 1W9DM 1PAMA 4LT9A 2ZRUA 1OYCA 3PJTA 1GGOA 5FJUA 3PBUA 1V6TA 5H1WA 3PF3A 4W9TA 3U8GA 1W3HA 3I68A 5ENLA 4AB4A 3TYBA 4KIEA 3G6LA 2WZEA 4IPIA 2WMGA 3PY2A 1EOKA 1BTMA 3GZ3A 4D8LA 7XIMA 3UF9A 1XLAA 3ANUA 1HKVA 2VVNA 2WMHA 4YU1A 4ERAA 1FHVA 3T2QA 3CYVA 1P6WA 1XINA 3LPOA 3RPDA 3HGJA 1VJZA 5A6KA 2JKPA 2X0SA 1I2NA 2GVGA 3SUWA 3WQ5A 3KEHA 4Y9MA 1H62A 1LL7A 4FF5A 2EPOA 3A9IA 3PZOA 4MWAD 4NNAA 3P62A 1AJ0A 1K6WA 2AAMA 4H7ZA 3D46A 2PD9A 3A12A 3KCLA 3WLLA 3TC6A 1H3GA 5A2AA 1E6SM 4NI3A 3H7UA 3PB2A 4FB7A 1F3TA 2PP0A 2HQAA 4XO7A 2R91A 2E6AA 3B8WA 1TV3A 4GBUA 4GJIA 2R1PA 3NDOA 1B5TA 4FSAA 1DYSA 4WSJA 1BRLB 3LLFA 1CIUA 4GXWA 4B92A 3IIVA 4S3AA 4LUTA 1PKMA 4ONVA 1BF6A 1TVPA 1HL2A 3NXLA 4YCPA 2XN1A 2ONEA 2QS8A 5D04C 4DJFC 4KGLA 2YYTA 2BOEX 2F9RA 5LA0A 2XIMA 3ARPA 1O5XA 3GD6A 4GKTA 3GM8A 3VGBA 4LBSA 1QR7A 3Q4DA 1UKOA 2HE8A 3E9AA 4BF5A 1O1HA 2OG9A 1R2SA 2GK1A 1V7AA 4YNGA 4TXEA 3OLIA 2WNZA 2WM0A 1WDRA 3TIMA 2J6XA 3QM3A 2OKTA 4DXVA 3D5HA 4IGMA 4XKYB 2QIIA 1JGIA 2YFOA 3IAPA 3THQA 2J25A 1E56A 1J18A 3PSVA 3MI6A 2FVKA 3ENLA 3CAQA 3KBWA 1QATA 1VHCA 3N18A 1DIDA 3BH4A 3AS0A 4NSBA 1G9HA 4D6HA 1PIFA 3NQ7A 3PPCA 4DM1A 4MKSA 1XLCA 4Z1BA 1F76A 1QK2A 4ZQRA 3WLKX 3MSDA 3QR3A 4GH3A 4JICA 4AZCA 5HR7A 3S9IA 1TREA 2RUSA 3LUTA 5EBUA 4ATDA 4JQ2A 1A5NC 3P67A 1WXJA 3FW6A 4D71A 5A3HA 2DVTA 1TTQA 1X39A 2E9MA 4MF4A 4OE7A 4EKJA 4E0CA 2D0HA 3PZ9A 1YYAA 4AZBA 3AJ7A 2H6RA 2OLAA 3DG6A 4XBJA 1AODA 3W7KA 3B0PA 3NQVA 1R87A 1K4GA 4KIRA 3OIXA 4PMZA 4MFDA 1VHNA 3N1AA 2J74A 3DBNA 1F3XA 5HMDA 3G2GA 1HO1A 4MAZA 3CZ8A 2WV8A 1P0EA 3LSBA 1RJQA 1QPOA 3TCEA 4IFRA 2JIWA 4LW7A 3W7QA 1J9YA 3WUEA 4LEFA 1RP9A 2Y5SA 5U7SA 1E70M 2X30A 2PDWA 2C3ZA 2P0IA 2FB3A 1NOUA 5AC8A 1I75A 2BGNE 4WD0A 4K37A 2Y7GA 1VH7A 3OYZA 3SURA 2NT0A 3TNBA 2OO6A 3NJ3A 2OPJA 1B9ZA 3QPZA 3QR1A 3LQLA 2P3ZA 1G6CA 5CZSA 2GJRA 4GCXA 1R3QA 3H4XA 4L6HA 3NL5A 1OC7A 3G1YA 5A6LA 3NPVA 1WZKA 4HSNA 1PCWA 1MZHA 1SW7A 4HHMA 5HMEA 3FYPA 1MFVA 1A5LC 5H8UA 1UWUA 2YA0A 5IHRA 1HP4A 4O28A 2WNNA 4PMYA 3NM1A 1XIIA 3F2DA 3UPMA 3TTYA 1B30A 3ALFA 3ATZA 2G4FA 1GTHA 3R58A 3TN4A 1Q5MA 3ARTA 3FA4A 1L6FA 3S6OA 4YYCA 2QCDB 1CECA 1S2VA 3HV8A 3WD1A 1YBQB 1JDDA 3GZAA 1JJKA 2P10A 3UZJA 2EG6A 1EHAA 4G1NA 3TEVA 2Z7KA 3M7SA 1DIKA 4GWEA 4GX9A 4UQAA 4AISA 4OUEA 3PZIA 1WP6A 3W82A 4MTVA 4D1IA 3ZVIA 3G77A 1VYRA 1NJJA 1PWMA 2EF9A 4XVEA 1ONWA 3CLMA 3T7VA 9XIMA 1L2QA 5GJNA 1TUFA 3H26A 2VGGA 2INEA 5FJPA 3V1HA 4AEOA 4PFMA 4TVUA 2ZA2A 3UJ2A 3PANA 1W3JA 1C8XA 1CB7B 3MCOA 1SFJA 3ICJA 1K4HA 3NGJA 2R1NA 2QCLA 2BV9A 4ZL1A 2OGYA 5EU9A 3PPGA 2HDJA 4GQGA 2A3AA 5I3JA 5CSRA 4W87A 3S2LA 1UH4A 1EIXA 5LNSA 1Y65A 4ZFCA 1FXPA 4LNYA 1N8IA 3CNYA 3E12A 1X1NA 1X97A 3M0HA 4XD5A 1ZSXA 5C9ZA 3BZGA 5FJRA 3GG8A 1XR2A 2BSLA 3NQBA 3GKAA 4IMGA 4H4IA 3D3AA 3AHXA 4UQEA 4DHGA 4UOZA 4M6UA 1LT8A 1GVRA 2JIEA 4CN4A 4MKVA 1A3WA 2RAGA 3DDMA 4UR8A 3SECA 2VGBA 4JAWA 4P8VA 2BWGA 1Z8AA 4LX4A 3GTFA 1B4EA 1TMHA 3WCZA 3OBKA 1U33A 2ZOXA 2NX1A 4Y9AA 1N7KA 4A29A 1QXLA 1SUXA 2ANUA 3R25A 3BCDA 4B3KA 1LUCA 3SFKA 1Z3NA 4O1CA 2C6QA 4X2PA 1B54A 3DGRA 1LORA 2DQXA 4QQ3A 1A0DA 3PNUA 3TN6A 2J9YA 3ZO9A 1JCJA 3WQ8A 5FEXA 4W88A 2GGIA 3CAVA 3GYEA 3U3HA 3HPFA 3N12A 3HO8A 4IFOA 4MY9A 4N4QA 5DO8A 3MHUA 3H53A 3TXVA 2XFYA 2V5DA 3BPWA 2BY0A 5MKGB 5C9XA 5FEWA 3Q37A 1WDPA 3HQPA 3CHCA 3SN0A 3WBWA 1MRQA 1HF6A 1MYRA 4MAVA 1UD8A 4UNIA 1E0XA 5E9AA 3VC6A 2ON3A 3TTSA 3WLOA 3AIBA 1EGMA 3KL0A 4ICNA 1ZNNA 1Q3NA 3OTRA 4B5VA 3H24A 4F66A 4UTTA 2R94A 4XZMX 5FJTA 2WVUA 4LAUA 4LAKA 3BLDA 1IXOA 3I6EA 3N2TA 3W72A 3PM6A 5HMFA 3WO8A 3EOOA 3T0BA 3L4YA 4DWSC 2W6RA 3OLEA 3WJZA 3AOFA 4GD0A 4CNUA 3TTEA 4L6DA 3W24A 1XG3A 4HNVA 3L5LA 2VFFA 3B4YA 4U2ZA 4QCEA 1IYXA 2Z27A 3NO1A 3R0KA 1TWIA 3KCOA 3TW9A 5EMJA 4L9YA 3W4RA 3W6YA 3TN5A 1HT6A 3TC3A 1RA0A 4W8LA 3V5OA 5I77A 3UYCA 4GZJA 1W91A 1W56A 2ISVA 4MPQA 3FYOA 2NXGA 4FO4A 3V0UA 3TFXA 4H3DA 3C3NA 4JY8A 2V5BA 3PTKA 3RO6A 4E5TA 2AMGA 2QYGA 4KFOA 3K13A 3AISA 4HK6A 4BZYA 4YWIA 3VD3A 4BWLC 3R13A 4UMAA 3VGDA 1H60A 3LGDA 4LUSB 4RCXA 5GPRA 4F3HA 1OT2A 1KGWA 3QHOA 2PA6A 4H41A 1J6OA 4C1LA 1GVYA 2CLFA 1V0MA 3BW3A 5MHBA 3A13A 1QNPA 3GHRA 3RNDA 1I1XA 1UB3A 3GW0A 5REQB 3LNPA 5FF4A 3PNZA 4JS3A 1V8EA 2I57A 4G7FA 4RXGA 2I5QA 2OO0A 1TJPA 3WQEA 1OGGA 3NQGA 1PKNA 4HYWA 1W9XA 1PV8A 1T5AA 2QZRA 3PTDA 4PB4A 2Y89A 5LIYX 3BLPX 2QCGA 1VS1A 3R94A 4HYRA 4DJDA 1EA0A 4IX0A 3MVIA 1JYNA 2OEJA 4J3XA 1BGAA 3W02A 3AICA 2XHYA 2WK2A 1FWDC 3WSUA 3CV1A 3CH0A 4UTHA 3LU2A 4HA1A 1KCLA 1TE1A 1PZ1A 4MZYA 5LKYA 3CEPA 3LTYA 3EX6A 9RUBA 5AC5A 1WO2A 1UA3A 2P3EA 1K77A 4BEQA 1OX4B 2GJPA 3ZR5A 1OABA 2DJLA 1RBAA 4JXCA 4MUZA 1V3IA 3G3MA 4CQDA 4NJGA 1JCTA 1EDQA 1UR4A 1XIBA 1JRBA 1V79A 3J7HA 4FI4A 3M44A 2V68A 1BVNP 1KFBA 2G50A 4ROQA 2Z7GA 2VGFA 3WK1A 2OQLA 1SSDA 1U5VA 4IJBA 1ZBCA 1ZJBA 1A3HA 3O6DA 2D73A 3EA3A 3N3TA 2ZRVA 1Q6LA 4KGJA 4C6QA 4EX4A 1QPKA 1Q8AA 3S2CA 2PGFA 3H7VA 4J3UA 4UQBA 2ACUA 1Z69A 3T9PA 1OF8A 4FEZA 3LENA 2XSXA 2NQJA 4FIRA 1KTNA 1KWGA 2XZ7A 1XKJA 4ATLA 1H7WA 2VR5A 5B80A 4X9SA 4LOCA 4ZCWA 3VILA 4A3UA 3VVGA 3B0XA 2R1MA 3C52A 1DHKA 3PZQA 3NQCA 1LT7A 5HA7A 1CT5A 4HK5A 3RX4A 3NL6A 1KV8A 1XWYA 4LY4A 2AQOA 1NU5A 1OYAA 3E2QA 1JUKA 2G3IA 2QCHA 3IVUA 4AH7A 1TJ2A 4M56A 4U5KA 2J78A 1YX1A 3GH4A 2BHUA 3DN5A 4TX8A 2PLCA 1Q6FA 4W4QA 1DOSA 3IGSA 3BAWA 4CEXC 4PBEA 5TIMA 4C5ZA 1RJRA 1US2A 1RXOB 4I6VA 3EYPA 1GUVA 3W87A 2D1ZA 1VBHA 3DFHA 4GHRA 2IPFA 3EB2A 4NL1A 3ITVA 3S9YA 2GGHA 1GWJA 4NUWA 1JD9A 3TTOA 1XLHA 1PZ3A 3HGOA 1JUBA 2HPIA 2X7WA 3RO8A 3OO2A 4GRSA 3DIPA 4TVCA 2XIQA 1DJIA 1GOIA 4PBFA 3T2PA 1S46A 3GXDA 1ZTVA 4KETA 4G8TA 5IHSA 2PDKA 3ABQA 1GPFA 4YTTA 2XM2A 4HCLA 2I56A 2ZC8A 3NAVA 4IH3A 3TA9A 3LPFA 1R38A 1IZKA 3IVTA 4P8WA 1BQCA 4XZBA 2ZXDA 4H9YA 4PUKA 4LPCA 4XSLA 1IV8A 2FB2A 2VX4A 2WLZA 1V51A 2ZUUA 5C9WA 3ZXWA 2O55A 4S3FA 3KOYA 1OFBA 1OSEA 2TSYA 4N4PA 3DI1A 1NDWA 4WZHA 3IRSA 5BW6A 3RPTA 4CD5A 2C8NA 4AIOA 2Y5EA 3RN6A 3P6LA 4GA8A 4YVXA 3GW3A 2CWNA 4JHOA 1SZEA 4LUJA 1S2AA 4B5SA 2CCRA 1XH2A 2EKGA 3PTMA 3STEA 4AD0A 4QDWA 5HPCA 1TWZA 4N6FA 2Z1SA 7CGTA 3MB9A 2HVOA 1M3UA 3N29A 3RRXA 3CZGA 1KFWA 3G1AA 1JDFA 2J7CA 1WUFA 1ICPA 4GIRA 1WOBA 2ATSA 1XSJA 3VKKA 2YA2A 1OZQA 4C6IA 1GYNA 4ICMA 1XICA 2PCEA 3EX3A 4DYEA 3WLHA 1GHSA 5EFFA 3DU0A 3W23A 4N9EA 4PSRA 1TPDA 3UJSA 2ZX8A 2BY2A 1VC4A 4R5EA 4PTDA 1D3HA 4ZQNA 2C7FA 5H8MA 3I4KA 3O0FA 4AZIA 2ZRWA 3B8TA 2WCGA 3FY1A 4FOJA 3LBMA 4FLQA 1HGYA 3CQHA 3QLLA 2ZC1A 3IJ9A 1HX0A 1KKRA 4JTHA 3CC1A 3PBWA 4UCFA 2FJKA 3OQEA 4ERGA 4C1NA 4QEHA 4GXPA 2GGGA 2Y62A 3KS5A 4HMDA 2R82A 1AL8A 4Z2JA 4ZOBA 4QAWA 4WCJA 4UOJA 5HQMA 1YTKA 1K3UA 1EXPA 2QCEA 3SY8A 2ZKMX 3W22A 1A80A 3MCNA 2YCKX 3FEQA 1P0NA 3NQ2A 4ILSA 1ADDA 4YTUA 2RH9A 1VZWA 3EXRA 3FJNA 1CXFA 4Z1AA 2OX1A 2IKGA 4CNOA 4GZEA 4HZ6A 4ZTYA 1W3NA 3V4BA 1A5MC 2W4XA 2VWTA 3F4CA 5HNUA 2Z1VA 2O9OA 4DLFA 3ONBA 4Q6JA 3CPGA 2QPSA 2RDXA 5E70A 4HQVA 2VM8A 2CNCA 5MKGA 4LRSA 3VKJA 3L4WA 2GL5A 2CHRA 5C7VA 4WX2A 5HDRA 1DWGM 2TAAA 2RHGA 2Z1WA 3GFZA 4JTTA 4WQ6A 2A3BA 2BOFX 3O3RA 3A4XA 3LY0A 1Q6GA 5D02A 1M7XA 2FMNA 1BYDA 3WFZA 4J5NA 3MVTA 2PWUA 4Z42C 3BWWA 1AZ2A 4L1WA 3ABOA 3BLOA 3FJ4A 1YTEA 1NWRA 2RGMA 3WK0A 4GQ0A 3WMCA 4FNTA 3ZSTA 1XI3A 3TDFA 3VX0A 4RW5A 3EWZA 4XAPA 4C7DA 2I16A 2XIOA 2PI6A 2DPEA 3FFSA 3UXAA 3FXYA 4CQ9A 3CIVA 3T42A 2VI0A 4TU1A 5E0KA 2VOMA 4HA3A 2XVGA 3GNPA 4K3ZA 5FEZA 4MDPA 1XH0A 3LK6A 5LIKX 4NJJA 1J01A 3WQ6A 4XZHA 4JKMA 4XAYA 3N15A 4L64A 5C7HA 3GXFA 1JYXA 3SQSA 4BCEA 4FLSA 4DPPA 5AC7A 2PDJA 2G8ZA 3H2FA 4DZIA 5E6ZA 2KX9A 1XYFA 1TVNA 2XH4A 3NZPA 3P82A 1JNDA 1DIEA 1LM1A 1Z9AA 3LPPA 4H7VA 4PB3A 1FXQA 4FXJA 4PA8A 3H70A 4M1BA 1VJIA 1DE6A 3BAIA 3ZT6A 3E0FA 3DGBA 3ARVA 3DKJA 7ENLA 2A2IA 3BJFA 2XIJA 5I3KA 1R47A 3BG5A 4MHBA 3M0MA 1DJWA 4Z0SA 5J5DA 5CAKA 5D38A 1WPCA 4RKAA 3V0TA 1OFRA 1BEUA 1QI5A 3IJ6A 4AX6A 2PC4A 3QC3A 4K2SA 3WDHA 1QNRA 1J0HA 4OVXA 1EJUC 4IIFA 3BJTA 2O4MA 3LRKA 3MHFA 2O9RA 4MYAA 1NF7A 1ZHAA 5HANA 4FPSA 3B0YA 1FHLA 3FN9A 1UQZA 3S4TA 4GVGA 3MT1A 5DMMA 4R33A 4PODA 1JI2A 3GSMA 1HVXA 5JBEA 2XISA 1KM0A 4FIQA 4PL1A 1P7TB 4E3VA 3WQGA 4LAMA 2D2GA 1YPFA 2Q3RA 5CG7A 3MWCA 1ZBWA 1H7PA 4LYPA 3UR5A 3IUDA 2QLYA 1W8GA 4AEEA 3UZYA 3MPGA 5D9OA 5G2WA 3CAKA 2DZTA 3S2NA 4OBTA 1FWHC 2ZUNA 3A23A 2XH7A 4CN6A 2BVYA 4ZZ9A 5M3WA 2DV0A 2X05A 3EGJA 4E4UA 3PG8A 5JBFA 3DFOA 1GW9A 4XZIA 2PRHA 4QQUA 1XYBA 1OFAA 1EGZA 3R0DA 4CCCA 3MJMA 3UCCA 3WQFA 3QEZA 3IIOA 1DTNA 3VGHA 2ZA1A 4DO7A 4NZ5A 5GNYA 1DQXA 1JI1A 1FBAA 4I7VA 2GWGA 2V81A 4JFVA 1RALA 1AH4A 1GZ1A 1T99A 3THDA 1MQPA 3Q58A 3VOIA 5DLCA 4N02A 4IQEA 2DFAA 1M9HA 4GKLA 4J3VA 4DB7A 2VUNA 2Q6ZA 3S46A 1IEIA 1F4HA 3SCVA 1ONEA 4DJED 3KLKA 3B0UX 4W7WA 2BLEA 4GVHA 1EC7A 3GDRA 4E2BA 3EB3A 2V5JA 3QMRA 4HN8A 1UUQA 1ZY9A 3I3BA 1HL8A 3HZ3A 4TX9A 3W1LA 3RM8A 3WQDA 1CLXA 4I6KA 5FJIA 2YW3A 4RZBA 4PUUA 4QNWA 3BXWA 1GQNA 3G0XA 3MP3A 2WB5A 4PMNA 2REQA 3H22A 2ZDSA 4UCGA 3LV5A 3LERA 1E9YB 2VRKA 9XIAA 1OX5A 1WYIA 4NNBA 3M07A 1UOZA 2A3CA 3CWNA 3ZZ1A 3W9ZA 3K1DA 3FHQA 4EXBA 4A3HA 4QJ1A 3UA4A 4TQTA 4XAZA 1XDLA 2ZYFA 2I9UA 4PZVA 5CSUA 2AKMA 2A7PA 4DI8A 1RQEA 2O56A 1W54A 2EKCA 4O8AA 4JQ1A 2G95A 3SRDA 1IWAA 2ESCA 4YVPA 8CGTA 3LG3A 4IPPA 3EKGA 3ONCA 1TPC1 1TV8A 5LSMA 3GYCA 4YTQA 2IQDA 1UG6A 4WKAA 1LQ2A 3CB8A 2X7VA 5RUBA 1ISZA 1E1FA 1AH0A 3IVSA 3CXOA 5EPDA 1IR2A 4WY0F 1JZ2A 4CQ8A 1EBHA 3LV6A 2RGLA 2ZX9A 5G4WA 2NLIA 2Z2BA 2WC4A 4GO8A 1WX0A 1QAPA 4AC1X 2YBUA 2VDIA 3F1QA 1XLLA 1ZJAA 4I5XA 4Q8UA 2I9EA 4EXQA 1DJGA 3T55A 1VPYA 4HYVA 2VX5A 1UWSA 3WBXA 2FIQA 2YLLA 7ODCA 1NIUA 3EA1A 4O1BA 2ZIDA 3NQAA 2A3HA 5BU9A 4J2PA 3KRZA 5BNKA 2V2CA 2WCSA 3BLFA 2PEVA 2WJFA 4GISA 1XLFA 3PAOA 1QI3A 3UBPC 3MO7A 8RUCA 2PAJA 1GZGA 3ZYZA 4JIEA 2W61A 1CZ1A 1FWGC 4RNJA 4AZHA 4J9JA 2QW5A 4DYKA 2GJXA 3BUVA 1RD5A 4WXYA 3S2MA 2BFGA 2IQ0A 3RMEA 3TKFA 2D0FA 5CPNA 4P7QA 5AVHA 2L5HA 4M7SA 3VNIA 1T40A 2VXNA 4UQ9A 4ZSTA 1OFDA 4TMCA 2FDSA 1CX9A 2J27A 1X38A 3WJSA 4UNKA 1E0UA 1O6IA 3B8SA 1K9EA 4CU8A 4AZCB 3BGAA 3PBVA 2DH2A 2PDNA 3A64A 3MQTA 1DORA 2E0PA 1XIFA 3S6TA 1SW3A 4HOZA 3SAZA 2BBFA 2EAWA 3BAYA 3WMLA 3VUSA 3WNLA 1ZUAX 1NFGA 4P7RA 1W1IE 1CLKA 3WKZA 4QHRA 1U1JA 4GYJA 1GOXA 1G01A 5BXPA 3V75A 4J7RA 2OZ0A 2W91A 1JVNA 1O7AA 3E02A 3C3UA 2YKKA 4F0LA 1TA3B 3W1XA 1SM9A 1S2TA 4OUIA 1GZJA 4X22A 2BOGX 3GVQA 1EDGA 4IHCA 4DZHA 3HFYA 2GPTA 1K8CA 2CLPA 1M7PA 3CEUA 1AUSL 1AJZA 1RCOB 4OQVA 5F4SA 1EZ2A 2PURA 3JR2A 3MC5A 2XYLA 5KSWA 1J12A 1QUMA 1A4LA 4CQCA 3UG8A 3WF4A 1WOAA 5IXEA 1OCNA 2FZBA 5I3FA 2X2GA 2AGKA 4OV9A 2DZPA 1PYMA 2V2HA 2PWDA 4XZ9A 4BQ4A 3SRFA 1UYQA 2PUZA 5J04A 1PKLA 2Y85A 3SM0A 1K6AA 2QJMA 5A69A 5L9FA 8XIAA 4DN1A 1ICQA 3R12A 1PKYA 3C2RA 4C5YA 1FUYA 1EGVA 1RQBA 5JH1A 2OLSA 1MXGA 1PWLA 3EWBX 1GNXA 1E6PA 4AD1A 1BXCA 1JEZA 1VF8A 1FWTA 3I7RA 4EK7A 1NH6A 3JZUA 4ZO7A 1IF2A 3N11A 3U7BA 1KKOA 2VEMA 3WF0A 3WYZA 2ODOA 4AMCA 1HKIA 2XDFA 3HMCA 2A6NA 3MSYA 3EKLA 1QI0A 1MNZA 5HR6A 1UW9A 3H4WA 3LS9A 4CUCA 3S5OA 3M0VA 1AQ0A 1IZJA 1IEWA 3ALGA 4QE1A 3W37A 5AVNA 3WQPA 2BDQA 3NEHA 1AD1A 1OYBA 1YTDA 3QKZA 1K70A 3N34A 4Q8MA 3SRKA 4FMVA 4WJ8A 4LBRA 1M7OA 3FCPA 2FGBA 4DF1A 1O5KA 3QXBA 2HK1A 1EX5A 5FCZA 1EZWA 5HWMA 5B7YA 1V3KA 1OJXA 1Q6DA 3R0UA 3MYPA 1WV2A 3NEVA 2DQWA 4E2VA 3P14A 1OFQA 1W2PA 3EDKA 3W71A 3E0LA 2YB1A 2QCCA 2V6AA 3L67A 4JHZA 4HGXA 4ASTA 2JK2A 3WLJA 1E1CA 5DT5A 4BEUA 1JULA 4IG2A 1XC6A 2A0NA 3KHJA 4H7CA 5E5CA 3TH6A 4H8HA 4WJXA 5GJMA 3FGCB 4QJ4B 3W7IA 4L7ZA 1R30A 1QNQA 4E6MA 3A21A 3NYZA 4P7LA 1E5NA 4FA3A 1Z42A 3SSJA 3JZEA 5CG0A 3EPOA 3URAA 1AMKA 1ZENA 1CWYA 2LLEA 2ZVIA 4V33A 2Z25A 3W2NA 3B9EA 4JFTA 1SZFA 4NAFA 2B7QA 1VRXA 4KWUA 1UZDA 4ZQMA 2J88A 4L9ZA 2WMIB 4LUTB 1B31A 1E72M 3F5KA 4GUFA 2C18A 3GVGA 4S3BA 4FNSA 3TA6A 4JTLA 1LLZA 3LX9A 3W2MA 4KRUA 3SJ3A 1AZ1A 3CH9A 1XISA 1F61A 1WDQA 1NVMA 1XUZA 1ZAJA 3FK4A 1CXIA 4A8IA 3MUCA 3W1NA 2HBVA 3F4DA 2DT0A 1U1HA 2B4GA 4PTMA 4FAMA 1C8YA 2WVVB 3UR8A 2GUBA 4WJEA 1EX1A 1IIGA 1EO5A 1QI4A 1HJSA 1LRTA 2YW4A 1M7JA 2WHMA 1ZU8A 1US0A 5CGMA 4Y96A 3GTXA 1JZ4A 1FP8A 4JZ5A 2NX9A 1YW1A 3QC0A 3FJ6A 3V35A 1PDYA 1ZLPA 1ICSA 3REQA 1EJXC 3RR1A 5C0QA 1FDJA 3F5JA 4UZUA 2VRJA 2YCJA 2VP8A 3G1HA 4CU7A 3N04A 1NAL1 1X6LA 2DVUA 1V6WA 1JPHA 5DMNA 1KRBC 5CPMA 2JE8A 4QSFA 4MPKA 1HKWA 1ME8A 3QW3A 1QW8A 2XM1A 4QE4A 4ZA0A 3C5QA 1FWAC 3CIWA 1DWIM 2X1RA 3LHVA 3UP8A 4B16A 1SVDA 5CQ1A 1ISXA 3OG3A 5A6TC 5F2LA 1EL3A 5T9CE 1E51A 2D23A 2O7SA 2D24A 3TZNA 3W2LA 4DY1A 1EP2A 1GJWA 4IP5A 2IXVA 3WK2A 1ZQ5A 2ZE3A 5E6YA 5D30A 3WH6A 3S1GA 2GJLA 2BXYA 1KCXA 3HM7A 3BJSA 3N17A 4WOZA 3QRHA 5D33A 1TCDA 4BQ2A 3KZSA 3II1A 2W9MA 2D2HA 5HNNA 1A3XA 3LHUA 1DBTA 1KTBA 2ZTJA 1PX3A 5ABGA 3N2XA 3IPWA 1BSLA 2BHYA 2YBTA 2OWWA 3WBEA 1HKMA 3L0NA 4WKFA 5FSEC 1XYAA 4AU0A 2B31A 3E6EA 3ELFA 4NASA 1CGYA 1TKKA 4JIIX 3FYYA 1Q66A 2QXWA 3G24A 5I23A 5AB3A 1VIWA 5ECUA 1J6PA 2PE4A 2HRWA 4EPEC 2X1UA 3LB0A 2VZVA 2ZX7A 4TR9A 4IQJA 4AHQA 3DHUA 2XN0A 2E3ZA 1T0OA 2DIKA 3W1TA 3MWAA 4EACA 3CUHA 5JH2A 4C6JA 3UJFA 2HWGA 3N2CA 1XGDA 1I8JA 1F8IA 2QF8A 2IS7A 3WQCA 4ZMGA 1IGWA 3V18A 5KZ6A 3N4AA 4GUGA 3SY5A 1ZAHA 4K1GA 4DAFA 4HNOA 2E09A 4GPNA 5HWNA 1J0JA 1FWEC 3UETA 5E93A 2WSYA 1DWAM 2YL9A 4I3GA 4YCOA 4MSSA 2PTZA 4KCVA 3OVRA 4AG0A 1V3LA 4A6GA 2NV2A 3IK4A 1H7NA 2G4JA 1FKXA 2DVXA 3O16A 4TUFA 3HQ1A 4X60A 3PBYA 3KTXA 2A7RA 3T0DA 4B5WA 1Y8BA 4ZB5A 3NUKA 4HZMA 1E6ZA 3EKZA 3E0IA 4AF0B 3OBAA 1PB0A 2C71A 4W86A 1BPLB 3W76A 3MMWA 4RW3A 4WEVX 1S5NA 5I06A 2OWCA 4DWSA 1KV5A 5C2GA 3TYDA 3UPWA 4RJEA 3NL2A 3MYOA 5C54A 1H7OA 3CUJA 4ORIA 4F0MA 1UR3M 1X8CA 1WZLA 3IJQA 1DE5A 1MW1A 2G3NA 1UZ4A 2J9XA 4AY1A 1NEYA 2CFFA 2XFRA 4UTFA 4O0QA 1ADOA 3SUVA 3CYJA 4JIRA 4Z1CA 2CYGA 3PUGA 3VA8A 1VBUA 3JUGA 5I3DA 4JR5A 2PTXA 2R14A 4PYSA 1XIDA 4PGLA 3RU8X 3AIUA 1E9ZB 4L4PA 1Y7VA 4O13A 3PWGA 4PR4A 3LMZA 3AIRA 3EWWA 3G1FA 1OIMA 1P6CA 1RPKA 1BHGA 3UR7A 4B9ZA 5G2HA 1O95A 1JAEA 5FF2A 4O15A 1UP0A 5K9DA 1OC5A 2CBIA 4GQRA 1UC5A 5K7JA 3IARA 4I90A 4RZ5A 2PF8A 1UOKA 1OFEA 2QGYA 5DBUA 1W1YA 1NTHA 1QJWA 4JFSA 4H8VA 4GACA 2WANA 1DQUA 3W7CA 3O2LA 3M0YA 3WBYA 1XM3A 3H6OA 1LBLA 2Y8KA 4EPBC 3M43A 2NXIA 4PULA 3USZA 4AWTA 1UIOA 1OFOA 1QWGA 3GG0A 2GGJA 1BXNA 2VX7A 3BAXA 2ZWYA 5KETA 2XN2A 2WO5A 1UKPA 3GXIA 5K9XA 4GYFA 3MDWA 2CPUA 3BGJA 2WQDA 3NPUA 4EOUA 2VMFA 5D2WA 2QULA 3L4VA 1EB3A 2HSAA 3LHTA 4XIAA 3EWYA 5D37A 3TJLA 2NVCA 1QASA 3HU7A 2OYKA 3O6YX 2CZVA 2VX6A 1REQB 3W7JA 2QJHA 1GVFA 2MANA 3CWOX 4ALDA 4JYFA 2R1KA 2YCIX 4V1YA 1B1YA 1AVAA 2CBUA 2J7DA 2CBVA 3BTNA 3EWCA 3V36A 5BWAA 4AYSA 2GGEA 3LXCA 1GCYA 3WL1A 5I02A 5KZEA 3CB3A 2V5LA 3FV9A 2E4TA 3VNZA 1SJCA 3IS4A 1XD0A 3RR4A 3SIMA 3DFQA 3OPSA 1A4MA 1F3WA 3ZWSA 1DQWA 6TIMA 4Z17A 5HWJA 5FL0A 2WVVA 3W2KA 4M51A 1AD4A 5FKYA 2GOUA 4AUBA 3W7OA 1JL8A 4HNLA 1E4LA 2JQXA 4DBSA 1R9YA 4H2HA 4OJYA 2F2KA 5HQLA 1F07A 1HQTA 5A2CA 4RV8A 2OWXA 3TONA 4HPHA 4PMQA 4LJ3A 3SCSA 1XYZA 5J8LA 1J79A 5HNRA 2VZTA 5DT7A 1PCKA 3R10A 2Y7EA 1GG1A 1U83A 1BRLA 1KFKA 2X0YA 1THFD 4LCQA 4CD8A 4BR1A 4GOAA 4PMUA 2XWEA 3A5VA 3MV01 1R7AA 4N9CA 4JL2A 4YIWA 4DBEA 1RCXB 1Q7MA 4GCAA 5JBDA 5FA5A 2A3EA 1NY1A 1KA9F 2E1WA 1C8QA 3W88A 2JF7A 5FJJA 3AJXA 5DQPA 1CBGA 3OJGA 3WLMA 3B9AA 3PPFA 1Z7AA 4ZE4A 1UR8A 4IGNA 4HCDA 3GY1A 1RUSA 1U5HA 3W81A 3CUXA 2YB4A 1KD0A 4NAEB 2C13A 1G4PA 1UR9A 2ATMA 3LZ5A 1SO4A 4IICA 3U6WA 4WGXA 4A8LA 3KX6A 4BF7A 1PIIA 1OX6A 1TVLA 2SFPA 3D3FA 1A5BA 2B81A 1OY0A 4WIWA 2OQYA 1CENA 4Q4KA 2CLKA 5CPSA 1V93A 5AOUA 2PFHA 3EEGA 4S3EA 2JGYA 3F5LA 2EPMX 2QEZA 1VCGA 4J28A 1UMYA 3DBPA 2YCEA 5KMYA 2QT3A 4JYDA 3DC8A 1W9VA 2WXDM 5A8OA 4OZOA 3CJPA 1FWIC 1QK0A 1H1ZA 3DH7A 1J96A 5F7UA 4OHQA 3TP4A 3T0TA 4HOXA 1MUMA 2OR2A 5AHFA 4KF1A 1TWDA 1TJ0A 3GO2A 2O4QA 3ATYA 2WVTA 1V7YA 3LTSA 1XLMA 1WNOA 1XD1A 4JTDA 3MUIA 3GHTA 4Y90A 2A3LA 3O0KA 5A6AA 3B97A 7TIMA 3NYDA 3VKCA 2E40A 1RD6A 4GQBA 1B2YA 3FAWA 1IGSA 3T40A 3AHYA 4LWWA 1MWOA 2XIBA 1BXBA 4MLRA 1XBZA 3CPUA 2O9TA 1V0LA 5BXRA 3K8LA 2DW6A 2OB3A 4CGTA 1KR0A 4GGHA 3GXTA 2W0UA 4MADA 2Z28A 1XDJA 4IIEA 4B3ZA 1TA3A 1W6TA 4AF0A 3EX1A 3L65A 4GUIA 1QOXA 3JRKA 3ZOAA 4DJEA 3RG6A 3T0AA 1RY0A 1F6YA 3ZR4A 1Q2RA 3ZLGA 3RIKA 3N6JA 3W6LA 4GVIA 3CHDA 4F40A 4L56A 1X7IA 3ARQA 1J4EA 3EMCA 1JPDX 5CEWA 4NKCA 3WJXA 2F6XA 4GQQA 4UFKA 3U9IA 3SZ8A 3G22A 1RLDA 1OG0A 3POHA 1VRDA 2V67A 3A5FA 1GQJA 4B5XA 3S1UA 4WVXA 2HEJA 4IGSA 5AHMA 3E96A 2Z0IA 1EJRC 4H9MA 2WOQA 2P5NA 3U48A 4AHOA 4CCZA 1XW8A 4LXFA 4A05A 1KRAC 4AXNA 5M03A 5TF0A 3ABZA 4EPKA 1E43A 3UEQA 3OU8A 3SUSA 3M46A 2FQIA 1AG1O 2Q01A 3FDGA 2OEKA 1VKFA 4CQAA 5H91A 4IPNB 1F74A 5CPQA 1RJPA 3OZOA 1JCXA 3DXIA 3AS3A 1EUNA 3NG3A 4JTUA 1I0DA 3NQ6A 5B7ZA 2XVPA 3DHPA 4CVUA 1UH3A 2VWSA 4Y6GA 4H8UA 2QJJA 4GI9A 3H8AA 4F9JA 1PO9A 3N2OA 4NT0A 1WBHA 4QS5A 2OZTA 2J4GA 3NWRA 3AXHA 4R7OA 4NQ1A 4F2UA 1I4NA 3N9RA 1KC7A 2VFDA 4CD4A 4GX8A 2PDYA 1HKJA 1KFJA 1FCVA 3W84A 2HBXA 4C90A 4CD7A 2OKOA 3UXIA 4RNHA 2QVNA 3R1ZA 5LGXA 3BZJA 3HG3A 4ZOAA 2I5IA 4G9PA 3S1VA 3NQEA 4D6EA 1W5OA 5CXPA 1I9CB 1LP6A 1CNVA 2HE5A 1XIHA 4Q6XA 1FRBA 3DEQA 1J0YA 2CLEA 3ZJ8A 4A3RA 1JD7A 4C6CA 3OB8A 1VGAA 5K4ZA 3CMJA 2O0TA 4RZ6A 1NFPA 2V0TA 3BGGA 3TR9A 1CXLA 5JU6A 3ABSA 4O1DA 4AFYA 1W32A 4C7FA 2FKPA 4WLCA 4JFWA 3GDMA 3QVQA 3C2EA 1JF6A 1WDSA 6TAAA 4AZ6A 3GNDA 4JNZA 3ERPA 1WE5A 1GW1A 4DJEC 3WMBA 4PUEA 2QGHA 3G1VA 4P8XA 1V3HA 2ZZ3A 3K8MA 1R6WA 3KBNA 3AYSA 2Y6ZA 3ZLHA 2DZWA 2NUYA 4POCA 3WLPA 4ML9A 1VB9A 4JY9A 1E4NA 1GT8A 3N6HA 1QHZA 4XIMA 3VXGA 5I0DA 3GTIA 5C9RA 5AYYA 4JCLA 4H83A 1GQIA 4CEUC 4PCPA 3BV4A 3UWWA 1BWLA 5CGQA 2EPNA 3W2UA 3WLTA 3RLHA 1O66A 2NVDA 3N9SA 3TMLA 3R5EA 3NZGA 5C2CA 5AC6A 3IGUA 1LOQA 1NFBA 1Q4NX 4MYXA 3TYCA 1KQZA 4M8UA 3I3EA 3G1RA 3GNNA 3CL6A 1JGMA 3W01A 3W1QA 4YTRA 4OECA 3CK5A 3HJEA 2PWVA 2Z2UA 3QZEA 3UGRA 4QLKA 1RLCL 1E9LA 1XXXA 2A6LA 1KXHA 2NX3A 1IQ8A 3GBDA 1T96A 4Y8FA 3BLLA 5L6UA 1O1ZA 3BOFA 1I2PA 4G56A 3W25A 3STCA 3GR4A 2HPMA 1UWTA 3QTGA 5F1UA 5F4WA 3IJ8A 3WUFA 3N2BA 1B90A 1LQ0A 4DI9A 5DF0A 4RE4A 4TVDA 2J7FA 3PZGA 5D9MA 3VOFA 2HS6A 3ZWTA 4AIBA 4O4WA 3P74A 3UPBA 5DCEA 4RNIA 3UWZA 4HD5A 4XZLX 3ZM8A 4UXDA 5A94A 4FX8A 5EBAA 1HUVA 4Z0JA 4I7WA 3S5SA 3VAVA 4TV6A 1PUDA 1Q6RA 3KOZA 1SR0A 1TIWA 2CKSA 1MUWA 4C6OA 1FKWA 2UY2A 3CZJA 1K8ZA 2QR6A 3NL3A 2WZIA 5I2UA 1UBPC 5IDZA 4ZOEA 2YBVA 5LIXX 2VCAA 4GIAA 1TV2A 1UROA 1AFSA 2HVNA 2YXXA 3MV11 4PUNA 4K39A 3DG7A 3ARRA 4GNVA 1IXNA 1UR0A 5D32A 1XYCA 1JPKA 3PJXA 1AW2A 2C14A 4IT1A 3ARYA 3SGUA 3BO9A 3FA3A 3KS6A 4KRTA 4N9BA 1YPIA 5CJNA 3GFXA 3TW6A 4LCSA 3LBOA 3VIJA 5DN1A 1WCGA 2CWXA 1OM0A 3TNOA 3EOLA 4C7GA 3DYMA 3A9BA 2VR4A 4PSPA 1UWQA 1W31A 2XPKA 1V3JA 3MJYA 3VM7A 6ENLA 1V03A 1KBJA 2NV1A 4UR9A 5CAHA 2HCVA 4Q4RA 4Q33A 4PUDA 3C6CA 4FXFA 1JPIA 3LHWA 4R9XA 1VCVA 2AL1A 4K8HA 1GOWA 1KR1A 4GI4A 3LGEA 2Y2WA 2W5FA 1GPWA 1SFTA 2G37A 4HZ8A 1CPUA 4S3GA 4MGGA 3IJLA 1V6XA 3UG5A 3VGFA 3A22A 1ZZMA 3B9OA 3GX9A 2POZA 3WNPA 3B3DA 2QKFA 1Q6EA 1JCNA 2J9ZA 2VEFA 4AIUA 4GG9A 4XBKA 2UY5A 4O19A 2FZDA 3D6NA 5CC5A 1R8LA 2GSHA 4IL2A 2UY4A 2RDUA 3H2OA 1E40A 2NQ9A 2UWFA 4KMQA 6A3HA 5LXXA 2PDLA 1OINA 1A0EA 1JCLA 3PUDA 2V63A 1XX1A 1FOBA 2C1HA 3P3BA 2Y88A 3WL0A 1PHQA 2GUUA 3PULA 4PTVA 1K9FA 1F73A 4FR6A 1VFUA 4E8DA 2Q8XA 4X9YA 3GU2A 4M3PA 3H2NA 3WLQA 1N8WA 4WDTA 3AMDA 1E1CB 2PODA 1XHGA 4MY8A 5K3VA 4G6CA 3OYXA 3CBWA 2NW0A 3B06A 1GJUA 1K8XA 3VX1A 5G2IA 1ZGDA 3M9YA 3APGA 5A6SA 1D8WA 5DXYA 3L0GA 2VHLA 3N25A 3PG9A 4MB4A 1A5CA 4GNJA 1TZ9A 4RLIA 6PTDA 1UR1A 1W17A 3HTWA 4BWLA 4CU6A 7TAAA 3IANA 1HJWA 1TTJA 1A5AA 3QOKA 3WDQA 1A5UA 3DUGA 3UW6A 1IXQA 4HMNA 1RV8A 1P0BA 2NV9A 4RR4A 3ZJKA 4NX5A 1MZRA 3Q94A 3DHDA 2X40A 1OGBA 2EQDA 3BSMA 3WBAA 4KFNA 4B4HA 2YCLB 5HUOA 3ABRA 4NVTA 3DYPA 3TROA 4PCSA 8TIMA 3M47A 4Q8TA 2VEPA 5BXTA 1KBLA 2EGZA 4EAYA 2QUVA 2W27A 4IPJA 1WKDA 4S3KA 3QQ0A 4NNCA 4YJ5A 5AN7A 3GH5A 4ZB2A 1LWJA 3TQPA 5CZJA 1IZCA 3UXLA 4HU4A 1UP3A 2DT3A 2ZICA 4H6EA 1M41A 5HQEA 2NWRA 3GAKA 1MQQA 3QR0A 1DVJA 5D4YA 1KGUA 3MA8A 4Q8PA 2Q3OA 3TU9A 5GNXA 4MY1A 3AYRA 4PUJA 2QVHA 2J8TA 4HNTA 1R85A 3W7GA 3O6AA 1I1WA 5JQ9A 1BG9A 2F38A 4LBUA 4OU1A 3T44A 3E74A 1I2RA 4GABA 4G7EB 3V5FA 1UKTA 4FNPA 3B4UA 3EXTA 1I0BA 1R7OA 4KH2A 5HJXA 2C19A 3AO0A 2VEGA 2X1TA 2PS2A 1MMFA 1TCMA 4ZQPA 1TE6A 1ZBKA 5EKYA 4MDOA 1OEPA 4M7TA 3SW6A 3DECA 1GKRA 3XINA 3WNMA 4MFEA 4L5ZA 1O5QA 3W28A 4PEKA 3WELA 1PIGA 5AHLA 1V02E 3CPRA 1ZBVA 4UFJA 1QU4A 3KW3A 4BQ5A 3S8HA 3UWEA 3E0WA 5AHIA 1S5VA 3EOEA 1ODUA 5ABHA 2KAUC 1W5PA 5CZKA 2VFIA 3WDPP 5DRIA 2Y24A 4I9MA 3SCUA 4GH1A 3APTA 2JEQA 3L21A 2BODX 4ADSA 4DAIA 2YDQA 2IKHA 4F0SA 5FF0A 1Q7QA 2ZDRA 3OZYA 5ABEA 1MI3A 1SJAA 1XIMA 3LRMA 2WSRA 2WMFA 1SJBA 3UESA 4YYFA 1UKSA 4HPNA 5CPLA 3C0JA 3HQNA 3CUGA 5A6BA 1VYSX 3QV7A 4O4VA 1H7XA 3S6DA 3BANA 3T8QA 2VZSA 1UD5A 1ME9A 3ANYA 3VNYA 1FDZA 1SZNA 2G3FA 2E7FA 2CETA 1DJQA 3NVTA 3TZFA 4C6EA 4JOMA 3U5UA 3CWHA 4UB9A 4XISA 3WMSA 1XYMA 1E0TA 3E0VA 4D6FA 2B7PA 2OYMA 2OJPA 4UIOA 4AVOA 2P50A 3K8KA 4H9VA 3FVDA 1A53A 2NLYA 4UNLA 5EFDA 1LCOA 4UWMA 3SCPA 1B3OA 2QDGA 3C8FA 3KE0A 4XZNX 4O0KA 3L12A 5C6MA 4O1FA 2AAAA 2VVSA 5TBOA 3W7MA 4I5RA 2DDXA 3FAXA 1KRCC 2CZDA 1US3A 2INFA 1YMYA 4J2MA 1DWHM 1QHOA 3T0CA 1JYVA 3QGVA 3B0VC 4J3TA 4YWSA 2J79A 4ZO6A 3VIHA 4K68A 1PEZA 1PZ2A 1DJYA 2B0MA 4MLJA 4HIBA 3WD0A 1XKYA 1S5TA 1KM6A 2O9PA 3DKLA 4MKNA 2J6VA 5A8QA 1KNWA 2OCZA 1YE4A 1HW6A 4YS1A 5EYWA 3BAJA 1HL9A 4V15A 5IOBA 4FOKA 4PMJA 3CIXA 2PDXA 2G3JA 2FJUB 2CIPA 3K46A 5DCDA 3M0IA 2E5DA 4ZTXA 3VIIA 4M24A 3VDHA 2XWDA 3MZ2A 1JFHA 3VNMA 4UMCA 3EEZA 3LTPA 1MEIA 1V77A 5XINA 5F1VA 3ZVHA 2ABAA 3OP2A 3DOPA 3HG4A 5CPOA 2PCQA 5HAOA 3TX9A 2V3EA 4JN7A 2ZWZA 3NQFA 4M81A 1H50A 1PYFA 5ABTA 2YL5A 4IM4A 1AMYA 3VNKA 1FDYA 4DUVA 2GYIA 2ZXQA 1QPNA 3MO4A 4OKDA 2GFTA 1X7FA 1XQKA 2GQ3A 1LLWA 4XO6A 2PBGA 4AIEA 2QDDA 2J13A 4RDVA 4URIA 4XAGA 3C2OA 1CYGA 4JNYA 2DZXA 1R46A 3W73A 4QAIA 2Y0FA 4IUOA 2C16A 2A4AA 3TYZA 3CUIA 2WKGA 1U30A 4I9AA 2ZZ6A 1W1A1 4BF9A 3C2YA 4LB3A 1GVOA 1AL7A 2YDAA 3VOHA 2B7NA 2P76A 5D05A 3W1PA 4FX7A 3PS7A 1IEVA 4ORMA 2A79A 2XGZA 1I2QA 1GK8A 5FEPA 3NZQA 1FH8A 2PP1A 3RCYA 2OOGA 2Z1BA 3GDTA 4FXSA 1BKHA 1F3EA 2DZUA 1PBGA 1PTDA 2PU1A 2NSOA 2GDVA 2EJ1A 2J8FA 1YIXA 4DNMA 4OBSA 5CPTA 4Y2WA 1YADA 1J0ZA 1OHLA 1R86A 1EJ7L 2PDIA 3WENA 1N2VA 1VLWA 4E2OA 3F4VA 4UFIA 5E9XA 3TR2A 2AKZA 4KESA 1PTGA 3MW7A 2XFFA 2VURA 2FGLA 3AS1A 5AYZA 2H8ZA 5BMXA 1QNSA 4HHLA 3F2BA 2Y8UA 5F2MA 1WA3A 3O7UA 3SN1A 4ERIA 5AYXA 3RDKA 2RFGA 1E6NA 3OGRA 1UD3A 1I60A 3N4EA 5BWFA 3U2EA 1G4SA 1JZ6A 4BY3A 3ITGA 1FHUA 3O06A 1TFVA 4KEZA 1HXJA 3POCA 3CHVA 2BXVA 3AWNA 3CMFA 3O07A 4B90A 1T6MA 3PUEA 3U4AA 1DEDA 1YHTA 1TSIA 1QNOA 1GVEA 1AQMA 1OF6A 3GNOA 2XTKA 4C6LA 4RL3A 3KTSA 3USBA 3RJXA 5FSDC 2QPXA 1JCMP 3R43A 3NIYA 3EMQA 2ISSA 2YGYA 4RUBA 3EWUA 1EJSC 3W0KA 1B3XA 5LHEA 4MJZA 3NNTA 3RM4A 1VQTA 3W1MA 3HBLA 5FOOA 3IWPA 3P7YA 3VI2A 3K2GA 2D69A 3NGFA 1GOOA 1H2JA 3L66A 1E6XM 5F2IA 2QV5A 1UD4A 4R3UA 4MNJA 5FD0A 5EA9A 3QYSA 2PRMA 3PTQA 5M5DA 1K9TA 3VDGA 2XSBA 1GONA 2EG8A 4JCMA 2WSKA 2WAGA 3KAOA 3TJ4A 3BMVA 2IQTA 3LCLA 2Z1XA 3AWOA 1QW7A 3UVAA 3FSUA 4C6KA 1VP5A 3QBUA 2OEMA 1B3VA 1YXDA 3HA1A 4LQ1A 1EEXA 4Q4MA 2GQ9A 1O12A 4Q4QA 3B9DA 3IACA 2CKRA 4XQ6A 1P1MA 2JALA 5CKSA 4WY0A 5BMWA 3W53A 1TWSA 2PWEA 1E1EA 1WQ5A 4HCHA 1H49A 4TTUA 4MB5A 5JXQA 4DJFA 1KWKA 4XD3A 3WZ0E 3NTYA 1T8QA 4PL2A 1HJVA 4PTNA 3P5ZA 4MJMA 3URBA 2BTMA 1ITQA 1UIPA 5FF3A 3CHEA 4PBGA 1BTCA 2VUYA 1QDSA 3PSWA 1J5SA 3RPMA 3UWUA 2QPUA 1XDMA 4MOZA 3SCNA 2Q09A 1GYLA 1SMDA 4U5IA 1D9EA 1GKPA 2WC3A 1TQJA 3BOXA 4G5DA 2E67A 1U5JA 2XG9A 2ZUVA 1GVIA 1KRMA 3W27A 5CLWA 1E6RA 3AZSA 2V30A 5D8ZA 7PTDA 3GXMA 3W07A 4LB4A 3JS3A 3VNLA 4U28A 2NQZA 3RFAA 1B57A 2ZFAA 3P84A 4NZ3A 5D8WA 5ECVA 3T2OA 4YXGA 4BS0A 3WQ4A 1BWKA 4YN5A 2QCFA 4QBXA 4HN4A 2DSVA 3ARZA 3G18A 1C91A 1QOQA 4OFCA 3OVGA 3N19B 4D6IA 3P5YA 3U0HA 2Z26A 4LVAA 3ARSA 4AQLA 1OG6A 3UZZA 1RAKA 3MP5A 3HMJG 4GLEA 5BZAA 1XBVA 2XIIA 4JTAA 2OOFA 3FNDA 3P8IA 2C15A 5SWUA 1DP0A 4EP8C 1QRQA 1XPYA 4EVZA 5AFDA 5DBTA 4DUOA 1BLIA 4KW2A 1JZ5A 3EBVA 4NZCA 4QG9A 3H2EA 3LQGA 4AX7A 4UZSA 4Y9PA 2WCAA 3RU6A 2DSZA 4N7QA 3ABXA 1X8FA 4HHHA 5G1TA 3R8GA 1IWPA 4DX3A 1V5XA 1LUCB 4NU7A 4S38A 5KINA 4DBUA 1H51A 4IUGA 2OFJA 4E8CA 1K7EA 2CITA 1KW1A 3WLIA 4EWND 1AQHA 5DY3A 4JFUA 4ZBCA 3CMGA 1MO0A 4NHVA 4K36A 1S1RA 5EMMA 3U2CA 1R9XA 3DC0A 4MB3A 5A6BD 4V27A 2EPKX 5CCZA 1VR6A 2FTPA 4P7OA 2CLIA 3B8IA 3QPEA 2PZ0A 3U5YA 1UPMB 1QBBA 4O14A 1F5ZA 1XBXA 3S1WA 1OVDA 2CLHA 3TWAA 2DSUA 2GJNA 2PGWA 2F2HA 1CCWB 2E25A 4LVFA 1XLKA 1EH9A 3K1GA 4GFSA 1SW0A 1W1TA 3VDBA 3GKFA 4AYGA 2QDHA 4UR7A 1ADSA 3EPNA 1RVKA 1MEHA 4NZ1A 1HJQA 1OCQA 3M0LA 1E3XA 5I09A 3CV2A 3BW4A 1JG9A 4FXRA 3NPXA 4F79A 3BSGA 2ZTKA 4M19A 2D3LA 2ZRXA 2ZZ7A 4IMEA 4GI8A 1UHVA 4PCFA 3QYQA 2WPGA 3UXKA 1CXEA 4GY1A 3ZIZA 1UJQA 1SPQA 3P80A 3NOEA 4QITA 3V16A 4HVXA 4S3JA 3TQKA 3GE7A 5CGTA 1J11A 4L4OA 2PTYA 3R8RA 1EBGA 4UTIA 3GTNA 1H41A 2P88A 4IF2A 3HPAA 4QEEA 5BOFA 1U1UA 4CNTA 2P1FA 1TZ7A 3IIPA 2GZXA 4N42A 4OWGA 4JIQA 3FIGA 9CGTA 3VE7A 5HXMA 1V3MA 3BG3A 4YHGA 1DXIA 1V02A 1FH7A 4IWWA 2GOKA 3VIPA 3T1GA 3G5EA 5LIUX 4RXFA 2NT1A 4S23A 4H9TA 4ADTA 4E4FA 1FP9A 3VINA 1W1PA 4MWAA 3W3OA 1VJSA 2DEPA 1D2KA 5IFTA 1KTCA 4QG8A 1GQLA 4RE2A 4AD5A 3VKBA 4HT3A 3E2SA 1NDZA 1XCWA 4C6DA 1R3TA 1RHCA 3M5YA 4X0NA 6REQA 4L1XA 1LRQA 4Q8WA 2YFNA 4ENLA 3JW7A 1FCUA 3WLNA 3VD5A 4KBXA 3WDIA 3UWYA 2EO7A 5GQBA 3LM7A 3TWBA 1VBGA 1L9WA 1GYMA 4LC6A 2VQUA 1FWNA 2QUUA 2VELA 2ZCGA 4IIHA 5IFPA 1C7TA 4RDYA 2Y7DA 4FS9A 2FVLA 3DENA 4K1WA 4FK9A 2F6UA 1I2OA 3SO7A 1X6UA 2AMXA 3KVKA 4MNMA 4DZ5A 1K03A 4HNNA 3MUXA 3VOGA 2FMOA 1HIZA 1LRNA 3WG6A 1VFHA 1POJA 4GFIA 5BRBA 2ZUSA 1KBBA 4LSBA 3AMLA 7REQA 1BGGA 1Z44A 4Y9NA 2WJDA 3NDYA 1XP3A 3EDEA 4XKMA 2OZ8A 4I8DA 1V6UA 3NOYA 3I4EA 4H9XA 1E4MM 1FY6A 1GEQA 2PDPA 2XU2A 4D6DA 4IXXA 2JBMA 3SFWA 1GHRA 4AEFA 2HROA 5FACA 2ASHA 2OELA 2G3MA 3TV8A 4L9XA 4QNEA 3C2FA 3TSDA 5EMLA 3SCOA 3G1SA 4AZ5A 1EQPA 2V3DA 3L4XA 4HU3A 3KBJA 3GVRA 4MJ4A 3VYLA 2IXUA 4Q7BA 4P5UA 1U22A 1ML1A 4OOUA 4LUYA 3LI1A 1QTWA 3M6DA 1L6SA 3CQIA 3WQOA 1EIBA 3GIQA 4V2XA 3L4UA 5E09A 3UZ5A 1J2WA 5A8NA 3M5VA 1FWBC 1CDGA 1A49A 4K7VA 2Z2AA 1XBYA 3KVLA 3C2VA 1EC8A 2WMJA 3KWSA 1H1YA 3HG5A 4RE3A 3BCJA 5DY2A 4G7EA 2FTYA 3CQ0A 1WXZA 7A3HA 3EX2A 1V6YA 2F8QA 1TRIA 4G1KA 2ZUTA 3FLUA 5XIAA 2ALDA 1BAGA 8A3HA 5CC3A 1UZHA 2GSEA 3T08A 1JXJA 4NY2A 2GQAA 3ITLA 4KCUA 3ARWA 1Z48A 4LC8A 1IXPA 2HK0A 3QF0A 2QMJA 3LRLA 2E9LA 1W1ZA 4HK7A 3IV3A 2I14A 4L4LA 1LBFA 2E77A 4BHYA 1D7KA 3W74A 1KM2A 3PUOA 4AAJA 1NWUA 1NWSA 5LXEA 5KZDA 1JFXA 4HJFA 1P4CA 1XL9A 3V5CA 3BCFA 3KVJA 4O1EA 1C90A 3ISIX 3KZPA 1XF0A 4Q7IA 4WKHA 1TB3A 1F7BA 1C9WA 4NZ4A 2YX0A 1QWKA 5M17A 3ITOA 5E0FA 4US5D 3I3DA 3ZQ9A 4INFA 1EWEA 2V38A 4D8ZA 1FCQA 1P43A 1HNYA 3GLCA 2CBJA 4F2BA 4OOZA 3B9NA 3VABA 2VQTA 3R89A 4AZ7A 4JTIA 4XK2A 2R1LA 1SZRA 3N14A 4AD2A 1S3HA 2GVEA 4IL0A 3GH7A 4LALA 1FA2A 4ZVJA 3MKCA 4KEMA 2G0WA 3VTRA 1KBKA 2W66A 4YMZA 1IWBA 3WH7A 2E8YA 1XCFA 1I45A 2VCCA 1ZS2A 3SGZA 4WSKA 4QDPA 4W5ZA 3UWQA 4UTTC 1NDYA 2Y70A 1B9BA 2BVWA 3KRBA 5D9PA 5I07A 2ZE0A 1S2UA 3HURA 7REQB 1VYPX 4H04A 3MI3A 4M6VA 4LEQA 2PDUA 3LCGA 2IKJA 3WLRA 1K9DA 1CW2A 1TR9A 4UTWC 5K4XA 4Q4SA 2WWDA 3BARA 2FLIA 4D6CA 3EAUA 3WF2A 2FH6A 4KCWA 3A3WA 3EX4A 3ITCA 4S3CA 4Q4PA 1WXYA 4JTKA 3FS2A 3W7LA 1V6VA 4EF8A 5CLTA 3VOJA 1O68A 2X1IA 5I78A 4CLMA 4A3YA 4QX4A 3GXNA 1W5MA 1JZ3A 4ZB0A 2VC9A 2QHAA 3BQ5A 3Q45A 3O6CA 4LV4A 1G67A 5GNZA 5LZLA 4GYPA 5KEZA 2WMIA 1S1PA 1KFCA 3NFUA 4FLOA 3AXKA 1TPUA 4ZXOA 1MUCA 4NYUA 5GJPA 5LA2A 4A22A 1XRSA 2IMRA 2EXOA 3TOPA 1UD6A 2FTWA 2VOTA 3TMQA 1ENUA 1N82A 3WK3A 3IJ7A 3KDOA 1UP2A 2QDEA 4ACYA 3PZMA 1YRRA 3LGGA 4ZO9A 5A6JA 4H2CA 4H9ZA 2OT0A 3HB9A 3LDVA 4WDWA 4K38A 5EMKA 4J3ZA 1MNSA 3WH9A 2QIWA 3QY6A 3EXSA 1YKWA 4XTIA 5T26A 4CNPA 5I7GA 1R3SA 2R6OA 2W79A 1EXBA 3LPGA 1KB3A 1H0GA 2FYMA 3L9CA 4A4AA 4NAEA 3UWVA 3QHMA 3NZ1A 3AUOA 1UQYA 2TYSA 3VO0A 4ZXLA 4QTGA 2NSXA 1XRTA 2V82A 1R5YA 1ZALA 2Z6JA 2FZ8A 4O11A 4IJCA 5BU6A 1XSIA 4LUIA 2OVLA 5C55A 1PZ0A 4WOQA 3CGTA 3T4WA 3BL3A 2CXGA 3R79A 1MVYA 2EEXA 1D3CA 1XLDA 3B03A 4C6MA 5LNWA 1M04A 2X0HA 4LVDA 1NOWA 1E3ZA 1K8YA 1NSJA 3CU2A 4RZ4A 2XZ9A 2YYUA 5HJYA 1H7RA 3RITA 1PE1A 3CAWA 3M4HA 1HFBA 3P81A 1F6KA 2E6YA 3H23A 3ZT5A 3MUAA 5I24A 4NXKA 4IZGA 2HJPA 1ITXA 5FL1A 5FAGA 3CS2A 5I79A 4DYJA 1BSIA 2HISA 1S39A 4F4RA 3WF3A 2J7BA 3EWXA 5I3HA 2BZNA 2ALRA 3S5ZA 3VD4A 4RX0A 3KRUA 4XZWA 3QLDA 1W1VA 2XGBA 2PDCA 4PH6A 3M0ZA 4LH8A 3KRSA 3JU2A 4JEQA 1DXEA 4C6FA 4L1GA 2H3DA 3MANA 4DWDA 5TD4A 3QHNA 2DT2A 5TAOA 3MP4A 1RZMA 4DPQA 4X0VA 4AD3A 4JKKA 3LNMA 2ZBTA 3F4NA 3RF9A 3ZFHA 1IIHA 1KM1A 1M1BA 2TODA 3P0WA 3VZZA 3AZTA 1OIFA 1EOMA 2BY1A 4KERA 2FGZA 2Y63A 4FP1A 5AKQA 4DUXA 4E8GA 4UOQA 3XISA 2Z4GA 4TOQA 2NQHA 3W00A 1G7UA 1JCYA 2EJAA 1K1DA 1E4IA 3BICA 1XRVA 2XJ7A 4J1OA 4YLWA 4C91A 3H55A 3OZMA 4FF7A 1FCBA 1IT7A 2QF7A 2D3NA 4AWSA 3T05A 1LOLA 3SUUA 1SU5A 3CQKA 2BGSA 3QOMA 4JTEA 3MHGA 3EA2A 1Q63A 3M7WA 4GJJA 3SN4A 1C7SA 5CZTA 1PX4A 4JGDA 1OX4A 4M1RA 4EE9A 4A21A 4NJIA 1QVBA 4MM1A 1J2BA 1TZZA 5IRPA 5IBXC 4R7JA 2F6KA 4TV5A 4B4FA 4O54A 2ZZ5A 3LLDA 1UH2A 4ZQCA 4NP7A 4HP5A 3LCXA 4U3AA 3DCPA 1TJ1A 4BKNA 3B8DA 1OBAA 3A4JA 1XLGA 4RDZA 4HOWA 2HXUA 4S39A 3KVMA 1FFRA 1MW0A 2P0OA 3LBCA 4OBRA 1S5WA 5E1QA 1UJPA 2OU4A 1P0KA 4LS0A 1F2JA 3UQNA 1NARA 1YNQA 2X09A 4LYRA 1H1NA 2F7FA 4FLRA 3K4WA 2Z1KA 3GG7A 3TK7A 2VKZG 2R9RA 2XVLA 4IQLA 3HPXA 1IT8A 5CH9A 1PXGA 1WAWA 5CBIA 4NJKA 4J3SA 2GVLA 5H2ZA 2D0GA 3TAKA 1V0NA 4X61A 5C8BB 1VFMA 3ITXA 2Z6IA 4DELA 3TYAA 5BCAA 2CERA 1GTEA 3NA8A 4FHAA 3GR8A 4E38A 2V2DA 1W9UA 3G0UA 4ROPA 4KWWA 2OLHA 1FWSA 1M53A 3UXDA 4AY7A 4RNFA 3QGAC 1A50A 3CZKA 1TPB1 2AGTA 4K7YA 1SO5A 1TX0A 4WF7A 1KXVA 1XC4A 3C86A 2F84A 3VFLA 1LQAA 3NO3A 2JFEX 4K8GA 1EC9A 3KDNA 3VDCA 1W5QA 4HKPA 4YTSA 2JKEA 1KM4A 3WEOA 1OGSA 4IOTA 2GDQA 1OQFA 4LAZA 1JIBA 2W3ZA 1E9IA 3AIEA 2A21A 4LVBA 2FZMA 2HTMA 4F48A 3KWXA 4G2DA 4UQCA 1TPH1 3SUTA 3GR7A 2YPIA 3RX3A 4FR1A 4UTJA 2PF0A 4DO4A 4HPXA 2PZNA 3RILA 4LGXA 3LLXA 1XGZA 4ACZA 4QRNA 1W3LA 5M2FX 4IMAA 2O7QA 1F9CA 2GVYA 2Y8VA 1ZJHA 4BA0A 1AW5A 4CN1A 3QH2A 4D6GA 4B91A 3IIZA 3NSXA 3C8NA 4S1FA 5C5YA 1ZPTA 1FHDA 2TMDA 5EL1A 2ZQ0A 3STFA 3CL8A 3MUZ1 4EIVA 3AS2A 1H0IA 1RK6A 4CCEA 3C0SA 4XWUA 3E5BA 1CGTA 3CM4A 1FWCC 3IGHX 1NOFA 1TPFA 4WK9A 2JGQA 3QY8A 3G8EA 2WVSA 3QSRA 1WKYA 1G7VA 1DWJM 2UV8G 1VEOA 1VFOA 2C0HA 4JTGA 4XKYA 3GC4A 5XIMA 1QOPA 4NJHA 5LNVA 2NUXA 2R8WA 1LTDA 1Y0EA 4IMFA 2CZEA 4JHMA 3S2JA 3MZNA 4AWEA 3VCNA 2QV4A 2G5WA 3LHYA 1JYWA 2WBGA 2CZFA 1HGWA 4DLMA 2PBOA 2PDGA 4ZGYA 4DJFD 3JVAA 2OSWA 5T91A 3I7QA 1TUXA 4A2RA 3F7JA 3WD3A 3AROA 2QAPA 4H1ZA 1KCZA 3ECQA 2YDRA 4A8RA 1E0VA 3I7SA 2IPJA 3K30A 2XUCA 3PPHA 3S0CA 2DW7A 4V28A 1DHPA 1YBQA 3M6YA 3E38A 4JPGA 5CZ0A 3WN6A 4ZOCA 1PVNA 3PZUA 2H90A 1A47A 4O12A 1P6BA 5CBBA 2UBPC 2VYOA 4ML4A 4D72A 1W37A 1S38A 1M68A 1TIMA 3G1DA 4ICCX 3DFTA 1WB0A 2V3FA 4UTLA 4M80A 4MZ1A 1E0WA 1R9ZA 1F6PA 2OSXA 3G6MA 4RPPA 1RK5A 2YL6A 3BAKA 1ONXA 1BVZA 2BVDA 2A85A 5EMYA 4U10A 1V0KA 4KQNA 2DSKA 1C8VA 2PMQA 4GI6A 1O4UA 4HU0A 1H61A 4D2JA 1UA7A 1FWWA 1T8XA 3CV7A 3PZTA 1OZMA 1GOKA 5EMUA 3DG3A 3MKKA 5DX7A 1JNEA 3REQB 4Z1DA 4JEJA 2DY3A 1W3IA 4DO6A 1JUEA 4JTJA 2NQLA 2POTA 1LOSA 1NM9A 1WZAA 1XG4A 3CLWA 1XFCA 1J0KA 2MUCA 1WZMA 5HNTA 1UD2A 5G1MA 4U2YA 5HATA 3H2MA 2ZZ2A 4UC5A 1BD0A 3RCNA 4Y8EA 4B15A 2ACQA 4B5TA 3N9KA 1JDCA 1KXTA 4XSMA 2E28A 3VKDA 5K2ZA 1UPPA 1W1B1 3PZVA 1VLIA 4CD6A 5TNVA 3WD4A 2FPTA 2H9AB 4FZIA 4JDYA 2NZLA 2HS8A 4QIUA 5IDIA 4NAFB 3KOXA 1JZ8A 2J24A 4CCDA 1RBOB 3THUA 3EMZA 4JTRA 2QMKA 3KHDA 4PUMA 4LCRA 5CC6A 4LFYA 2ZZ1A 4R27A 2FFIA 3BLIA 1SR9A 1EJWC 2KZHA 1N55A 3O15A 4O52A 2OMAA 3WFAA 4DWSD 3GC5A 2XSAA 3SIZA 1M01A 2DUZA 6XIAA 1XIGA 3PK7A 3BMXA 4M5PA 3H12A 1Q8JA 3L7RA 1BG4A 1P48A 1CTNA 3W85A 1TPWA 3HV9A 2YXOA 2QUTA 4M6QA 2QJNA 3ZVHB 1R0MA 4C65A 4BFAA 1PL9A 1EUAA 2WWCA 4UTKA 3KBSA 5ABFB 1DTUA 2ZUMA 1GORA 4AVNA 2VJXA 3CZEA 4QCFA 3BOLA 3NSMA 1XIJA 4HNUA 5BRPA 2H9AA 4I5UA 1CGWA 1ESWA 1KLZA 2OGJA 3GUGA 3GBEA 4Q4OA 1LYXA 2PC8A 4F8XA 3W7PA 2CU0A 1OWQA 4HTYA 3LD5A 3AMKA 3MMTA 2C1IA 3APYA 4NIRA 1NWTA 2P8CA 4H01A 1OC6A 3E49A 3S3GA 2ZX5A 3L4ZA 3CT7A 1VFFA 3OIHA 2DU2A 2AQVA 3N3MA 1W9BM 2GUYA 5AYBA 2RKXA 4MB1A 1UKQA 3TFCA 3RHGA 2VDGA 1HVQA 1EYWA 3FOKA 1H5VA 4C1KA <