3Q6BA

The high-resolution and new form crystal structure of bama potra4-5 from e.coli
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
YKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein assembly complex, YaeT protein
publication title High-resolution structure of a new crystal form of BamA POTRA4-5 from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 50
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2010-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3q6bA01
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3q6bA02
3MC9A 2QCZA 3MC8A 3OG5A 3Q6BA 4C00A 2MHJA 2VH1A 4K3CA 3NJTA 4K3BA 4C4VA 2X8XX 4C4VB 2V9HA 2VH2A 2QDFA 4XGAB 3EFCA 4QAYA 4BZAA 4PK1A
chains in the Genus database with same CATH superfamily
3APDA 2LJIA 3Q69A 1JRUA 3PLVA 4GB9A 1TS4A 2XK5A 1AARA 2Y5CA 3MHZA 4KDLB 2DENB 1H8CA 3AEBB 2WXOA 4MM3A 2WXHA 4XE0A 4WJOA 3C0RB 1L7YA 1PGAA 1D5MC 1WX8A 3H7PB 2LWPA 4EOYA 4RGNA 2WX0A 3ETRA 2MBEA 3L17A 1BXTA 2NBWB 4GLSC 4YL8A 3SHQA 1GUAB 2AYOB 4A6QA 1TKEA 4OW0A 3VTWA 1UD7A 3GE8C 2MCNB 3U8ZA 4GMVA 1TT5B 1FXAA 2K0PA 4RGTA 3V60A 4ANVA 2YEPF 3BVZA 4N58A 1JWUD 3FAHA 2N7JA 3IT4B 4NQKE 2LVQA 2LGDA 1KH0A 5IOIA 4RGOS 4BFRA 1AW7A 2IGGA 3N20C 2AL6A 1C76A 1IP9A 2IJ0A 3L0WB 2KQ7A 3UF8A 2RSUA 3V6EB 3TSSA 2WP9B 4KDIC 4ARIA 2JF5A 1SE9A 3R7QA 1EM7A 2O6VA 1Y56A 3DBHI 1C4PA 3WANA 2ZJDA 1TZ1A 2PPHA 4PK1A 1UGJA 4IC7B 4BAXA 3DVGX 5JXVA 3O65B 4C56C 4LLGM 5T8IA 5EE3A 5CX3A 1N60A 2O2VA 1JWBD 3B2GA 1WX9A 3WCQA 3PGEA 2L83A 3P63A 3R2IA 4RF1A 2NCNA 4XGAB 5DPRA 5J18A 1QKZA 4I6NB 4QAYA 4BBNF 3H8HA 1HE8A 4ACFA 1MHXA 3W5UB 2M4NA 3B1LX 4YTPB 3TIXA 4ZRIA 5IAAC 2JSVX 2N9PC 4H2AA 2Z0DB 4IUMB 1WXAA 1YIWA 1NYRA 4M02A 1RAXA 4NQLB 2CU3A 4JWSC 2CJNA 3A33B 4G50A 1I4QA 2BF8B 4M8MA 2WDVB 1RFKA 4N59A 3P4RB 3V3XA 2FIDA 2DX5B 3TCAA 2NVUI 1QT9A 2KVRA 2ONQA 5D3IB 1BT0A 1YD8U 4GDLA 4GDKA 4JWUC 1HTQA 1K53A 3KW5B 2MA9B 1D4BA 1TGZB 2N1VA 2V4LA 3ZVVA 1E7VA 5JHAA 4RCOA 2C7HA 2VH1A 2LRUA 3AXCA 2I1KA 3ENEA 4LTUA 3Q8BA 4A8XC 2N9KA 2KK8A 2INNE 3AE5B 1PUTA 3EHVA 1E90A 2ZVNA 3AEEB 1CMXB 5D2MB 4MGZE 1WXMA 1WRIA 3GE3C 3IBEA 1SIFA 1GAQB 2QEJC 1WZ0A 5D7GA 3Q3JA 3AEDB 4XZ4A 3R66C 2HE7A 4WIPA 1YOVB 2OJWA 2FAZA 3RNCC 1XCQL 4E74A 2WXIA 1RFAA 3P2BA 2X38A 1YNTE 1LFDA 2FNJB 4GOCA 1E9MA 3LB8C 2A4ZA 4PYUA 1ZKHA 2WX1A 1WSPA 4FJYA 1I4PA 1I4RA 2NS5A 3VRAB 1WYWB 3Q8EA 4IKGA 4CO7A 1V1PA 2KN5A 1J0GA 5G5GA 1VJKA 4MELA 1MVKA 3BZDB 1LXDA 2N9XA 3P42A 2J52A 1P9DU 4RGMA 3N32A 1P0RA 4WWPA 3IAS1 1NENB 2BYTA 3MC8A 3NY5A 3VXWA 1IPGA 1WWTA 1SE4A 3QARA 4AOFA 4RFBA 4JL9A 2JYTA 4DHJD 2MQJA 2KLCA 1FPYA 3UIOB 1WMHA 3OJ4B 4HDQA 3WAPA 3W1YA 5H8YE 3OWEB 5G55A 2DWQA 3QQ8B 5HKHA 2OJRA 3MC9A 3AEGB 1VD2A 1TJEA 2KKCA 1WGHA 1WJ4A 3PPAA 4NY0A 4ZRQA 5BYRA 1S3SG 1QOFA 1KFYB 4ARCA 1EU4A 4OVUA 3U2SC 1SJHD 4IG7B 1FXTB 2Y5BB 4EUTA 3ZO5B 4P7IA 2K3UA 2L8JA 5BMIA 1HQRD 4DHZB 2LGXA 2O6VD 2XNAC 5CTRC 1L4ZB 3L13A 3ZJTA 2H88B 3WA0A 1L5PA 1ZDXA 3TBLD 2KFKB 2A5UA 2NR2A 1I7HA 3SFEB 4WWOA 2JZPA 4K1RB 1HXYD 3A9KA 4B9KA 4M0WA 3U7ZA 2W82A 3Q6BA 2ZEQA 1FNUA 4R3DA 2LXCA 1KLUD 3WIMA 4MT5A 1FRDA 4NAMA 4A20A 4CQNA 4HJKA 2D2QA 1UELA 3VR8B 3JSVB 4PS8A 4HPLB 2V0GA 4OZBA 3SD5A 1ENFA 1AWDA 3R7RA 1F9JA 3ZKJC 5D94A 1WXVA 2WDTB 2K6DB 3T3NA 1L0XB 1WXSA 2FCMA 3AH7A 2IYDB 3TL5A 2MJDA 5GMVA 2J0KA 3QC8B 3QK0A 3AM9A 4FLHA 3DHIC 4XX5A 4C4VA 4JGHB 1LQBA 4AS1A 3L08A 4WAAA 4J6IA 2YVCA 1A70A 4LCDE 2GI9A 5CHWA 1WJNA 2VZKB 4W9FA 5AUIA 4KV2A 2KTRB 2KDEB 1F2RI 3DPDA 4MEMA 2SAKA 4IOIE 3A1QA 5E6NA 2J7QB 1JMLA 3PZDA 2L3ZA 1T5XD 1E5WA 3HHMA 1ZW7A 1OEYJ 1TS3A 3Q3NC 3BVGA 1KF6B 3H1UA 4USAA 3HUIA 3DWGC 2D07B 1P7FA 3VH4B 3W9CB 1I4HA 3IXSA 2IGDA 3CIRB 2KMCA 1AYFA 1T0RC 4XC2A 3M63B 5C23A 1F77A 2BTEA 1V80A 3PZ8A 3SEBA 2LUEA 3LXFA 1C9FA 1VZ8A 5JH5C 5BMGA 2R2OA 3AECB 1NDDA 4W9GA 2IBIB 2EELA 1KM7A 2INDC 4WQOB 2LEKA 2N7EA 5KHOA 5G5HA 3MHSD 2C9WB 2MW5A 3NVYA 1ZGUB 3APCA 3DBLB 2ACZB 2WLBA 1GPXA 2CR5A 1MHHE 4ITKA 3PRPB 3E56A 1I35A 4BVUC 1JALA 2IO0B 1WM3A 2MH7A 1XQQA 5H92C 1FMAD 3VAWA 4HVBA 1WGYA 2JQRB 4ICUA 2W54A 1JRPA 1Q5WB 2DHZA 1YQ3B 4KKIA 3I9V1 5J17A 2RR9A 2WXJA 1XLQA 4RNAA 1UF0A 4B6WA 3Q3OC 3VUXA 1J8CA 2PVGC 3URYA 3C8YA 1KLVA 2WXMA 3QJZA 1PGBA 3DHGC 2JUOA 4CHKA 2GBJA 5E6JA 2KQSA 2LGYA 3RT3B 3VH3B 3Q8AA 2KQ4X 2RMMA 2I2YA 1SIJA 3AE8B 3TEWA 4K81A 3N1YC 2QIEB 3DQVA 2LXAA 1XLNA 3CWIA 4GXBA 2ZNVC 2ZNVB 1L0VB 1NI2A 4AJYB 4DK5A 1GB4A 4L23A 2X8XX 4B0EA 2JZ3B 2GBMA 1E7UA 1IGDA 1M94A 5D3DA 2J53A 3B08A 2WU5B 4RMAA 1ACCA 3MJ5A 2QCZA 1CJEA 1SF0A 4LK0M 2Y5PA 3BK1A 3CSFA 3GS2A 3HVDA 2HDEA 1GC6A 1J19A 1ZUD2 2KWVB 3RZWC 1UH6A 2CHZA 2KAJA 3RI7C 3KLSX 3TMPB 2PMVA 4ZDVA 2WXNA 1FNWA 1ZP0B 2RDBC 1N5XA 2FUG1 2KDMA 1WRDB 4LDTB 1NEKB 1WH3A 4RM8A 3R2TA 2GBKA 2VRRB 1GG3A 1EO6A 3EUB2 3OG5A 2MX2A 3ZNGC 1XXGA 1PQSA 2WXPA 5LLIA 1R4MI 1V6EA 2JY6A 3I57A 2ZCBA 1WY8A 3LYYA 2B3AA 3RYTA 4L2YA 4KX6B 3BYYB 1TY0A 4B0MA 4ANXA 1P7EA 4ANUA 5JHBA 2WDRB 4E3CA 4C7YA 3KVFB 4HKQA 1LM8B 4OVZA 4JIOU 1N63A 3UI3A 2L32A 5EE0A 2L52A 5CHVC 2HJ8A 3AI5A 4FULA 2BWES 2INPE 3ZLZA 4IWPA 2KT7A 4BBNC 3DWMA 3WAOA 1QOBA 2PLPA 4OHJA 3GB1A 3AE6B 5C3JB 4DBGA 4AJWA 2KNBA 4MJSA 1WJ6A 3IT6B 4FBJB 3PREA 2K39A 2KTFA 3ZTDA 2OEDA 4AWJA 1V86A 4NZLB 2QDFA 4NAWB 3PHXB 2GRIA 5TR5A 2WXLA 2W3RA 2LMCA 2NPTA 2RPVA 3NVWA 2KANA 1WIAA 1TYGB 4EKUA 5FKAC 3BIID 4IWQA 4PYZA 3N30A 3OAWA 3RCZA 2JU6X 3HK0A 4FJVB 3PRMB 2KHWB 3PHWB 2LRWA 2LI5A 4W9IA 3ML8A 1X1MA 3W5VB 1KOTA 1D6EC 3ZNHB 3TEYA 2XN9C 3TUOA 3VRBB 3PV1A 1JCKB 2ZCCA 4J3OD 2BW2A 3AMZA 2WXGA 1RYJA 3RNEC 4F1SA 4ICVA 2BB6A 3ZYYX 4WH4A 1GC7A 1YJ1A 4BKTA 1WZ3A 4KIKB 3VTUA 3JW0X 1OQYA 1WYGA 3A4SC 1FNVA 3GZNI 4FN2A 3DBHB 1C3TA 2PKOA 2J0JA 1T3QA 2V1YA 1U4AA 1YJJA 2CJOA 3ZTCA 4ANWA 2PVOD 3TEZA 2GB1A 3MFGA 4ZHPA 1V2YA 2ZPYA 2ZZPB 4NJ7A 3SU8X 2JPHA 5L95C 1WE6A 1V5TA 3QCAA 3IAM1 5BYSA 5CHFA 1K8RB 3PS6A 3ZXVA 3W2DA 3L4PA 2DZJA 2L00B 3W1SA 2PTLA 3VHTC 3A4RA 2MP2B 3E9SA 2LD9A 2KMMA 2ZPNA 3ZRCA 2G1EA 3NVZA 3ECIA 3IFWB 3QHTA 4BOZB 1TTNA 1EWCA 3BVMA 4KGTA 4A9AA 1V8CA 1IBXA 1ZOYB 5HFYA 3NJTA 3ONSA 2BYVE 2LHDA 2LFIA 2FE8A 2V9HA 4LJPB 1QILA 3FILB 4KSLC 1XF5L 3N9YC 4FXCA 2N4FA 1ZPSA 1P1AA 3ZQ4A 1V1OA 1T0SC 3ZDTA 4TKNA 1TBEA 3KH0A 4US9A 4WURA 4WJPA 1D5XC 1RRBA 2K9XA 3AN1A 1TS5A 2NTSA 1VZ7A 3QX1A 5FK9C 1WGGA 2M0XA 1XLPA 4YSYB 3A9JB 1T0QC 4EE2A 1ROEA 1LGRA 3RUIB 5C1ZA 3GP7A 2RD0A 3H7PA 1OQRA 3QA8A 3AE2B 1F52A 2K25A 1K50A 1IUEA 4KZ0A 3DHHC 2KWUB 4HEA1 1MG4A 2GBNA 2H89B 2G4DB 1UNSA 2ZW0A 2K8HA 1RLFA 2JT4B 1UWXA 2KC2A 2C5LC 3DVNV 4C00A 1HEZE 3DCGA 5AZHA 3DBRI 3RNGC 5L83A 2VZKD 2M8SA 3T9LA 2BKFA 2XK5B 2JRIB 3VR9B 4OZAA 4TQ1A 1WM2A 4MM3B 1QOGA 2V4IB 1Z5SB 2Z59B 2LHEA 1HA5A 2RGFA 4KGRA 4W9KA 3Q3FA 1WGRA 2KJ6A 1WGKA 2IPKD 4A55A 3R8BA 4GGQA 5I4DA 1PGXA 1XT9B 3AULA 1SBBB 2HTME 2JZZA 4UDUC 1YQ4B 2UYZB 3BYTB 2L0TA 4RF0A 4US8A 5C2TB 5AZFA 4P6VF 3RZFA 2D5GA 2LUMA 5HHDG 4HLEA 3K9PB 2MBOA 2JWUA 4DHJB 2WQYB 3I3TB 5IN7A 3PT2B 4IW0A 3JYUA 3PTFC 3WAMA 2KLGA 1YN5A 2R61A 3DOWA 2NTTA 1OEYA 2GBRA 4NJCA 2IGHA 2KOXA 2PW9A 3M3JA 4W9HA 1J7AA 2K5PA 1E6EB 1D5ZC 4ZHOA 2KN4A 2JRHA 3DBSA 2IO2B 1XLOA 1Y8RC 1TY2A 2M0AA 3H6NA 2IY1B 1FFUA 4ASWC 4HKZE 1QQRA 5EE1A 4F7ZA 1L6UA 3VVWB 1YX5B 1CK1A 2BGFA 5BMHA 4KVGB 1TKGA 3UQAA 1FM0D 1V97A 2KVZA 2PIAA 3SFDB 2O6VB 3LDZE 3PZ7A 1ISNA 5IP4D 1XD3B 2NMQA 4GIVA 2FBWB 3AU4A 4C7ZA 1OFFA 2KWCA 5E6PA 1QF6A 1WF9A 2O2VB 3U7DA 2R2QA 3BK2A 5KHQA 1SSNA 5D6JB 2KZRA 4OVVA 4W9JA 3MC0B 2J42A 4MGIE 2UU7A 4ZRJA 2FCNA 1E8WA 2EMSA 3NZ3A 2INCC 2KWDA 2CHWA 2QC8A 4LNIA 1FD6A 2AX5A 4L1BA 5IO9A 1WX7A 4NJ6A 3EECA 2JVCA 3AEAB 1JWSD 3AE7B 1JROA 1R4NI 2AQ3B 4KZCA 4WWMA 2LVOA 1OGWA 3RULA 2MBHA 4XYCA 3C19A 2HJ1A 2KX0A 1ET9A 2PEAA 1UBIA 2PE6B 3L54A 2D11A 3QIJA 4FA6A 3AE3B 2N9LA 3U30A 1DOXA 4F8CB 2D3GA 4GDLB 5JZEB 2CS4A 4GDKB 4YTMB 2KDBA 3U4EG 2MEKA 4HPMB 3ABVB 2JYEA 2AEHA 2LZ6A 1F1HA 2DAJA 2DBYA 1QOAA 3AB5A 4EFOA 3RMKC 2LVPA 1TKYA 2WU2B 2QILA 3SDLC 3V6CB 1L4DB 3PRZA 3RD2A 4ZRKA 1IGCA 5DCNA 2CU1A 3AEFB 2DZMA 1V9JA 4JX1C 1C4CA 3HIZA 1CZPA 2GLSA 1FEHA 3HM6X 4LJOB 4A90A 2CKHB 2M56B 4MDKE 2AQ2B 4IM3A 2LGSA 4MGYE 1MG8A 3D32A 1F0ZA 3I63C 2G4SA 2MHJA 3TEXA 1P3QU 1B1ZA 1SGHA 2WS3B 3H9DA 2DYMA 3RFZB 1MFWA 2PE9A 4LNKA 1V1PB 1EF1A 4DQOC 3T3OA 1AN8A 4DXAB 3EFCA 3BWUD 4ZYNA 1SE3A 1V81A 1JQ4A 2BWFA 3PO0A 2N7DA 1SB3C 4WQMA 4K3CA 4XDCA 2G9HD 2FCQA 4HDOA 2KFKA 3KUCB 3X23A 1BMLC 1WMHB 2D3CA 1IYFA 1C1YB 2J0MA 5LNK1 3KWVA 2QJLA 1NI3A 1JW9D 1WR6E 2K8BA 2B76B 2YEPB 3HVZA 4YTNB 1RM6C 1Q0WB 1K52A 2IZVB 5HI1A 3JSVA 3PLUA 3AE1B 4Q2JA 3NZUA 2VH2A 2BYEA 4YSXB 3BY4B 1RWSA 2K8CA 1EU3A 4WJNA 1M4VA 3NG0A 3L16A 5BO4B 1E8ZA 3RN9C 3Q2AC 1VCBA 4K7UA 3KQ4A 1KLGD 4BKGA 3VQIA 2ZVOA 5J2RA 1DGJA 2N0SB 2KYWA 1L2NA 2RPQA 3ZJUA 3APFA 3CMMB 4X57B 3B0AA 2V3PA 2HTHA 1G6JA 2D10A 1P98A 3A9KB 2L76A 5DPWA 2I38A 3MP9A 4M0WB 2IDYA 2KTRA 2N9EB 2BS4B 2W3SA 2QMTA 4HCNB 1EUVB 1KTKA 2HD5B 5G2NA 4BKSD 2SEBD 4E71A 2WXFA 4TUUA 4BOSC 1JWAD 2FCSA 1DOIA 5HG2A 1B9RA 4C80A 4AP4C 1QLBB 3EFUA 4M01A 3VTVA 4WWNA 3PSEB 1TZOA 4W9LA 2NBUA 5AZGA 1ZXHA 2BT6A 1N61A 4PT5A 3ZRFA 1UUPA 3Q14C 2FUHB 4AUQC 1ZXIA 4LNNA 4HROA 3RNAC 2WXKA 3OJ3A 4C4VB 2G3QB 1D3ZA 1TS2A 2M19A 3V05A 2CHXA 1XEEA 4XWWA 2MJEA 2IY0B 2MSED 3QWZB 2L7RA 1R4MB 4RH6A 1SEBD 3N3KB 5IA7A 1ZDVA 2TSSA 3A1QB 1MJDA 4EEWA 2IO3B 3X0WA 4REZA 1FIQA 2JXXA 1XO3A 4JQWC 2ICIA 5AEKB 3RNBC 1YN4A 2DZKA 2KDFB 4YT0B 3Q3MC 4FADA 2K22A 3AE4B 4I6LB 5TSSA 3FKYA 3R3MA 5LXHA 4HJGE 2XEWA 4DXFA 1HZ5A 2MBQA 2C7NB 3KWLA 4FHJA 4MH8A 5GXGB 3VDZA 2Z8LA 1WFYA 3LJ3A 3H7SA 2KX3A 4WAFA 2DZIA 4TMAB 1LO5D 2OHFA 4EZLA 3ZJVA 2J4XA 2JXTA 1FO4A 3ZW3A 2WGSA 3DVNU 2KDIA 1E0ZA 1MPEA 3M62B 4BZAA 2BVCA 4ZOHC 2KXJA 4LNOA 4HK2A 3AV8A 2GMIC 2W9NA 4DXGA 4DDID 3B9JA 4W9DA 4S17A 4GSWA 3SR6A 4PS3A 4P1BC 1E8XA 2KJHB 1FCLA 2KFJA 4LNFA 3K9OB 4OZCA 1YMHE 2KACA 4HPPA 2BPSA 2EMTA 4G11A 2KD0A 4KSKC 1I4GA 3N1XC 3ZNZB 2PJHA 2WWZA 1QZEA 5DPSA 1FXIA 5MPOA 1C4AA 3I5JC 5FR3A 3KYCD 1Z2MA 3P4PB 4WJQA 4P16A 1C79A 2LJ5A 2DYBA 1YX6B 4G3XB 3U52E 3BINA 2WXRA 1FFVA 3MTNB 2NBVB 4PS7A 3DVGY 2WYQA 3GZNB 2JWZA 3CSTA 1NYQA 3HM3A 4TV3A 4YSZB 4K7WA 1SE2A 1XCTL 2BKRB 4HRSA 4FHKA 1C77A 4W9CA 3Q8CA 1SJED 1K51A 4W9EA 2M17A 1WXQA 2Z0EB 1WI0A 2E6XA 3NVVA 1HZ6A 3GOEA 3EGRA 1VRAB 2W55A 2D3AA 3ALBA 4KGSA 3ML9A 5LXIB 2WXQA 1H4RA 2KMAA 3WALA 2AWTA 1UWMA 2L05A 4JLCA 2QSDA 1V5OA 2UWQA 1WR1A 1FCCC 3FC4A 2ZW1A 1ET6A 1FRRA 1S1QB 3M95A 2L1AA 3Q8FA 3J9CA 3UQBA 1YJIA 1VR9A 2KJRA 4S0RA 4G0NB 5EDSA 2MRPA 1T0YA 1N6ZA 4A3OA 3OLMD 4P1CC 4GN1A 4HXDA 3UINB 4II3B 2BS2B 5DPTA 2EKEC 2ON8A 1J7CA 3V62A 5EE9A 2K6QA 1UZXB 4HWIB 2KC1A 1GOZA 4M8NA 2Q5WD 4K3BA 2E3TA 1DYQA 3ZUNA 4IM0A 4A3PA 3L10B 2MWSB 4MSMB 4NAWA 2C60A 3KUDB 1GB1A 2BBCA 2M1MA 4IWOA 2DNFA 2N1WA 4AQ7A 1UBQA 2G45B 4DDGD 3CF6E 3ZGZA 4DWFA 1R7SA 3DBLI 4M00A 3VUWA 4KKJA 2BQQA 2L0FA 3NUHB 2GOWA 3UGBB 3RNFC 3NZSA 5FR6A 2MLBA 3JVZX 4N6EB 4D2KA 3DBRB 1STEA 4MGKE 1A5RA 3AU5A 1EF5A 4MJSB 4II2B 1UGMA 1VLBA 2JX5A 4MH0E 4JPSA 1ESFA 1E10A 4ZRPA 2RDGA 5BYQA 2KO3A 2LASA 4ZYSA 2QHOA 4B95A 4XDDA 3NRZA 1I42A 3UIPB 4BKSA 3TJPA 4KIKA 4URKA 2I1JA 3NS1A 1Q1OA 3NS8A 4MACA 2NPTB 1DOYA 2AQ1B 3KYDD 2DAFA 1NBFC 1BUIC 3O13A 3ZNID 3VFKA 2AL3A 3N1ZC 3P1MA 3S2AA 1MI0A 4NPNA 1V49A 1PFDA 5E6OA 4IDIA 1VZ6A 4TSSA 3VUYA 2LGIA 3NHEB 1N62A 1J7BA 3NOBA 2D3BA 2OOBB 3ZDMC 4EZKA 1T6BX 1YN3A 2IO1B 1CQVA 3IG3A 3ZIMA 1TIFA 4YXDB 2YLMA 2ASQA 2MP2A 1GJZA 2V3NA 1F2RC 3KUZA 4XWTA 4K7SA 3EA6A 1KJTA 3HRDD 3RPFC 4FJZA 1OQQA 2BS3B 2DLBA 4I6PA 3QAQA 1I4XA 1E8YA 3MJWA 2MJ3A 1PYWD 1L0YB 3FILA 3IHPC 2MBBB 3PVLA 5IKCM 1N5WA 1L6VA 3EC8A 4YWGG 1E7PB 2Y3AA 4LDTD 4RM9A 1KRHA 2C7MB 4EZJA 4O1NA 4NNJB 2WDQB 1VDVA 1WE7A 4TQ0A 1WGDA 5AUKA 1NVID 3DDCB 4GU2A 1EWYC 1PDXA 3P4QB 2DYOA 4N9F4 3W1SC 2FIFA 3V61A 2XBBC 2WNMA 3A9JA 2RDHA 3P4SB 3ZXRA 4JE3B 2V3SA 2BB5A 1C78A 2BYFA 2WHIA 1YQBA 1OTRB 3IVFA 3B2FA 1SXTA 1Q10A 2K1FA 4CYEA 4DHZE 2EKIA 1IBXB 3T8MA 1HTOA 1R4NB 2REXA 4IM2A 1GNUA 1JWMD 3AE9B 4HCPB 1ZE3D 4MSQB 1WJUA
chains in the Genus database with same CATH topology
3MC9A 2QCZA 3MC8A 3OG5A 3Q6BA 4C00A 2MHJA 2VH1A 4K3CA 3NJTA 4K3BA 4C4VA 2X8XX 4C4VB 2V9HA 2VH2A 2QDFA 4XGAB 3EFCA 4QAYA 4BZAA 4PK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MC9 A;  2QCZ A;  3MC8 A;  3OG5 A;  3Q6B A;  4C00 A;  2MHJ A;  2VH1 A;  4K3C A;  3NJT A;  4K3B A;  4C4V A;  2X8X X;  4C4V B;  2V9H A;  2VH2 A;  2QDF A;  4XGA B;  3EFC A;  4QAY A;  4BZA A;  4PK1 A; 
#chains in the Genus database with same CATH topology
 3APD A;  2LJI A;  3Q69 A;  1JRU A;  3PLV A;  4GB9 A;  1TS4 A;  2XK5 A;  1AAR A;  2Y5C A;  3MHZ A;  4KDL B;  2DEN B;  1H8C A;  3AEB B;  2WXO A;  4MM3 A;  2WXH A;  4XE0 A;  4WJO A;  3C0R B;  1L7Y A;  1PGA A;  1D5M C;  1WX8 A;  3H7P B;  2LWP A;  4EOY A;  4RGN A;  2WX0 A;  3ETR A;  2MBE A;  3L17 A;  1BXT A;  2NBW B;  4GLS C;  4YL8 A;  3SHQ A;  1GUA B;  2AYO B;  4A6Q A;  1TKE A;  4OW0 A;  3VTW A;  1UD7 A;  3GE8 C;  2MCN B;  3U8Z A;  4GMV A;  1TT5 B;  1FXA A;  2K0P A;  4RGT A;  3V60 A;  4ANV A;  2YEP F;  3BVZ A;  4N58 A;  1JWU D;  3FAH A;  2N7J A;  3IT4 B;  4NQK E;  2LVQ A;  2LGD A;  1KH0 A;  5IOI A;  4RGO S;  4BFR A;  1AW7 A;  2IGG A;  3N20 C;  2AL6 A;  1C76 A;  1IP9 A;  2IJ0 A;  3L0W B;  2KQ7 A;  3UF8 A;  2RSU A;  3V6E B;  3TSS A;  2WP9 B;  4KDI C;  4ARI A;  2JF5 A;  1SE9 A;  3R7Q A;  1EM7 A;  2O6V A;  1Y56 A;  3DBH I;  1C4P A;  3WAN A;  2ZJD A;  1TZ1 A;  2PPH A;  4PK1 A;  1UGJ A;  4IC7 B;  4BAX A;  3DVG X;  5JXV A;  3O65 B;  4C56 C;  4LLG M;  5T8I A;  5EE3 A;  5CX3 A;  1N60 A;  2O2V A;  1JWB D;  3B2G A;  1WX9 A;  3WCQ A;  3PGE A;  2L83 A;  3P63 A;  3R2I A;  4RF1 A;  2NCN A;  4XGA B;  5DPR A;  5J18 A;  1QKZ A;  4I6N B;  4QAY A;  4BBN F;  3H8H A;  1HE8 A;  4ACF A;  1MHX A;  3W5U B;  2M4N A;  3B1L X;  4YTP B;  3TIX A;  4ZRI A;  5IAA C;  2JSV X;  2N9P C;  4H2A A;  2Z0D B;  4IUM B;  1WXA A;  1YIW A;  1NYR A;  4M02 A;  1RAX A;  4NQL B;  2CU3 A;  4JWS C;  2CJN A;  3A33 B;  4G50 A;  1I4Q A;  2BF8 B;  4M8M A;  2WDV B;  1RFK A;  4N59 A;  3P4R B;  3V3X A;  2FID A;  2DX5 B;  3TCA A;  2NVU I;  1QT9 A;  2KVR A;  2ONQ A;  5D3I B;  1BT0 A;  1YD8 U;  4GDL A;  4GDK A;  4JWU C;  1HTQ A;  1K53 A;  3KW5 B;  2MA9 B;  1D4B A;  1TGZ B;  2N1V A;  2V4L A;  3ZVV A;  1E7V A;  5JHA A;  4RCO A;  2C7H A;  2VH1 A;  2LRU A;  3AXC A;  2I1K A;  3ENE A;  4LTU A;  3Q8B A;  4A8X C;  2N9K A;  2KK8 A;  2INN E;  3AE5 B;  1PUT A;  3EHV A;  1E90 A;  2ZVN A;  3AEE B;  1CMX B;  5D2M B;  4MGZ E;  1WXM A;  1WRI A;  3GE3 C;  3IBE A;  1SIF A;  1GAQ B;  2QEJ C;  1WZ0 A;  5D7G A;  3Q3J A;  3AED B;  4XZ4 A;  3R66 C;  2HE7 A;  4WIP A;  1YOV B;  2OJW A;  2FAZ A;  3RNC C;  1XCQ L;  4E74 A;  2WXI A;  1RFA A;  3P2B A;  2X38 A;  1YNT E;  1LFD A;  2FNJ B;  4GOC A;  1E9M A;  3LB8 C;  2A4Z A;  4PYU A;  1ZKH A;  2WX1 A;  1WSP A;  4FJY A;  1I4P A;  1I4R A;  2NS5 A;  3VRA B;  1WYW B;  3Q8E A;  4IKG A;  4CO7 A;  1V1P A;  2KN5 A;  1J0G A;  5G5G A;  1VJK A;  4MEL A;  1MVK A;  3BZD B;  1LXD A;  2N9X A;  3P42 A;  2J52 A;  1P9D U;  4RGM A;  3N32 A;  1P0R A;  4WWP A;  3IAS 1;  1NEN B;  2BYT A;  3MC8 A;  3NY5 A;  3VXW A;  1IPG A;  1WWT A;  1SE4 A;  3QAR A;  4AOF A;  4RFB A;  4JL9 A;  2JYT A;  4DHJ D;  2MQJ A;  2KLC A;  1FPY A;  3UIO B;  1WMH A;  3OJ4 B;  4HDQ A;  3WAP A;  3W1Y A;  5H8Y E;  3OWE B;  5G55 A;  2DWQ A;  3QQ8 B;  5HKH A;  2OJR A;  3MC9 A;  3AEG B;  1VD2 A;  1TJE A;  2KKC A;  1WGH A;  1WJ4 A;  3PPA A;  4NY0 A;  4ZRQ A;  5BYR A;  1S3S G;  1QOF A;  1KFY B;  4ARC A;  1EU4 A;  4OVU A;  3U2S C;  1SJH D;  4IG7 B;  1FXT B;  2Y5B B;  4EUT A;  3ZO5 B;  4P7I A;  2K3U A;  2L8J A;  5BMI A;  1HQR D;  4DHZ B;  2LGX A;  2O6V D;  2XNA C;  5CTR C;  1L4Z B;  3L13 A;  3ZJT A;  2H88 B;  3WA0 A;  1L5P A;  1ZDX A;  3TBL D;  2KFK B;  2A5U A;  2NR2 A;  1I7H A;  3SFE B;  4WWO A;  2JZP A;  4K1R B;  1HXY D;  3A9K A;  4B9K A;  4M0W A;  3U7Z A;  2W82 A;  3Q6B A;  2ZEQ A;  1FNU A;  4R3D A;  2LXC A;  1KLU D;  3WIM A;  4MT5 A;  1FRD A;  4NAM A;  4A20 A;  4CQN A;  4HJK A;  2D2Q A;  1UEL A;  3VR8 B;  3JSV B;  4PS8 A;  4HPL B;  2V0G A;  4OZB A;  3SD5 A;  1ENF A;  1AWD A;  3R7R A;  1F9J A;  3ZKJ C;  5D94 A;  1WXV A;  2WDT B;  2K6D B;  3T3N A;  1L0X B;  1WXS A;  2FCM A;  3AH7 A;  2IYD B;  3TL5 A;  2MJD A;  5GMV A;  2J0K A;  3QC8 B;  3QK0 A;  3AM9 A;  4FLH A;  3DHI C;  4XX5 A;  4C4V A;  4JGH B;  1LQB A;  4AS1 A;  3L08 A;  4WAA A;  4J6I A;  2YVC A;  1A70 A;  4LCD E;  2GI9 A;  5CHW A;  1WJN A;  2VZK B;  4W9F A;  5AUI A;  4KV2 A;  2KTR B;  2KDE B;  1F2R I;  3DPD A;  4MEM A;  2SAK A;  4IOI E;  3A1Q A;  5E6N A;  2J7Q B;  1JML A;  3PZD A;  2L3Z A;  1T5X D;  1E5W A;  3HHM A;  1ZW7 A;  1OEY J;  1TS3 A;  3Q3N C;  3BVG A;  1KF6 B;  3H1U A;  4USA A;  3HUI A;  3DWG C;  2D07 B;  1P7F A;  3VH4 B;  3W9C B;  1I4H A;  3IXS A;  2IGD A;  3CIR B;  2KMC A;  1AYF A;  1T0R C;  4XC2 A;  3M63 B;  5C23 A;  1F77 A;  2BTE A;  1V80 A;  3PZ8 A;  3SEB A;  2LUE A;  3LXF A;  1C9F A;  1VZ8 A;  5JH5 C;  5BMG A;  2R2O A;  3AEC B;  1NDD A;  4W9G A;  2IBI B;  2EEL A;  1KM7 A;  2IND C;  4WQO B;  2LEK A;  2N7E A;  5KHO A;  5G5H A;  3MHS D;  2C9W B;  2MW5 A;  3NVY A;  1ZGU B;  3APC A;  3DBL B;  2ACZ B;  2WLB A;  1GPX A;  2CR5 A;  1MHH E;  4ITK A;  3PRP B;  3E56 A;  1I35 A;  4BVU C;  1JAL A;  2IO0 B;  1WM3 A;  2MH7 A;  1XQQ A;  5H92 C;  1FMA D;  3VAW A;  4HVB A;  1WGY A;  2JQR B;  4ICU A;  2W54 A;  1JRP A;  1Q5W B;  2DHZ A;  1YQ3 B;  4KKI A;  3I9V 1;  5J17 A;  2RR9 A;  2WXJ A;  1XLQ A;  4RNA A;  1UF0 A;  4B6W A;  3Q3O C;  3VUX A;  1J8C A;  2PVG C;  3URY A;  3C8Y A;  1KLV A;  2WXM A;  3QJZ A;  1PGB A;  3DHG C;  2JUO A;  4CHK A;  2GBJ A;  5E6J A;  2KQS A;  2LGY A;  3RT3 B;  3VH3 B;  3Q8A A;  2KQ4 X;  2RMM A;  2I2Y A;  1SIJ A;  3AE8 B;  3TEW A;  4K81 A;  3N1Y C;  2QIE B;  3DQV A;  2LXA A;  1XLN A;  3CWI A;  4GXB A;  2ZNV C;  2ZNV B;  1L0V B;  1NI2 A;  4AJY B;  4DK5 A;  1GB4 A;  4L23 A;  2X8X X;  4B0E A;  2JZ3 B;  2GBM A;  1E7U A;  1IGD A;  1M94 A;  5D3D A;  2J53 A;  3B08 A;  2WU5 B;  4RMA A;  1ACC A;  3MJ5 A;  2QCZ A;  1CJE A;  1SF0 A;  4LK0 M;  2Y5P A;  3BK1 A;  3CSF A;  3GS2 A;  3HVD A;  2HDE A;  1GC6 A;  1J19 A;  1ZUD 2;  2KWV B;  3RZW C;  1UH6 A;  2CHZ A;  2KAJ A;  3RI7 C;  3KLS X;  3TMP B;  2PMV A;  4ZDV A;  2WXN A;  1FNW A;  1ZP0 B;  2RDB C;  1N5X A;  2FUG 1;  2KDM A;  1WRD B;  4LDT B;  1NEK B;  1WH3 A;  4RM8 A;  3R2T A;  2GBK A;  2VRR B;  1GG3 A;  1EO6 A;  3EUB 2;  3OG5 A;  2MX2 A;  3ZNG C;  1XXG A;  1PQS A;  2WXP A;  5LLI A;  1R4M I;  1V6E A;  2JY6 A;  3I57 A;  2ZCB A;  1WY8 A;  3LYY A;  2B3A A;  3RYT A;  4L2Y A;  4KX6 B;  3BYY B;  1TY0 A;  4B0M A;  4ANX A;  1P7E A;  4ANU A;  5JHB A;  2WDR B;  4E3C A;  4C7Y A;  3KVF B;  4HKQ A;  1LM8 B;  4OVZ A;  4JIO U;  1N63 A;  3UI3 A;  2L32 A;  5EE0 A;  2L52 A;  5CHV C;  2HJ8 A;  3AI5 A;  4FUL A;  2BWE S;  2INP E;  3ZLZ A;  4IWP A;  2KT7 A;  4BBN C;  3DWM A;  3WAO A;  1QOB A;  2PLP A;  4OHJ A;  3GB1 A;  3AE6 B;  5C3J B;  4DBG A;  4AJW A;  2KNB A;  4MJS A;  1WJ6 A;  3IT6 B;  4FBJ B;  3PRE A;  2K39 A;  2KTF A;  3ZTD A;  2OED A;  4AWJ A;  1V86 A;  4NZL B;  2QDF A;  4NAW B;  3PHX B;  2GRI A;  5TR5 A;  2WXL A;  2W3R A;  2LMC A;  2NPT A;  2RPV A;  3NVW A;  2KAN A;  1WIA A;  1TYG B;  4EKU A;  5FKA C;  3BII D;  4IWQ A;  4PYZ A;  3N30 A;  3OAW A;  3RCZ A;  2JU6 X;  3HK0 A;  4FJV B;  3PRM B;  2KHW B;  3PHW B;  2LRW A;  2LI5 A;  4W9I A;  3ML8 A;  1X1M A;  3W5V B;  1KOT A;  1D6E C;  3ZNH B;  3TEY A;  2XN9 C;  3TUO A;  3VRB B;  3PV1 A;  1JCK B;  2ZCC A;  4J3O D;  2BW2 A;  3AMZ A;  2WXG A;  1RYJ A;  3RNE C;  4F1S A;  4ICV A;  2BB6 A;  3ZYY X;  4WH4 A;  1GC7 A;  1YJ1 A;  4BKT A;  1WZ3 A;  4KIK B;  3VTU A;  3JW0 X;  1OQY A;  1WYG A;  3A4S C;  1FNV A;  3GZN I;  4FN2 A;  3DBH B;  1C3T A;  2PKO A;  2J0J A;  1T3Q A;  2V1Y A;  1U4A A;  1YJJ A;  2CJO A;  3ZTC A;  4ANW A;  2PVO D;  3TEZ A;  2GB1 A;  3MFG A;  4ZHP A;  1V2Y A;  2ZPY A;  2ZZP B;  4NJ7 A;  3SU8 X;  2JPH A;  5L95 C;  1WE6 A;  1V5T A;  3QCA A;  3IAM 1;  5BYS A;  5CHF A;  1K8R B;  3PS6 A;  3ZXV A;  3W2D A;  3L4P A;  2DZJ A;  2L00 B;  3W1S A;  2PTL A;  3VHT C;  3A4R A;  2MP2 B;  3E9S A;  2LD9 A;  2KMM A;  2ZPN A;  3ZRC A;  2G1E A;  3NVZ A;  3ECI A;  3IFW B;  3QHT A;  4BOZ B;  1TTN A;  1EWC A;  3BVM A;  4KGT A;  4A9A A;  1V8C A;  1IBX A;  1ZOY B;  5HFY A;  3NJT A;  3ONS A;  2BYV E;  2LHD A;  2LFI A;  2FE8 A;  2V9H A;  4LJP B;  1QIL A;  3FIL B;  4KSL C;  1XF5 L;  3N9Y C;  4FXC A;  2N4F A;  1ZPS A;  1P1A A;  3ZQ4 A;  1V1O A;  1T0S C;  3ZDT A;  4TKN A;  1TBE A;  3KH0 A;  4US9 A;  4WUR A;  4WJP A;  1D5X C;  1RRB A;  2K9X A;  3AN1 A;  1TS5 A;  2NTS A;  1VZ7 A;  3QX1 A;  5FK9 C;  1WGG A;  2M0X A;  1XLP A;  4YSY B;  3A9J B;  1T0Q C;  4EE2 A;  1ROE A;  1LGR A;  3RUI B;  5C1Z A;  3GP7 A;  2RD0 A;  3H7P A;  1OQR A;  3QA8 A;  3AE2 B;  1F52 A;  2K25 A;  1K50 A;  1IUE A;  4KZ0 A;  3DHH C;  2KWU B;  4HEA 1;  1MG4 A;  2GBN A;  2H89 B;  2G4D B;  1UNS A;  2ZW0 A;  2K8H A;  1RLF A;  2JT4 B;  1UWX A;  2KC2 A;  2C5L C;  3DVN V;  4C00 A;  1HEZ E;  3DCG A;  5AZH A;  3DBR I;  3RNG C;  5L83 A;  2VZK D;  2M8S A;  3T9L A;  2BKF A;  2XK5 B;  2JRI B;  3VR9 B;  4OZA A;  4TQ1 A;  1WM2 A;  4MM3 B;  1QOG A;  2V4I B;  1Z5S B;  2Z59 B;  2LHE A;  1HA5 A;  2RGF A;  4KGR A;  4W9K A;  3Q3F A;  1WGR A;  2KJ6 A;  1WGK A;  2IPK D;  4A55 A;  3R8B A;  4GGQ A;  5I4D A;  1PGX A;  1XT9 B;  3AUL A;  1SBB B;  2HTM E;  2JZZ A;  4UDU C;  1YQ4 B;  2UYZ B;  3BYT B;  2L0T A;  4RF0 A;  4US8 A;  5C2T B;  5AZF A;  4P6V F;  3RZF A;  2D5G A;  2LUM A;  5HHD G;  4HLE A;  3K9P B;  2MBO A;  2JWU A;  4DHJ B;  2WQY B;  3I3T B;  5IN7 A;  3PT2 B;  4IW0 A;  3JYU A;  3PTF C;  3WAM A;  2KLG A;  1YN5 A;  2R61 A;  3DOW A;  2NTT A;  1OEY A;  2GBR A;  4NJC A;  2IGH A;  2KOX A;  2PW9 A;  3M3J A;  4W9H A;  1J7A A;  2K5P A;  1E6E B;  1D5Z C;  4ZHO A;  2KN4 A;  2JRH A;  3DBS A;  2IO2 B;  1XLO A;  1Y8R C;  1TY2 A;  2M0A A;  3H6N A;  2IY1 B;  1FFU A;  4ASW C;  4HKZ E;  1QQR A;  5EE1 A;  4F7Z A;  1L6U A;  3VVW B;  1YX5 B;  1CK1 A;  2BGF A;  5BMH A;  4KVG B;  1TKG A;  3UQA A;  1FM0 D;  1V97 A;  2KVZ A;  2PIA A;  3SFD B;  2O6V B;  3LDZ E;  3PZ7 A;  1ISN A;  5IP4 D;  1XD3 B;  2NMQ A;  4GIV A;  2FBW B;  3AU4 A;  4C7Z A;  1OFF A;  2KWC A;  5E6P A;  1QF6 A;  1WF9 A;  2O2V B;  3U7D A;  2R2Q A;  3BK2 A;  5KHQ A;  1SSN A;  5D6J B;  2KZR A;  4OVV A;  4W9J A;  3MC0 B;  2J42 A;  4MGI E;  2UU7 A;  4ZRJ A;  2FCN A;  1E8W A;  2EMS A;  3NZ3 A;  2INC C;  2KWD A;  2CHW A;  2QC8 A;  4LNI A;  1FD6 A;  2AX5 A;  4L1B A;  5IO9 A;  1WX7 A;  4NJ6 A;  3EEC A;  2JVC A;  3AEA B;  1JWS D;  3AE7 B;  1JRO A;  1R4N I;  2AQ3 B;  4KZC A;  4WWM A;  2LVO A;  1OGW A;  3RUL A;  2MBH A;  4XYC A;  3C19 A;  2HJ1 A;  2KX0 A;  1ET9 A;  2PEA A;  1UBI A;  2PE6 B;  3L54 A;  2D11 A;  3QIJ A;  4FA6 A;  3AE3 B;  2N9L A;  3U30 A;  1DOX A;  4F8C B;  2D3G A;  4GDL B;  5JZE B;  2CS4 A;  4GDK B;  4YTM B;  2KDB A;  3U4E G;  2MEK A;  4HPM B;  3ABV B;  2JYE A;  2AEH A;  2LZ6 A;  1F1H A;  2DAJ A;  2DBY A;  1QOA A;  3AB5 A;  4EFO A;  3RMK C;  2LVP A;  1TKY A;  2WU2 B;  2QIL A;  3SDL C;  3V6C B;  1L4D B;  3PRZ A;  3RD2 A;  4ZRK A;  1IGC A;  5DCN A;  2CU1 A;  3AEF B;  2DZM A;  1V9J A;  4JX1 C;  1C4C A;  3HIZ A;  1CZP A;  2GLS A;  1FEH A;  3HM6 X;  4LJO B;  4A90 A;  2CKH B;  2M56 B;  4MDK E;  2AQ2 B;  4IM3 A;  2LGS A;  4MGY E;  1MG8 A;  3D32 A;  1F0Z A;  3I63 C;  2G4S A;  2MHJ A;  3TEX A;  1P3Q U;  1B1Z A;  1SGH A;  2WS3 B;  3H9D A;  2DYM A;  3RFZ B;  1MFW A;  2PE9 A;  4LNK A;  1V1P B;  1EF1 A;  4DQO C;  3T3O A;  1AN8 A;  4DXA B;  3EFC A;  3BWU D;  4ZYN A;  1SE3 A;  1V81 A;  1JQ4 A;  2BWF A;  3PO0 A;  2N7D A;  1SB3 C;  4WQM A;  4K3C A;  4XDC A;  2G9H D;  2FCQ A;  4HDO A;  2KFK A;  3KUC B;  3X23 A;  1BML C;  1WMH B;  2D3C A;  1IYF A;  1C1Y B;  2J0M A;  5LNK 1;  3KWV A;  2QJL A;  1NI3 A;  1JW9 D;  1WR6 E;  2K8B A;  2B76 B;  2YEP B;  3HVZ A;  4YTN B;  1RM6 C;  1Q0W B;  1K52 A;  2IZV B;  5HI1 A;  3JSV A;  3PLU A;  3AE1 B;  4Q2J A;  3NZU A;  2VH2 A;  2BYE A;  4YSX B;  3BY4 B;  1RWS A;  2K8C A;  1EU3 A;  4WJN A;  1M4V A;  3NG0 A;  3L16 A;  5BO4 B;  1E8Z A;  3RN9 C;  3Q2A C;  1VCB A;  4K7U A;  3KQ4 A;  1KLG D;  4BKG A;  3VQI A;  2ZVO A;  5J2R A;  1DGJ A;  2N0S B;  2KYW A;  1L2N A;  2RPQ A;  3ZJU A;  3APF A;  3CMM B;  4X57 B;  3B0A A;  2V3P A;  2HTH A;  1G6J A;  2D10 A;  1P98 A;  3A9K B;  2L76 A;  5DPW A;  2I38 A;  3MP9 A;  4M0W B;  2IDY A;  2KTR A;  2N9E B;  2BS4 B;  2W3S A;  2QMT A;  4HCN B;  1EUV B;  1KTK A;  2HD5 B;  5G2N A;  4BKS D;  2SEB D;  4E71 A;  2WXF A;  4TUU A;  4BOS C;  1JWA D;  2FCS A;  1DOI A;  5HG2 A;  1B9R A;  4C80 A;  4AP4 C;  1QLB B;  3EFU A;  4M01 A;  3VTV A;  4WWN A;  3PSE B;  1TZO A;  4W9L A;  2NBU A;  5AZG A;  1ZXH A;  2BT6 A;  1N61 A;  4PT5 A;  3ZRF A;  1UUP A;  3Q14 C;  2FUH B;  4AUQ C;  1ZXI A;  4LNN A;  4HRO A;  3RNA C;  2WXK A;  3OJ3 A;  4C4V B;  2G3Q B;  1D3Z A;  1TS2 A;  2M19 A;  3V05 A;  2CHX A;  1XEE A;  4XWW A;  2MJE A;  2IY0 B;  2MSE D;  3QWZ B;  2L7R A;  1R4M B;  4RH6 A;  1SEB D;  3N3K B;  5IA7 A;  1ZDV A;  2TSS A;  3A1Q B;  1MJD A;  4EEW A;  2IO3 B;  3X0W A;  4REZ A;  1FIQ A;  2JXX A;  1XO3 A;  4JQW C;  2ICI A;  5AEK B;  3RNB C;  1YN4 A;  2DZK A;  2KDF B;  4YT0 B;  3Q3M C;  4FAD A;  2K22 A;  3AE4 B;  4I6L B;  5TSS A;  3FKY A;  3R3M A;  5LXH A;  4HJG E;  2XEW A;  4DXF A;  1HZ5 A;  2MBQ A;  2C7N B;  3KWL A;  4FHJ A;  4MH8 A;  5GXG B;  3VDZ A;  2Z8L A;  1WFY A;  3LJ3 A;  3H7S A;  2KX3 A;  4WAF A;  2DZI A;  4TMA B;  1LO5 D;  2OHF A;  4EZL A;  3ZJV A;  2J4X A;  2JXT A;  1FO4 A;  3ZW3 A;  2WGS A;  3DVN U;  2KDI A;  1E0Z A;  1MPE A;  3M62 B;  4BZA A;  2BVC A;  4ZOH C;  2KXJ A;  4LNO A;  4HK2 A;  3AV8 A;  2GMI C;  2W9N A;  4DXG A;  4DDI D;  3B9J A;  4W9D A;  4S17 A;  4GSW A;  3SR6 A;  4PS3 A;  4P1B C;  1E8X A;  2KJH B;  1FCL A;  2KFJ A;  4LNF A;  3K9O B;  4OZC A;  1YMH E;  2KAC A;  4HPP A;  2BPS A;  2EMT A;  4G11 A;  2KD0 A;  4KSK C;  1I4G A;  3N1X C;  3ZNZ B;  2PJH A;  2WWZ A;  1QZE A;  5DPS A;  1FXI A;  5MPO A;  1C4A A;  3I5J C;  5FR3 A;  3KYC D;  1Z2M A;  3P4P B;  4WJQ A;  4P16 A;  1C79 A;  2LJ5 A;  2DYB A;  1YX6 B;  4G3X B;  3U52 E;  3BIN A;  2WXR A;  1FFV A;  3MTN B;  2NBV B;  4PS7 A;  3DVG Y;  2WYQ A;  3GZN B;  2JWZ A;  3CST A;  1NYQ A;  3HM3 A;  4TV3 A;  4YSZ B;  4K7W A;  1SE2 A;  1XCT L;  2BKR B;  4HRS A;  4FHK A;  1C77 A;  4W9C A;  3Q8C A;  1SJE D;  1K51 A;  4W9E A;  2M17 A;  1WXQ A;  2Z0E B;  1WI0 A;  2E6X A;  3NVV A;  1HZ6 A;  3GOE A;  3EGR A;  1VRA B;  2W55 A;  2D3A A;  3ALB A;  4KGS A;  3ML9 A;  5LXI B;  2WXQ A;  1H4R A;  2KMA A;  3WAL A;  2AWT A;  1UWM A;  2L05 A;  4JLC A;  2QSD A;  1V5O A;  2UWQ A;  1WR1 A;  1FCC C;  3FC4 A;  2ZW1 A;  1ET6 A;  1FRR A;  1S1Q B;  3M95 A;  2L1A A;  3Q8F A;  3J9C A;  3UQB A;  1YJI A;  1VR9 A;  2KJR A;  4S0R A;  4G0N B;  5EDS A;  2MRP A;  1T0Y A;  1N6Z A;  4A3O A;  3OLM D;  4P1C C;  4GN1 A;  4HXD A;  3UIN B;  4II3 B;  2BS2 B;  5DPT A;  2EKE C;  2ON8 A;  1J7C A;  3V62 A;  5EE9 A;  2K6Q A;  1UZX B;  4HWI B;  2KC1 A;  1GOZ A;  4M8N A;  2Q5W D;  4K3B A;  2E3T A;  1DYQ A;  3ZUN A;  4IM0 A;  4A3P A;  3L10 B;  2MWS B;  4MSM B;  4NAW A;  2C60 A;  3KUD B;  1GB1 A;  2BBC A;  2M1M A;  4IWO A;  2DNF A;  2N1W A;  4AQ7 A;  1UBQ A;  2G45 B;  4DDG D;  3CF6 E;  3ZGZ A;  4DWF A;  1R7S A;  3DBL I;  4M00 A;  3VUW A;  4KKJ A;  2BQQ A;  2L0F A;  3NUH B;  2GOW A;  3UGB B;  3RNF C;  3NZS A;  5FR6 A;  2MLB A;  3JVZ X;  4N6E B;  4D2K A;  3DBR B;  1STE A;  4MGK E;  1A5R A;  3AU5 A;  1EF5 A;  4MJS B;  4II2 B;  1UGM A;  1VLB A;  2JX5 A;  4MH0 E;  4JPS A;  1ESF A;  1E10 A;  4ZRP A;  2RDG A;  5BYQ A;  2KO3 A;  2LAS A;  4ZYS A;  2QHO A;  4B95 A;  4XDD A;  3NRZ A;  1I42 A;  3UIP B;  4BKS A;  3TJP A;  4KIK A;  4URK A;  2I1J A;  3NS1 A;  1Q1O A;  3NS8 A;  4MAC A;  2NPT B;  1DOY A;  2AQ1 B;  3KYD D;  2DAF A;  1NBF C;  1BUI C;  3O13 A;  3ZNI D;  3VFK A;  2AL3 A;  3N1Z C;  3P1M A;  3S2A A;  1MI0 A;  4NPN A;  1V49 A;  1PFD A;  5E6O A;  4IDI A;  1VZ6 A;  4TSS A;  3VUY A;  2LGI A;  3NHE B;  1N62 A;  1J7B A;  3NOB A;  2D3B A;  2OOB B;  3ZDM C;  4EZK A;  1T6B X;  1YN3 A;  2IO1 B;  1CQV A;  3IG3 A;  3ZIM A;  1TIF A;  4YXD B;  2YLM A;  2ASQ A;  2MP2 A;  1GJZ A;  2V3N A;  1F2R C;  3KUZ A;  4XWT A;  4K7S A;  3EA6 A;  1KJT A;  3HRD D;  3RPF C;  4FJZ A;  1OQQ A;  2BS3 B;  2DLB A;  4I6P A;  3QAQ A;  1I4X A;  1E8Y A;  3MJW A;  2MJ3 A;  1PYW D;  1L0Y B;  3FIL A;  3IHP C;  2MBB B;  3PVL A;  5IKC M;  1N5W A;  1L6V A;  3EC8 A;  4YWG G;  1E7P B;  2Y3A A;  4LDT D;  4RM9 A;  1KRH A;  2C7M B;  4EZJ A;  4O1N A;  4NNJ B;  2WDQ B;  1VDV A;  1WE7 A;  4TQ0 A;  1WGD A;  5AUK A;  1NVI D;  3DDC B;  4GU2 A;  1EWY C;  1PDX A;  3P4Q B;  2DYO A;  4N9F 4;  3W1S C;  2FIF A;  3V61 A;  2XBB C;  2WNM A;  3A9J A;  2RDH A;  3P4S B;  3ZXR A;  4JE3 B;  2V3S A;  2BB5 A;  1C78 A;  2BYF A;  2WHI A;  1YQB A;  1OTR B;  3IVF A;  3B2F A;  1SXT A;  1Q10 A;  2K1F A;  4CYE A;  4DHZ E;  2EKI A;  1IBX B;  3T8M A;  1HTO A;  1R4N B;  2REX A;  4IM2 A;  1GNU A;  1JWM D;  3AE9 B;  4HCP B;  1ZE3 D;  4MSQ B;  1WJU A; 
#chains in the Genus database with same CATH homology
 3MC9 A;  2QCZ A;  3MC8 A;  3OG5 A;  3Q6B A;  4C00 A;  2MHJ A;  2VH1 A;  4K3C A;  3NJT A;  4K3B A;  4C4V A;  2X8X X;  4C4V B;  2V9H A;  2VH2 A;  2QDF A;  4XGA B;  3EFC A;  4QAY A;  4BZA A;  4PK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...