3Q6BA

The high-resolution and new form crystal structure of bama potra4-5 from e.coli
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
b'YKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein assembly complex, YaeT protein
molecule tags Protein binding
source organism Escherichia coli
publication title High-resolution structure of a new crystal form of BamA POTRA4-5 from Escherichia coli.
pubmed doi rcsb
total genus 50
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2010-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3q6bA01
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3q6bA02
3Q6BA 3EFCA 4K3BA 4C00A 4BZAA 4XGAB 4C4VB 3MC9A 4QAYA 2VH1A 2X8XX 2QCZA 3OG5A 2MHJA 2VH2A 4C4VA 4K3CA 4PK1A 2V9HA 2QDFA 3NJTA 3MC8A
chains in the Genus database with same CATH superfamily
2ZJDA 3APFA 2HTME 2WXPA 5BYQA 2N9EB 4YWGG 2IY1B 4M8NA 1BXTA 1JQ4A 1I4PA 4YSZB 2RR9A 1SJHD 2MSED 5E6PA 3WALA 1D5XC 2INNE 2KJ6A 4WJQA 3R2TA 2VZKB 4TUUA 3GS2A 3GZNB 1YJJA 3HM3A 2EMSA 3D32A 3PSEB 2LGYA 2W3SA 1IP9A 2JVCA 3NOBA 2K8CA 1SIFA 2BW2A 4YT0B 1V81A 2MBQA 1IYFA 5D2MB 3W1YA 4KV2A 1V9JA 4I6LB 4A20A 2C7NB 1Q1OA 2DZMA 3Q3NC 2D5GA 3VVWB 1TKYA 1SE2A 1VR9A 1SBBB 1T3QA 1C9FA 2H88B 2JWZA 3DOWA 3BYYB 3U7ZA 3QIJA 2RD0A 3IHPC 3ZUNA 2KD0A 2LUMA 4K1RB 1WGDA 1VZ6A 1Z2MA 3KUDB 1N60A 3W5UB 3JYUA 1SEBD 2LEKA 3PPAA 3OLMD 3PRZA 1GNUA 4K7WA 3RD2A 2KDFB 3NZSA 1JW9D 1WX9A 1A5RA 4GGQA 4DDID 2M19A 3DBSA 1S1QB 1T0QC 1TIFA 1G6JA 1OFFA 1YJ1A 4KGTA 1A70A 5BMHA 3NS8A 1VRAB 1EF5A 1NYQA 1TY2A 1XEEA 1F9JA 2WXQA 1WGHA 4MM3A 3Q3OC 2ONQA 1E7UA 2R2QA 4YTNB 2L0FA 1V2YA 3PTFC 4HCPB 3DBHB 4LJOB 2QILA 3VHTC 1F1HA 1ROEA 2CJNA 1J7AA 2M4NA 1ACCA 2VZKD 2RDHA 2G3QB 1DOIA 1WFYA 1WXAA 1ZPSA 1F0ZA 4A6QA 1WZ3A 2LGIA 3N20C 4AWJA 3QK0A 3P63A 5CHVC 3RNCC 2TSSA 4EKUA 2OEDA 3A33B 1E90A 2N7DA 1JCKB 3M62B 5HI1A 2GBJA 2INCC 1UH6A 3N30A 3DBHI 3FILB 2J4XA 4NAWB 4ITKA 4E74A 2LZ6A 2D11A 1E0ZA 4C4VA 2PJHA 4LLGM 1V49A 2WX1A 2IZVB 2ZCCA 4HPLB 2M17A 2N7JA 3BK1A 3I9V1 5C23A 1MFWA 4HKZE 1P7EA 2JWUA 3MHZA 4MGIE 2MH7A 2MQJA 5D7GA 3IT4B 1HZ6A 3NVZA 5DPWA 5GMVA 4XDCA 4N9F4 1RRBA 2IGHA 3KYDD 1TZOA 1TYGB 1C3TA 4NY0A 1CQVA 2MWSB 4ZRPA 2WX0A 3PT2B 3IVFA 4GMVA 3DVNV 2INDC 2ZNVC 4JWUC 5L83A 2XK5B 2G4SA 2LHDA 1XXGA 2BYEA 2N4FA 1AN8A 2K39A 1QF6A 2KC2A 1SGHA 4BOSC 1NENB 5BYRA 4DHJB 5FKAC 4FJVB 1ISNA 2WXMA 4FJYA 3BIID 1KFYB 4MJSA 4ARIA 3QARA 2J0JA 5AEKB 1WI0A 2M56B 3EGRA 4P7IA 2NVUI 1FRRA 1D4BA 2PIAA 1WM2A 3VRBB 2LASA 1FNWA 2DAFA 1WXQA 1IBXA 4ZRKA 1E7PB 4BFRA 1YN3A 2KMAA 3CSFA 2X8XX 3V60A 2LVPA 4S17A 3RNBC 1Q0WB 4W9DA 1L4ZB 3WAOA 1MHXA 4LDTB 4GOCA 1SB3C 2LRUA 1YOVB 2GBKA 2KO3A 3IBEA 2ZCBA 1NBFC 1V8CA 4IOIE 3T3NA 1PQSA 4WWNA 4RGOS 2Y3AA 1OTRB 2FCQA 2V1YA 1M4VA 4A3OA 2IO1B 1WZ0A 3ALBA 2G4DB 2Z0EB 4MGZE 4MSQB 1VZ8A 1YQBA 1WR1A 2KNBA 2DENB 3BYTB 2Q5WD 1YMHE 3P4QB 4KSLC 1ZP0B 3A9JA 4CO7A 2LMCA 4DHJD 1I4GA 3LXFA 5IOIA 3VTVA 3N1ZC 2FAZA 3ZDTA 3B1LX 4KX6B 3ZYYX 2R2OA 3P4PB 2WDQB 4F7ZA 2L32A 3AV8A 3UQAA 2JQRB 2UU7A 1K8RB 1TY0A 4RGMA 1SXTA 3AECB 3ZTCA 4AJYB 2FUHB 2KKCA 3PZ7A 5JXVA 2MA9B 2GMIC 2L0TA 2D3AA 1V1PB 2AWTA 2M8SA 3VQIA 1PDXA 5JZEB 5DPRA 1L0VB 2CHWA 2D07B 3E56A 2G45B 2MJEA 3NY5A 1EF1A 4RF1A 2JYTA 4JLCA 5HFYA 3U30A 1QILA 2O6VB 4OZAA 3L16A 2WXOA 1LGRA 3RNEC 4FBJB 3JSVA 5AUKA 1YQ4B 2EELA 2MEKA 3N9YC 4KDLB 5HKHA 4FA6A 3MJWA 4BKSA 2VH1A 2K6QA 3PZDA 2ZZPB 1GUAB 3NZUA 4M8MA 2UYZB 1E5WA 3TEXA 1L2NA 3QWZB 4AQ7A 2JZZA 3GE8C 2WYQA 2A5UA 3TUOA 4ZRIA 1T0SC 3VUYA 2VRRB 3B9JA 3A9KA 5IN7A 2HJ8A 2QIEB 2WXNA 1OQRA 2AQ1B 1XO3A 1RAXA 1P3QU 1F2RC 4GU2A 2DNFA 2K0PA 1GAQB 2KX0A 2FCNA 4BKTA 4GDLA 4W9HA 1NDDA 2H89B 1RWSA 2D3GA 4ANWA 3B2GA 2MP2B 2X38A 4W9EA 1MJDA 1EUVB 4I6NB 3KVFB 1MG4A 1FNVA 1N62A 2PVGC 3LB8C 3W1SC 4MELA 1FIQA 4A8XC 4E3CA 2L05A 2KAJA 4US9A 4QAYA 4NJ7A 4OZBA 1LO5D 4AS1A 1AYFA 4G11A 1RYJA 1JWMD 2KDBA 4IG7B 3VR8B 1NEKB 1KLVA 2V3NA 3HM6X 4K7UA 2K8BA 4HRSA 2DBYA 4N59A 4JGHB 3KW5B 2RPVA 1C79A 1CJEA 3B2FA 3AE5B 3EC8A 4P1BC 4DDGD 1K51A 1I4RA 3VH4B 1ET6A 2IO2B 5EE3A 3ML9A 4PK1A 3HIZA 2XN9C 1UD7A 4FN2A 2BYVE 2KJHB 4NAWA 1YX6B 2W54A 3VR9B 1IGCA 3VXWA 4HVBA 1QLBB 1VCBA 3BVZA 1FPYA 4W9LA 5IP4D 3Q3MC 2LGDA 5G2NA 2BKFA 1L7YA 3RFZB 1TKGA 3SFDB 2BS2B 5AZFA 3CWIA 4I6PA 1FXAA 1N5XA 1Z5SB 3TMPB 2KQ7A 2ZNVB 3ZO5B 2QCZA 3SFEB 2IDYA 3PS6A 2YEPB 1GOZA 5J18A 4RNAA 3LYYA 4KKIA 2C7MB 4L2YA 3EFUA 2Z59B 2QMTA 2ZW0A 4LNIA 2Z0DB 3LDZE 3TCAA 1NI2A 4C4VB 4N6EB 4F1SA 3QHTA 1T0YA 2I2YA 2XNAC 2GB1A 5FK9C 1I42A 2PPHA 2J0MA 2ZPYA 4B0EA 4DK5A 3H7PA 4KVGB 1KLUD 1XLOA 3WAMA 2BWFA 3B08A 3MC8A 2JY6A 4RCOA 1T0RC 1HTOA 3Q8EA 2RMMA 5LXHA 1F2RI 4Q2JA 4YSYB 3C0RB 3M63B 2D2QA 4ZHPA 1DOYA 4IDIA 2BVCA 1XCTL 1UELA 1VDVA 2L76A 1L0XB 2V3SA 3DBRB 2NBUA 4KZ0A 2MCNB 2GBMA 1WRDB 2AL3A 4KIKA 2O6VA 4BOZB 4ANUA 2AX5A 4USAA 2OOBB 1T6BX 3HVDA 1HE8A 3SDLC 2QC8A 2CU3A 2NTTA 2KX3A 4DXAB 1LM8B 2WXRA 2JXXA 4ASWC 1STEA 1IBXB 3AXCA 2K6DB 2LD9A 3V3XA 1M94A 2WHIA 1C78A 4URKA 2LGXA 2WXHA 4MM3B 3FC4A 1V1PA 2KMCA 3AU4A 2KJRA 3ZRCA 3EECA 2PE9A 1E6EB 3AEEB 2KMMA 2L83A 5H92C 4L23A 2GBRA 4S0RA 4MT5A 1XD3B 2WP9B 1TT5B 1VZ7A 3AEBB 3VRAB 1JWSD 2JXTA 2LGSA 2MBOA 1E8ZA 4UDUC 1WE6A 2JYEA 4G50A 4TV3A 3A9JB 1JROA 3A1QA 1MHHE 3ENEA 4EEWA 2JZPA 3WAPA 1OQQA 3C8YA 3OG5A 1DGJA 4WJOA 1YD8U 4IC7B 2W82A 3HHMA 2J42A 1FRDA 4C56C 1WY8A 2KACA 3H8HA 4PS7A 3IAM1 3ZKJC 2RDGA 1ESFA 4X57B 4OVVA 4NAMA 4PT5A 2E3TA 5T8IA 1NI3A 2KDIA 2KTFA 3GZNI 3L0WB 2KTRA 1XLNA 2KN5A 4WAAA 4OVUA 1E8XA 2DZIA 2W3RA 1TKEA 3WANA 3AH7A 3WCQA 4NZLB 2D10A 2KQ4X 2IYDB 1WGKA 1WF9A 4IM3A 4DHZB 1WGYA 2RGFA 1FFVA 1JWUD 4TSSA 3J9CA 1R4MB 1D3ZA 3RNAC 1KJTA 4MEMA 1RFKA 3AEAB 4HDQA 3IAS1 4OZCA 5BYSA 2JT4B 3RYTA 4EZJA 4K81A 4BVUC 1FMAD 1L4DB 4GIVA 3BZDB 2AL6A 3UIOB 1K53A 4ZYSA 2DHZA 1GG3A 4XE0A 3RPFC 3TL5A 3BVMA 5TR5A 4MGYE 2WDTB 5JHAA 3KH0A 2L1AA 4JL9A 3RULA 5MPOA 3P42A 1YN5A 4AOFA 1H8CA 4B6WA 4R3DA 2WXKA 4H2AA 1YNTE 3NVYA 3VTWA 2KXJA 3QAQA 1SE9A 3DWMA 5DCNA 1QT9A 1KLGD 2LI5A 4ANXA 3ZJTA 3HK0A 2QEJC 4PYZA 1XQQA 2NS5A 3DDCB 2BS4B 2KN4A 4D2KA 1P7FA 2RSUA 3UI3A 2MHJA 1L5PA 3W2DA 3Q8BA 5CHWA 1TGZB 1FNUA 3APCA 5LLIA 3NZ3A 3DVGX 2MBHA 3U8ZA 2SAKA 3JVZX 4E71A 1PUTA 1ZDVA 3OWEB 5I4DA 3ZJUA 4K3BA 1VD2A 3ZGZA 2LJIA 4DHZE 1AWDA 3PHWB 2IGDA 3PHXB 4EZLA 3T3OA 3DBLI 3W1SA 3TBLD 3AE1B 4ACFA 2KZRA 3ZVVA 2V9HA 3A4RA 1TBEA 1BUIC 1F77A 4JX1C 3KWLA 2J52A 4W9KA 1QKZA 2W9NA 1ZE3D 2BTEA 3MJ5A 2V3PA 4IKGA 1UGJA 2WXFA 2OHFA 1BMLC 1SJED 3I63C 4YSXB 2RDBC 4LJPB 1WXVA 1CMXB 3ONSA 1B1ZA 5AUIA 2ICIA 3E9SA 2IJ0A 1CK1A 3OAWA 5IO9A 2E6XA 2FBWB 5CTRC 1XCQL 4BZAA 2N9KA 1WGGA 3Q3JA 4WWPA 3L54A 4RGTA 1QOAA 3V62A 3L08A 3PO0A 4W9FA 3T8MA 1HEZE 4BKSD 1UBIA 1ENFA 2KQSA 3NJTA 1FFUA 1JRPA 4PS3A 2L7RA 4II2B 1KRHA 3DBRI 5CX3A 2CR5A 1V5TA 2FIDA 3AU5A 4ANVA 1WJ6A 1MG8A 2WQYB 1WH3A 1R4NB 2DZJA 1PYWD 4LDTD 4DQOC 2RPQA 4A9AA 2LXAA 3R7RA 5EDSA 2J0KA 1JWBD 2KANA 2I1JA 3AEGB 1Y8RC 1C76A 2B76B 4TQ0A 1TTNA 3P1MA 3L17A 4MACA 4KKJA 2WNMA 2L52A 3R3MA 3V6CB 3KQ4A 3O13A 2KWUB 1GC7A 4IWOA 1I4QA 4RM8A 2KC1A 1LQBA 1L6VA 2BYFA 3DPDA 1PGBA 4XZ4A 2NTSA 3ZDMC 2KFJA 4WQOB 3ZTDA 4DWFA 3ECIA 2DLBA 3AE9B 1JWAD 3L13A 2UWQA 1HXYD 2M0AA 2WDRB 2BGFA 3P2BA 3AEFB 4YL8A 2DYOA 4NPNA 3TJPA 4ZDVA 2KLGA 5J17A 3OJ4B 4PYUA 2N7EA 4ZHOA 1ZUD2 3PLVA 3PREA 1VLBA 1XLPA 1KTKA 3H1UA 1L6UA 4HXDA 3ML8A 3VH3B 2DWQA 5DPSA 2V0GA 2WU5B 1WJNA 1JRUA 2JU6X 3KUZA 4M0WA 1WX8A 1TJEA 3R8BA 3TEYA 3BY4B 4LK0M 4TMAB 2QHOA 2C60A 3I57A 1C1YB 4XDDA 3EFCA 1QOBA 1PGAA 3V6EB 4ICVA 2REXA 1ZDXA 1E7VA 1K50A 2L3ZA 3FAHA 3ZJVA 2V4IB 1C4AA 1EU4A 1U4AA 2GLSA 4FHKA 4L1BA 4JPSA 2XEWA 4XYCA 3NHEB 2KOXA 2MBEA 4A90A 4LNOA 3ZNID 3DCGA 4IW0A 5CHFA 1B9RA 2A4ZA 5E6NA 4GXBA 1UZXB 3A1QB 4M02A 2KVRA 2MX2A 2BKRB 3NVWA 1WE7A 4XWTA 5IKCM 2LFIA 2KT7A 4PS8A 1Q10A 4GSWA 5G55A 1P98A 4MGKE 2ZW1A 3IFWB 4O1NA 4HK2A 5C2TB 2BB6A 5J2RA 2JZ3B 4HJGE 1TZ1A 3MC9A 2NPTB 4GDKA 2N0SB 2KVZA 1SF0A 4J3OD 5D3DA 2KDEB 4NQLB 1AARA 1MI0A 3DVNU 2JUOA 3C19A 2DYBA 2R61A 1D5MC 1IGDA 1FO4A 1J7BA 1GB1A 1P9DU 5KHOA 1N61A 2I1KA 3B0AA 3DWGC 3AB5A 4GLSC 4YXDB 4HPPA 1YN4A 4JQWC 3K9PB 3MFGA 3MP9A 1D5ZC 3AE4B 1IPGA 3ZRFA 3Q14C 1FEHA 2VH2A 3JSVB 1C77A 4TKNA 1MVKA 2DAJA 1WXMA 2KTRB 2NCNA 3RNGC 4JIOU 1UWMA 2OJRA 2W55A 4LTUA 3AI5A 4US8A 2QJLA 1BT0A 4EZKA 1PGXA 3DVGY 4HWIB 4P16A 5G5GA 3TEWA 2KFKB 3A4SC 1XF5L 4K3CA 3Q3FA 1R7SA 1UGMA 2KWCA 4C7YA 3VFKA 4DBGA 1GC6A 4IWPA 4FADA 4TQ1A 3QX1A 1QQRA 2AEHA 4MH0E 1KH0A 4EE2A 2K3UA 3H7SA 4NNJB 2LRWA 2K8HA 1NYRA 1H4RA 1FCLA 2J7QB 4AUQC 3QCAA 3NVVA 3DQVA 4LNNA 1R4MI 4ARCA 1C4CA 1ET9A 4HDOA 4JE3B 4IUMB 3Q6BA 2N1WA 2IGGA 2PLPA 3AE3B 3ZNGC 1OEYA 1K52A 5IAAC 3RZWC 2G1EA 2JF5A 2N9PC 3RN9C 2BBCA 3R66C 1RM6C 4FLHA 3UGBB 1SSNA 3ZXVA 4CHKA 1DOXA 1WWTA 1E10A 2L8JA 3IXSA 3L4PA 2IBIB 1FXTB 2SEBD 1GJZA 2AQ3B 1X1MA 1HQRD 1FXIA 1N63A 1WGRA 2CU1A 3DHHC 2JRHA 2LHEA 4FJZA 2D3CA 1V86A 2EKIA 4G0NB 1UWXA 3RI7C 1FD6A 2LWPA 1EM7A 3SR6A 1QOFA 3V61A 2LVQA 1KF6B 2J53A 4HPMB 5EE9A 3BK2A 4LCDE 2HE7A 4DXGA 1ZGUB 2MW5A 3BVGA 2IO0B 4XWWA 4XX5A 3AEDB 3PLUA 4GN1A 1EU3A 2BS3B 3APDA 3RZFA 1XLQA 2BQQA 2JPHA 4BKGA 1JALA 2NPTA 1UUPA 4GDKB 1EWCA 4G3XB 3ZNZB 2PMVA 3QC8B 1FCCC 5G5HA 3BWUD 3VUWA 2PW9A 3QJZA 2JX5A 3BINA 2KWDA 4ZOHC 1WSPA 1IUEA 2INPE 2BPSA 5H8YE 2N1VA 3N1YC 2IY0B 3JW0X 3TSSA 3M95A 5LXIB 4WAFA 4N58A 4KIKB 4ZYNA 4KSKC 3N3KB 4XGAB 3RUIB 4DXFA 2CS4A 3KYCD 3O65B 2C7HA 2PE6B 1TS4A 3V05A 4EUTA 1XT9B 3KLSX 4OHJA 2K5PA 1LXDA 3GP7A 5BO4B 4FHJA 3M3JA 2B3AA 3FKYA 4F8CB 3PRMB 2HDEA 5D94A 3RT3B 1QOGA 1KOTA 1ZKHA 4CYEA 4AP4C 3ZNHB 2WU2B 2OJWA 3ZLZA 1C4PA 4HJKA 1WM3A 1ZXIA 4MJSB 1RFAA 2HD5B 1OQYA 4M00A 4XC2A 3AE7B 3IG3A 2O2VB 3I3TB 2QDFA 3ZW3A 1F52A 4GB9A 3FILA 3HVZA 2PTLA 1E8YA 2BF8B 4II3B 2BT6A 1I7HA 4W9JA 1YX5B 4A3PA 4FULA 4KDIC 1YQ3B 1WRIA 4RH6A 4OVZA 1OEYJ 1J7CA 1DYQA 3OJ3A 2D3BA 3U7DA 3ABVB 3N1XC 3R2IA 3AN1A 1GB4A 1WXSA 4C00A 1EO6A 2MRPA 3DHGC 3LJ3A 1I4XA 3KUCB 2BWES 2I38A 1SE4A 4WJPA 1P1AA 4B95A 2NBVB 1E8WA 4ZRQA 4HKQA 3MC0B 1LFDA 4MSMB 1J8CA 2MP2A 3AE2B 1E9MA 4NJ6A 5LNK1 1YJIA 4WJNA 2LVOA 2C5LC 1WYGA 3U52E 2LUEA 4W9CA 5EE1A 4WQMA 5L95C 3NRZA 1V6EA 2EKEC 1HTQA 1WYWB 1ZW7A 1I4HA 4WWOA 1V5OA 3Q69A 3W5VB 3CF6E 3GB1A 5HG2A 2ACZB 2NBWB 2NMQA 3TEZA 2LJ5A 2BYTA 4BBNF 2CKHB 2GRIA 3AULA 2XBBC 2GI9A 5JH5C 5DPTA 2ON8A 3PZ8A 3GE3C 3WIMA 2MLBA 3NG0A 2AQ2B 2LXCA 2MJ3A 4C7ZA 5D6JB 3R7QA 3X23A 1N5WA 1WJUA 5EE0A 2YLMA 1VJKA 4IM0A 2BB5A 4W9IA 4EOYA 1R4NI 4RFBA 1WX7A 1I35A 3PVLA 4WWMA 3S2AA 5TSSA 3RNFC 3SD5A 2C9WB 2IO3B 3MHSD 3IT6B 5E6OA 2FIFA 2K25A 2DX5B 3KWVA 2MBBB 3Q8CA 3P4RB 2KK8A 4KGSA 4HLEA 1V80A 4J6IA 2NR2A 3URYA 2JSVX 3RCZA 1WJ4A 3H9DA 1WR6E 5AZGA 2FCMA 3A9KB 4WURA 4A55A 1TS3A 1TS2A 4FXCA 2JRIB 2N9LA 4RF0A 2DYMA 2WXIA 2KWVB 3HRDD 4P1CC 3ZQ4A 3HUIA 5BMGA 4LNFA 2WXGA 1CZPA 2XK5A 1PFDA 1D6EC 1Q5WB 3AE8B 3UINB 3VUXA 2GBNA 4EFOA 5IA7A 1SE3A 3H6NA 2KHWB 2PVOD 3CIRB 2KYWA 5AZHA 3VDZA 3AMZA 4OW0A 2K1FA 4RGNA 1V1OA 4HROA 1GPXA 3QA8A 2ZVNA 1SIJA 1EWYC 3PV1A 1V97A 4M01A 3H7PB 2L00B 5HHDG 2K9XA 2KLCA 4JWSC 4RM9A 2ASQA 4WH4A 1TS5A 2O2VA 2KDMA 5C1ZA 3MTNB 1MPEA 4NJCA 2IPKD 3NS1A 4RMAA 2M1MA 3WA0A 2FE8A 2ZPNA 4CQNA 2Z8LA 3Q8FA 1S3SG 4IM2A 4MH8A 5JHBA 3NUHB 2V4LA 4BBNC 2WLBA 1ZOYB 4AJWA 1AW7A 4BAXA 3X0WA 2FNJB 1KM7A 3N32A 4C80A 2Y5BB 2HTHA 4B0MA 3TIXA 1P0RA 4W9GA 4KZCA 5GXGB 3SU8X 2FUG1 2GOWA 2AYOB 2MJDA 3EUB2 3DBLB 4YTPB 2G9HD 4K7SA 4B9KA 2ZEQA 1UF0A 3ETRA 2FCSA 1J0GA 4P6VF 1YIWA 4ICUA 2YEPF 2KFKA 1N6ZA 3I5JC 5FR6A 4WIPA 4LNKA 3EA6A 2CJOA 3T9LA 3VTUA 5FR3A 3UF8A 4NQKE 1T5XD 3CSTA 5E6JA 2N9XA 3RMKC 3AM9A 1RLFA 3EHVA 1HZ5A 1Y56A 3QQ8B 2YVCA 1ZXHA 3W9CB 1QZEA 2QSDA 2WXJA 1WMHA 2HJ1A 2CHZA 3P4SB 5BMIA 3Q2AC 1UBQA 2Y5CA 4HCNB 2K22A 3PGEA 2M0XA 2WXLA 2PEAA 2PKOA 2ZVOA 4HEA1 1UNSA 3VAWA 2CHXA 2DZKA 2WWZA 1JMLA 4REZA 2WDVB 2EMTA 1WMHB 5C3JB 4KGRA 3K9OB 1J19A 3ZXRA 3UIPB 3PRPB 1L0YB 1OGWA 3Q8AA 5D3IB 4M0WB 3L10B 3AE6B 3SEBA 4ZRJA 5KHQA 1WIAA 2O6VD 4YTMB 3UQBA 1NVID 3GOEA 3U2SC 3SHQA 4GDLB 2WGSA 2Y5PA 3U4EG 1FM0D 3ZIMA 4IWQA 2WS3B 4MDKE 1HA5A 3CMMB 3DHIC
chains in the Genus database with same CATH topology
3Q6BA 3EFCA 4K3BA 4C00A 4BZAA 4XGAB 4C4VB 3MC9A 4QAYA 2VH1A 2X8XX 2QCZA 3OG5A 2MHJA 2VH2A 4C4VA 4K3CA 4PK1A 2V9HA 2QDFA 3NJTA 3MC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6B A;  3EFC A;  4K3B A;  4C00 A;  4BZA A;  4XGA B;  4C4V B;  3MC9 A;  4QAY A;  2VH1 A;  2X8X X;  2QCZ A;  3OG5 A;  2MHJ A;  2VH2 A;  4C4V A;  4K3C A;  4PK1 A;  2V9H A;  2QDF A;  3NJT A;  3MC8 A; 
#chains in the Genus database with same CATH topology
 2ZJD A;  3APF A;  2HTM E;  2WXP A;  5BYQ A;  2N9E B;  4YWG G;  2IY1 B;  4M8N A;  1BXT A;  1JQ4 A;  1I4P A;  4YSZ B;  2RR9 A;  1SJH D;  2MSE D;  5E6P A;  3WAL A;  1D5X C;  2INN E;  2KJ6 A;  4WJQ A;  3R2T A;  2VZK B;  4TUU A;  3GS2 A;  3GZN B;  1YJJ A;  3HM3 A;  2EMS A;  3D32 A;  3PSE B;  2LGY A;  2W3S A;  1IP9 A;  2JVC A;  3NOB A;  2K8C A;  1SIF A;  2BW2 A;  4YT0 B;  1V81 A;  2MBQ A;  1IYF A;  5D2M B;  3W1Y A;  4KV2 A;  1V9J A;  4I6L B;  4A20 A;  2C7N B;  1Q1O A;  2DZM A;  3Q3N C;  2D5G A;  3VVW B;  1TKY A;  1SE2 A;  1VR9 A;  1SBB B;  1T3Q A;  1C9F A;  2H88 B;  2JWZ A;  3DOW A;  3BYY B;  3U7Z A;  3QIJ A;  2RD0 A;  3IHP C;  3ZUN A;  2KD0 A;  2LUM A;  4K1R B;  1WGD A;  1VZ6 A;  1Z2M A;  3KUD B;  1N60 A;  3W5U B;  3JYU A;  1SEB D;  2LEK A;  3PPA A;  3OLM D;  3PRZ A;  1GNU A;  4K7W A;  3RD2 A;  2KDF B;  3NZS A;  1JW9 D;  1WX9 A;  1A5R A;  4GGQ A;  4DDI D;  2M19 A;  3DBS A;  1S1Q B;  1T0Q C;  1TIF A;  1G6J A;  1OFF A;  1YJ1 A;  4KGT A;  1A70 A;  5BMH A;  3NS8 A;  1VRA B;  1EF5 A;  1NYQ A;  1TY2 A;  1XEE A;  1F9J A;  2WXQ A;  1WGH A;  4MM3 A;  3Q3O C;  2ONQ A;  1E7U A;  2R2Q A;  4YTN B;  2L0F A;  1V2Y A;  3PTF C;  4HCP B;  3DBH B;  4LJO B;  2QIL A;  3VHT C;  1F1H A;  1ROE A;  2CJN A;  1J7A A;  2M4N A;  1ACC A;  2VZK D;  2RDH A;  2G3Q B;  1DOI A;  1WFY A;  1WXA A;  1ZPS A;  1F0Z A;  4A6Q A;  1WZ3 A;  2LGI A;  3N20 C;  4AWJ A;  3QK0 A;  3P63 A;  5CHV C;  3RNC C;  2TSS A;  4EKU A;  2OED A;  3A33 B;  1E90 A;  2N7D A;  1JCK B;  3M62 B;  5HI1 A;  2GBJ A;  2INC C;  1UH6 A;  3N30 A;  3DBH I;  3FIL B;  2J4X A;  4NAW B;  4ITK A;  4E74 A;  2LZ6 A;  2D11 A;  1E0Z A;  4C4V A;  2PJH A;  4LLG M;  1V49 A;  2WX1 A;  2IZV B;  2ZCC A;  4HPL B;  2M17 A;  2N7J A;  3BK1 A;  3I9V 1;  5C23 A;  1MFW A;  4HKZ E;  1P7E A;  2JWU A;  3MHZ A;  4MGI E;  2MH7 A;  2MQJ A;  5D7G A;  3IT4 B;  1HZ6 A;  3NVZ A;  5DPW A;  5GMV A;  4XDC A;  4N9F 4;  1RRB A;  2IGH A;  3KYD D;  1TZO A;  1TYG B;  1C3T A;  4NY0 A;  1CQV A;  2MWS B;  4ZRP A;  2WX0 A;  3PT2 B;  3IVF A;  4GMV A;  3DVN V;  2IND C;  2ZNV C;  4JWU C;  5L83 A;  2XK5 B;  2G4S A;  2LHD A;  1XXG A;  2BYE A;  2N4F A;  1AN8 A;  2K39 A;  1QF6 A;  2KC2 A;  1SGH A;  4BOS C;  1NEN B;  5BYR A;  4DHJ B;  5FKA C;  4FJV B;  1ISN A;  2WXM A;  4FJY A;  3BII D;  1KFY B;  4MJS A;  4ARI A;  3QAR A;  2J0J A;  5AEK B;  1WI0 A;  2M56 B;  3EGR A;  4P7I A;  2NVU I;  1FRR A;  1D4B A;  2PIA A;  1WM2 A;  3VRB B;  2LAS A;  1FNW A;  2DAF A;  1WXQ A;  1IBX A;  4ZRK A;  1E7P B;  4BFR A;  1YN3 A;  2KMA A;  3CSF A;  2X8X X;  3V60 A;  2LVP A;  4S17 A;  3RNB C;  1Q0W B;  4W9D A;  1L4Z B;  3WAO A;  1MHX A;  4LDT B;  4GOC A;  1SB3 C;  2LRU A;  1YOV B;  2GBK A;  2KO3 A;  3IBE A;  2ZCB A;  1NBF C;  1V8C A;  4IOI E;  3T3N A;  1PQS A;  4WWN A;  4RGO S;  2Y3A A;  1OTR B;  2FCQ A;  2V1Y A;  1M4V A;  4A3O A;  2IO1 B;  1WZ0 A;  3ALB A;  2G4D B;  2Z0E B;  4MGZ E;  4MSQ B;  1VZ8 A;  1YQB A;  1WR1 A;  2KNB A;  2DEN B;  3BYT B;  2Q5W D;  1YMH E;  3P4Q B;  4KSL C;  1ZP0 B;  3A9J A;  4CO7 A;  2LMC A;  4DHJ D;  1I4G A;  3LXF A;  5IOI A;  3VTV A;  3N1Z C;  2FAZ A;  3ZDT A;  3B1L X;  4KX6 B;  3ZYY X;  2R2O A;  3P4P B;  2WDQ B;  4F7Z A;  2L32 A;  3AV8 A;  3UQA A;  2JQR B;  2UU7 A;  1K8R B;  1TY0 A;  4RGM A;  1SXT A;  3AEC B;  3ZTC A;  4AJY B;  2FUH B;  2KKC A;  3PZ7 A;  5JXV A;  2MA9 B;  2GMI C;  2L0T A;  2D3A A;  1V1P B;  2AWT A;  2M8S A;  3VQI A;  1PDX A;  5JZE B;  5DPR A;  1L0V B;  2CHW A;  2D07 B;  3E56 A;  2G45 B;  2MJE A;  3NY5 A;  1EF1 A;  4RF1 A;  2JYT A;  4JLC A;  5HFY A;  3U30 A;  1QIL A;  2O6V B;  4OZA A;  3L16 A;  2WXO A;  1LGR A;  3RNE C;  4FBJ B;  3JSV A;  5AUK A;  1YQ4 B;  2EEL A;  2MEK A;  3N9Y C;  4KDL B;  5HKH A;  4FA6 A;  3MJW A;  4BKS A;  2VH1 A;  2K6Q A;  3PZD A;  2ZZP B;  1GUA B;  3NZU A;  4M8M A;  2UYZ B;  1E5W A;  3TEX A;  1L2N A;  3QWZ B;  4AQ7 A;  2JZZ A;  3GE8 C;  2WYQ A;  2A5U A;  3TUO A;  4ZRI A;  1T0S C;  3VUY A;  2VRR B;  3B9J A;  3A9K A;  5IN7 A;  2HJ8 A;  2QIE B;  2WXN A;  1OQR A;  2AQ1 B;  1XO3 A;  1RAX A;  1P3Q U;  1F2R C;  4GU2 A;  2DNF A;  2K0P A;  1GAQ B;  2KX0 A;  2FCN A;  4BKT A;  4GDL A;  4W9H A;  1NDD A;  2H89 B;  1RWS A;  2D3G A;  4ANW A;  3B2G A;  2MP2 B;  2X38 A;  4W9E A;  1MJD A;  1EUV B;  4I6N B;  3KVF B;  1MG4 A;  1FNV A;  1N62 A;  2PVG C;  3LB8 C;  3W1S C;  4MEL A;  1FIQ A;  4A8X C;  4E3C A;  2L05 A;  2KAJ A;  4US9 A;  4QAY A;  4NJ7 A;  4OZB A;  1LO5 D;  4AS1 A;  1AYF A;  4G11 A;  1RYJ A;  1JWM D;  2KDB A;  4IG7 B;  3VR8 B;  1NEK B;  1KLV A;  2V3N A;  3HM6 X;  4K7U A;  2K8B A;  4HRS A;  2DBY A;  4N59 A;  4JGH B;  3KW5 B;  2RPV A;  1C79 A;  1CJE A;  3B2F A;  3AE5 B;  3EC8 A;  4P1B C;  4DDG D;  1K51 A;  1I4R A;  3VH4 B;  1ET6 A;  2IO2 B;  5EE3 A;  3ML9 A;  4PK1 A;  3HIZ A;  2XN9 C;  1UD7 A;  4FN2 A;  2BYV E;  2KJH B;  4NAW A;  1YX6 B;  2W54 A;  3VR9 B;  1IGC A;  3VXW A;  4HVB A;  1QLB B;  1VCB A;  3BVZ A;  1FPY A;  4W9L A;  5IP4 D;  3Q3M C;  2LGD A;  5G2N A;  2BKF A;  1L7Y A;  3RFZ B;  1TKG A;  3SFD B;  2BS2 B;  5AZF A;  3CWI A;  4I6P A;  1FXA A;  1N5X A;  1Z5S B;  3TMP B;  2KQ7 A;  2ZNV B;  3ZO5 B;  2QCZ A;  3SFE B;  2IDY A;  3PS6 A;  2YEP B;  1GOZ A;  5J18 A;  4RNA A;  3LYY A;  4KKI A;  2C7M B;  4L2Y A;  3EFU A;  2Z59 B;  2QMT A;  2ZW0 A;  4LNI A;  2Z0D B;  3LDZ E;  3TCA A;  1NI2 A;  4C4V B;  4N6E B;  4F1S A;  3QHT A;  1T0Y A;  2I2Y A;  2XNA C;  2GB1 A;  5FK9 C;  1I42 A;  2PPH A;  2J0M A;  2ZPY A;  4B0E A;  4DK5 A;  3H7P A;  4KVG B;  1KLU D;  1XLO A;  3WAM A;  2BWF A;  3B08 A;  3MC8 A;  2JY6 A;  4RCO A;  1T0R C;  1HTO A;  3Q8E A;  2RMM A;  5LXH A;  1F2R I;  4Q2J A;  4YSY B;  3C0R B;  3M63 B;  2D2Q A;  4ZHP A;  1DOY A;  4IDI A;  2BVC A;  1XCT L;  1UEL A;  1VDV A;  2L76 A;  1L0X B;  2V3S A;  3DBR B;  2NBU A;  4KZ0 A;  2MCN B;  2GBM A;  1WRD B;  2AL3 A;  4KIK A;  2O6V A;  4BOZ B;  4ANU A;  2AX5 A;  4USA A;  2OOB B;  1T6B X;  3HVD A;  1HE8 A;  3SDL C;  2QC8 A;  2CU3 A;  2NTT A;  2KX3 A;  4DXA B;  1LM8 B;  2WXR A;  2JXX A;  4ASW C;  1STE A;  1IBX B;  3AXC A;  2K6D B;  2LD9 A;  3V3X A;  1M94 A;  2WHI A;  1C78 A;  4URK A;  2LGX A;  2WXH A;  4MM3 B;  3FC4 A;  1V1P A;  2KMC A;  3AU4 A;  2KJR A;  3ZRC A;  3EEC A;  2PE9 A;  1E6E B;  3AEE B;  2KMM A;  2L83 A;  5H92 C;  4L23 A;  2GBR A;  4S0R A;  4MT5 A;  1XD3 B;  2WP9 B;  1TT5 B;  1VZ7 A;  3AEB B;  3VRA B;  1JWS D;  2JXT A;  2LGS A;  2MBO A;  1E8Z A;  4UDU C;  1WE6 A;  2JYE A;  4G50 A;  4TV3 A;  3A9J B;  1JRO A;  3A1Q A;  1MHH E;  3ENE A;  4EEW A;  2JZP A;  3WAP A;  1OQQ A;  3C8Y A;  3OG5 A;  1DGJ A;  4WJO A;  1YD8 U;  4IC7 B;  2W82 A;  3HHM A;  2J42 A;  1FRD A;  4C56 C;  1WY8 A;  2KAC A;  3H8H A;  4PS7 A;  3IAM 1;  3ZKJ C;  2RDG A;  1ESF A;  4X57 B;  4OVV A;  4NAM A;  4PT5 A;  2E3T A;  5T8I A;  1NI3 A;  2KDI A;  2KTF A;  3GZN I;  3L0W B;  2KTR A;  1XLN A;  2KN5 A;  4WAA A;  4OVU A;  1E8X A;  2DZI A;  2W3R A;  1TKE A;  3WAN A;  3AH7 A;  3WCQ A;  4NZL B;  2D10 A;  2KQ4 X;  2IYD B;  1WGK A;  1WF9 A;  4IM3 A;  4DHZ B;  1WGY A;  2RGF A;  1FFV A;  1JWU D;  4TSS A;  3J9C A;  1R4M B;  1D3Z A;  3RNA C;  1KJT A;  4MEM A;  1RFK A;  3AEA B;  4HDQ A;  3IAS 1;  4OZC A;  5BYS A;  2JT4 B;  3RYT A;  4EZJ A;  4K81 A;  4BVU C;  1FMA D;  1L4D B;  4GIV A;  3BZD B;  2AL6 A;  3UIO B;  1K53 A;  4ZYS A;  2DHZ A;  1GG3 A;  4XE0 A;  3RPF C;  3TL5 A;  3BVM A;  5TR5 A;  4MGY E;  2WDT B;  5JHA A;  3KH0 A;  2L1A A;  4JL9 A;  3RUL A;  5MPO A;  3P42 A;  1YN5 A;  4AOF A;  1H8C A;  4B6W A;  4R3D A;  2WXK A;  4H2A A;  1YNT E;  3NVY A;  3VTW A;  2KXJ A;  3QAQ A;  1SE9 A;  3DWM A;  5DCN A;  1QT9 A;  1KLG D;  2LI5 A;  4ANX A;  3ZJT A;  3HK0 A;  2QEJ C;  4PYZ A;  1XQQ A;  2NS5 A;  3DDC B;  2BS4 B;  2KN4 A;  4D2K A;  1P7F A;  2RSU A;  3UI3 A;  2MHJ A;  1L5P A;  3W2D A;  3Q8B A;  5CHW A;  1TGZ B;  1FNU A;  3APC A;  5LLI A;  3NZ3 A;  3DVG X;  2MBH A;  3U8Z A;  2SAK A;  3JVZ X;  4E71 A;  1PUT A;  1ZDV A;  3OWE B;  5I4D A;  3ZJU A;  4K3B A;  1VD2 A;  3ZGZ A;  2LJI A;  4DHZ E;  1AWD A;  3PHW B;  2IGD A;  3PHX B;  4EZL A;  3T3O A;  3DBL I;  3W1S A;  3TBL D;  3AE1 B;  4ACF A;  2KZR A;  3ZVV A;  2V9H A;  3A4R A;  1TBE A;  1BUI C;  1F77 A;  4JX1 C;  3KWL A;  2J52 A;  4W9K A;  1QKZ A;  2W9N A;  1ZE3 D;  2BTE A;  3MJ5 A;  2V3P A;  4IKG A;  1UGJ A;  2WXF A;  2OHF A;  1BML C;  1SJE D;  3I63 C;  4YSX B;  2RDB C;  4LJP B;  1WXV A;  1CMX B;  3ONS A;  1B1Z A;  5AUI A;  2ICI A;  3E9S A;  2IJ0 A;  1CK1 A;  3OAW A;  5IO9 A;  2E6X A;  2FBW B;  5CTR C;  1XCQ L;  4BZA A;  2N9K A;  1WGG A;  3Q3J A;  4WWP A;  3L54 A;  4RGT A;  1QOA A;  3V62 A;  3L08 A;  3PO0 A;  4W9F A;  3T8M A;  1HEZ E;  4BKS D;  1UBI A;  1ENF A;  2KQS A;  3NJT A;  1FFU A;  1JRP A;  4PS3 A;  2L7R A;  4II2 B;  1KRH A;  3DBR I;  5CX3 A;  2CR5 A;  1V5T A;  2FID A;  3AU5 A;  4ANV A;  1WJ6 A;  1MG8 A;  2WQY B;  1WH3 A;  1R4N B;  2DZJ A;  1PYW D;  4LDT D;  4DQO C;  2RPQ A;  4A9A A;  2LXA A;  3R7R A;  5EDS A;  2J0K A;  1JWB D;  2KAN A;  2I1J A;  3AEG B;  1Y8R C;  1C76 A;  2B76 B;  4TQ0 A;  1TTN A;  3P1M A;  3L17 A;  4MAC A;  4KKJ A;  2WNM A;  2L52 A;  3R3M A;  3V6C B;  3KQ4 A;  3O13 A;  2KWU B;  1GC7 A;  4IWO A;  1I4Q A;  4RM8 A;  2KC1 A;  1LQB A;  1L6V A;  2BYF A;  3DPD A;  1PGB A;  4XZ4 A;  2NTS A;  3ZDM C;  2KFJ A;  4WQO B;  3ZTD A;  4DWF A;  3ECI A;  2DLB A;  3AE9 B;  1JWA D;  3L13 A;  2UWQ A;  1HXY D;  2M0A A;  2WDR B;  2BGF A;  3P2B A;  3AEF B;  4YL8 A;  2DYO A;  4NPN A;  3TJP A;  4ZDV A;  2KLG A;  5J17 A;  3OJ4 B;  4PYU A;  2N7E A;  4ZHO A;  1ZUD 2;  3PLV A;  3PRE A;  1VLB A;  1XLP A;  1KTK A;  3H1U A;  1L6U A;  4HXD A;  3ML8 A;  3VH3 B;  2DWQ A;  5DPS A;  2V0G A;  2WU5 B;  1WJN A;  1JRU A;  2JU6 X;  3KUZ A;  4M0W A;  1WX8 A;  1TJE A;  3R8B A;  3TEY A;  3BY4 B;  4LK0 M;  4TMA B;  2QHO A;  2C60 A;  3I57 A;  1C1Y B;  4XDD A;  3EFC A;  1QOB A;  1PGA A;  3V6E B;  4ICV A;  2REX A;  1ZDX A;  1E7V A;  1K50 A;  2L3Z A;  3FAH A;  3ZJV A;  2V4I B;  1C4A A;  1EU4 A;  1U4A A;  2GLS A;  4FHK A;  4L1B A;  4JPS A;  2XEW A;  4XYC A;  3NHE B;  2KOX A;  2MBE A;  4A90 A;  4LNO A;  3ZNI D;  3DCG A;  4IW0 A;  5CHF A;  1B9R A;  2A4Z A;  5E6N A;  4GXB A;  1UZX B;  3A1Q B;  4M02 A;  2KVR A;  2MX2 A;  2BKR B;  3NVW A;  1WE7 A;  4XWT A;  5IKC M;  2LFI A;  2KT7 A;  4PS8 A;  1Q10 A;  4GSW A;  5G55 A;  1P98 A;  4MGK E;  2ZW1 A;  3IFW B;  4O1N A;  4HK2 A;  5C2T B;  2BB6 A;  5J2R A;  2JZ3 B;  4HJG E;  1TZ1 A;  3MC9 A;  2NPT B;  4GDK A;  2N0S B;  2KVZ A;  1SF0 A;  4J3O D;  5D3D A;  2KDE B;  4NQL B;  1AAR A;  1MI0 A;  3DVN U;  2JUO A;  3C19 A;  2DYB A;  2R61 A;  1D5M C;  1IGD A;  1FO4 A;  1J7B A;  1GB1 A;  1P9D U;  5KHO A;  1N61 A;  2I1K A;  3B0A A;  3DWG C;  3AB5 A;  4GLS C;  4YXD B;  4HPP A;  1YN4 A;  4JQW C;  3K9P B;  3MFG A;  3MP9 A;  1D5Z C;  3AE4 B;  1IPG A;  3ZRF A;  3Q14 C;  1FEH A;  2VH2 A;  3JSV B;  1C77 A;  4TKN A;  1MVK A;  2DAJ A;  1WXM A;  2KTR B;  2NCN A;  3RNG C;  4JIO U;  1UWM A;  2OJR A;  2W55 A;  4LTU A;  3AI5 A;  4US8 A;  2QJL A;  1BT0 A;  4EZK A;  1PGX A;  3DVG Y;  4HWI B;  4P16 A;  5G5G A;  3TEW A;  2KFK B;  3A4S C;  1XF5 L;  4K3C A;  3Q3F A;  1R7S A;  1UGM A;  2KWC A;  4C7Y A;  3VFK A;  4DBG A;  1GC6 A;  4IWP A;  4FAD A;  4TQ1 A;  3QX1 A;  1QQR A;  2AEH A;  4MH0 E;  1KH0 A;  4EE2 A;  2K3U A;  3H7S A;  4NNJ B;  2LRW A;  2K8H A;  1NYR A;  1H4R A;  1FCL A;  2J7Q B;  4AUQ C;  3QCA A;  3NVV A;  3DQV A;  4LNN A;  1R4M I;  4ARC A;  1C4C A;  1ET9 A;  4HDO A;  4JE3 B;  4IUM B;  3Q6B A;  2N1W A;  2IGG A;  2PLP A;  3AE3 B;  3ZNG C;  1OEY A;  1K52 A;  5IAA C;  3RZW C;  2G1E A;  2JF5 A;  2N9P C;  3RN9 C;  2BBC A;  3R66 C;  1RM6 C;  4FLH A;  3UGB B;  1SSN A;  3ZXV A;  4CHK A;  1DOX A;  1WWT A;  1E10 A;  2L8J A;  3IXS A;  3L4P A;  2IBI B;  1FXT B;  2SEB D;  1GJZ A;  2AQ3 B;  1X1M A;  1HQR D;  1FXI A;  1N63 A;  1WGR A;  2CU1 A;  3DHH C;  2JRH A;  2LHE A;  4FJZ A;  2D3C A;  1V86 A;  2EKI A;  4G0N B;  1UWX A;  3RI7 C;  1FD6 A;  2LWP A;  1EM7 A;  3SR6 A;  1QOF A;  3V61 A;  2LVQ A;  1KF6 B;  2J53 A;  4HPM B;  5EE9 A;  3BK2 A;  4LCD E;  2HE7 A;  4DXG A;  1ZGU B;  2MW5 A;  3BVG A;  2IO0 B;  4XWW A;  4XX5 A;  3AED B;  3PLU A;  4GN1 A;  1EU3 A;  2BS3 B;  3APD A;  3RZF A;  1XLQ A;  2BQQ A;  2JPH A;  4BKG A;  1JAL A;  2NPT A;  1UUP A;  4GDK B;  1EWC A;  4G3X B;  3ZNZ B;  2PMV A;  3QC8 B;  1FCC C;  5G5H A;  3BWU D;  3VUW A;  2PW9 A;  3QJZ A;  2JX5 A;  3BIN A;  2KWD A;  4ZOH C;  1WSP A;  1IUE A;  2INP E;  2BPS A;  5H8Y E;  2N1V A;  3N1Y C;  2IY0 B;  3JW0 X;  3TSS A;  3M95 A;  5LXI B;  4WAF A;  4N58 A;  4KIK B;  4ZYN A;  4KSK C;  3N3K B;  4XGA B;  3RUI B;  4DXF A;  2CS4 A;  3KYC D;  3O65 B;  2C7H A;  2PE6 B;  1TS4 A;  3V05 A;  4EUT A;  1XT9 B;  3KLS X;  4OHJ A;  2K5P A;  1LXD A;  3GP7 A;  5BO4 B;  4FHJ A;  3M3J A;  2B3A A;  3FKY A;  4F8C B;  3PRM B;  2HDE A;  5D94 A;  3RT3 B;  1QOG A;  1KOT A;  1ZKH A;  4CYE A;  4AP4 C;  3ZNH B;  2WU2 B;  2OJW A;  3ZLZ A;  1C4P A;  4HJK A;  1WM3 A;  1ZXI A;  4MJS B;  1RFA A;  2HD5 B;  1OQY A;  4M00 A;  4XC2 A;  3AE7 B;  3IG3 A;  2O2V B;  3I3T B;  2QDF A;  3ZW3 A;  1F52 A;  4GB9 A;  3FIL A;  3HVZ A;  2PTL A;  1E8Y A;  2BF8 B;  4II3 B;  2BT6 A;  1I7H A;  4W9J A;  1YX5 B;  4A3P A;  4FUL A;  4KDI C;  1YQ3 B;  1WRI A;  4RH6 A;  4OVZ A;  1OEY J;  1J7C A;  1DYQ A;  3OJ3 A;  2D3B A;  3U7D A;  3ABV B;  3N1X C;  3R2I A;  3AN1 A;  1GB4 A;  1WXS A;  4C00 A;  1EO6 A;  2MRP A;  3DHG C;  3LJ3 A;  1I4X A;  3KUC B;  2BWE S;  2I38 A;  1SE4 A;  4WJP A;  1P1A A;  4B95 A;  2NBV B;  1E8W A;  4ZRQ A;  4HKQ A;  3MC0 B;  1LFD A;  4MSM B;  1J8C A;  2MP2 A;  3AE2 B;  1E9M A;  4NJ6 A;  5LNK 1;  1YJI A;  4WJN A;  2LVO A;  2C5L C;  1WYG A;  3U52 E;  2LUE A;  4W9C A;  5EE1 A;  4WQM A;  5L95 C;  3NRZ A;  1V6E A;  2EKE C;  1HTQ A;  1WYW B;  1ZW7 A;  1I4H A;  4WWO A;  1V5O A;  3Q69 A;  3W5V B;  3CF6 E;  3GB1 A;  5HG2 A;  2ACZ B;  2NBW B;  2NMQ A;  3TEZ A;  2LJ5 A;  2BYT A;  4BBN F;  2CKH B;  2GRI A;  3AUL A;  2XBB C;  2GI9 A;  5JH5 C;  5DPT A;  2ON8 A;  3PZ8 A;  3GE3 C;  3WIM A;  2MLB A;  3NG0 A;  2AQ2 B;  2LXC A;  2MJ3 A;  4C7Z A;  5D6J B;  3R7Q A;  3X23 A;  1N5W A;  1WJU A;  5EE0 A;  2YLM A;  1VJK A;  4IM0 A;  2BB5 A;  4W9I A;  4EOY A;  1R4N I;  4RFB A;  1WX7 A;  1I35 A;  3PVL A;  4WWM A;  3S2A A;  5TSS A;  3RNF C;  3SD5 A;  2C9W B;  2IO3 B;  3MHS D;  3IT6 B;  5E6O A;  2FIF A;  2K25 A;  2DX5 B;  3KWV A;  2MBB B;  3Q8C A;  3P4R B;  2KK8 A;  4KGS A;  4HLE A;  1V80 A;  4J6I A;  2NR2 A;  3URY A;  2JSV X;  3RCZ A;  1WJ4 A;  3H9D A;  1WR6 E;  5AZG A;  2FCM A;  3A9K B;  4WUR A;  4A55 A;  1TS3 A;  1TS2 A;  4FXC A;  2JRI B;  2N9L A;  4RF0 A;  2DYM A;  2WXI A;  2KWV B;  3HRD D;  4P1C C;  3ZQ4 A;  3HUI A;  5BMG A;  4LNF A;  2WXG A;  1CZP A;  2XK5 A;  1PFD A;  1D6E C;  1Q5W B;  3AE8 B;  3UIN B;  3VUX A;  2GBN A;  4EFO A;  5IA7 A;  1SE3 A;  3H6N A;  2KHW B;  2PVO D;  3CIR B;  2KYW A;  5AZH A;  3VDZ A;  3AMZ A;  4OW0 A;  2K1F A;  4RGN A;  1V1O A;  4HRO A;  1GPX A;  3QA8 A;  2ZVN A;  1SIJ A;  1EWY C;  3PV1 A;  1V97 A;  4M01 A;  3H7P B;  2L00 B;  5HHD G;  2K9X A;  2KLC A;  4JWS C;  4RM9 A;  2ASQ A;  4WH4 A;  1TS5 A;  2O2V A;  2KDM A;  5C1Z A;  3MTN B;  1MPE A;  4NJC A;  2IPK D;  3NS1 A;  4RMA A;  2M1M A;  3WA0 A;  2FE8 A;  2ZPN A;  4CQN A;  2Z8L A;  3Q8F A;  1S3S G;  4IM2 A;  4MH8 A;  5JHB A;  3NUH B;  2V4L A;  4BBN C;  2WLB A;  1ZOY B;  4AJW A;  1AW7 A;  4BAX A;  3X0W A;  2FNJ B;  1KM7 A;  3N32 A;  4C80 A;  2Y5B B;  2HTH A;  4B0M A;  3TIX A;  1P0R A;  4W9G A;  4KZC A;  5GXG B;  3SU8 X;  2FUG 1;  2GOW A;  2AYO B;  2MJD A;  3EUB 2;  3DBL B;  4YTP B;  2G9H D;  4K7S A;  4B9K A;  2ZEQ A;  1UF0 A;  3ETR A;  2FCS A;  1J0G A;  4P6V F;  1YIW A;  4ICU A;  2YEP F;  2KFK A;  1N6Z A;  3I5J C;  5FR6 A;  4WIP A;  4LNK A;  3EA6 A;  2CJO A;  3T9L A;  3VTU A;  5FR3 A;  3UF8 A;  4NQK E;  1T5X D;  3CST A;  5E6J A;  2N9X A;  3RMK C;  3AM9 A;  1RLF A;  3EHV A;  1HZ5 A;  1Y56 A;  3QQ8 B;  2YVC A;  1ZXH A;  3W9C B;  1QZE A;  2QSD A;  2WXJ A;  1WMH A;  2HJ1 A;  2CHZ A;  3P4S B;  5BMI A;  3Q2A C;  1UBQ A;  2Y5C A;  4HCN B;  2K22 A;  3PGE A;  2M0X A;  2WXL A;  2PEA A;  2PKO A;  2ZVO A;  4HEA 1;  1UNS A;  3VAW A;  2CHX A;  2DZK A;  2WWZ A;  1JML A;  4REZ A;  2WDV B;  2EMT A;  1WMH B;  5C3J B;  4KGR A;  3K9O B;  1J19 A;  3ZXR A;  3UIP B;  3PRP B;  1L0Y B;  1OGW A;  3Q8A A;  5D3I B;  4M0W B;  3L10 B;  3AE6 B;  3SEB A;  4ZRJ A;  5KHQ A;  1WIA A;  2O6V D;  4YTM B;  3UQB A;  1NVI D;  3GOE A;  3U2S C;  3SHQ A;  4GDL B;  2WGS A;  2Y5P A;  3U4E G;  1FM0 D;  3ZIM A;  4IWQ A;  2WS3 B;  4MDK E;  1HA5 A;  3CMM B;  3DHI C; 
#chains in the Genus database with same CATH homology
 3Q6B A;  3EFC A;  4K3B A;  4C00 A;  4BZA A;  4XGA B;  4C4V B;  3MC9 A;  4QAY A;  2VH1 A;  2X8X X;  2QCZ A;  3OG5 A;  2MHJ A;  2VH2 A;  4C4V A;  4K3C A;  4PK1 A;  2V9H A;  2QDF A;  3NJT A;  3MC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...