3Q6BA

The high-resolution and new form crystal structure of bama potra4-5 from e.coli
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
YKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein assembly complex, YaeT protein
publication title High-resolution structure of a new crystal form of BamA POTRA4-5 from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 50
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2010-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3q6bA01
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3q6bA02
2X8XX 4C4VA 2QDFA 2VH1A 4C00A 2QCZA 4K3BA 4QAYA 4PK1A 3MC9A 2MHJA 4BZAA 3MC8A 2VH2A 3Q6BA 3OG5A 2V9HA 3EFCA 4K3CA 4XGAB 3NJTA 4C4VB
chains in the Genus database with same CATH superfamily
3W2DA 3T3NA 4FADA 2WDQB 2RMMA 3QQ8B 1NEKB 1FPYA 1VZ7A 2JVCA 2JZ3B 2KDEB 2FIDA 4DHJB 4F7ZA 4OVVA 3TUOA 4F8CB 2KOXA 3I3TB 3ZNGC 1BT0A 3HVDA 2NVUI 4BBNC 2KWVB 4HVBA 1C77A 2JXTA 4MGYE 2JX5A 1WX7A 2L00B 2KMMA 2ZCCA 1XO3A 1IUEA 1VCBA 4A90A 3A1QB 1YMHE 1FM0D 1KTKA 3ENEA 2NPTB 3Q8EA 3Q3NC 1IBXA 2YLMA 2KJ6A 3RYTA 5AZGA 3NG0A 2RDHA 4TKNA 2FCNA 4MELA 2MBOA 2MBEA 2KD0A 3PLVA 5HFYA 3RPFC 2RGFA 1SJED 2KJRA 2DLBA 3PZ7A 2G3QB 4NJ6A 1JRPA 2MP2A 1EU4A 4WURA 1LQBA 4LJPB 1QOGA 4LNOA 3GE8C 2KVZA 3P2BA 2SEBD 4R3DA 4BKGA 4FN2A 1XLQA 4EZLA 2LD9A 3IG3A 4MJSB 1WJ4A 4II2B 3V60A 2B76B 1E5WA 4HPLB 4NAMA 4E74A 2OHFA 3C8YA 3PVLA 1QZEA 3I57A 1SEBD 4EUTA 2K39A 1EF5A 1A5RA 3M3JA 3ZXRA 2IO3B 1EU3A 4N58A 1TT5B 2PPHA 4L1BA 4MH0E 1I4RA 2MWSB 1L4DB 4ANVA 4RM8A 1GB1A 2ZZPB 3I5JC 2C9WB 3MHZA 4EOYA 1JRUA 4DBGA 4K7UA 1IPGA 4BAXA 3B9JA 4GN1A 2IY1B 4YTPB 1FEHA 3N30A 4IC7B 3BWUD 5BYQA 3VQIA 5D3IB 2WX0A 3CF6E 5JH5C 3LB8C 4C4VA 2KDBA 3E9SA 5BMGA 2CHXA 1KM7A 2PE6B 4C80A 1SSNA 2L7RA 1KLVA 4JWSC 2H89B 2J0JA 3QWZB 4B0EA 4JGHB 2WLBA 3DVGY 5MPOA 4HEA1 1V97A 4LNFA 4BOZB 4KIKB 1Z5SB 1NENB 1K53A 4BVUC 3NVYA 1E0ZA 1H8CA 3L17A 3HHMA 2MA9B 3AE4B 4GB9A 3DBLB 2QHOA 2JT4B 2BB5A 2MQJA 3CSFA 4M8NA 2GMIC 4OHJA 2IO1B 4WIPA 3DHHC 4CYEA 1MVKA 4OZBA 4RM9A 3TBLD 5G2NA 4P1CC 1PDXA 4M8MA 5CHVC 1V2YA 1QOBA 1UWMA 3RI7C 2QILA 2AL6A 3WANA 2WX1A 5LXIB 1YX6B 3WALA 5EDSA 4RCOA 4GMVA 1FIQA 2LRUA 3RNEC 3GS2A 1YQ4B 2W3SA 4JIOU 2FE8A 1Z2MA 3V6EB 3PT2B 2A4ZA 4FJVB 1P7EA 4A8XC 2I38A 4FA6A 2DAJA 4IKGA 1WJUA 1T5XD 2WP9B 2A5UA 1V1PA 2QEJC 4FHJA 4HPMB 2HD5B 1CJEA 4OZCA 1ZGUB 1KH0A 5BMIA 1KFYB 4ICVA 2WXNA 1V86A 3Q3MC 4US8A 4B6WA 2LHDA 2NTSA 3L16A 4OVZA 3IAM1 3RT3B 4G50A 5C3JB 4ZYSA 4G3XB 1D5MC 2J53A 3VTWA 1L5PA 4JX1C 2O6VB 3VFKA 3X23A 3CMMB 4ZRKA 1SGHA 2KFKB 3VRAB 4MH8A 3APDA 2ZCBA 3PHWB 2SAKA 2MSED 3ABVB 3DQVA 3IT4B 2M56B 4HDQA 3RN9C 2K8HA 2G1EA 1LO5D 4A3OA 4DWFA 4REZA 3EC8A 2GBKA 1WGDA 3NJTA 4AJWA 1SE2A 3ZO5B 3NVZA 1N63A 4C00A 2BYFA 4PK1A 1P7FA 3EA6A 3NS8A 2BWES 4DHZB 2WXRA 3BK1A 3MC8A 3N1YC 2MCNB 2LJ5A 3O13A 3VH4B 4WQMA 4CQNA 5JHBA 5EE3A 1KOTA 1FNWA 3PREA 4HCNB 2D3BA 1SIJA 2GB1A 1DOYA 1NDDA 3U8ZA 4FBJB 2L3ZA 2KQ7A 1JWUD 2BYVE 3B0AA 1SE9A 1RLFA 4BFRA 3EFUA 2LFIA 3DBSA 1K8RB 3DVNV 1S1QB 4HDOA 2Y5BB 3T3OA 3ML9A 2N9XA 4KKJA 2MJDA 3JSVA 3P4PB 4WWNA 1MHHE 3BK2A 3P4QB 2KJHB 2N9PC 2MBBB 3LXFA 4DXAB 4RNAA 2G4DB 3KWLA 1WH3A 2BWFA 3HM6X 1KF6B 2L0TA 4BKSA 1YOVB 3BIID 3V6CB 4MGKE 2ZW0A 4LNNA 2RR9A 1GOZA 2W55A 5G5GA 1TY2A 3AXCA 1WXQA 3S2AA 1FO4A 2DAFA 2L05A 4HRSA 3A4RA 1I4XA 1C4AA 1TKGA 2J4XA 5D3DA 1HEZE 2FAZA 4B9KA 1GC7A 2PTLA 3U2SC 4BKSD 4GSWA 3PV1A 3U7ZA 3NHEB 3SFEB 2NS5A 4XWTA 3ONSA 3DWMA 4GDKA 3MC0B 2XBBC 2J42A 4A55A 1IGDA 1WIAA 2L8JA 3K9OB 1V8CA 2IGHA 2D5GA 2BF8B 1C4PA 3RNGC 3ZKJC 1R7SA 2DYBA 3SHQA 2KO3A 1WWTA 1MFWA 1ZP0B 3PSEB 4ZDVA 3AE3B 2KLCA 4EZKA 4C7YA 1IBXB 2PLPA 3FC4A 1C4CA 1U4AA 4AP4C 1XQQA 2FNJB 4RH6A 1QOAA 4ZYNA 5FR3A 1SXTA 3Q3FA 3QC8B 1TKYA 2H88B 2O2VB 1C76A 2INPE 1C3TA 2V1YA 1R4MB 4FHKA 1T6BX 3DCGA 3KLSX 1J8CA 3FILA 3MHSD 1SB3C 2KX0A 5D6JB 1WZ3A 2HE7A 2RDBC 4EZJA 3DBRB 1HXYD 2FIFA 4WJOA 2MJEA 4AUQC 2C7MB 1T0YA 1HQRD 2REXA 3DWGC 2AYOB 3L10B 4NQLB 2V3SA 4K1RB 4ACFA 2JYEA 4XGAB 1OEYJ 4WAAA 4RF0A 3VTVA 2LVQA 3VAWA 4DK5A 3QIJA 1JWSD 1WRIA 2JXXA 2K6DB 2LUMA 4KSLC 3MC9A 3PRPB 2DWQA 4YTNB 2V0GA 2LVPA 2LVOA 2D07B 1DOIA 2WXLA 2AQ2B 2BYTA 1MI0A 4IG7B 5IA7A 1ZUD2 2DX5B 3RZWC 2JY6A 2LEKA 1HTOA 1WE7A 1OFFA 1ET9A 3BYTB 2KDIA 3QA8A 1MHXA 4HKZE 2L32A 1E6EB 4DDGD 2EKIA 1AW7A 2L0FA 1IGCA 2KQSA 1VDVA 2EKEC 2AQ3B 3TJPA 1I4HA 4GXBA 3H6NA 4W9CA 3R7QA 1WR6E 3PHXB 3OWEB 5DPTA 2XK5A 2PVOD 3NVVA 3RZFA 4ZRIA 1RYJA 3L13A 2DZKA 2QDFA 4ICUA 2OJRA 2VH1A 2GLSA 1LFDA 2Q5WD 1N6ZA 1P1AA 1XLOA 4MM3A 3H7SA 3VHTC 1XCQL 4MGIE 3Q8FA 1OEYA 2MJ3A 1WGKA 3B08A 5E6OA 4KV2A 2WXPA 2AL3A 2RSUA 5IAAC 5CTRC 2D2QA 2K8CA 1GPXA 2WXMA 3SEBA 2DENB 3QX1A 4RGOS 5BYRA 2ACZB 4IDIA 4L23A 1AYFA 3IAS1 1X1MA 4HWIB 1WX9A 1WRDB 1GAQB 2C5LC 2EELA 1V9JA 2OJWA 2M0XA 2WQYB 1AN8A 4LDTD 5C2TB 1ISNA 1RFKA 3WCQA 4LK0M 2PE9A 2M8SA 2HDEA 3Q14C 3ZNZB 3V3XA 1XXGA 1FRRA 1FD6A 3MJWA 2ZPYA 2XN9C 1E8YA 1F9JA 3ZGZA 1Y56A 3A9KA 2CJNA 2MBQA 1M94A 2M1MA 5AZHA 4DQOC 1IYFA 2BPSA 1V80A 1OQQA 4S17A 3Q6BA 1N5XA 4XDDA 1ZE3D 5IN7A 1N62A 3UIOB 3HUIA 4AWJA 2W9NA 5BYSA 1LGRA 1WYGA 4KZ0A 3U30A 1F2RC 2QCZA 1EO6A 1WI0A 2C60A 1TYGB 3L08A 2NR2A 1YJJA 2DZIA 2JWUA 3TEXA 4TQ0A 2KTRA 1OTRB 2G45B 3QK0A 3H7PA 3PRMB 1WMHB 5DPRA 5J18A 3RCZA 2L83A 4M0WA 3UINB 4E71A 3W1SA 3AE9B 1PYWD 4NZLB 3ZIMA 1R4NI 5KHOA 1K51A 3UF8A 1PFDA 3AE2B 4OZAA 1QILA 4W9JA 1NYQA 5IP4D 3BZDB 2X8XX 1AWDA 4DXGA 1T0SC 2GRIA 2MH7A 3A9JA 4B0MA 4HXDA 1J19A 2KWDA 2IDYA 2N9KA 5TSSA 1FRDA 1VD2A 4KDLB 4IM2A 2KDFB 2JZZA 2WNMA 3ZTDA 5EE1A 2YVCA 4A6QA 1G6JA 2INCC 3JYUA 2I1KA 3DBHI 4GLSC 1D3ZA 4H2AA 1ESFA 3R8BA 5H92C 1FNVA 3ZW3A 2JUOA 2NBUA 1IP9A 4F1SA 2KWCA 1TJEA 3R2IA 3GZNB 3LDZE 3ZDMC 3LJ3A 2Y5CA 2ZW1A 2BYEA 2LUEA 4XX5A 3AEDB 2KKCA 1OQYA 4OW0A 2KMAA 2IZVB 2ZPNA 2WDRB 2ASQA 2N7EA 3DDCB 4K7SA 1E7UA 2MX2A 3ZVVA 4W9IA 2OEDA 2CHZA 2IYDB 4C7ZA 1TTNA 2JYTA 2L76A 2WXJA 2PJHA 2NPTA 1T3QA 1ENFA 2IO2B 3AU5A 1VZ6A 1BXTA 2DBYA 1EF1A 4IWQA 5AZFA 1ACCA 2B3AA 1J7AA 1L4ZB 3NOBA 2WDVB 3IFWB 3AM9A 1FCCC 4GDKB 4J3OD 1KLUD 1SE3A 4DHZE 2GOWA 1XT9B 4E3CA 2CU3A 3SR6A 2G9HD 4MEMA 1L0VB 3KVFB 2YEPF 1RRBA 3I9V1 1N61A 2KFJA 3KUZA 2Y3AA 2W3RA 4ZRPA 2Z0DB 3K9PB 1XD3B 2M17A 3QJZA 3X0WA 2PW9A 1NVID 2K3UA 2Z59B 1JQ4A 1TIFA 5KHQA 4NNJB 4YTMB 2JRIB 2IY0B 3BY4B 4MSQB 2DZJA 2QC8A 1WXSA 3P63A 1GJZA 1UGJA 4FLHA 2WYQA 4PS7A 2WXHA 2WXFA 5AEKB 5LNK1 2KVRA 3J9CA 1P9DU 2BS4B 1DYQA 3ZUNA 3L0WB 2N1WA 1T0RC 1L2NA 3T8MA 1FMAD 3V61A 4NAWB 1MG4A 1F1HA 5BO4B 2MRPA 2WXIA 3GOEA 3FILB 5TR5A 2UWQA 2D3AA 1YN3A 2J0KA 2M4NA 3ZNHB 2RDGA 3C0RB 2LGXA 3KYCD 3EUB2 1PQSA 2KAJA 3P42A 2KACA 1TS5A 3QARA 3LYYA 2I2YA 1YIWA 2J52A 3DVNU 1E8ZA 4TSSA 2KANA 1L6VA 1J7BA 1FNUA 2JF5A 2HJ1A 2XNAC 4HKQA 4GOCA 2PEAA 1JALA 4WWOA 4BZAA 4P7IA 3RMKC 1H4RA 3UQAA 2K1FA 4MACA 2IBIB 4WWMA 4UDUC 3UQBA 1LXDA 1E7VA 2BGFA 4X57B 3AI5A 4EFOA 2ONQA 5DCNA 4IWOA 1E8WA 3R66C 2D3CA 4KIKA 3ZXVA 4KGRA 2N7JA 2Y5PA 3Q8CA 4ZRJA 2E6XA 1TS2A 3R2TA 4A3PA 1J7CA 1WX8A 2KC1A 3WAOA 4BBNF 1D4BA 3JVZX 1YNTE 2FBWB 4O1NA 3AN1A 4N9F4 4W9GA 1QQRA 1HE8A 3NS1A 4YT0B 4XWWA 3TL5A 1QF6A 4LLGM 2GBJA 1PGXA 2VH2A 2INDC 3L4PA 3ZJVA 3HIZA 5E6JA 1TGZB 4LDTB 3T9LA 3FKYA 4GIVA 1E10A 2N7DA 3OJ3A 4KSKC 3RNCC 2R2QA 1GB4A 4M01A 5HG2A 2HTHA 1DGJA 4BKTA 1N60A 4D2KA 1WFYA 3N20C 3GE3C 2KMCA 2L1AA 3W1SC 2J0MA 3U4EG 3ZLZA 3E56A 2KK8A 3VR9B 2V3PA 1JWMD 4LNIA 2QMTA 1WZ0A 4KGSA 2MP2B 2INNE 2IO0B 2LHEA 2WGSA 3WA0A 4JLCA 3U7DA 3H1UA 4ANUA 2KTFA 2LGYA 1GUAB 3W5VB 5E6NA 2O6VA 3A9KB 3B1LX 5FK9C 2K8BA 3RULA 2KFKA 2WXGA 3ZNID 2WHIA 5T8IA 1Q0WB 4YSZB 1K50A 3A33B 4EE2A 2FCQA 5C23A 1NBFC 4HLEA 1C1YB 3BVGA 4DXFA 1C79A 2EMTA 1ROEA 2LZ6A 2MLBA 2KN4A 1Q5WB 2BTEA 5GXGB 4HCPB 5JHAA 2J7QB 3KQ4A 3AV8A 2KDMA 2W82A 2BT6A 2GBMA 4GGQA 4WQOB 4P16A 4IM3A 2MBHA 2QJLA 3DHIC 4KVGB 1WYWB 5FKAC 2LWPA 4B95A 3AE6B 3ZRFA 1D5ZC 1Q1OA 3IHPC 1CQVA 2IGDA 1XLPA 1WXAA 2KX3A 5HHDG 5DPWA 2EMSA 3ZYYX 1HTQA 2CKHB 4K7WA 4M0WB 1ZDVA 2JQRB 3N9YC 1TZOA 3QAQA 4HROA 3N1XC 1E90A 2FUG1 1WXMA 3DBLI 4HK2A 2LXAA 3PZDA 3H9DA 1TY0A 4RFBA 3RNAC 3CWIA 2BBCA 3EFCA 2N9EB 5H8YE 3SU8X 1I4GA 4G11A 4C4VB 1TZ1A 2K25A 4W9LA 2N9LA 4TV3A 4EKUA 4IWPA 1L0YB 4GDLA 3KWVA 1WGHA 3EECA 3MP9A 5IO9A 3AH7A 3AB5A 4ANWA 1GNUA 3OAWA 2E3TA 1BUIC 3AE8B 4RGMA 4FJYA 3DHGC 5J17A 3ETRA 3FAHA 3P4SB 1UNSA 3BYYB 3RNFC 1UGMA 1FFVA 2NCNA 4P1BC 3C19A 4KGTA 3L54A 2UU7A 3AMZA 3KW5B 5BMHA 4IM0A 1Q10A 2X38A 2ZEQA 1XF5L 3IBEA 3ZRCA 3URYA 1YJIA 4W9FA 2MEKA 2DZMA 1FXIA 5IKCM 1B1ZA 4RMAA 3VUXA 4ZOHC 1GG3A 2OOBB 1I4PA 3APFA 1MJDA 1WF9A 3B2GA 2K0PA 2Z8LA 3AU4A 3Q3JA 1TBEA 1CK1A 2C7NB 4LJOB 4L2YA 3W5UB 4K3BA 2KLGA 2WXKA 1RM6C 4J6IA 4NQKE 1V1PB 1HZ6A 2CHWA 1FXAA 1L0XB 4YSYB 4BOSC 4FJZA 1K52A 2KC2A 3NUHB 2O2VA 4KKIA 3VXWA 1EM7A 3Q3OC 1JWBD 3HVZA 2BVCA 3CIRB 3N1ZC 2ON8A 1WJ6A 3GB1A 2VZKD 3D32A 4JL9A 1WXVA 1XLNA 4I6LB 2AEHA 1UUPA 2N4FA 2R2OA 1ZXIA 1I7HA 2MHJA 4N6EB 4W9DA 2C7HA 3M95A 2AWTA 3MFGA 4WWPA 1TS4A 4NJ7A 3WAMA 1PGBA 3HK0A 4XE0A 1FXTB 3UGBB 1RFAA 4N59A 4JPSA 3NY5A 1KLGD 2GBNA 3ZDTA 3PGEA 3AECB 4WJPA 3W1YA 4EEWA 2CJOA 2CU1A 3PTFC 2ICIA 4A20A 2PIAA 2PKOA 3TEWA 1P0RA 1ZDXA 2BB6A 3VDZA 2M0AA 3ZJUA 4G0NB 3HRDD 1YX5B 5AUIA 1WSPA 1EUVB 5D7GA 1WGRA 2W54A 2FCMA 3TIXA 1WM3A 2NBVB 3Q69A 1D5XC 2K6QA 3RNBC 2RPVA 1NI2A 1M4VA 3EGRA 2V4LA 1JMLA 3TCAA 4JWUC 1YD8U 1E8XA 3P4RB 1OGWA 2HTME 4YSXB 1C9FA 4ZRQA 2DYMA 4ZHPA 1P3QU 3Q8AA 4WJQA 4LNKA 1V5OA 2BQQA 1JROA 3BVZA 4NJCA 4MSMB 3M63B 4WH4A 1LM8B 2QIEB 3JSVB 2D3GA 1XEEA 4MGZE 1GC6A 1NI3A 1JW9D 2DNFA 2K22A 3H8HA 3RD2A 3SD5A 2LI5A 4KX6B 3R3MA 3R7RA 2KQ4X 2BW2A 3WIMA 3A1QA 1YQ3B 5IOIA 4DHJD 5FR6A 1QLBB 4URKA 2JSVX 5D94A 4ARCA 4CHKA 2K5PA 1FCLA 1STEA 1UELA 1L6UA 5L95C 1UZXB 5G5HA 1AARA 3VH3B 4C56C 2LASA 1J0GA 2I1JA 4W9HA 3OJ4B 2DYOA 1R4MI 3Q8BA 4HJGE 1JCKB 2FCSA 2NTTA 5CHWA 2UYZB 2D11A 3AE7B 1UWXA 4NPNA 1F77A 1OQRA 3IXSA 1VR9A 3VTUA 1UBQA 2GI9A 4IW0A 4KDIC 3DBRI 4WJNA 2KYWA 4TMAB 1HZ5A 2ZVOA 1V6EA 4GU2A 5LLIA 2LMCA 2JZPA 2LXCA 1F0ZA 2N0SB 3OG5A 1E9MA 4NY0A 3AEEB 2KNBA 4CO7A 1WE6A 4HJKA 1JWAD 4MJSA 2GBRA 4IUMB 5HKHA 2D10A 1ET6A 1UBIA 5G55A 2VRRB 1S3SG 4ITKA 2KT7A 4ARIA 3SDLC 3TMPB 3VRBB 2LRWA 5JXVA 3ECIA 4XZ4A 1Y8RC 1WGGA 3NZ3A 2JU6X 4RGTA 2NBWB 1RAXA 1FFUA 3MTNB 3V05A 4KZCA 4K3CA 3N32A 4PS8A 1WMHA 1WY8A 1V49A 3AE1B 4IOIE 4W9KA 4HPPA 1UH6A 1V1OA 3B2FA 2G4SA 5HI1A 1P98A 1SE4A 4AOFA 2LGDA 3AEFB 1TKEA 1WGYA 3EHVA 3KUCB 4P6VF 4YL8A 1HA5A 5EE0A 1SIFA 2IJ0A 1XCTL 2L52A 2XEWA 1VJKA 4PT5A 3CSTA 1I35A 1I4QA 4TUUA 5C1ZA 1BMLC 1PUTA 1YJ1A 2KXJA 2MW5A 1SF0A 3KUDB 1ZOYB 5EE9A 3PO0A 2LGSA 4AQ7A 2IPKD 2CS4A 2CR5A 1ZW7A 4QAYA 4M00A 5JZEB 3V62A 4M02A 1QOFA 3IVFA 1SBBB 4I6NB 5CHFA 2XK5B 4LTUA 3TEZA 1PGAA 3RFZB 1CZPA 1R4NB 3PLUA 4A9AA 3NZUA 1KRHA 4I6PA 4RGNA 2ZVNA 2BKRB 4Q2JA 5I4DA 1E7PB 4GDLB 4AS1A 4MM3B 3I63C 1A70A 3RUIB 1EWYC 4S0RA 2ZNVC 3WAPA 1V5TA 3IT6B 1MG8A 2PMVA 1UD7A 3O65B 4RF1A 2AQ1B 1WM2A 2FUHB 4USAA 2RPQA 4WAFA 1RWSA 1QKZA 2PVGC 1YN4A 4FXCA 3HM3A 2V4IB 3UIPB 2KHWB 2NMQA 4XYCA 3DBHB 3ZJTA 2TSSA 4XDCA 2LGIA 1ZXHA 3DOWA 2JPHA 2WWZA 2LJIA 3PZ8A 1L7YA 3PS6A 2K9XA 3JW0X 3UI3A 3VUYA 3TSSA 1T0QC 3VUWA 2ZJDA 5GMVA 1NYRA 1WR1A 3ZTCA 3AULA 3AEBB 2N1VA 4YWGG 1VRAB 1DOXA 5LXHA 2VZKB 2WU2B 3KH0A 3NZSA 4ZHOA 1ZPSA 3ML8A 1YQBA 3GP7A 3APCA 3BVMA 4JQWC 3AE5B 3QHTA 5AUKA 1SJHD 3NRZA 2Z0EB 3MJ5A 1WJNA 4ANXA 1B9RA 3PRZA 4DDID 4YXDB 1D6EC 1TS3A 3W9CB 2KWUB 2M19A 1MPEA 4NAWA 2ZNVB 2R61A 3A4SC 4K81A 3VVWB 2KN5A 2BS2B 3AEGB 4PS3A 5E6PA 4AJYB 4MT5A 4XC2A 2O6VD 1VLBA 4MDKE 2RD0A 4FULA 3DVGX 3N3KB 2WU5B 3BINA 2BKFA 1C78A 2JWZA 1I42A 3QCAA 2KTRB 3H7PB 1UF0A 5D2MB 4PYZA 4OVUA 3DPDA 3VR8B 2KZRA 1F2RI 4PYUA 1KJTA 1YN5A 3GZNI 3NVWA 2WDTB 3M62B 5J2RA 2WXOA 1CMXB 2V3NA 4LCDE 2V9HA 3U52E 1V81A 2WXQA 1QT9A 5DPSA 5L83A 4TQ1A 2BS3B 1VZ8A 3AEAB 2DHZA 3PPAA 2JRHA 1N5WA 2WS3B 2HJ8A 3A9JB 3OLMD 3TEYA 4ASWC 3P1MA 5CX3A 2YEPB 3ZQ4A 4W9EA 4JE3B 4US9A 3ALBA 3KYDD 1ZKHA 4II3B 2IGGA 3Q2AC 1EWCA 2AX5A 1F52A 3SFDB 2QSDA
chains in the Genus database with same CATH topology
2X8XX 4C4VA 2QDFA 2VH1A 4C00A 2QCZA 4K3BA 4QAYA 4PK1A 3MC9A 2MHJA 4BZAA 3MC8A 2VH2A 3Q6BA 3OG5A 2V9HA 3EFCA 4K3CA 4XGAB 3NJTA 4C4VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X8X X;  4C4V A;  2QDF A;  2VH1 A;  4C00 A;  2QCZ A;  4K3B A;  4QAY A;  4PK1 A;  3MC9 A;  2MHJ A;  4BZA A;  3MC8 A;  2VH2 A;  3Q6B A;  3OG5 A;  2V9H A;  3EFC A;  4K3C A;  4XGA B;  3NJT A;  4C4V B; 
#chains in the Genus database with same CATH topology
 3W2D A;  3T3N A;  4FAD A;  2WDQ B;  2RMM A;  3QQ8 B;  1NEK B;  1FPY A;  1VZ7 A;  2JVC A;  2JZ3 B;  2KDE B;  2FID A;  4DHJ B;  4F7Z A;  4OVV A;  3TUO A;  4F8C B;  2KOX A;  3I3T B;  3ZNG C;  1BT0 A;  3HVD A;  2NVU I;  4BBN C;  2KWV B;  4HVB A;  1C77 A;  2JXT A;  4MGY E;  2JX5 A;  1WX7 A;  2L00 B;  2KMM A;  2ZCC A;  1XO3 A;  1IUE A;  1VCB A;  4A90 A;  3A1Q B;  1YMH E;  1FM0 D;  1KTK A;  3ENE A;  2NPT B;  3Q8E A;  3Q3N C;  1IBX A;  2YLM A;  2KJ6 A;  3RYT A;  5AZG A;  3NG0 A;  2RDH A;  4TKN A;  2FCN A;  4MEL A;  2MBO A;  2MBE A;  2KD0 A;  3PLV A;  5HFY A;  3RPF C;  2RGF A;  1SJE D;  2KJR A;  2DLB A;  3PZ7 A;  2G3Q B;  4NJ6 A;  1JRP A;  2MP2 A;  1EU4 A;  4WUR A;  1LQB A;  4LJP B;  1QOG A;  4LNO A;  3GE8 C;  2KVZ A;  3P2B A;  2SEB D;  4R3D A;  4BKG A;  4FN2 A;  1XLQ A;  4EZL A;  2LD9 A;  3IG3 A;  4MJS B;  1WJ4 A;  4II2 B;  3V60 A;  2B76 B;  1E5W A;  4HPL B;  4NAM A;  4E74 A;  2OHF A;  3C8Y A;  3PVL A;  1QZE A;  3I57 A;  1SEB D;  4EUT A;  2K39 A;  1EF5 A;  1A5R A;  3M3J A;  3ZXR A;  2IO3 B;  1EU3 A;  4N58 A;  1TT5 B;  2PPH A;  4L1B A;  4MH0 E;  1I4R A;  2MWS B;  1L4D B;  4ANV A;  4RM8 A;  1GB1 A;  2ZZP B;  3I5J C;  2C9W B;  3MHZ A;  4EOY A;  1JRU A;  4DBG A;  4K7U A;  1IPG A;  4BAX A;  3B9J A;  4GN1 A;  2IY1 B;  4YTP B;  1FEH A;  3N30 A;  4IC7 B;  3BWU D;  5BYQ A;  3VQI A;  5D3I B;  2WX0 A;  3CF6 E;  5JH5 C;  3LB8 C;  4C4V A;  2KDB A;  3E9S A;  5BMG A;  2CHX A;  1KM7 A;  2PE6 B;  4C80 A;  1SSN A;  2L7R A;  1KLV A;  4JWS C;  2H89 B;  2J0J A;  3QWZ B;  4B0E A;  4JGH B;  2WLB A;  3DVG Y;  5MPO A;  4HEA 1;  1V97 A;  4LNF A;  4BOZ B;  4KIK B;  1Z5S B;  1NEN B;  1K53 A;  4BVU C;  3NVY A;  1E0Z A;  1H8C A;  3L17 A;  3HHM A;  2MA9 B;  3AE4 B;  4GB9 A;  3DBL B;  2QHO A;  2JT4 B;  2BB5 A;  2MQJ A;  3CSF A;  4M8N A;  2GMI C;  4OHJ A;  2IO1 B;  4WIP A;  3DHH C;  4CYE A;  1MVK A;  4OZB A;  4RM9 A;  3TBL D;  5G2N A;  4P1C C;  1PDX A;  4M8M A;  5CHV C;  1V2Y A;  1QOB A;  1UWM A;  3RI7 C;  2QIL A;  2AL6 A;  3WAN A;  2WX1 A;  5LXI B;  1YX6 B;  3WAL A;  5EDS A;  4RCO A;  4GMV A;  1FIQ A;  2LRU A;  3RNE C;  3GS2 A;  1YQ4 B;  2W3S A;  4JIO U;  2FE8 A;  1Z2M A;  3V6E B;  3PT2 B;  2A4Z A;  4FJV B;  1P7E A;  4A8X C;  2I38 A;  4FA6 A;  2DAJ A;  4IKG A;  1WJU A;  1T5X D;  2WP9 B;  2A5U A;  1V1P A;  2QEJ C;  4FHJ A;  4HPM B;  2HD5 B;  1CJE A;  4OZC A;  1ZGU B;  1KH0 A;  5BMI A;  1KFY B;  4ICV A;  2WXN A;  1V86 A;  3Q3M C;  4US8 A;  4B6W A;  2LHD A;  2NTS A;  3L16 A;  4OVZ A;  3IAM 1;  3RT3 B;  4G50 A;  5C3J B;  4ZYS A;  4G3X B;  1D5M C;  2J53 A;  3VTW A;  1L5P A;  4JX1 C;  2O6V B;  3VFK A;  3X23 A;  3CMM B;  4ZRK A;  1SGH A;  2KFK B;  3VRA B;  4MH8 A;  3APD A;  2ZCB A;  3PHW B;  2SAK A;  2MSE D;  3ABV B;  3DQV A;  3IT4 B;  2M56 B;  4HDQ A;  3RN9 C;  2K8H A;  2G1E A;  1LO5 D;  4A3O A;  4DWF A;  4REZ A;  3EC8 A;  2GBK A;  1WGD A;  3NJT A;  4AJW A;  1SE2 A;  3ZO5 B;  3NVZ A;  1N63 A;  4C00 A;  2BYF A;  4PK1 A;  1P7F A;  3EA6 A;  3NS8 A;  2BWE S;  4DHZ B;  2WXR A;  3BK1 A;  3MC8 A;  3N1Y C;  2MCN B;  2LJ5 A;  3O13 A;  3VH4 B;  4WQM A;  4CQN A;  5JHB A;  5EE3 A;  1KOT A;  1FNW A;  3PRE A;  4HCN B;  2D3B A;  1SIJ A;  2GB1 A;  1DOY A;  1NDD A;  3U8Z A;  4FBJ B;  2L3Z A;  2KQ7 A;  1JWU D;  2BYV E;  3B0A A;  1SE9 A;  1RLF A;  4BFR A;  3EFU A;  2LFI A;  3DBS A;  1K8R B;  3DVN V;  1S1Q B;  4HDO A;  2Y5B B;  3T3O A;  3ML9 A;  2N9X A;  4KKJ A;  2MJD A;  3JSV A;  3P4P B;  4WWN A;  1MHH E;  3BK2 A;  3P4Q B;  2KJH B;  2N9P C;  2MBB B;  3LXF A;  4DXA B;  4RNA A;  2G4D B;  3KWL A;  1WH3 A;  2BWF A;  3HM6 X;  1KF6 B;  2L0T A;  4BKS A;  1YOV B;  3BII D;  3V6C B;  4MGK E;  2ZW0 A;  4LNN A;  2RR9 A;  1GOZ A;  2W55 A;  5G5G A;  1TY2 A;  3AXC A;  1WXQ A;  3S2A A;  1FO4 A;  2DAF A;  2L05 A;  4HRS A;  3A4R A;  1I4X A;  1C4A A;  1TKG A;  2J4X A;  5D3D A;  1HEZ E;  2FAZ A;  4B9K A;  1GC7 A;  2PTL A;  3U2S C;  4BKS D;  4GSW A;  3PV1 A;  3U7Z A;  3NHE B;  3SFE B;  2NS5 A;  4XWT A;  3ONS A;  3DWM A;  4GDK A;  3MC0 B;  2XBB C;  2J42 A;  4A55 A;  1IGD A;  1WIA A;  2L8J A;  3K9O B;  1V8C A;  2IGH A;  2D5G A;  2BF8 B;  1C4P A;  3RNG C;  3ZKJ C;  1R7S A;  2DYB A;  3SHQ A;  2KO3 A;  1WWT A;  1MFW A;  1ZP0 B;  3PSE B;  4ZDV A;  3AE3 B;  2KLC A;  4EZK A;  4C7Y A;  1IBX B;  2PLP A;  3FC4 A;  1C4C A;  1U4A A;  4AP4 C;  1XQQ A;  2FNJ B;  4RH6 A;  1QOA A;  4ZYN A;  5FR3 A;  1SXT A;  3Q3F A;  3QC8 B;  1TKY A;  2H88 B;  2O2V B;  1C76 A;  2INP E;  1C3T A;  2V1Y A;  1R4M B;  4FHK A;  1T6B X;  3DCG A;  3KLS X;  1J8C A;  3FIL A;  3MHS D;  1SB3 C;  2KX0 A;  5D6J B;  1WZ3 A;  2HE7 A;  2RDB C;  4EZJ A;  3DBR B;  1HXY D;  2FIF A;  4WJO A;  2MJE A;  4AUQ C;  2C7M B;  1T0Y A;  1HQR D;  2REX A;  3DWG C;  2AYO B;  3L10 B;  4NQL B;  2V3S A;  4K1R B;  4ACF A;  2JYE A;  4XGA B;  1OEY J;  4WAA A;  4RF0 A;  3VTV A;  2LVQ A;  3VAW A;  4DK5 A;  3QIJ A;  1JWS D;  1WRI A;  2JXX A;  2K6D B;  2LUM A;  4KSL C;  3MC9 A;  3PRP B;  2DWQ A;  4YTN B;  2V0G A;  2LVP A;  2LVO A;  2D07 B;  1DOI A;  2WXL A;  2AQ2 B;  2BYT A;  1MI0 A;  4IG7 B;  5IA7 A;  1ZUD 2;  2DX5 B;  3RZW C;  2JY6 A;  2LEK A;  1HTO A;  1WE7 A;  1OFF A;  1ET9 A;  3BYT B;  2KDI A;  3QA8 A;  1MHX A;  4HKZ E;  2L32 A;  1E6E B;  4DDG D;  2EKI A;  1AW7 A;  2L0F A;  1IGC A;  2KQS A;  1VDV A;  2EKE C;  2AQ3 B;  3TJP A;  1I4H A;  4GXB A;  3H6N A;  4W9C A;  3R7Q A;  1WR6 E;  3PHX B;  3OWE B;  5DPT A;  2XK5 A;  2PVO D;  3NVV A;  3RZF A;  4ZRI A;  1RYJ A;  3L13 A;  2DZK A;  2QDF A;  4ICU A;  2OJR A;  2VH1 A;  2GLS A;  1LFD A;  2Q5W D;  1N6Z A;  1P1A A;  1XLO A;  4MM3 A;  3H7S A;  3VHT C;  1XCQ L;  4MGI E;  3Q8F A;  1OEY A;  2MJ3 A;  1WGK A;  3B08 A;  5E6O A;  4KV2 A;  2WXP A;  2AL3 A;  2RSU A;  5IAA C;  5CTR C;  2D2Q A;  2K8C A;  1GPX A;  2WXM A;  3SEB A;  2DEN B;  3QX1 A;  4RGO S;  5BYR A;  2ACZ B;  4IDI A;  4L23 A;  1AYF A;  3IAS 1;  1X1M A;  4HWI B;  1WX9 A;  1WRD B;  1GAQ B;  2C5L C;  2EEL A;  1V9J A;  2OJW A;  2M0X A;  2WQY B;  1AN8 A;  4LDT D;  5C2T B;  1ISN A;  1RFK A;  3WCQ A;  4LK0 M;  2PE9 A;  2M8S A;  2HDE A;  3Q14 C;  3ZNZ B;  3V3X A;  1XXG A;  1FRR A;  1FD6 A;  3MJW A;  2ZPY A;  2XN9 C;  1E8Y A;  1F9J A;  3ZGZ A;  1Y56 A;  3A9K A;  2CJN A;  2MBQ A;  1M94 A;  2M1M A;  5AZH A;  4DQO C;  1IYF A;  2BPS A;  1V80 A;  1OQQ A;  4S17 A;  3Q6B A;  1N5X A;  4XDD A;  1ZE3 D;  5IN7 A;  1N62 A;  3UIO B;  3HUI A;  4AWJ A;  2W9N A;  5BYS A;  1LGR A;  1WYG A;  4KZ0 A;  3U30 A;  1F2R C;  2QCZ A;  1EO6 A;  1WI0 A;  2C60 A;  1TYG B;  3L08 A;  2NR2 A;  1YJJ A;  2DZI A;  2JWU A;  3TEX A;  4TQ0 A;  2KTR A;  1OTR B;  2G45 B;  3QK0 A;  3H7P A;  3PRM B;  1WMH B;  5DPR A;  5J18 A;  3RCZ A;  2L83 A;  4M0W A;  3UIN B;  4E71 A;  3W1S A;  3AE9 B;  1PYW D;  4NZL B;  3ZIM A;  1R4N I;  5KHO A;  1K51 A;  3UF8 A;  1PFD A;  3AE2 B;  4OZA A;  1QIL A;  4W9J A;  1NYQ A;  5IP4 D;  3BZD B;  2X8X X;  1AWD A;  4DXG A;  1T0S C;  2GRI A;  2MH7 A;  3A9J A;  4B0M A;  4HXD A;  1J19 A;  2KWD A;  2IDY A;  2N9K A;  5TSS A;  1FRD A;  1VD2 A;  4KDL B;  4IM2 A;  2KDF B;  2JZZ A;  2WNM A;  3ZTD A;  5EE1 A;  2YVC A;  4A6Q A;  1G6J A;  2INC C;  3JYU A;  2I1K A;  3DBH I;  4GLS C;  1D3Z A;  4H2A A;  1ESF A;  3R8B A;  5H92 C;  1FNV A;  3ZW3 A;  2JUO A;  2NBU A;  1IP9 A;  4F1S A;  2KWC A;  1TJE A;  3R2I A;  3GZN B;  3LDZ E;  3ZDM C;  3LJ3 A;  2Y5C A;  2ZW1 A;  2BYE A;  2LUE A;  4XX5 A;  3AED B;  2KKC A;  1OQY A;  4OW0 A;  2KMA A;  2IZV B;  2ZPN A;  2WDR B;  2ASQ A;  2N7E A;  3DDC B;  4K7S A;  1E7U A;  2MX2 A;  3ZVV A;  4W9I A;  2OED A;  2CHZ A;  2IYD B;  4C7Z A;  1TTN A;  2JYT A;  2L76 A;  2WXJ A;  2PJH A;  2NPT A;  1T3Q A;  1ENF A;  2IO2 B;  3AU5 A;  1VZ6 A;  1BXT A;  2DBY A;  1EF1 A;  4IWQ A;  5AZF A;  1ACC A;  2B3A A;  1J7A A;  1L4Z B;  3NOB A;  2WDV B;  3IFW B;  3AM9 A;  1FCC C;  4GDK B;  4J3O D;  1KLU D;  1SE3 A;  4DHZ E;  2GOW A;  1XT9 B;  4E3C A;  2CU3 A;  3SR6 A;  2G9H D;  4MEM A;  1L0V B;  3KVF B;  2YEP F;  1RRB A;  3I9V 1;  1N61 A;  2KFJ A;  3KUZ A;  2Y3A A;  2W3R A;  4ZRP A;  2Z0D B;  3K9P B;  1XD3 B;  2M17 A;  3QJZ A;  3X0W A;  2PW9 A;  1NVI D;  2K3U A;  2Z59 B;  1JQ4 A;  1TIF A;  5KHQ A;  4NNJ B;  4YTM B;  2JRI B;  2IY0 B;  3BY4 B;  4MSQ B;  2DZJ A;  2QC8 A;  1WXS A;  3P63 A;  1GJZ A;  1UGJ A;  4FLH A;  2WYQ A;  4PS7 A;  2WXH A;  2WXF A;  5AEK B;  5LNK 1;  2KVR A;  3J9C A;  1P9D U;  2BS4 B;  1DYQ A;  3ZUN A;  3L0W B;  2N1W A;  1T0R C;  1L2N A;  3T8M A;  1FMA D;  3V61 A;  4NAW B;  1MG4 A;  1F1H A;  5BO4 B;  2MRP A;  2WXI A;  3GOE A;  3FIL B;  5TR5 A;  2UWQ A;  2D3A A;  1YN3 A;  2J0K A;  2M4N A;  3ZNH B;  2RDG A;  3C0R B;  2LGX A;  3KYC D;  3EUB 2;  1PQS A;  2KAJ A;  3P42 A;  2KAC A;  1TS5 A;  3QAR A;  3LYY A;  2I2Y A;  1YIW A;  2J52 A;  3DVN U;  1E8Z A;  4TSS A;  2KAN A;  1L6V A;  1J7B A;  1FNU A;  2JF5 A;  2HJ1 A;  2XNA C;  4HKQ A;  4GOC A;  2PEA A;  1JAL A;  4WWO A;  4BZA A;  4P7I A;  3RMK C;  1H4R A;  3UQA A;  2K1F A;  4MAC A;  2IBI B;  4WWM A;  4UDU C;  3UQB A;  1LXD A;  1E7V A;  2BGF A;  4X57 B;  3AI5 A;  4EFO A;  2ONQ A;  5DCN A;  4IWO A;  1E8W A;  3R66 C;  2D3C A;  4KIK A;  3ZXV A;  4KGR A;  2N7J A;  2Y5P A;  3Q8C A;  4ZRJ A;  2E6X A;  1TS2 A;  3R2T A;  4A3P A;  1J7C A;  1WX8 A;  2KC1 A;  3WAO A;  4BBN F;  1D4B A;  3JVZ X;  1YNT E;  2FBW B;  4O1N A;  3AN1 A;  4N9F 4;  4W9G A;  1QQR A;  1HE8 A;  3NS1 A;  4YT0 B;  4XWW A;  3TL5 A;  1QF6 A;  4LLG M;  2GBJ A;  1PGX A;  2VH2 A;  2IND C;  3L4P A;  3ZJV A;  3HIZ A;  5E6J A;  1TGZ B;  4LDT B;  3T9L A;  3FKY A;  4GIV A;  1E10 A;  2N7D A;  3OJ3 A;  4KSK C;  3RNC C;  2R2Q A;  1GB4 A;  4M01 A;  5HG2 A;  2HTH A;  1DGJ A;  4BKT A;  1N60 A;  4D2K A;  1WFY A;  3N20 C;  3GE3 C;  2KMC A;  2L1A A;  3W1S C;  2J0M A;  3U4E G;  3ZLZ A;  3E56 A;  2KK8 A;  3VR9 B;  2V3P A;  1JWM D;  4LNI A;  2QMT A;  1WZ0 A;  4KGS A;  2MP2 B;  2INN E;  2IO0 B;  2LHE A;  2WGS A;  3WA0 A;  4JLC A;  3U7D A;  3H1U A;  4ANU A;  2KTF A;  2LGY A;  1GUA B;  3W5V B;  5E6N A;  2O6V A;  3A9K B;  3B1L X;  5FK9 C;  2K8B A;  3RUL A;  2KFK A;  2WXG A;  3ZNI D;  2WHI A;  5T8I A;  1Q0W B;  4YSZ B;  1K50 A;  3A33 B;  4EE2 A;  2FCQ A;  5C23 A;  1NBF C;  4HLE A;  1C1Y B;  3BVG A;  4DXF A;  1C79 A;  2EMT A;  1ROE A;  2LZ6 A;  2MLB A;  2KN4 A;  1Q5W B;  2BTE A;  5GXG B;  4HCP B;  5JHA A;  2J7Q B;  3KQ4 A;  3AV8 A;  2KDM A;  2W82 A;  2BT6 A;  2GBM A;  4GGQ A;  4WQO B;  4P16 A;  4IM3 A;  2MBH A;  2QJL A;  3DHI C;  4KVG B;  1WYW B;  5FKA C;  2LWP A;  4B95 A;  3AE6 B;  3ZRF A;  1D5Z C;  1Q1O A;  3IHP C;  1CQV A;  2IGD A;  1XLP A;  1WXA A;  2KX3 A;  5HHD G;  5DPW A;  2EMS A;  3ZYY X;  1HTQ A;  2CKH B;  4K7W A;  4M0W B;  1ZDV A;  2JQR B;  3N9Y C;  1TZO A;  3QAQ A;  4HRO A;  3N1X C;  1E90 A;  2FUG 1;  1WXM A;  3DBL I;  4HK2 A;  2LXA A;  3PZD A;  3H9D A;  1TY0 A;  4RFB A;  3RNA C;  3CWI A;  2BBC A;  3EFC A;  2N9E B;  5H8Y E;  3SU8 X;  1I4G A;  4G11 A;  4C4V B;  1TZ1 A;  2K25 A;  4W9L A;  2N9L A;  4TV3 A;  4EKU A;  4IWP A;  1L0Y B;  4GDL A;  3KWV A;  1WGH A;  3EEC A;  3MP9 A;  5IO9 A;  3AH7 A;  3AB5 A;  4ANW A;  1GNU A;  3OAW A;  2E3T A;  1BUI C;  3AE8 B;  4RGM A;  4FJY A;  3DHG C;  5J17 A;  3ETR A;  3FAH A;  3P4S B;  1UNS A;  3BYY B;  3RNF C;  1UGM A;  1FFV A;  2NCN A;  4P1B C;  3C19 A;  4KGT A;  3L54 A;  2UU7 A;  3AMZ A;  3KW5 B;  5BMH A;  4IM0 A;  1Q10 A;  2X38 A;  2ZEQ A;  1XF5 L;  3IBE A;  3ZRC A;  3URY A;  1YJI A;  4W9F A;  2MEK A;  2DZM A;  1FXI A;  5IKC M;  1B1Z A;  4RMA A;  3VUX A;  4ZOH C;  1GG3 A;  2OOB B;  1I4P A;  3APF A;  1MJD A;  1WF9 A;  3B2G A;  2K0P A;  2Z8L A;  3AU4 A;  3Q3J A;  1TBE A;  1CK1 A;  2C7N B;  4LJO B;  4L2Y A;  3W5U B;  4K3B A;  2KLG A;  2WXK A;  1RM6 C;  4J6I A;  4NQK E;  1V1P B;  1HZ6 A;  2CHW A;  1FXA A;  1L0X B;  4YSY B;  4BOS C;  4FJZ A;  1K52 A;  2KC2 A;  3NUH B;  2O2V A;  4KKI A;  3VXW A;  1EM7 A;  3Q3O C;  1JWB D;  3HVZ A;  2BVC A;  3CIR B;  3N1Z C;  2ON8 A;  1WJ6 A;  3GB1 A;  2VZK D;  3D32 A;  4JL9 A;  1WXV A;  1XLN A;  4I6L B;  2AEH A;  1UUP A;  2N4F A;  2R2O A;  1ZXI A;  1I7H A;  2MHJ A;  4N6E B;  4W9D A;  2C7H A;  3M95 A;  2AWT A;  3MFG A;  4WWP A;  1TS4 A;  4NJ7 A;  3WAM A;  1PGB A;  3HK0 A;  4XE0 A;  1FXT B;  3UGB B;  1RFA A;  4N59 A;  4JPS A;  3NY5 A;  1KLG D;  2GBN A;  3ZDT A;  3PGE A;  3AEC B;  4WJP A;  3W1Y A;  4EEW A;  2CJO A;  2CU1 A;  3PTF C;  2ICI A;  4A20 A;  2PIA A;  2PKO A;  3TEW A;  1P0R A;  1ZDX A;  2BB6 A;  3VDZ A;  2M0A A;  3ZJU A;  4G0N B;  3HRD D;  1YX5 B;  5AUI A;  1WSP A;  1EUV B;  5D7G A;  1WGR A;  2W54 A;  2FCM A;  3TIX A;  1WM3 A;  2NBV B;  3Q69 A;  1D5X C;  2K6Q A;  3RNB C;  2RPV A;  1NI2 A;  1M4V A;  3EGR A;  2V4L A;  1JML A;  3TCA A;  4JWU C;  1YD8 U;  1E8X A;  3P4R B;  1OGW A;  2HTM E;  4YSX B;  1C9F A;  4ZRQ A;  2DYM A;  4ZHP A;  1P3Q U;  3Q8A A;  4WJQ A;  4LNK A;  1V5O A;  2BQQ A;  1JRO A;  3BVZ A;  4NJC A;  4MSM B;  3M63 B;  4WH4 A;  1LM8 B;  2QIE B;  3JSV B;  2D3G A;  1XEE A;  4MGZ E;  1GC6 A;  1NI3 A;  1JW9 D;  2DNF A;  2K22 A;  3H8H A;  3RD2 A;  3SD5 A;  2LI5 A;  4KX6 B;  3R3M A;  3R7R A;  2KQ4 X;  2BW2 A;  3WIM A;  3A1Q A;  1YQ3 B;  5IOI A;  4DHJ D;  5FR6 A;  1QLB B;  4URK A;  2JSV X;  5D94 A;  4ARC A;  4CHK A;  2K5P A;  1FCL A;  1STE A;  1UEL A;  1L6U A;  5L95 C;  1UZX B;  5G5H A;  1AAR A;  3VH3 B;  4C56 C;  2LAS A;  1J0G A;  2I1J A;  4W9H A;  3OJ4 B;  2DYO A;  1R4M I;  3Q8B A;  4HJG E;  1JCK B;  2FCS A;  2NTT A;  5CHW A;  2UYZ B;  2D11 A;  3AE7 B;  1UWX A;  4NPN A;  1F77 A;  1OQR A;  3IXS A;  1VR9 A;  3VTU A;  1UBQ A;  2GI9 A;  4IW0 A;  4KDI C;  3DBR I;  4WJN A;  2KYW A;  4TMA B;  1HZ5 A;  2ZVO A;  1V6E A;  4GU2 A;  5LLI A;  2LMC A;  2JZP A;  2LXC A;  1F0Z A;  2N0S B;  3OG5 A;  1E9M A;  4NY0 A;  3AEE B;  2KNB A;  4CO7 A;  1WE6 A;  4HJK A;  1JWA D;  4MJS A;  2GBR A;  4IUM B;  5HKH A;  2D10 A;  1ET6 A;  1UBI A;  5G55 A;  2VRR B;  1S3S G;  4ITK A;  2KT7 A;  4ARI A;  3SDL C;  3TMP B;  3VRB B;  2LRW A;  5JXV A;  3ECI A;  4XZ4 A;  1Y8R C;  1WGG A;  3NZ3 A;  2JU6 X;  4RGT A;  2NBW B;  1RAX A;  1FFU A;  3MTN B;  3V05 A;  4KZC A;  4K3C A;  3N32 A;  4PS8 A;  1WMH A;  1WY8 A;  1V49 A;  3AE1 B;  4IOI E;  4W9K A;  4HPP A;  1UH6 A;  1V1O A;  3B2F A;  2G4S A;  5HI1 A;  1P98 A;  1SE4 A;  4AOF A;  2LGD A;  3AEF B;  1TKE A;  1WGY A;  3EHV A;  3KUC B;  4P6V F;  4YL8 A;  1HA5 A;  5EE0 A;  1SIF A;  2IJ0 A;  1XCT L;  2L52 A;  2XEW A;  1VJK A;  4PT5 A;  3CST A;  1I35 A;  1I4Q A;  4TUU A;  5C1Z A;  1BML C;  1PUT A;  1YJ1 A;  2KXJ A;  2MW5 A;  1SF0 A;  3KUD B;  1ZOY B;  5EE9 A;  3PO0 A;  2LGS A;  4AQ7 A;  2IPK D;  2CS4 A;  2CR5 A;  1ZW7 A;  4QAY A;  4M00 A;  5JZE B;  3V62 A;  4M02 A;  1QOF A;  3IVF A;  1SBB B;  4I6N B;  5CHF A;  2XK5 B;  4LTU A;  3TEZ A;  1PGA A;  3RFZ B;  1CZP A;  1R4N B;  3PLU A;  4A9A A;  3NZU A;  1KRH A;  4I6P A;  4RGN A;  2ZVN A;  2BKR B;  4Q2J A;  5I4D A;  1E7P B;  4GDL B;  4AS1 A;  4MM3 B;  3I63 C;  1A70 A;  3RUI B;  1EWY C;  4S0R A;  2ZNV C;  3WAP A;  1V5T A;  3IT6 B;  1MG8 A;  2PMV A;  1UD7 A;  3O65 B;  4RF1 A;  2AQ1 B;  1WM2 A;  2FUH B;  4USA A;  2RPQ A;  4WAF A;  1RWS A;  1QKZ A;  2PVG C;  1YN4 A;  4FXC A;  3HM3 A;  2V4I B;  3UIP B;  2KHW B;  2NMQ A;  4XYC A;  3DBH B;  3ZJT A;  2TSS A;  4XDC A;  2LGI A;  1ZXH A;  3DOW A;  2JPH A;  2WWZ A;  2LJI A;  3PZ8 A;  1L7Y A;  3PS6 A;  2K9X A;  3JW0 X;  3UI3 A;  3VUY A;  3TSS A;  1T0Q C;  3VUW A;  2ZJD A;  5GMV A;  1NYR A;  1WR1 A;  3ZTC A;  3AUL A;  3AEB B;  2N1V A;  4YWG G;  1VRA B;  1DOX A;  5LXH A;  2VZK B;  2WU2 B;  3KH0 A;  3NZS A;  4ZHO A;  1ZPS A;  3ML8 A;  1YQB A;  3GP7 A;  3APC A;  3BVM A;  4JQW C;  3AE5 B;  3QHT A;  5AUK A;  1SJH D;  3NRZ A;  2Z0E B;  3MJ5 A;  1WJN A;  4ANX A;  1B9R A;  3PRZ A;  4DDI D;  4YXD B;  1D6E C;  1TS3 A;  3W9C B;  2KWU B;  2M19 A;  1MPE A;  4NAW A;  2ZNV B;  2R61 A;  3A4S C;  4K81 A;  3VVW B;  2KN5 A;  2BS2 B;  3AEG B;  4PS3 A;  5E6P A;  4AJY B;  4MT5 A;  4XC2 A;  2O6V D;  1VLB A;  4MDK E;  2RD0 A;  4FUL A;  3DVG X;  3N3K B;  2WU5 B;  3BIN A;  2BKF A;  1C78 A;  2JWZ A;  1I42 A;  3QCA A;  2KTR B;  3H7P B;  1UF0 A;  5D2M B;  4PYZ A;  4OVU A;  3DPD A;  3VR8 B;  2KZR A;  1F2R I;  4PYU A;  1KJT A;  1YN5 A;  3GZN I;  3NVW A;  2WDT B;  3M62 B;  5J2R A;  2WXO A;  1CMX B;  2V3N A;  4LCD E;  2V9H A;  3U52 E;  1V81 A;  2WXQ A;  1QT9 A;  5DPS A;  5L83 A;  4TQ1 A;  2BS3 B;  1VZ8 A;  3AEA B;  2DHZ A;  3PPA A;  2JRH A;  1N5W A;  2WS3 B;  2HJ8 A;  3A9J B;  3OLM D;  3TEY A;  4ASW C;  3P1M A;  5CX3 A;  2YEP B;  3ZQ4 A;  4W9E A;  4JE3 B;  4US9 A;  3ALB A;  3KYD D;  1ZKH A;  4II3 B;  2IGG A;  3Q2A C;  1EWC A;  2AX5 A;  1F52 A;  3SFD B;  2QSD A; 
#chains in the Genus database with same CATH homology
 2X8X X;  4C4V A;  2QDF A;  2VH1 A;  4C00 A;  2QCZ A;  4K3B A;  4QAY A;  4PK1 A;  3MC9 A;  2MHJ A;  4BZA A;  3MC8 A;  2VH2 A;  3Q6B A;  3OG5 A;  2V9H A;  3EFC A;  4K3C A;  4XGA B;  3NJT A;  4C4V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...