3Q6BA

The high-resolution and new form crystal structure of bama potra4-5 from e.coli
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
YKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-resolution structure of a new crystal form of BamA POTRA4-5 from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
molecule keywords Outer membrane protein assembly complex, YaeT protein
total genus 50
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2010-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3q6bA01
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3q6bA02
2X8XX 4K3BA 4C4VB 4QAYA 3NJTA 2VH2A 4C4VA 2V9HA 4PK1A 3Q6BA 3EFCA 4XGAB 2QCZA 4C00A 3OG5A 2QDFA 3MC8A 4BZAA 2MHJA 2VH1A 3MC9A 4K3CA
chains in the Genus database with same CATH superfamily
2KFKA 4HCNB 3FC4A 2GBMA 3IAS1 4XYCA 3UIOB 1WRDB 5BYQA 3TEYA 1KLUD 2Z8LA 2LXCA 4YTPB 1I4RA 1QF6A 1AW7A 3GE8C 2AEHA 4ZHOA 2KKCA 4RH6A 4IW0A 2X8XX 5EE0A 2CHZA 1C4CA 2MEKA 1P7EA 4LLGM 2LRWA 1PFDA 2AYOB 2D07B 3UINB 4FLHA 3IT6B 1WRIA 2DZJA 2QCZA 1YQBA 4C00A 3P2BA 3KWLA 1WJUA 2ZW0A 3IG3A 1V86A 4KZ0A 4P16A 1PDXA 1Y8RC 2KWVB 1DOYA 4CYEA 1C3TA 3EC8A 4LNNA 3TCAA 4ARCA 2DYMA 3HIZA 1YN3A 1A5RA 1FXTB 1L0XB 1PYWD 3PHWB 3GZNB 4EKUA 2AWTA 3NUHB 2OJRA 1ZUD2 4GDKA 1F9JA 2WYQA 3QX1A 4W9DA 3ZO5B 1KH0A 4GDKB 1V1PA 2DYBA 4HLEA 1C78A 2K22A 5E6PA 1TKEA 1CMXB 1D4BA 3Q3MC 3GS2A 1ISNA 3V61A 1T0RC 2CJOA 5CX3A 2BVCA 3APFA 2M17A 3V6EB 4US8A 5JHBA 1TJEA 4MH8A 2DZIA 3ZNGC 2HTHA 2MH7A 3TBLD 5D6JB 1YQ3B 1GNUA 2ONQA 1JMLA 1YOVB 5EDSA 1WMHA 2DNFA 2ON8A 3FKYA 1OTRB 1SJED 4ARIA 2LGSA 1QQRA 2L8JA 1ZDXA 4K7SA 3NVYA 4P6VF 3PV1A 2K3UA 2NBWB 4JQWC 3RPFC 1VD2A 3NHEB 4NAWB 3UIPB 1F2RC 4HKZE 1V1PB 1WZ0A 2K5PA 2MX2A 2DENB 2LVQA 1E8WA 1JCKB 3ZJVA 1WGYA 4BBNC 2N7EA 4AUQC 2GBKA 3QA8A 4MEMA 1JW9D 2L83A 4XGAB 3OG5A 4PT5A 3AU4A 3EFUA 3R8BA 2ZCBA 1TGZB 2RMMA 4HDOA 3RNBC 4DDGD 1IBXB 5G2NA 2QC8A 4E3CA 3NJTA 5IO9A 3NVWA 3I63C 2JZZA 2KFJA 2IPKD 4PK1A 4X57B 4HDQA 4LJOB 1MPEA 2LI5A 4WWMA 4DXFA 2MHJA 3I3TB 4ZRJA 3V60A 3ZGZA 4XDCA 2QILA 4NQLB 3OJ3A 4MSQB 3CSFA 2MP2B 4ZRPA 2KWDA 1IUEA 4MM3B 2FCNA 4ANUA 1YJJA 3AEFB 2O2VB 2MJ3A 2AL3A 4YTMB 2KJ6A 3HVZA 3E9SA 2O2VA 2Z59B 4KKIA 2JX5A 4LNKA 2IO0B 5EE1A 4B95A 1F1HA 4E71A 4BKGA 2BB5A 4HVBA 1YJ1A 1RFAA 2I1KA 4HPLB 3ZTDA 1JALA 2IDYA 3U30A 3VDZA 5KHQA 3BVGA 3DWGC 3T8MA 4RGMA 3A1QB 4BOSC 5CHWA 1N61A 5I4DA 5D3DA 4F7ZA 2K6DB 2KQ4X 4C80A 2JZPA 3VRAB 2KACA 1UGJA 3GOEA 2N7JA 2ZVOA 3O65B 2INPE 2UYZB 1KM7A 3EGRA 3J9CA 1E6EB 3APDA 2BBCA 1AYFA 3SD5A 3W2DA 5DPRA 2BYTA 4KKJA 1WIAA 2CHWA 2MA9B 1H8CA 2GBRA 3ABVB 3PT2B 1TY0A 1C4PA 2KDEB 4IM2A 1N63A 1RM6C 3BYTB 1P7FA 1YX5B 2KLCA 1GJZA 4DBGA 2ZPYA 3U52E 3MJWA 3DBSA 2IY0B 4PS8A 1F52A 3DVNU 4GGQA 3GP7A 2L0TA 4W9CA 4GDLB 5CHFA 4GB9A 2LD9A 4BFRA 3SR6A 1GG3A 1WYGA 2WXJA 4GN1A 3RI7C 1VZ6A 2DYOA 2WXOA 3AE4B 2MRPA 2V3SA 5G5HA 5D94A 2NR2A 2RGFA 1C9FA 1V97A 2JYEA 4WWNA 4F8CB 2I1JA 3PRMB 2BF8B 4JGHB 4MH0E 3PGEA 2KVRA 3B0AA 1GB1A 4HKQA 2K8HA 1KF6B 2LXAA 3A4SC 2JQRB 3R2IA 5C23A 3ZJTA 4MGZE 4KVGB 2CR5A 1UBIA 3L54A 3PZ8A 4O1NA 3S2AA 1ESFA 4KSKC 3P4RB 2PE9A 1GUAB 4BVUC 1F0ZA 2VZKB 3GE3C 3RN9C 2FUG1 1J7BA 2VRRB 2WXPA 2WDQB 2N9XA 2WS3B 1WGRA 4ZYSA 1HA5A 3WAPA 3ZQ4A 1V5TA 1WJNA 1XF5L 2PIAA 3TUOA 1EWCA 1DOIA 2KOXA 1P1AA 2MLBA 1SE3A 1UUPA 2D3CA 2D3GA 4ZRQA 5GXGB 2J52A 1SJHD 3N1XC 2BS4B 3NG0A 2RD0A 3PRZA 4J6IA 4ZDVA 1UWMA 1WX8A 4BKSA 1E7VA 2KQ7A 1ZOYB 1SB3C 2GBNA 1FD6A 3H6NA 2L1AA 1KOTA 2IO3B 3DHIC 2K6QA 3WAMA 5IAAC 2Z0DB 5E6JA 1WSPA 1MJDA 3N20C 1L5PA 1N62A 2WU2B 4AQ7A 3BVZA 3ZDTA 3BY4B 1KFYB 1PGAA 2B3AA 1E7UA 3SFEB 5T8IA 3ZDMC 3ETRA 3MC9A 2DHZA 1Q5WB 5IN7A 4A8XC 1XD3B 4ICVA 5LNK1 2WQYB 1WJ4A 3IAM1 3Q3FA 2M8SA 3AN1A 2GB1A 4AJWA 1QT9A 3A33B 2KHWB 1XLPA 4WJQA 2W82A 1FRDA 3ZW3A 2LGIA 2M0XA 3SEBA 3BWUD 4G3XB 5H8YE 3B9JA 1UH6A 4ANXA 3NVVA 4LDTD 3VFKA 3IVFA 1ZXIA 4M8MA 4AWJA 4B9KA 5FR3A 3PLUA 5H92C 2REXA 4B6WA 4DWFA 2D11A 3ZRFA 2WDTB 2JZ3B 1TT5B 1OFFA 4W9IA 3R2TA 4MGKE 2J0JA 1WJ6A 4C7YA 1L7YA 3AU5A 4MJSA 4RGOS 5JHAA 2FCSA 1E0ZA 2JU6X 4BOZB 3OAWA 3NOBA 2KMMA 2SEBD 2W3RA 3HVDA 2JRHA 3M62B 4RGNA 1TS2A 2ACZB 1H4RA 1V2YA 4ITKA 2KNBA 3QARA 3JSVA 3GZNI 3KVFB 2EMSA 3JSVB 2LJ5A 2C5LC 2K39A 1T5XD 2KTRA 4K7UA 1QLBB 3JW0X 2RPVA 1V9JA 2JRIB 2XNAC 1UZXB 4GLSC 1FNUA 2ZZPB 4OZBA 5DPSA 3PO0A 4ICUA 2KVZA 4XDDA 1HTOA 5AEKB 2O6VB 3R3MA 2A5UA 4KGSA 4II2B 4M8NA 4N58A 2LASA 2M4NA 2KDMA 1I4QA 3CMMB 2AX5A 1C77A 1KLGD 2LJIA 4NJ7A 3DHHC 3I5JC 4IM0A 4KIKB 5JZEB 4LDTB 2YEPB 1ET6A 4C56C 1KLVA 1FXIA 1QOAA 3U2SC 1B1ZA 3VRBB 2PJHA 1Y56A 4NAWA 1V8CA 2K9XA 1R4MB 3RT3B 2ASQA 2BS2B 2NTSA 2W3SA 1L0YB 1DGJA 1QOBA 4GU2A 4I6LB 3VQIA 3UQBA 2R61A 5EE3A 5BMIA 1MHXA 2BS3B 2BWFA 4IOIE 4WURA 5HG2A 1ROEA 2KN5A 4US9A 3W1SC 2MBQA 4MGYE 4C4VA 1PQSA 4NAMA 2JY6A 1FFUA 4OZAA 2N9LA 3X0WA 4JE3B 3Q3OC 3R7QA 4NZLB 5BMGA 2KN4A 4URKA 4KIKA 5BMHA 1NENB 3CIRB 2K1FA 3Q8EA 4DHZB 3AEDB 3JYUA 3HHMA 4WH4A 3N1YC 2L76A 2PLPA 1WXAA 2G45B 4LTUA 2W54A 3A9KA 1PGBA 2L7RA 2KK8A 4NJCA 2EMTA 4OVUA 2JUOA 1VZ8A 3MJ5A 3ZYYX 5HI1A 3WA0A 5C2TB 2W55A 2CHXA 4OVVA 1XO3A 5IA7A 4CQNA 3VUYA 3EECA 3ZXRA 2LFIA 3KLSX 3IT4B 1OQRA 3QAQA 4L2YA 3SDLC 3EA6A 5L95C 2QEJC 3Q6BA 2KDFB 2LEKA 1L6VA 1XCQL 3VVWB 1SE4A 4JIOU 4EUTA 3AE6B 1LGRA 4KSLC 3TEZA 3B08A 2QSDA 4UDUC 3TEXA 2YVCA 3H1UA 4H2AA 4NNJB 3Q3JA 3DBRB 4G50A 4HRSA 2WDRB 4W9KA 1MG8A 1WX7A 3VUXA 3R66C 1FM0D 2LRUA 1YX6B 4II3B 4YSXB 1OQQA 3H7PA 1K50A 2PVGC 2CU1A 4DDID 3TEWA 3D32A 3MFGA 4NJ6A 1Q0WB 4N59A 2I38A 4FHKA 1FIQA 1DOXA 4G11A 1UBQA 4HK2A 1FCCC 4A6QA 1OGWA 1ET9A 3QQ8B 3NZSA 4B0MA 2N1VA 2DLBA 2DX5B 1VCBA 4MSMB 2Y3AA 1Z5SB 3UF8A 4Q2JA 2CS4A 2JPHA 2DZMA 4KGTA 1WE6A 3DBRI 2KX3A 3ML9A 4FULA 3ZIMA 1CZPA 1ZXHA 5D3IB 2LGDA 4XE0A 4GOCA 3TJPA 3PRPB 2FNJB 4FJZA 2PKOA 1SXTA 2FCMA 2KX0A 2WHIA 3AV8A 1XLOA 5IKCM 1K51A 3DCGA 3L17A 2RDHA 1I4GA 1FRRA 5G55A 2R2QA 3AE8B 2BPSA 4WJNA 4HXDA 4IDIA 4R3DA 3TIXA 5AZHA 3CF6E 4E74A 5J17A 4WIPA 4EEWA 4W9GA 2KDBA 4A9AA 1I4PA 2KO3A 1XT9B 2J42A 5AUKA 5C3JB 4XZ4A 4YSZB 1KRHA 3Q8AA 2N9PC 5GMVA 4WJPA 3H8HA 3VH4B 2MBOA 3AE5B 4I6NB 2RR9A 4IWPA 3V6CB 1HE8A 1T6BX 3HRDD 4S17A 3UI3A 4ZHPA 4FA6A 1HQRD 2X38A 2L05A 2A4ZA 1E7PB 3RZWC 4AS1A 3I9V1 1WF9A 3TL5A 1UELA 4BKSD 3PS6A 1WM3A 4REZA 1VRAB 1NBFC 2D5GA 1TTNA 2WXQA 2AQ2B 1C1YB 2QJLA 2M19A 3LYYA 3PHXB 3NY5A 4RM9A 4W9FA 5EE9A 3ZKJC 1NI3A 2V0GA 1G6JA 1L6UA 2IBIB 1ZGUB 2IGDA 1QZEA 4AP4C 3K9PB 2BYEA 2K8CA 2ZJDA 3B2GA 2E3TA 1EF5A 2KTFA 2MSED 1T0SC 4RFBA 4HPMB 4MGIE 4FBJB 4ANWA 3KH0A 2KWCA 1WXMA 5BYRA 4YXDB 4JWUC 2GRIA 3EHVA 1FEHA 1SGHA 3HUIA 4WWOA 4C4VB 4RMAA 2V9HA 4DHJB 5HKHA 1EUVB 2LVOA 5LLIA 4EFOA 2KD0A 1N5WA 1WH3A 1WMHB 1E10A 2CU3A 1TBEA 4LJPB 2NCNA 2KJHB 4YT0B 3U4EG 5MPOA 4W9JA 1YJIA 3A9KB 1RFKA 1NI2A 1AN8A 3JVZX 4MJSB 2RDGA 3IBEA 4ZRIA 3DVNV 3DPDA 2YLMA 2WXMA 2NTTA 3Q8FA 2D3AA 5J18A 1WGKA 2INCC 1D5ZC 2LVPA 3AEGB 2J53A 1K53A 2EKEC 2Y5CA 3EFCA 1P98A 2N9EB 3MC0B 2K0PA 1EF1A 2G4SA 2XK5A 3ENEA 3MC8A 4IUMB 2BTEA 2ZW1A 3A1QA 3AEBB 1ZP0B 3P42A 3QIJA 2D10A 4HJKA 2PEAA 4FADA 1JROA 1E8XA 2IZVB 3UGBB 4M00A 2NPTB 1GC7A 3A4RA 1C4AA 1WR1A 3RMKC 3IHPC 1WY8A 2J7QB 3SHQA 3BZDB 1E8ZA 4TKNA 2BB6A 1C76A 2G3QB 4TQ1A 1SBBB 5KHOA 2H88B 2WX0A 5D2MB 2JWZA 1QILA 1S3SG 2MBHA 5LXIB 1WX9A 4LK0M 1HXYD 3ZUNA 2ZEQA 1KJTA 2ZCCA 4FJYA 5DPWA 2KMCA 4K81A 5FK9C 2MBBB 2N4FA 3AE2B 3RFZB 3QK0A 1I35A 3C8YA 3AEAB 3A9JB 3R7RA 2C7MB 2ICIA 3PVLA 5IOIA 4EZKA 2JXXA 2OEDA 1QOGA 5IP4D 3DDCB 2WXGA 4L1BA 1J19A 4GSWA 2DBYA 3P63A 1J7CA 1L2NA 1UWXA 3AE7B 3DOWA 1ZW7A 2C9WB 3LJ3A 4M0WB 3WAOA 4OZCA 1NDDA 1YNTE 4PS3A 3RNAC 4P1CC 4A3PA 4QAYA 3NVZA 4ASWC 3P4QB 3ZNID 3LXFA 1WGDA 4OW0A 1BXTA 4GDLA 4ANVA 1RLFA 3AEEB 3DVGX 2G4DB 2EELA 4FHJA 2VH1A 4W9EA 1VJKA 1WFYA 3P4SB 4KDLB 1UGMA 1L4DB 4JLCA 3PLVA 4C7ZA 1K8RB 2O6VD 2GLSA 4KX6B 1JQ4A 5HFYA 4USAA 3RD2A 1TZ1A 3NS8A 1LXDA 2INDC 4FN2A 1TYGB 2V4IB 3RZFA 2AQ1B 4BKTA 3VR8B 4N9F4 4RNAA 4K7WA 1IGCA 1LM8B 3RCZA 1V5OA 2LHEA 1TS3A 4DHZE 3NZUA 5TR5A 2YEPF 2L0FA 1MI0A 2NVUI 2ZNVB 2FIDA 5LXHA 3DVGY 1TKYA 2G9HD 1IPGA 4A90A 1SF0A 4RF0A 4I6PA 1UNSA 2C7NB 2KYWA 5HHDG 1MVKA 1F2RI 3KYDD 1TY2A 1IBXA 1MHHE 1FMAD 2Q5WD 2L52A 1K52A 1M4VA 5CHVC 1S1QB 4TUUA 3N30A 4BBNF 3CSTA 4NPNA 1UF0A 2EKIA 3ML8A 1WXQA 2WXNA 3CWIA 3IFWB 4RM8A 1E5WA 2N9KA 2JXTA 3OJ4B 3BINA 4FXCA 3B2FA 1WXVA 3VUWA 3ZLZA 3MTNB 1RAXA 2IYDB 3FAHA 3L16A 3EUB2 1KTKA 3QCAA 1GPXA 1MG4A 3VTWA 1A70A 3M95A 2NMQA 2WGSA 4P1BC 2LUMA 4TQ0A 3L08A 4HJGE 1J7AA 3V05A 1GAQB 3K9OB 1I4HA 2WLBA 3DBLI 1M94A 3ZNHB 2WXIA 3AULA 1WGHA 1V80A 4EE2A 2RDBC 5DCNA 3KW5B 1ZKHA 2BW2A 4KDIC 2J0KA 4OVZA 4WJOA 3KQ4A 3N32A 2KJRA 1D6EC 2KTRB 1RWSA 5D7GA 2BT6A 3QHTA 4GXBA 3H7SA 1WYWB 1GOZA 4YTNB 3V62A 3V3XA 4WQOB 1FPYA 1NYQA 2PW9A 3WCQA 1SSNA 1VDVA 4TMAB 1MFWA 1Z2MA 2K25A 3WANA 2ZVNA 2NPTA 2LGYA 4IM3A 2OOBB 2WX1A 1HZ5A 1E8YA 1WGGA 3OWEB 4M01A 3VH3B 3QJZA 2WWZA 3PPAA 3WALA 1XQQA 4RCOA 3IXSA 2PVOD 4IKGA 2V4LA 3NRZA 4CHKA 4XWWA 4LNOA 1J8CA 1WI0A 2NBUA 2V3NA 4RF1A 1SE2A 3Q2AC 1WR6E 1OEYA 4DXGA 4ZRKA 1N60A 2FUHB 3ECIA 1JWAD 4S0RA 5DPTA 5AZGA 3DBHI 1LO5D 2J4XA 1T0QC 1P0RA 2MWSB 3N9YC 1JWBD 5BYSA 2ZNVC 1ZE3D 1ZDVA 2LUEA 4AOFA 2GI9A 3PSEB 4K3BA 2MCNB 1D5MC 3PREA 5AZFA 4DQOC 5CTRC 4EZJA 2KT7A 2WU5B 3VAWA 1TZOA 3L13A 3O13A 2C60A 2PTLA 2JYTA 3P4PB 2PE6B 2QIEB 5C1ZA 4KZCA 1PGXA 2TSSA 3BYYB 4HEA1 3VR9B 4B0EA 1FXAA 3DWMA 3N1ZC 1HZ6A 1OQYA 1T0YA 5E6NA 4PYUA 1X1MA 3W1SA 2DWQA 3DHGC 2HE7A 3RNGC 3X23A 4A55A 4M0WA 2MBEA 1NEKB 2G1EA 3ZXVA 1HTQA 3VTUA 4XX5A 2QHOA 2M56B 2IO1B 4MT5A 1LQBA 3C0RB 1VZ7A 2WXRA 4TV3A 3PTFC 2I2YA 3U7ZA 1Q10A 2QMTA 2WXLA 2KANA 1FFVA 1TS4A 1C79A 2HDEA 1JWMD 2Y5BB 1CQVA 4K3CA 2FBWB 3KYCD 4RGTA 2HJ1A 2VZKD 2V1YA 1QOFA 3AE9B 3AM9A 2WXHA 1RRBA 2BGFA 1NYRA 1UD7A 3E56A 2CJNA 2DAJA 1YN5A 2RSUA 2L3ZA 4JWSC 2DAFA 2MP2A 4TSSA 3Q69A 2INNE 4DXAB 3ZRCA 3HM6X 3T3NA 3ZTCA 2NS5A 2V3PA 1TS5A 2KZRA 3RNCC 1IYFA 2OHFA 2KXJA 1R4NB 4YWGG 2KFKB 1RYJA 4HCPB 1XEEA 5J2RA 4HROA 1FNVA 4IC7B 3RNFC 2WXKA 2L00B 1ZPSA 2LGXA 2HTME 4PYZA 4YL8A 4N6EB 4WAAA 4MDKE 1IP9A 3AI5A 1BUIC 4IG7B 2M0AA 4J3OD 2VH2A 5G5GA 4HWIB 3LDZE 3BK1A 3ALBA 4W9LA 2GOWA 2LHDA 4DHJD 1L4ZB 3B1LX 1SEBD 5AUIA 2KLGA 2UWQA 2N1WA 2Z0EB 3H9DA 2JT4B 4JPSA 1LFDA 2IGHA 3A9JA 3KUZA 1F77A 2HJ8A 1WXSA 2FCQA 2WDVB 1TKGA 3ZNZB 1EO6A 2WNMA 3T9LA 1EU3A 1U4AA 2WXFA 5JXVA 1IGDA 2IY1B 2KDIA 2UU7A 3AMZA 3ONSA 2BWES 1GC6A 5E6OA 4D2KA 2NBVB 5FR6A 1I42A 2XEWA 1V6EA 2SAKA 1CK1A 3RNEC 1BMLC 3ZJUA 2N0SB 4LNFA 3W5UB 3P1MA 3SFDB 3GB1A 3ZVVA 4IWQA 2FIFA 1SIJA 2MJDA 1D3ZA 2C7HA 3TMPB 1TIFA 2XN9C 4YSYB 4CO7A 3T3OA 2H89B 2AL6A 3AH7A 3L0WB 3Q8BA 3DBHB 1PUTA 2KAJA 1ENFA 2BYVE 3QWZB 3HM3A 4IWOA 4JL9A 1P9DU 3VXWA 1XLQA 4XC2A 2JWUA 3AE3B 3AXCA 2O6VA 2BKFA 1EM7A 4LNIA 2D3BA 4A3OA 3QC8B 1FCLA 2BKRB 3FILA 1YMHE 1V81A 3Q3NC 1YQ4B 3BK2A 1HEZE 3KUDB 4LCDE 2KC2A 2LMCA 3W5VB 1SIFA 3BIID 1V1OA 3RUIB 1T3QA 1ACCA 1FO4A 1YD8U 3PZ7A 4GIVA 3U7DA 2Y5PA 3RULA 3RYTA 1JWUD 1WWTA 3M3JA 2KQSA 1QKZA 1VLBA 1WM2A 1XXGA 1P3QU 4EOYA 2IGGA 4HPPA 1V49A 4WQMA 3MP9A 3LB8C 4BZAA 3I57A 3SU8X 1DYQA 3AE1B 2JVCA 2ZPNA 1STEA 2IO2B 1OEYJ 4BAXA 4A20A 1FNWA 3MHZA 1I7HA 2K8BA 1AWDA 1XCTL 5BO4B 4GMVA 2JF5A 4NQKE 2XBBC 5JH5C 3FILB 1BT0A 2QDFA 2DZKA 1E90A 2MW5A 4JX1C 1R4MI 2KWUB 4ZOHC 3HK0A 2MQJA 3AB5A 4KV2A 4EZLA 3MHSD 2GMIC 3DBLB 2M1MA 1GB4A 3M63B 1VR9A 3PZDA 1XLNA 3VTVA 3APCA 2BQQA 3C19A 4M02A 1AARA 2R2OA 4MM3A 4ZYNA 1EWYC 1JWSD 5TSSA 4L23A 4ACFA 3WIMA 2OJWA 4PS7A 3Q14C 1D5XC 2IJ0A 4XWTA 2BYFA 2JSVX 2AQ3B 4W9HA 4MELA 2E6XA 3VHTC 2FE8A 4AJYB 1E9MA 2CKHB 4DK5A 1SE9A 2FAZA 2KC1A 1L0VB 1N5XA 4G0NB 3L4PA 3BVMA 2D2QA 4WAFA 1JRPA 2L32A 5FKAC 2LWPA 4F1SA 2GBJA 3L10B 1JRUA 4K1RB 3Q8CA 2KMAA 1WE7A 3URYA 3TSSA 3NZ3A 1NVID 4KGRA 3UQAA 4MACA 1R7SA 2N7DA 2XK5B 3U8ZA 3KUCB 1YIWA 2HD5B 1R4NI 2J0MA 3OLMD 4WWPA 2B76B 4OHJA 2MJEA 3KWVA 4FJVB 4NY0A 1I4XA 2W9NA 1CJEA 3DQVA 2PMVA 2WP9B 4P7IA 3W1YA 3H7PB 3NS1A 3W9CB 2RPQA 1YN4A 2LZ6A 3N3KB 1Q1OA 2PPHA 3AECB 1B9RA 1J0GA 1N6ZA 5L83A 1EU4A 1WZ3A
chains in the Genus database with same CATH topology
2X8XX 4K3BA 4C4VB 4QAYA 3NJTA 2VH2A 4C4VA 2V9HA 4PK1A 3Q6BA 3EFCA 4XGAB 2QCZA 4C00A 3OG5A 2QDFA 3MC8A 4BZAA 2MHJA 2VH1A 3MC9A 4K3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X8X X;  4K3B A;  4C4V B;  4QAY A;  3NJT A;  2VH2 A;  4C4V A;  2V9H A;  4PK1 A;  3Q6B A;  3EFC A;  4XGA B;  2QCZ A;  4C00 A;  3OG5 A;  2QDF A;  3MC8 A;  4BZA A;  2MHJ A;  2VH1 A;  3MC9 A;  4K3C A; 
#chains in the Genus database with same CATH topology
 2KFK A;  4HCN B;  3FC4 A;  2GBM A;  3IAS 1;  4XYC A;  3UIO B;  1WRD B;  5BYQ A;  3TEY A;  1KLU D;  2Z8L A;  2LXC A;  4YTP B;  1I4R A;  1QF6 A;  1AW7 A;  3GE8 C;  2AEH A;  4ZHO A;  2KKC A;  4RH6 A;  4IW0 A;  2X8X X;  5EE0 A;  2CHZ A;  1C4C A;  2MEK A;  1P7E A;  4LLG M;  2LRW A;  1PFD A;  2AYO B;  2D07 B;  3UIN B;  4FLH A;  3IT6 B;  1WRI A;  2DZJ A;  2QCZ A;  1YQB A;  4C00 A;  3P2B A;  3KWL A;  1WJU A;  2ZW0 A;  3IG3 A;  1V86 A;  4KZ0 A;  4P16 A;  1PDX A;  1Y8R C;  2KWV B;  1DOY A;  4CYE A;  1C3T A;  3EC8 A;  4LNN A;  3TCA A;  4ARC A;  2DYM A;  3HIZ A;  1YN3 A;  1A5R A;  1FXT B;  1L0X B;  1PYW D;  3PHW B;  3GZN B;  4EKU A;  2AWT A;  3NUH B;  2OJR A;  1ZUD 2;  4GDK A;  1F9J A;  2WYQ A;  3QX1 A;  4W9D A;  3ZO5 B;  1KH0 A;  4GDK B;  1V1P A;  2DYB A;  4HLE A;  1C78 A;  2K22 A;  5E6P A;  1TKE A;  1CMX B;  1D4B A;  3Q3M C;  3GS2 A;  1ISN A;  3V61 A;  1T0R C;  2CJO A;  5CX3 A;  2BVC A;  3APF A;  2M17 A;  3V6E B;  4US8 A;  5JHB A;  1TJE A;  4MH8 A;  2DZI A;  3ZNG C;  2HTH A;  2MH7 A;  3TBL D;  5D6J B;  1YQ3 B;  1GNU A;  2ONQ A;  1JML A;  1YOV B;  5EDS A;  1WMH A;  2DNF A;  2ON8 A;  3FKY A;  1OTR B;  1SJE D;  4ARI A;  2LGS A;  1QQR A;  2L8J A;  1ZDX A;  4K7S A;  3NVY A;  4P6V F;  3PV1 A;  2K3U A;  2NBW B;  4JQW C;  3RPF C;  1VD2 A;  3NHE B;  4NAW B;  3UIP B;  1F2R C;  4HKZ E;  1V1P B;  1WZ0 A;  2K5P A;  2MX2 A;  2DEN B;  2LVQ A;  1E8W A;  1JCK B;  3ZJV A;  1WGY A;  4BBN C;  2N7E A;  4AUQ C;  2GBK A;  3QA8 A;  4MEM A;  1JW9 D;  2L83 A;  4XGA B;  3OG5 A;  4PT5 A;  3AU4 A;  3EFU A;  3R8B A;  2ZCB A;  1TGZ B;  2RMM A;  4HDO A;  3RNB C;  4DDG D;  1IBX B;  5G2N A;  2QC8 A;  4E3C A;  3NJT A;  5IO9 A;  3NVW A;  3I63 C;  2JZZ A;  2KFJ A;  2IPK D;  4PK1 A;  4X57 B;  4HDQ A;  4LJO B;  1MPE A;  2LI5 A;  4WWM A;  4DXF A;  2MHJ A;  3I3T B;  4ZRJ A;  3V60 A;  3ZGZ A;  4XDC A;  2QIL A;  4NQL B;  3OJ3 A;  4MSQ B;  3CSF A;  2MP2 B;  4ZRP A;  2KWD A;  1IUE A;  4MM3 B;  2FCN A;  4ANU A;  1YJJ A;  3AEF B;  2O2V B;  2MJ3 A;  2AL3 A;  4YTM B;  2KJ6 A;  3HVZ A;  3E9S A;  2O2V A;  2Z59 B;  4KKI A;  2JX5 A;  4LNK A;  2IO0 B;  5EE1 A;  4B95 A;  1F1H A;  4E71 A;  4BKG A;  2BB5 A;  4HVB A;  1YJ1 A;  1RFA A;  2I1K A;  4HPL B;  3ZTD A;  1JAL A;  2IDY A;  3U30 A;  3VDZ A;  5KHQ A;  3BVG A;  3DWG C;  3T8M A;  4RGM A;  3A1Q B;  4BOS C;  5CHW A;  1N61 A;  5I4D A;  5D3D A;  4F7Z A;  2K6D B;  2KQ4 X;  4C80 A;  2JZP A;  3VRA B;  2KAC A;  1UGJ A;  3GOE A;  2N7J A;  2ZVO A;  3O65 B;  2INP E;  2UYZ B;  1KM7 A;  3EGR A;  3J9C A;  1E6E B;  3APD A;  2BBC A;  1AYF A;  3SD5 A;  3W2D A;  5DPR A;  2BYT A;  4KKJ A;  1WIA A;  2CHW A;  2MA9 B;  1H8C A;  2GBR A;  3ABV B;  3PT2 B;  1TY0 A;  1C4P A;  2KDE B;  4IM2 A;  1N63 A;  1RM6 C;  3BYT B;  1P7F A;  1YX5 B;  2KLC A;  1GJZ A;  4DBG A;  2ZPY A;  3U52 E;  3MJW A;  3DBS A;  2IY0 B;  4PS8 A;  1F52 A;  3DVN U;  4GGQ A;  3GP7 A;  2L0T A;  4W9C A;  4GDL B;  5CHF A;  4GB9 A;  2LD9 A;  4BFR A;  3SR6 A;  1GG3 A;  1WYG A;  2WXJ A;  4GN1 A;  3RI7 C;  1VZ6 A;  2DYO A;  2WXO A;  3AE4 B;  2MRP A;  2V3S A;  5G5H A;  5D94 A;  2NR2 A;  2RGF A;  1C9F A;  1V97 A;  2JYE A;  4WWN A;  4F8C B;  2I1J A;  3PRM B;  2BF8 B;  4JGH B;  4MH0 E;  3PGE A;  2KVR A;  3B0A A;  1GB1 A;  4HKQ A;  2K8H A;  1KF6 B;  2LXA A;  3A4S C;  2JQR B;  3R2I A;  5C23 A;  3ZJT A;  4MGZ E;  4KVG B;  2CR5 A;  1UBI A;  3L54 A;  3PZ8 A;  4O1N A;  3S2A A;  1ESF A;  4KSK C;  3P4R B;  2PE9 A;  1GUA B;  4BVU C;  1F0Z A;  2VZK B;  3GE3 C;  3RN9 C;  2FUG 1;  1J7B A;  2VRR B;  2WXP A;  2WDQ B;  2N9X A;  2WS3 B;  1WGR A;  4ZYS A;  1HA5 A;  3WAP A;  3ZQ4 A;  1V5T A;  1WJN A;  1XF5 L;  2PIA A;  3TUO A;  1EWC A;  1DOI A;  2KOX A;  1P1A A;  2MLB A;  1SE3 A;  1UUP A;  2D3C A;  2D3G A;  4ZRQ A;  5GXG B;  2J52 A;  1SJH D;  3N1X C;  2BS4 B;  3NG0 A;  2RD0 A;  3PRZ A;  4J6I A;  4ZDV A;  1UWM A;  1WX8 A;  4BKS A;  1E7V A;  2KQ7 A;  1ZOY B;  1SB3 C;  2GBN A;  1FD6 A;  3H6N A;  2L1A A;  1KOT A;  2IO3 B;  3DHI C;  2K6Q A;  3WAM A;  5IAA C;  2Z0D B;  5E6J A;  1WSP A;  1MJD A;  3N20 C;  1L5P A;  1N62 A;  2WU2 B;  4AQ7 A;  3BVZ A;  3ZDT A;  3BY4 B;  1KFY B;  1PGA A;  2B3A A;  1E7U A;  3SFE B;  5T8I A;  3ZDM C;  3ETR A;  3MC9 A;  2DHZ A;  1Q5W B;  5IN7 A;  4A8X C;  1XD3 B;  4ICV A;  5LNK 1;  2WQY B;  1WJ4 A;  3IAM 1;  3Q3F A;  2M8S A;  3AN1 A;  2GB1 A;  4AJW A;  1QT9 A;  3A33 B;  2KHW B;  1XLP A;  4WJQ A;  2W82 A;  1FRD A;  3ZW3 A;  2LGI A;  2M0X A;  3SEB A;  3BWU D;  4G3X B;  5H8Y E;  3B9J A;  1UH6 A;  4ANX A;  3NVV A;  4LDT D;  3VFK A;  3IVF A;  1ZXI A;  4M8M A;  4AWJ A;  4B9K A;  5FR3 A;  3PLU A;  5H92 C;  2REX A;  4B6W A;  4DWF A;  2D11 A;  3ZRF A;  2WDT B;  2JZ3 B;  1TT5 B;  1OFF A;  4W9I A;  3R2T A;  4MGK E;  2J0J A;  1WJ6 A;  4C7Y A;  1L7Y A;  3AU5 A;  4MJS A;  4RGO S;  5JHA A;  2FCS A;  1E0Z A;  2JU6 X;  4BOZ B;  3OAW A;  3NOB A;  2KMM A;  2SEB D;  2W3R A;  3HVD A;  2JRH A;  3M62 B;  4RGN A;  1TS2 A;  2ACZ B;  1H4R A;  1V2Y A;  4ITK A;  2KNB A;  3QAR A;  3JSV A;  3GZN I;  3KVF B;  2EMS A;  3JSV B;  2LJ5 A;  2C5L C;  2K39 A;  1T5X D;  2KTR A;  4K7U A;  1QLB B;  3JW0 X;  2RPV A;  1V9J A;  2JRI B;  2XNA C;  1UZX B;  4GLS C;  1FNU A;  2ZZP B;  4OZB A;  5DPS A;  3PO0 A;  4ICU A;  2KVZ A;  4XDD A;  1HTO A;  5AEK B;  2O6V B;  3R3M A;  2A5U A;  4KGS A;  4II2 B;  4M8N A;  4N58 A;  2LAS A;  2M4N A;  2KDM A;  1I4Q A;  3CMM B;  2AX5 A;  1C77 A;  1KLG D;  2LJI A;  4NJ7 A;  3DHH C;  3I5J C;  4IM0 A;  4KIK B;  5JZE B;  4LDT B;  2YEP B;  1ET6 A;  4C56 C;  1KLV A;  1FXI A;  1QOA A;  3U2S C;  1B1Z A;  3VRB B;  2PJH A;  1Y56 A;  4NAW A;  1V8C A;  2K9X A;  1R4M B;  3RT3 B;  2ASQ A;  2BS2 B;  2NTS A;  2W3S A;  1L0Y B;  1DGJ A;  1QOB A;  4GU2 A;  4I6L B;  3VQI A;  3UQB A;  2R61 A;  5EE3 A;  5BMI A;  1MHX A;  2BS3 B;  2BWF A;  4IOI E;  4WUR A;  5HG2 A;  1ROE A;  2KN5 A;  4US9 A;  3W1S C;  2MBQ A;  4MGY E;  4C4V A;  1PQS A;  4NAM A;  2JY6 A;  1FFU A;  4OZA A;  2N9L A;  3X0W A;  4JE3 B;  3Q3O C;  3R7Q A;  4NZL B;  5BMG A;  2KN4 A;  4URK A;  4KIK A;  5BMH A;  1NEN B;  3CIR B;  2K1F A;  3Q8E A;  4DHZ B;  3AED B;  3JYU A;  3HHM A;  4WH4 A;  3N1Y C;  2L76 A;  2PLP A;  1WXA A;  2G45 B;  4LTU A;  2W54 A;  3A9K A;  1PGB A;  2L7R A;  2KK8 A;  4NJC A;  2EMT A;  4OVU A;  2JUO A;  1VZ8 A;  3MJ5 A;  3ZYY X;  5HI1 A;  3WA0 A;  5C2T B;  2W55 A;  2CHX A;  4OVV A;  1XO3 A;  5IA7 A;  4CQN A;  3VUY A;  3EEC A;  3ZXR A;  2LFI A;  3KLS X;  3IT4 B;  1OQR A;  3QAQ A;  4L2Y A;  3SDL C;  3EA6 A;  5L95 C;  2QEJ C;  3Q6B A;  2KDF B;  2LEK A;  1L6V A;  1XCQ L;  3VVW B;  1SE4 A;  4JIO U;  4EUT A;  3AE6 B;  1LGR A;  4KSL C;  3TEZ A;  3B08 A;  2QSD A;  4UDU C;  3TEX A;  2YVC A;  3H1U A;  4H2A A;  4NNJ B;  3Q3J A;  3DBR B;  4G50 A;  4HRS A;  2WDR B;  4W9K A;  1MG8 A;  1WX7 A;  3VUX A;  3R66 C;  1FM0 D;  2LRU A;  1YX6 B;  4II3 B;  4YSX B;  1OQQ A;  3H7P A;  1K50 A;  2PVG C;  2CU1 A;  4DDI D;  3TEW A;  3D32 A;  3MFG A;  4NJ6 A;  1Q0W B;  4N59 A;  2I38 A;  4FHK A;  1FIQ A;  1DOX A;  4G11 A;  1UBQ A;  4HK2 A;  1FCC C;  4A6Q A;  1OGW A;  1ET9 A;  3QQ8 B;  3NZS A;  4B0M A;  2N1V A;  2DLB A;  2DX5 B;  1VCB A;  4MSM B;  2Y3A A;  1Z5S B;  3UF8 A;  4Q2J A;  2CS4 A;  2JPH A;  2DZM A;  4KGT A;  1WE6 A;  3DBR I;  2KX3 A;  3ML9 A;  4FUL A;  3ZIM A;  1CZP A;  1ZXH A;  5D3I B;  2LGD A;  4XE0 A;  4GOC A;  3TJP A;  3PRP B;  2FNJ B;  4FJZ A;  2PKO A;  1SXT A;  2FCM A;  2KX0 A;  2WHI A;  3AV8 A;  1XLO A;  5IKC M;  1K51 A;  3DCG A;  3L17 A;  2RDH A;  1I4G A;  1FRR A;  5G55 A;  2R2Q A;  3AE8 B;  2BPS A;  4WJN A;  4HXD A;  4IDI A;  4R3D A;  3TIX A;  5AZH A;  3CF6 E;  4E74 A;  5J17 A;  4WIP A;  4EEW A;  4W9G A;  2KDB A;  4A9A A;  1I4P A;  2KO3 A;  1XT9 B;  2J42 A;  5AUK A;  5C3J B;  4XZ4 A;  4YSZ B;  1KRH A;  3Q8A A;  2N9P C;  5GMV A;  4WJP A;  3H8H A;  3VH4 B;  2MBO A;  3AE5 B;  4I6N B;  2RR9 A;  4IWP A;  3V6C B;  1HE8 A;  1T6B X;  3HRD D;  4S17 A;  3UI3 A;  4ZHP A;  4FA6 A;  1HQR D;  2X38 A;  2L05 A;  2A4Z A;  1E7P B;  3RZW C;  4AS1 A;  3I9V 1;  1WF9 A;  3TL5 A;  1UEL A;  4BKS D;  3PS6 A;  1WM3 A;  4REZ A;  1VRA B;  1NBF C;  2D5G A;  1TTN A;  2WXQ A;  2AQ2 B;  1C1Y B;  2QJL A;  2M19 A;  3LYY A;  3PHX B;  3NY5 A;  4RM9 A;  4W9F A;  5EE9 A;  3ZKJ C;  1NI3 A;  2V0G A;  1G6J A;  1L6U A;  2IBI B;  1ZGU B;  2IGD A;  1QZE A;  4AP4 C;  3K9P B;  2BYE A;  2K8C A;  2ZJD A;  3B2G A;  2E3T A;  1EF5 A;  2KTF A;  2MSE D;  1T0S C;  4RFB A;  4HPM B;  4MGI E;  4FBJ B;  4ANW A;  3KH0 A;  2KWC A;  1WXM A;  5BYR A;  4YXD B;  4JWU C;  2GRI A;  3EHV A;  1FEH A;  1SGH A;  3HUI A;  4WWO A;  4C4V B;  4RMA A;  2V9H A;  4DHJ B;  5HKH A;  1EUV B;  2LVO A;  5LLI A;  4EFO A;  2KD0 A;  1N5W A;  1WH3 A;  1WMH B;  1E10 A;  2CU3 A;  1TBE A;  4LJP B;  2NCN A;  2KJH B;  4YT0 B;  3U4E G;  5MPO A;  4W9J A;  1YJI A;  3A9K B;  1RFK A;  1NI2 A;  1AN8 A;  3JVZ X;  4MJS B;  2RDG A;  3IBE A;  4ZRI A;  3DVN V;  3DPD A;  2YLM A;  2WXM A;  2NTT A;  3Q8F A;  2D3A A;  5J18 A;  1WGK A;  2INC C;  1D5Z C;  2LVP A;  3AEG B;  2J53 A;  1K53 A;  2EKE C;  2Y5C A;  3EFC A;  1P98 A;  2N9E B;  3MC0 B;  2K0P A;  1EF1 A;  2G4S A;  2XK5 A;  3ENE A;  3MC8 A;  4IUM B;  2BTE A;  2ZW1 A;  3A1Q A;  3AEB B;  1ZP0 B;  3P42 A;  3QIJ A;  2D10 A;  4HJK A;  2PEA A;  4FAD A;  1JRO A;  1E8X A;  2IZV B;  3UGB B;  4M00 A;  2NPT B;  1GC7 A;  3A4R A;  1C4A A;  1WR1 A;  3RMK C;  3IHP C;  1WY8 A;  2J7Q B;  3SHQ A;  3BZD B;  1E8Z A;  4TKN A;  2BB6 A;  1C76 A;  2G3Q B;  4TQ1 A;  1SBB B;  5KHO A;  2H88 B;  2WX0 A;  5D2M B;  2JWZ A;  1QIL A;  1S3S G;  2MBH A;  5LXI B;  1WX9 A;  4LK0 M;  1HXY D;  3ZUN A;  2ZEQ A;  1KJT A;  2ZCC A;  4FJY A;  5DPW A;  2KMC A;  4K81 A;  5FK9 C;  2MBB B;  2N4F A;  3AE2 B;  3RFZ B;  3QK0 A;  1I35 A;  3C8Y A;  3AEA B;  3A9J B;  3R7R A;  2C7M B;  2ICI A;  3PVL A;  5IOI A;  4EZK A;  2JXX A;  2OED A;  1QOG A;  5IP4 D;  3DDC B;  2WXG A;  4L1B A;  1J19 A;  4GSW A;  2DBY A;  3P63 A;  1J7C A;  1L2N A;  1UWX A;  3AE7 B;  3DOW A;  1ZW7 A;  2C9W B;  3LJ3 A;  4M0W B;  3WAO A;  4OZC A;  1NDD A;  1YNT E;  4PS3 A;  3RNA C;  4P1C C;  4A3P A;  4QAY A;  3NVZ A;  4ASW C;  3P4Q B;  3ZNI D;  3LXF A;  1WGD A;  4OW0 A;  1BXT A;  4GDL A;  4ANV A;  1RLF A;  3AEE B;  3DVG X;  2G4D B;  2EEL A;  4FHJ A;  2VH1 A;  4W9E A;  1VJK A;  1WFY A;  3P4S B;  4KDL B;  1UGM A;  1L4D B;  4JLC A;  3PLV A;  4C7Z A;  1K8R B;  2O6V D;  2GLS A;  4KX6 B;  1JQ4 A;  5HFY A;  4USA A;  3RD2 A;  1TZ1 A;  3NS8 A;  1LXD A;  2IND C;  4FN2 A;  1TYG B;  2V4I B;  3RZF A;  2AQ1 B;  4BKT A;  3VR8 B;  4N9F 4;  4RNA A;  4K7W A;  1IGC A;  1LM8 B;  3RCZ A;  1V5O A;  2LHE A;  1TS3 A;  4DHZ E;  3NZU A;  5TR5 A;  2YEP F;  2L0F A;  1MI0 A;  2NVU I;  2ZNV B;  2FID A;  5LXH A;  3DVG Y;  1TKY A;  2G9H D;  1IPG A;  4A90 A;  1SF0 A;  4RF0 A;  4I6P A;  1UNS A;  2C7N B;  2KYW A;  5HHD G;  1MVK A;  1F2R I;  3KYD D;  1TY2 A;  1IBX A;  1MHH E;  1FMA D;  2Q5W D;  2L52 A;  1K52 A;  1M4V A;  5CHV C;  1S1Q B;  4TUU A;  3N30 A;  4BBN F;  3CST A;  4NPN A;  1UF0 A;  2EKI A;  3ML8 A;  1WXQ A;  2WXN A;  3CWI A;  3IFW B;  4RM8 A;  1E5W A;  2N9K A;  2JXT A;  3OJ4 B;  3BIN A;  4FXC A;  3B2F A;  1WXV A;  3VUW A;  3ZLZ A;  3MTN B;  1RAX A;  2IYD B;  3FAH A;  3L16 A;  3EUB 2;  1KTK A;  3QCA A;  1GPX A;  1MG4 A;  3VTW A;  1A70 A;  3M95 A;  2NMQ A;  2WGS A;  4P1B C;  2LUM A;  4TQ0 A;  3L08 A;  4HJG E;  1J7A A;  3V05 A;  1GAQ B;  3K9O B;  1I4H A;  2WLB A;  3DBL I;  1M94 A;  3ZNH B;  2WXI A;  3AUL A;  1WGH A;  1V80 A;  4EE2 A;  2RDB C;  5DCN A;  3KW5 B;  1ZKH A;  2BW2 A;  4KDI C;  2J0K A;  4OVZ A;  4WJO A;  3KQ4 A;  3N32 A;  2KJR A;  1D6E C;  2KTR B;  1RWS A;  5D7G A;  2BT6 A;  3QHT A;  4GXB A;  3H7S A;  1WYW B;  1GOZ A;  4YTN B;  3V62 A;  3V3X A;  4WQO B;  1FPY A;  1NYQ A;  2PW9 A;  3WCQ A;  1SSN A;  1VDV A;  4TMA B;  1MFW A;  1Z2M A;  2K25 A;  3WAN A;  2ZVN A;  2NPT A;  2LGY A;  4IM3 A;  2OOB B;  2WX1 A;  1HZ5 A;  1E8Y A;  1WGG A;  3OWE B;  4M01 A;  3VH3 B;  3QJZ A;  2WWZ A;  3PPA A;  3WAL A;  1XQQ A;  4RCO A;  3IXS A;  2PVO D;  4IKG A;  2V4L A;  3NRZ A;  4CHK A;  4XWW A;  4LNO A;  1J8C A;  1WI0 A;  2NBU A;  2V3N A;  4RF1 A;  1SE2 A;  3Q2A C;  1WR6 E;  1OEY A;  4DXG A;  4ZRK A;  1N60 A;  2FUH B;  3ECI A;  1JWA D;  4S0R A;  5DPT A;  5AZG A;  3DBH I;  1LO5 D;  2J4X A;  1T0Q C;  1P0R A;  2MWS B;  3N9Y C;  1JWB D;  5BYS A;  2ZNV C;  1ZE3 D;  1ZDV A;  2LUE A;  4AOF A;  2GI9 A;  3PSE B;  4K3B A;  2MCN B;  1D5M C;  3PRE A;  5AZF A;  4DQO C;  5CTR C;  4EZJ A;  2KT7 A;  2WU5 B;  3VAW A;  1TZO A;  3L13 A;  3O13 A;  2C60 A;  2PTL A;  2JYT A;  3P4P B;  2PE6 B;  2QIE B;  5C1Z A;  4KZC A;  1PGX A;  2TSS A;  3BYY B;  4HEA 1;  3VR9 B;  4B0E A;  1FXA A;  3DWM A;  3N1Z C;  1HZ6 A;  1OQY A;  1T0Y A;  5E6N A;  4PYU A;  1X1M A;  3W1S A;  2DWQ A;  3DHG C;  2HE7 A;  3RNG C;  3X23 A;  4A55 A;  4M0W A;  2MBE A;  1NEK B;  2G1E A;  3ZXV A;  1HTQ A;  3VTU A;  4XX5 A;  2QHO A;  2M56 B;  2IO1 B;  4MT5 A;  1LQB A;  3C0R B;  1VZ7 A;  2WXR A;  4TV3 A;  3PTF C;  2I2Y A;  3U7Z A;  1Q10 A;  2QMT A;  2WXL A;  2KAN A;  1FFV A;  1TS4 A;  1C79 A;  2HDE A;  1JWM D;  2Y5B B;  1CQV A;  4K3C A;  2FBW B;  3KYC D;  4RGT A;  2HJ1 A;  2VZK D;  2V1Y A;  1QOF A;  3AE9 B;  3AM9 A;  2WXH A;  1RRB A;  2BGF A;  1NYR A;  1UD7 A;  3E56 A;  2CJN A;  2DAJ A;  1YN5 A;  2RSU A;  2L3Z A;  4JWS C;  2DAF A;  2MP2 A;  4TSS A;  3Q69 A;  2INN E;  4DXA B;  3ZRC A;  3HM6 X;  3T3N A;  3ZTC A;  2NS5 A;  2V3P A;  1TS5 A;  2KZR A;  3RNC C;  1IYF A;  2OHF A;  2KXJ A;  1R4N B;  4YWG G;  2KFK B;  1RYJ A;  4HCP B;  1XEE A;  5J2R A;  4HRO A;  1FNV A;  4IC7 B;  3RNF C;  2WXK A;  2L00 B;  1ZPS A;  2LGX A;  2HTM E;  4PYZ A;  4YL8 A;  4N6E B;  4WAA A;  4MDK E;  1IP9 A;  3AI5 A;  1BUI C;  4IG7 B;  2M0A A;  4J3O D;  2VH2 A;  5G5G A;  4HWI B;  3LDZ E;  3BK1 A;  3ALB A;  4W9L A;  2GOW A;  2LHD A;  4DHJ D;  1L4Z B;  3B1L X;  1SEB D;  5AUI A;  2KLG A;  2UWQ A;  2N1W A;  2Z0E B;  3H9D A;  2JT4 B;  4JPS A;  1LFD A;  2IGH A;  3A9J A;  3KUZ A;  1F77 A;  2HJ8 A;  1WXS A;  2FCQ A;  2WDV B;  1TKG A;  3ZNZ B;  1EO6 A;  2WNM A;  3T9L A;  1EU3 A;  1U4A A;  2WXF A;  5JXV A;  1IGD A;  2IY1 B;  2KDI A;  2UU7 A;  3AMZ A;  3ONS A;  2BWE S;  1GC6 A;  5E6O A;  4D2K A;  2NBV B;  5FR6 A;  1I42 A;  2XEW A;  1V6E A;  2SAK A;  1CK1 A;  3RNE C;  1BML C;  3ZJU A;  2N0S B;  4LNF A;  3W5U B;  3P1M A;  3SFD B;  3GB1 A;  3ZVV A;  4IWQ A;  2FIF A;  1SIJ A;  2MJD A;  1D3Z A;  2C7H A;  3TMP B;  1TIF A;  2XN9 C;  4YSY B;  4CO7 A;  3T3O A;  2H89 B;  2AL6 A;  3AH7 A;  3L0W B;  3Q8B A;  3DBH B;  1PUT A;  2KAJ A;  1ENF A;  2BYV E;  3QWZ B;  3HM3 A;  4IWO A;  4JL9 A;  1P9D U;  3VXW A;  1XLQ A;  4XC2 A;  2JWU A;  3AE3 B;  3AXC A;  2O6V A;  2BKF A;  1EM7 A;  4LNI A;  2D3B A;  4A3O A;  3QC8 B;  1FCL A;  2BKR B;  3FIL A;  1YMH E;  1V81 A;  3Q3N C;  1YQ4 B;  3BK2 A;  1HEZ E;  3KUD B;  4LCD E;  2KC2 A;  2LMC A;  3W5V B;  1SIF A;  3BII D;  1V1O A;  3RUI B;  1T3Q A;  1ACC A;  1FO4 A;  1YD8 U;  3PZ7 A;  4GIV A;  3U7D A;  2Y5P A;  3RUL A;  3RYT A;  1JWU D;  1WWT A;  3M3J A;  2KQS A;  1QKZ A;  1VLB A;  1WM2 A;  1XXG A;  1P3Q U;  4EOY A;  2IGG A;  4HPP A;  1V49 A;  4WQM A;  3MP9 A;  3LB8 C;  4BZA A;  3I57 A;  3SU8 X;  1DYQ A;  3AE1 B;  2JVC A;  2ZPN A;  1STE A;  2IO2 B;  1OEY J;  4BAX A;  4A20 A;  1FNW A;  3MHZ A;  1I7H A;  2K8B A;  1AWD A;  1XCT L;  5BO4 B;  4GMV A;  2JF5 A;  4NQK E;  2XBB C;  5JH5 C;  3FIL B;  1BT0 A;  2QDF A;  2DZK A;  1E90 A;  2MW5 A;  4JX1 C;  1R4M I;  2KWU B;  4ZOH C;  3HK0 A;  2MQJ A;  3AB5 A;  4KV2 A;  4EZL A;  3MHS D;  2GMI C;  3DBL B;  2M1M A;  1GB4 A;  3M63 B;  1VR9 A;  3PZD A;  1XLN A;  3VTV A;  3APC A;  2BQQ A;  3C19 A;  4M02 A;  1AAR A;  2R2O A;  4MM3 A;  4ZYN A;  1EWY C;  1JWS D;  5TSS A;  4L23 A;  4ACF A;  3WIM A;  2OJW A;  4PS7 A;  3Q14 C;  1D5X C;  2IJ0 A;  4XWT A;  2BYF A;  2JSV X;  2AQ3 B;  4W9H A;  4MEL A;  2E6X A;  3VHT C;  2FE8 A;  4AJY B;  1E9M A;  2CKH B;  4DK5 A;  1SE9 A;  2FAZ A;  2KC1 A;  1L0V B;  1N5X A;  4G0N B;  3L4P A;  3BVM A;  2D2Q A;  4WAF A;  1JRP A;  2L32 A;  5FKA C;  2LWP A;  4F1S A;  2GBJ A;  3L10 B;  1JRU A;  4K1R B;  3Q8C A;  2KMA A;  1WE7 A;  3URY A;  3TSS A;  3NZ3 A;  1NVI D;  4KGR A;  3UQA A;  4MAC A;  1R7S A;  2N7D A;  2XK5 B;  3U8Z A;  3KUC B;  1YIW A;  2HD5 B;  1R4N I;  2J0M A;  3OLM D;  4WWP A;  2B76 B;  4OHJ A;  2MJE A;  3KWV A;  4FJV B;  4NY0 A;  1I4X A;  2W9N A;  1CJE A;  3DQV A;  2PMV A;  2WP9 B;  4P7I A;  3W1Y A;  3H7P B;  3NS1 A;  3W9C B;  2RPQ A;  1YN4 A;  2LZ6 A;  3N3K B;  1Q1O A;  2PPH A;  3AEC B;  1B9R A;  1J0G A;  1N6Z A;  5L83 A;  1EU4 A;  1WZ3 A; 
#chains in the Genus database with same CATH homology
 2X8X X;  4K3B A;  4C4V B;  4QAY A;  3NJT A;  2VH2 A;  4C4V A;  2V9H A;  4PK1 A;  3Q6B A;  3EFC A;  4XGA B;  2QCZ A;  4C00 A;  3OG5 A;  2QDF A;  3MC8 A;  4BZA A;  2MHJ A;  2VH1 A;  3MC9 A;  4K3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...