3Q6GL

Crystal structure of fab of rhesus mab 2.5b specific for quaternary neutralizing epitope of hiv-1 gp120
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
209
structure length
209
Chain Sequence
YDLTQARSVSVSPGQTARVTCGGDNIGSKSVQWYQQKPPQAPVLVMSADDERSSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSHHMLFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVEVAWKADGSAVNAGVETTKPSKQSNNKYAASSYLSLTSDQWKSHKSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Human and Macaque mAbs 2909 and 2.5B: Implications for the Configuration of the Quaternary Neutralizing Epitope of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Light chain of Fab of rhesus mAb 2.5B
total genus 47
structure length 209
sequence length 209
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q6gL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q6gL01
1SY6L 4WRLA 3VFUA 4ZFGL 3QFJA 3FQNA 4H5SB 1I9JH 4NP4H 4RMWA 3UCRA 3MBED 5C0AA 3LIZL 3VI4F 3HE6C 4P2RB 4AJ0A 4E41A 5GZOC 2V5MA 3AS0A 2OMBA 2EDXA 2GTWA 2EE6A 3BUYA 3IS0X 2J8UF 2HFGL 4XWOC 3FO0H 4MJ4A 4ODXB 1D3CA 1FFRA 5F3BA 1JVKA 1U0QA 3QP3A 5C7XL 1T1XB 2CUIA 4NN6B 1OAYH 4X8XA 1LD9A 3IDUA 3BT2L 4K7PY 1B2WL 3RL2A 4FFWC 5AZEL 4U3CA 2P44B 3A67H 1KIRB 5IQ9A 4JZOB 1MI5D 1PQZA 3FCTA 1CFNA 4LLVB 3CPLA 3MXVH 4NO0A 3D2UA 3LMJH 1JHLH 2A1WH 3H8NA 2R2BA 2BNQE 1IM9B 2AXHA 4M7KH 4D3CH 3MRDA 5CGYC 4HT1H 3MLVL 3HFMH 1LP9A 3OG6B 3DX6B 4UIKH 4HQQH 4MD5B 5CCKH 5DYOB 4HG4K 1AGEA 1P5VA 4QF1B 4IMKA 3TVMC 4KJWD 2VLKB 1RU9H 3H3PL 4I3SL 5DRXA 4ODBD 1P4LA 1JE6A 1EUUA 1NBYA 1U3ZA 1BAFL 1CGTA 1MAKA 2HAZA 1LNUA 4TUJB 1IEAA 4U1LB 5JXED 3CDFA 4HKJB 5FYJD 4GG6A 1JWMB 5C0AE 2QADD 4HLZH 5SX5H 2VLRA 3GSWB 4HKBB 5CZVH 1OTUC 4L9LA 3WXVH 4YFLF 5EZIH 1LO5B 2OK0L 3IJYB 1FRGL 1IBGH 5DLML 5K9JH 4HWNA 3ARDB 2E8ZA 2FNBA 1FBIL 1TVBA 3IJHB 4I18C 1R3JB 4R7DA 1AJ7L 4TVPH 1SBBA 5I1CL 5KVFH 3GSOA 4P4KB 1A6VL 1EERB 3JWOH 3ULSA 5KSAA 3QQ3A 1MAMH 2X44D 2GJ6E 4PG2A 3SKJH 4CDHA 2CRZA 3BKCH 1P2CA 2EH8L 4ZFOL 3VXSB 4L4TD 2YPLB 2H9GA 5EO0B 1T03H 2AV1A 3Q5YA 3MLUH 5FO8B 3RGVA 3LRGA 1MJ8H 4LSUH 4XBGB 5F8QC 2JKXA 2HWZH 3EFFA 5HI5D 3FT3A 5CBEA 3VXNB 1JPTH 2FEDD 2NY2C 2R1XA 1A6UL 2OLDA 2ICEA 5EU6E 3O81A 5KSBE 5D1XD 4AIOA 4QRUB 5D70L 4YO0A 1PG7W 3CX5K 5KSBF 4U7KA 1BFVH 1S78D 4LPWA 3B9VA 4GFTB 3BPLC 4PJGF 3UX9B 3FT2A 4O58L 1KCUL 3SGJC 2B0SL 5GRJL 3MJ8A 5ADOH 3GB7A 5IVZB 5DD0L 32C2A 3RWHB 4MNQB 5B3JE 5IB2A 3QZWA 3SCMA 4ZO8A 4F9PC 5I8OL 2VN4A 1FH5L 3QH3A 3VI3E 2YPKA 1AY1L 5DK2B 3E2HB 1IAIH 1F58L 2Y9RT 4YHKL 1ZEAL 3W0WB 3RVUC 3FB7A 3OTTA 4YHPB 1T20A 4QRRB 4R97B 3GSNL 4OLUH 1BFTA 3I75A 2AI0L 1NSNL 3ISWA 3I75B 3B43A 5DUML 3VGFA 3M1BB 4HUUA 1MOEA 4I77L 4KJQC 4TTGA 1BAFH 2HJFA 1YEJH 4X8JA 5JTWA 5J12C 1GGTA 4KROC 1S8DA 3OKLA 1N6VA 5DJDA 2YPKB 4PJ5A 5CD5D 2D7MA 3AREC 4IRJA 3BDYL 3C6LD 5HYSG 3U46A 1ZTXH 2GSIA 3NZ8B 3TCLA 5I1IL 3MRKA 2JLLA 1OW0C 3MOQA 2OXGA 1DDHB 3DHMA 3CFBA 2X9XA 5C0RL 2ICCA 4LSSH 1A2YA 1A5FL 5GS0H 1MLBA 3D85B 5HHME 2JJSC 5FA4A 1U9KA 4JO1H 4YO0B 3RX8A 4QRUA 1SJXA 1SHMA 4NQCD 5F1SA 1U8IB 4AG4H 5SWZD 4NO3B 3EJZD 3V6FB 4JHAL 4PJBF 4I0CC 2C1PA 3TBVA 3GBNL 3SDXF 4Q9QL 5HTSA 2VZ1A 4HZLB 4AIZA 2NXYB 1DANT 4XRCB 4X5WB 4MJIE 2ZCLH 5FHBH 1T5WB 4X6CB 4CN4A 4RWYL 2VQ1A 3FQWA 4EIZC 1RJLB 3R4DA 4HBQA 2C26A 4P2OC 4GKNA 8FABA 2YPVL 3RQ3A 4BA8A 1EH9A 2GK0A 2V5SA 3B2VH 1FAIH 1TJHH 1V3LA 3BWUC 4KRPD 5HHPB 4ELMF 3UYRL 4OM0H 3MV9A 1CFVL 2PTUA 2VSDA 4LLWB 2MPAL 4WEMB 2P4AB 3VI4E 4E41E 2Z92A 1A1OB 3V7AE 4YHZH 1OGTB 3WFBH 1JFQL 3IJYA 2IPUG 4L9LB 4HKBA 1JUFB 1JF1A 4KI5E 3VFNB 1T3FB 3MBEB 3TZVC 5KANI 4GG6B 3PV7A 1T4KA 2VLJA 3UTPE 3GIVA 1XF4A 2CO6B 3TBYA 1UZ6E 3PGFL 4LCWB 1P4LB 4P2RD 4P2OD 5ERWB 4NKOA 3D39B 1NSNH 2FJGB 1FGNH 1QLFB 2EDWA 5F7KC 2ADJA 4MD5A 3BD4A 3UTZA 3CH8A 1OAKH 5CHNB 5JORA 1OP3H 3TA3C 3JTTA 4BSVB 3OPZL 1K9TA 5F7MC 3AB0C 2YA0A 4QXTB 4LLVA 4HWEL 1PQZB 5C6WH 2AXJA 1NUNB 4D0CA 5FCUH 4PGEB 2F53A 5C07B 1ZTXL 4NRZA 1B0GA 3F58H 3MCKB 4IM8A 1D6EB 5FF6A 1PKOA 1PEWA 3SOBH 5C0CA 3DI2B 5F9OL 4N0FB 5IB4A 3VXMB 2ERJB 1AHWB 1SYVA 1JPGA 2NLJA 5FYKD 1QA9B 4Q6IA 5HDBF 1TQCB 2Z35A 2XICA 4LVNC 5JZ7C 3O3DB 4RGOH 4PLNC 4JKLA 4PP1C 4PLJC 2DYPD 3O2DH 3O2WL 2CIKA 1WCQA 1HWHB 1X5AA 2F15A 1XIWB 3DO3A 4CVZA 1C12B 4PTTB 5DQDL 3BRGC 1GL4B 5LQBH 5C0GA 1MF2H 3O8XA 4KRMB 4MD0A 2CUHA 3H0TB 4JM2A 4EDWL 4TQEL 3T0BA 3QO1B 4PJ7A 5CP3A 2VMFA 3RBSA 4ENEC 2E7CA 4AEHH 3RI5K 4YPGA 4FFVD 1I4FB 3TJEL 2ZUQB 1Q9KB 2ADGB 4GKOA 5F7NC 2WBKA 3ARWA 2X1QA 4LSTL 3RVVD 1RZKC 5FYKU 2R4RL 1FSKB 1DQQA 4PJGE 4CADB 5IVOA 2YPLD 2BSED 3IDNA 3JWDL 4X4ZA 5TE4L 4WUUB 1GVIA 4NP4L 4EDXB 4TUKL 4P2YA 4XI5C 1ZLUK 4C4KO 1BQHA 3W2DL 1GPOL 1L6XA 1J0IA 4CGTA 4N0CC 2R0ZL 1I7ZA 2H2SC 1HYSD 3SGKC 2AXGA 2W0FB 5D1XB 1TPXB 4KRLB 1DBKL 5JMRA 4DCQA 1IT9L 5JW4Q 4K7PH 2R8SH 5MEQA 1IGTA 4YXKL 4OCRL 5ADPL 4Y5VC 5I1JH 5I71C 1IAKA 4U1MB 2EIBA 1CLYH 5J56B 5JLZB 4JZNB 3MMEB 5C0FA 1QKZH 4HH8A 5EBGA 3WLWC 4D9LH 1CR9H 4MWFA 4YNYB 4TSCL 2GTZA 4MNQD 4HC1L 1KFAL 1LO3L 4BUGA 4PRNA 5GGRB 4M5ZL 1FSKC 1NPUA 5LGHL 4PR5B 4FXKA 3VGHA 3TEUA 1R3IL 1LO4L 2C1OA 4RIRA 1ZLVK 4X83A 3O6LL 4JCLA 4JREB 1FFPB 1KJMA 2B1HL 3MSPA 4PJBA 1A6ZA 2A6KA 4POZD 2WUCL 2R9HC 3GO1H 3PIQB 4I3GA 1E6OL 2B7DT 2BRRH 5E2WH 1E0OB 2Q3AA 4F3FA 2P5EA 5GGQH 1TPXC 3QIWD 3BWAA 3L3DB 1I85A 1L7TH 3RJQB 3SDXB 1XCQA 3GHEH 4HEME 4BFIB 4L3EB 1QD0A 3C6LB 1A6VH 3JWOL 4MCZB 2QEJA 4CUCA 1U2CA 3SKJL 3RDTB 3QUXC 4JG1H 1FO0B 5I1LB 2EYTA 4RRPA 3IVKA 3RL1A 4IJ3C 3G5VA 2AGJL 4CBPA 2RBLA 4NJAL 4ZMAT 4Z7OE 4J8RB 1OB1B 4TNVK 2J3SA 2KUTA 1NC2D 1KCKA 3C60B 5IWLC 2DTML 3AU1B 3BGMB 2O5YL 4TPRL 5DRZA 1GPOH 4FMKA 4POYA 1UENA 3NA9H 3HNSH 1QLRB 5EOQL 3ZE2F 5MERA 1KV3A 4EUPG 2Z31B 4BKLB 4MAUL 4IMLA 1CTOA 5EU4A 1BZ7A 4BQCA 4LNRA 1WTGT 4OGYH 1A6TA 1B88A 4UBDC 5GS2D 1YC7A 1AGBB 1RUML 2IPTL 2PN5A 3LQZA 3V79C 3L3HA 5IJVB 2DB8A 4S2SA 5I30L 4HWZA 2DQJH 1MHPL 1XF3A 3N85L 1AXTH 1D9KC 1ZANL 5CFHA 3H7LA 3SJVD 5JW5B 4M6OL 5ISZD 5E2VH 1HILA 3QUKB 1R5VA 3W81A 1P4IH 4LVOC 1IC4L 4Y19B 3KPRB 2LFGA 4JJ5B 1I7TB 2PTVA 5FGRA 5MI0B 3K4DA 3QEQA 3RU8L 1S9YA 1WIPA 3FFCA 3L3GA 3HUJF 4KK6D 2F53E 3T4AA 5I0DA 5DDHB 3PGCA 4GMSL 3MLRH 1JZ3A 1XGTB 4KTEH 1RI8A 4NQXB 4A6YB 4OZIF 4PP2B 3BE1L 5JHLL 3MBXH 5T1LD 4JM2F 2YBRA 4YHLH 5F3HB 1J0ZA 1WWCA 2GW5A 3BO8A 4I5BB 1UB6A 1V8HA 4G80B 3PWJA 4LHUG 2BOCB 1MFDH 2YUWA 4GUPA 3ZTNL 3LN4B 5ANMA 5ESVA 2ZG2A 5SWSA 4YHOL 2V2WA 5DJZB 5ACMA 3MRNB 4RGNE 3VH8B 4H1LH 4J1UA 1DFBH 3U6RB 3ESVF 3LN9A 2DQFB 4P5TD 5HJ3A 6CGTA 4U3HA 1NCWH 2WM0A 4EI6A 5C2BH 3KPMB 1E27B 2APWA 1JIBA 4ZYKA 4XAWL 1OLZA 3HPLA 3KPOB 2WBJD 2APFA 2DL2A 3O3AB 3NOIA 4IRSB 4RAUA 3ZKND 1AXSB 4X7SH 5T3ZL 5ID1B 1NGZB 5JPMA 4KVCH 4H88H 4Y8DC 3RY4A 4X6FB 4WHTA 2XA8H 1QR1B 3UTTA 1DCLA 2VIRB 1IFHH 2O5ZH 4PRHB 2OQJA 4WWKA 4GKZA 2IPTH 4LQ1A 5DTFA 3NGBB 1QPXA 2DQJL 1BPVA 5IQ7L 5J6GA 2MKWA 5JOFA 2NY3D 1N7ML 3NCJH 1TITA 3V7AG 4OZHB 4Y4FD 3EO0A 4ZOAA 4NQDE 2AJSL 5DEGA 5C0CE 2AJXH 1S7XA 3K4AA 4WHYH 1YY9D 4HPOL 2IBGA 4LHUA 5HHQB 1UFUA 3NABL 2DLTA 1F3JB 2MHAA 5INDB 5A16B 2VNCA 4MA8H 4I13B 4JDZB 1WUNT 4GRLA 1U3HA 2IH3B 1UH3A 1HHHB 3ZKMD 2CO7B 5GRVL 2Y6SC 2VAAB 4XP1H 1NCTA 3PQYA 2FEEI 1MRFL 4YC2C 2AQ1A 1A3RL 1TZGL 3H9HA 3MOBH 4JFDD 3SQOL 1BX2A 1F4WL 1DTUA 1H3UA 2IANA 5T5NG 2NY0C 3TN0A 3MA9L 3KS0H 2AEQL 2NY7H 1G7PB 4LHQB 4HZAA 5MENA 3PWLB 5DRWA 3MRBA 3H9HB 1ROWA 5IR1B 1RZGA 3VGAC 4H20H 2Q86B 1NCDL 3X3GL 4XP6H 5DI8A 5MEPA 1NFIB 1I8KB 1U42A 1W2KT 4I48A 4OZFG 3GKZA 4ONGL 4JKWA 3UTSD 2N56A 3MV8D 1KTLA 1ZHNB 5J1AA 4MQXC 1EO7A 1Q1JL 2X4OB 1CU4L 3V95A 3EYSH 1UWGL 1Q9LB 4OFYD 2YD8A 4B50A 2LU7A 4LDLB 1JHTA 4PV8B 5JOPE 5DEGB 2D0FA 2VZUA 2HMIC 3CU7A 3BKYH 1U3HD 5CZXC 3CZFA 1FQ9C 3GBML 2NMSA 2FDBP 4LCWE 1YNKH 2JTDA 3F7YA 5L6YH 5I75C 3R8QA 1ZV5A 4U1SA 3KDMA 3W9EB 3CSYB 1MCPH 1BVLB 1FVDA 3E3QE 4JRXE 5CIPH 4TSAH 1ZA6B 4JR9L 5DQJB 3EFDL 2R39A 2H8PB 1KT2B 2C4FT 1JN6B 3ROLA 1C1EH 2QTEA 1DE4A 4MXQC 1M7IA 5DD5L 1E4WH 2D9QB 3WNMA 1TCRA 4RAUB 2F58L 1RZFL 4ERSL 5D71H 5H35A 4GRLC 2AI0H 3QG7L 4XMKH 3QPQD 1E27A 3UTTD 4JZJB 1L6ZA 4XHJD 1IVLA 5LGJA 1GOHA 4PJXB 3TGXA 3VRJB 1QBLL 3VXPA 2APVA 4XP1L 4POUB 1TZGH 2A73A 4K94L 2AABL 4KZEL 3SQOH 4LPYA 4HMDA 1F4WH 3ULVF 1DSFL 2HH0L 4ZS7H 1P7QA 4K8RD 1P4BH 4XNYH 4WWKC 3PNWB 3STBA 3P9MA 5GGVY 1KIQA 3VWJA 5D9SA 2AERT 1NBZA 1NDGB 1MUJA 2HRPL 5ADOL 3DV4A 4YAQB 1GGCH 4X9GA 1LE9A 2BY1A 5C07E 2CK2A 3GSVA 4ETYA 3L3GB 5HVWA 2FWOB 1QP1A 4M62H 3QEQB 4D9RE 1Q94A 1K4CB 3G6JE 3NIDE 4JJ5A 5HYJB 3SDAD 3CCHA 3QXWA 4X5XA 3T09A 3BQUD 3BISA 5HPOA 3GHEL 2Z91A 3AS3A 2YMXL 2X40A 4MB3A 2YEZA 4NKIH 3MLXH 4I77H 1H3TA 1EJOL 3G5XB 3EYFB 1ZLSL 3MRJB 3SGDH 3MLTB 1N6UA 1X5LA 1WZ1H 3MGTA 4JFXB 1QO3A 4MJ6B 3KYMB 4L3CB 4F15B 2R1YB 1MCPL 5C0ND 5EU6D 3C87A 5INCA 4CU7A 2VYRE 5FM4A 4X4ME 1RK0A 1NCUA 4K8RL 1GIGH 4RMUA 4Z7VA 3PHOA 5ISZA 1U95A 1BD2E 1EBPA 1DBAL 5E9DE 4N9GA 4JPVL 1A5FH 2PO6B 2EXYD 5HYFA 5EU7C 5F93C 5DHVH 4JKPL 1A6AA 1PFCA 3QB7C 2E9BA 2FJHA 3QO0A 1GC1H 4FNLL 4IRSD 2FZ3B 3FO2A 3FO0L 1BGXL 1VFMA 3CC5A 5EUOE 4HV8A 4OCWL 3F5WB 1Z2KA 2L7UA 1FZKA 4OGYL 3FT4A 4JJHA 3BP7B 3EUUA 1OB1A 1HXMB 4MXWL 1VACB 4GAJH 3U30B 1BJ1J 4F2MA 4PJAF 5GJSL 1PD6A 2W9EL 2VQUA 2JIXD 3DROA 4L8SB 1OAXL 4WFFD 5DMGC 3PWUA 3SDCA 3V4UL 3VWKD 1D9KA 1MCQA 3X14A 1KCSH 4RWYH 5GQBA 3TCXA 4M1GL 4MNHA 2AJYH 4QRSB 4HUWA 4NWTL 3EYVB 1XCQB 4P4RB 4JO4H 4Y4FB 2F5BL 4FA8A 4QTIH 2XQBH 3HC3H 2CDFB 1OTUD 4NO2A 3L3DA 4JFPA 4XCYB 2P5EB 2NR6D 4YUEL 1NFDF 1OQXA 2EE2A 4HKZB 5KVDH 2J4WL 2UWEA 5KVEL 4HUXB 5B3JF 1T04A 5GGRY 5C0NC 4KHXH 5FUOL 2EKJA 3WV0A 1JPSL 3LDBC 1A7NH 1A7QH 2FO4A 3DTXA 2HKHH 1S7RA 3IT8D 1KNOB 5E5RB 1FBIH 3PGFH 5F9JA 4XXDB 4FQ2H 3QCUL 1MCEA 1CLCA 4Z8FL 1M05A 4QXWA 5EUOA 2I9TB 1ZT4A 3ARFC 4JM4L 1K3ZA 3E8UL 2W0PA 3O0RL 1N5AA 5E5MB 5ICYB 1QG3A 2XYCA 2HYMA 4OGXL 4HS3B 1A9BA 1MFDL 4EBQL 2B1AH 3DPBA 5J0BA 4LPXA 3QUXA 2BNRA 4H26A 4MLIA 1RZJH 3E1F1 4YIQA 1PGRB 4E0RA 4LEXL 5CGMA 4G6KL 4NUJA 3TT3L 5D72H 5E4EB 4FXGB 3VXUB 3NFNA 4K23H 4DCQB 5I19L 1JPTL 4ZUVB 4OV5B 2WP3T 3T65A 1DBAH 5BQ7A 2Q8BH 1NL0L 2HTLC 4Z18A 3EDDA 4YXHH 4ACPA 1QLEL 4ZPTB 2R4SL 4OCYH 2XKNB 5L2KB 4RMTA 4JPIA 3DIFB 4XWOD 4IOIB 3S6CA 2VUOA 3SE3C 4EDXA 4JRXD 5F9WB 4E5XB 2IAMB 1KYOK 3NPZB 4JANA 5F7EH 4JN2A 3KPRE 1T1YA 3GI9H 3ZYJA 3N9GL 1QZ1A 4WUKL 1CE6B 2PTTB 4K3DL 4NFBA 1WBYB 3ZT6A 2HTLD 7CGTA 2FL5B 1I4FA 3BEWB 3IFPA 4D9QE 3AXLA 4M4PA 2CIIA 1E4KC 4XHQA 2AJXL 5DUPL 4OT1H 2BNUA 5ENWB 4XCNA 1FDLL 4R8WH 4LCCA 3S35X 5F6IB 1BZ9B 5D7JA 2PW1A 4OZHF 4CVXA 4LSTH 3WIFA 1H9VA 3L3JA 1ZT7B 4F7PB 1IQDA 3PDDA 2CQVA 3SGKA 4NPYB 4GS7C 5CS7A 4P23B 4ORGB 5DEFA 4TULH 5EZJA 4XCCL 4F7EB 1OF2B 2W60A 4N5ED 1MJJA 2BP3A 2CRMA 2QQQA 1T66D 3KNBA 1QA9A 4KKLC 5FHAL 5DGRA 4HF5H 4PJIE 3GZKA 3RNKB 4UILH 1SYVB 3TVMD 1AHWA 1JWUB 4M00A 3RWEB 4N0FA 3AMKA 5BRZD 1U8OB 1KJVB 4LSSL 5FF6B 5ILTL 2R8SL 4ZSOA 1B0GB 3KJ6L 4XCFH 1I9IL 1W0WA 4G6FD 2FH8A 5TE6H 3DO7B 3Q3GA 3ZHLA 4LSRL 3O4LD 3HB3C 3FN3A 4UIMA 5JW3L 1BHGA 1RMFH 1YYLH 2Y36L 5I1AA 5HGBA 3HUJA 4K23L 3HMWL 3MUGB 3L5WA 2VZSA 4OSUL 1SBSL 4X4YB 1QLFA 1T2JA 3JV0A 3B2UC 1FNFA 3D39A 3GI8L 5F8RC 5GISH 5ERWA 2NW3A 3VRLF 3V5HB 4KTDL 3QEQD 4OLZL 4RRPG 1UWEH 5CJOL 5FHBL 5BXFA 1H3GA 3GMPB 3SEPA 1G7IB 1D5BB 2ED7A 3LKNA 3OKOB 5CJXA 4KXZI 1RZJC 5GRUH 4Q6IC 5CP7B 5H94B 1BVKA 2JELH 4ZUUB 2YN5A 2X42A 4HC1A 2NQCA 4R26L 4KJYA 3SJVA 3UPAA 3SDYH 5FYLH 4UT7H 4LLWA 1V05A 3GI9L 1UWXK 1QSEB 4MHHI 1HYSC 2C3GA 2F54A 1B0RA 4JHZA 3LZFL 3MODH 4U1HA 4FABH 3TJHC 3MXWL 3QJFB 4DKEH 2G2RB 1AD0A 3ZYIA 2F8VA 4OZGF 2VQ1B 4AK1A 1IC7H 4JQIH 1OVZA 1AIFB 4PTUB 4OF8A 3NZHL 4IRZH 2WANA 1MCWW 2PCPB 4Z77A 3S3PA 4NZTL 2C1PB 3TBVB 1MEXH 3O3EB 4LEOB 3ES6A 4M6NL 1RURL 5FYJH 5IKCB 3GSUA 3QXUA 4AIXA 1U8PA 2FX8L 4GG8B 3TZVA 1YPZA 5EZLB 4K2UH 4ZAKD 4C56A 1IAII 3VMOA 4LU5L 4MB4A 4Y4HB 1YZZA 4M7JL 4KV5F 2NY0D 1CXLA 1IL1B 4ONOA 3RUGA 3SOBL 3VWKB 1K8IA 3MRPA 4P3DA 3DX8B 4UOW1 1OPGH 1UA6H 1FAIL 1TJHL 3BH9B 1I9IH 4XMPL 4X6CE 1T22B 5IB3A 1JI1A 5TE6L 3SKUD 4KAQL 4ELKA 1FNSL 2VXVH 1KN2L 4CMMB 5DJDB 3S35L 5CUSH 5T3XE 4O2EA 1G0YR 1KELL 3ALWA 3CVHH 3CSBA 4NCDA 1A14H 5HDOA 1HXYB 1DANU 4ZXBB 4LSVH 5JQ6H 3VFOB 3U83A 4HUUB 3WCYA 3P4LA 2Y5TB 2IFGA 1I1YB 3U0WL 4I0KA 4XBPA 3TNMB 5CCKL 1IEBA 3VFOA 4EUPH 1QVOB 4YHPA 1J11A 2EKSA 4JFOA 3O6ML 3VFTA 1FL6B 4RGMB 4EN3D 3BMVA 2FJFB 3Q1SH 1CK0L 4PJ8D 3QZWB 3RFZC 3HE7C 4CW1B 1FZMA 3P0YH 3F12B 32C2B 3RWHA 2JJSA 2PYEA 4PREA 4UQ3A 2VJXA 2K7QA 4JG0L 2R4RH 4LOUD 1D7FA 5I15L 3BZEB 1MFEL 4XNZB 5J8OA 3I2CH 5TDOB 3T77B 2UVEA 5MEOA 3P4NB 3SKMB 3DI3B 4M6ML 5FUZH 4PJCA 4AY0A 3RGVD 3FRPG 4IRJC 3SCMD 1CT8B 4KRPC 2Z93B 3GKWL 2EH8H 1XGYL 1MRDL 3GSUB 3DX7B 1IAOA 1IGMH 1IGJA 4WW2A 2R1XB 2BXYA 1OP3K 4DKFH 3ES6B 4PJEF 3SE4A 3WLBA 3O3EA 5L2KD 1JTOA 4YXKH 5D7IE 1XFPA 3IS1X 1YNTB 5IG7A 5D7IF 4C56D 5LXGH 1FCCA 4DN3L 3ULUC 2FHCA 1NGWB 3AB0B 3VXSA 3SGDI 2OP4L 1XCTB 1UGNA 2H26A 1AD0B 1F2XK 2FD6L 5EZOL 3QJFA 5CJBA 2V2XB 4U1HB 2EDNA 1HHJA 4M5ZH 4Y5XC 4U1KA 2VDLH 4OLVH 4F58L 3LKRB 4BUHA 5JUEL 4HMEA 1V7NL 3V9FA 3HZVA 5HI3D 1AXIB 1LO5A 1BVKB 4BZ1H 1KN2H 4XP6L 5CP7A 2FR4B 3U7WH 2MTPA 4Q9BA 4WHDA 4U2ZA 2BOBB 2XWJA 3DVNB 2ICWI 3NAAH 4TRPH 3WBDA 2AJUH 4WFHE 5HDQH 3V5HA 4Y2DD 2NW3B 3SDAC 2CMRL 5I1HH 3MOAH 4QF1A 5EWIL 2LU4A 4OLUL 1CXFA 3I50L 3MUGA 3NN8B 4MCYB 5BMFL 1LP9B 1XGRA 5HGBB 3RGVC 1PZUB 1AQDB 4K71B 3GSRB 4HX1A 4QHNB 3RWIB 4GXUN 3U4EB 1IM9A 1UCBH 4MA8L 1G6VK 2R1WB 1MQ8A 5JXEA 4OCRH 5I1JL 3ZDZE 3FB6B 1EXUB 3INUL 4AEIL 2E27L 4JRYA 4JZOA 2ZUWA 2YK1H 2ATPA 4ODWB 2AQ2A 2HKFH 5IQ9B 1JRHH 1W8OA 1T2XA 4RZCA 3WSQH 2ICWJ 4LKXB 2MWCA 2YSSB 2XKSA 2C4XA 4OLWL 1AQKL 1WJ3A 3TT3H 1VSCA 1T1XA 5IW3A 5DMYA 1RY7B 3VFVA 1RULL 4I18A 4QCIB 4Y4KB 2HLAA 3QFJD 4YGVB 4W6WB 4ZTPH 4NO0D 1MRCL 1CWVA 5I76B 5HI5C 1EAJA 1OF2A 3I3DA 4OZGB 3ROOA 5DEFB 1HNFA 4NHUA 4P23A 4DQOH 2X70B 1VEPA 5DFTA 5D1XC 3VD5A 3TVMA 1KB9K 3FQNB 4H5SA 2GITA 2PW1B 2C3WA 4Q0XL 4QT5A 3QDGA 4DZ8A 5JW4N 2IG2L 5E00A 4XBEH 5ENWA 3GBNH 1F6FB 2EYSB 4PGBB 4QY8B 4ZDHA 4OZGE 5L0QC 4LKCA 2CIIB 5EH1A 4GRMA 5FECA 2ZUTA 1UVQB 3E6HA 3RJDA 2FL5A 1QRNE 3IFPB 5C6TL 5IHLB 4KZEH 2E9IA 3M8OL 2OSLA 5E2VL 3EDFA 5IM7B 1HKLL 4MA7H 3VFPB 1T0NB 4HJ0C 3PGDA 4MD4B 3CFDB 1R3KA 1U8KA 2OI9B 5L6YL 1UC6A 3UYRH 1INQB 1TVHB 3QBTB 3OL2A 4MJIB 4EEEA 3KLHC 1JZ2A 4BZ1L 1I3UA 2B4CH 1MHHB 4JO2H 1HH9A 4JFDE 5L2KA 1UZ8A 4FQLH 4PRID 4UZGA 1KYOJ 3OV6A 4LBEB 1MREH 4MQTB 2DTMH 4GKSB 4POZC 1ZLUH 3VI3F 3DVGA 4ZQKA 5JHLH 1GAFH 1FYTE 4OV5A 1BVZA 2DD8H 4OZFH 4UILL 3S3JA 5KTEH 4EVNB 1WWBX 3AREB 1ZGLB 5H37G 1FZOA 2YMXH 4B53A 4E9LA 4PJIA 5T1DL 2IBZY 2G9HA 2R69L 4YIQB 4U7SA 3GM0A 3B3IB 3VDAA 4XC3H 2EDYA 4V1DE 1XEDA 5E9DB 2ITCB 2BNRB 5IHUL 2NY1C 4BK4A 1FCGA 3BJ91 4P2CG 3FHQA 4AM0B 3IXTA 5JMOC 1A9BB 4Z5RA 2A0LC 3R0MA 3H42L 3P11H 3V6ZA 2AABH 4YDJA 2YD4A 2DQCL 5EUOB 5ACZA 1FC2D 3VRIA 5F9JB 1XGPB 2CKBA 3H3KA 5TE7L 2X09A 5JO5A 2FO4B 1MFAH 3OXRB 3C6SA 3MLZH 4HXBL 1UM6L 1WV7T 1BOYA 4DQOL 3HLAB 1YEHL 3S37H 4HIIA 1QTYT 4HKXB 4NQUA 4RGOL 3TBWA 4U6VH 2UYLA 3WO4B 1P7KA 2DQHL 5KG9A 1NAMH 2X6MA 5TQ2L 2P8PA 4M5YH 4NO2B 4PJEB 3MYJA 3QDJD 3OKNA 4M62L 2YRPA 4ALAL 4HIXH 4HUWB 4EIGB 2X4NA 4MAYA 1JHKL 5E1HB 2OTWA 2VZ3A 1U8NB 1YMHB 2XTLA 4XHJC 3V52H 3G5YB 4ZS6C 2H2SD 4JPWH 1CE1L 2DAVA 1NLDL 1MVUB 5DJ8B 4CRPA 4YE4H 5HYQA 1G7LB 2VUYA 4MZ3A 5A2JH 4G9DB 2YUZA 1JTTA 3VCLA 3TZVD 1YJDL 5GRWA 5ABDE 5TDNB 3QAZC 4OQTH 3F5WA 3KJ4C 1JNHA 1OGAB 1FFNB 1X5ZA 4RAVA 2IEPA 1NGPL 4OD2A 3O9WA 3TT1L 3SDDD 1A6AB 4H8WC 4KKCC 4M43H 3KPSD 4UOW0 1U95B 2ID5A 4M8QB 2VLME 3QDGD 1IRAY 2XA8L 1FNEA 1I75A 3NCBB 3QUZD 1QBML 2DQDH 1N6QL 3MGTB 4GAJL 1QFWM 4CVUA 1KPRA 3LKPA 3BGAA 1MCJA 5C8JA 1X5KA 3EYFA 4HGWB 5CLTA 1AO7E 1KELH 5J3HD 3SDXE 1CR9L 3P11L 4FQPA 2HTKC 1QFOA 3MV7A 1HIML 4Z7UA 5JDSB 3QHTC 1M6OA 4FTVE 2AJYL 5C08D 1UXSB 4R0LA 1HSAB 4J23A 2EYRB 3QIBA 4JFEA 3AM8C 4Z0XA 2E7HA 2V5RA 2VXTH 4V1DA 4OCYL 4YUEH 1VERA 3AMLA 5HHMB 3MLYL 1YEHH 4HUVB 4U4BA 4CNIA 3CUPA 1RJZB 1X3DA 2WZPD 3Q1SL 3JVGA 4OIAA 1F97A 4NQVB 1NAML 5TDPB 3EKCA 3LS4H 5H8DA 2YHGA 1T7XA 3KYKL 3BDYH 5IW1A 5FXCH 3Q2CA 5GGQL 1MFEH 1F90H 3MRCA 4Z0XB 5IF0B 1O5DT 1ZVSA 4Y1AE 3EOAA 4JM4H 2BVEA 1KTDB 3WFZA 2MQ3A 5I1GH 3FAWA 3HPJA 4YHNB 2CJUL 1D5MA 1HOCB 2ZNWA 2H2PC 2QQNL 1E4WL 4Z7UB 1NUDA 5MENE 5KSBB 3GMOB 3JV6B 3KGRA 3WFEH 1FDLH 4R8WL 5DA4A 4LSPH 5DFVD 3V0AC 5ITBL 4GBXA 3BDBA 3VXPB 4OUUA 5DJ2B 4HGKC 3HZMB 5IBUB 4JZJA 5F9AC 4UNVA 4FQ1H 1NGPH 3ARPA 4N0YL 3MUHL 4XCCH 1OWRM 4DK6A 3WHXA 3GM8A 4FQIH 4WJ5B 2DLIA 1JI2A 5HHXL 2MCG1 4YEEA 1OTSC 5DWUH 5EU7E 1JN6A 1I8LC 1KT2A 5CEZE 1LHZA 1HI6B 1DSFH 1AO7B 4AQ1B 1OP5H 3QDAA 5KANG 4XNYL 3GBMH 3B2VL 2GUOB 3ARVA 4U1SB 1CFVH 3I6LD 4G8GE 3FOMA 3F7YB 4KROD 1U3JA 1YN6B 4DUXA 1A64A 3MRRA 4P5KA 3U7WL 4PFEA 4G9DA 4CMHC 1HK6A 3HAEB 1R24B 4FZEL 2ED8A 4F7TB 2HT2C 3IF1B 2A83B 4PRIB 3B8SA 3DECA 1P4IL 4LHJB 2CXKA 3X3FL 1ZHNA 5CEZL 1FL3B 3UJTH 43C9A 4DN4L 3H9SE 3REWA 2Q8AH 1I8KA 4LK4A 2QADC 3RU8H 5DI8B 2BNQB 3MLYH 4H1LB 1OAKL 3MYJB 4KPHL 5A1AA 2NTSP 4Z7QE 4XB8A 1MCLA 3C2AH 2DQUH 4FTVB 5MENB 5EZIL 2BNRD 2DLFL 5FV1L 4MXVF 2I5YL 1D6VL 4OD3L 3LZFH 3MODL 2D2OA 4MXVE 1A02N 3FB5A 5KVFL 3LEXA 2DMCA 5F9DC 5FGBA 4YQXL 4BSJA 5KSUB 1G9ML 1IM3A 1KACB 4S1SL 1HINH 2F19H 4NQDA 1ZHBB 2IH3A 4LRIA 4NRXA 3IXTB 1MEXL 2QL1A 4JDZA 5DMGD 5J6HA 4JCMA 4JFDA 4YDVB 3MZGB 1OTTD 1ULVA 4WI8A 3TNNB 3WXWH 3OKKA 2W9EH 1JBJA 5LJYH 1RUPL 1FZOB 3UPRB 1XF1A 1M71A 5C09A 4P2QA 5LVEA 3TO2B 1LDPH 1FN4A 1YEEH 3IRZA 1H5BB 4GKSA 4PJ8C 5GRUL 5IFJA 1T83A 5FYJE 2Z8SA 3KAAA 2GSGB 4WTZA 4JFQB 3FJTA 2JIXA 3CSGA 1TZIB 4O51A 2MCPL 5ALCL 1DUYB 1KCRH 5HHOB 1E4JA 4WHTB 1FG9C 3GMQB 2HA1A 4GSDL 4FQLL 1SJVA 4X6EA 3RAJH 1C5DA 1R3KB 1U8KB 4HIHA 4RQQA 4FZEH 3RVXC 4CDGC 4N1CA 5IK3B 2VLMD 1K3IA 3L7EB 4PRHE 3FRPA 2GJ6D 5EBMA 3KPOA 2GJJA 3B6SB 4HIJA 2F54D 4LSQH 5I17A 4PY8I 2R0ZH 3GSNH 1P9MC 4DEPC 5D5MA 2R9HD 4GRMB 4LKCB 4MGXA 1U8MB 4WFGD 2ZCHH 4MSWA 4PGBA 3SJVE 2VAJA 5IT2H 5I8KH 5CBAA 1MLCB 1H3PH 5F89B 3QDGB 2MFNA 4ZTOH 5GGUA 2WBJA 4QRPE 3QUZB 3UDWC 4G80A 3GFUA 2ITDA 4FQQB 5GJTL 5TQ0L 1KG0B 5E24E 1AC0A 4HK3N 3GNML 4P2QE 3TPKA 2WLZA 3RP1A 3MO1B 5I76A 1KFAH 1LO3H 3BYYA 5KS9A 1HHGB 1BM3H 1N3NB 3MA9H 5L0QB 4QRPA 4S1RL 2VDPH 1QHOA 4QCIA 5LGHH 2CRYA 3G6JA 5E99L 3CXHJ 1TNMA 3HC3L 3LD8C 4OAWA 3U0PB 4LKXA 1NCDH 2X4RA 1L7IH 1VA9A 4IRSC 5CUSL 3CXDH 3FFCB 1DLHA 2YZ1A 3G6JF 4P46D 2ORBL 1DQMH 4WI3A 2EDEA 1UM4H 4GMTH 1E6OH 2BRRL 3KPRA 4GLRH 4QOKE 1AQDA 1GOFA 1PKQB 3BPOC 1NJ9A 1QYGL 4WUKH 3LKSA 5I16B 1XGRB 3TYFB 1R5VB 4MXQD 1KEMH 1JHKH 4XI5D 1J5OH 1TLKA 5EZOH 1BP3B 1MJUL 5LAXB 4FFYL 1F6AA 3GMLB 4QNPE 1RZ7L 1ZKAA 4S2SB 3SPVA 2CD0A 2EEDA 4PRBB 3NFPB 5E2TL 4NYLB 1NMBH 2W65B 1GRWA 5ALCH 1DVFA 2IPKA 5DHYB 3C5ZC 1BZ7B 4L4VB 3C2SA 3RIAK 2CR6A 3WIHA 5MERB 4PJHA 4TULL 4HBCH 1A6WL 2QLVB 3MNWA 3VXME 2Q8BL 3RKPA 4JAMB 2A6IB 4C58B 2V5TA 1MRDH 2YKLH 3OQ3B 3B8YA 3OF6D 5JXAH 4EI5A 5CJ5A 1X9QA 3FQRA 3QUML 5HHVL 3B9KC 3QIUC 4JY6A 3IFOA 4DGVL 3Q6FB 2F8XC 2UV3A 4LSRH 4U6TA 5EU5B 5GZND 1RMFL 1YYLL 4KROB 4N1HB 2EIDA 3DYPA 4Z7QF 5DMIL 1S7SB 1JHLL 2EEAA 2XACC 3SDXA 1JGVH 3QUMB 4NQED 5FGCE 4ZTPL 4PJCB 3HFML 2OR8A 1YEKL 3C6LC 3V2AR 2ESVE 3VJ6A 4F3FB 3IDGB 3T77A 3W0WD 1CIDA 5E94A 2V7NA 2XTJD 4RBPH 2YD7A 3A0OA 1L7IL 2PYEB 2BY2A 5FO9A 4CW1A 1KPVA 3RTQD 1Q9WB 1FFPA 3LQMA 3DMMA 4Q0XH 2A6DA 2IG2H 3QIWA 2BCKB 2MOVA 4HCRH 4PR5A 3OJDB 5E6IA 4MVBC 4XAKE 1KEML 1MY5A 2D31B 3C08L 2R0WL 1DLFH 3MX0A 1RQ5A 4XBPB 4MWFB 3B9KB 3QIUB 3TN0D 2YUXA 1RZ7H 2XY2A 4LFHG 2Z31C 3PV6B 2HT3D 1SM3H 2CLZB 4PJHF 5C0FB 5KN5B 1J0JA 3OKEB 4P59L 1IAKB 4U1MA 3SE9L 3U0TB 5IMMA 3VD3A 2HKFL 5ITFA 1CGUA 4CMMA 4Q97A 5HSFA 5I6XB 2V9TA 4JLRB 1A4KB 1A9EA 5HGDA 4MA1C 1UM5H 3W11D 4YGAB 2Y36H 4PRPD 3MFGB 5FYJL 3HMWH 1GIGL 4GS7B 1I7ZB 4GW4A 3C09B 1HQ4B 4KKCD 4X0KA 4XVTL 1ITCA 3FO9A 3TBTB 2NY1B 3VWKA 4FQIL 3V6OC 4K7PX 4HHAA 4S0TD 4KUCD 4HS8H 1T89C 1NGQL 4OM1L 3JV4B 2VLLA 5F7WC 4FS0A 2X5PA 3T04D 5JR1H 1J1XL 2GI7A 1DQQB 2HLFD 1WBZB 1OPGL 2OL3A 5ANME 3KPPA 2UVFA 2X4PA 3WS6C 5A40E 1CLYL 4R4NC 4HXAL 3D69B 2PCPA 4HCRA 1LK2B 2NY4B 1LEKA 4PPTA 4YDIL 2EZ0D 2JJTA 1XF5A 5EC2B 3WO4C 1AIFA 3BH8A 3F6LA 5IESH 3H0TA 4JM2B 3RNQB 5C0GB 5AD0B 5CZKA 4IIQC 2G2RA 2AXFB 3FRUA 1R3IH 4UOJA 5DMKA 5EO9B 3NIGE 1MFAL 1A1MB 2F54B 1AP2A 5F88B 1BMGA 2IWGA 3KYNA 5D93B 4KJYB 4IOSD 2Z35B 3TF7C 4O02H 3WHE0 3IDYB 2F5AL 5FO7A 1I1FA 1U8JB 5D2LF 3R1GH 5H94A 4LLQA 4OI9A 5I8CB 2DLEA 3QFJE 4KHXL 3KPQA 4U1IA 4Y19E 1A7BA 4W6YB 2P24A 5K9KA 5I8EB 2DIBA 2MJWA 4LAQL 3ARBC 3GMPA 3UBXB 5LG1A 4HFUH 1I7RB 1D6EA 2HVJB 4K3EL 4L4JA 4F15C 2NTFB 5JIHA 5C07D 2F53B 5C07A 2JCCB 4G8FB 1F13A 5GS0L 2BFVL 3OR7A 4R4FH 5FB8B 4XC3L 1BD2A 2B1AL 5F1KC 4KQ4H 4FMFA 5JIPA 4DKFL 1FNSH 1QSFA 3QCVL 4G42B 2RGSA 3Q3GB 4YX2L 2E9WA 2IALB 1NMCC 2NCMA 1MPAH 4G6KH 5IEKB 2JCCA 1I9JL 3NPSC 4XPAH 1SJHB 1S5IH 3WS6A 2BHUA 3OKMB 5IFAH 4KRNA 5DO2D 2QR0A 3GIVB 5J1TC 1R5IA 1R3LA 1SEQH 1JWUA 1ZE3C 2P24B 1OSPH 3RNKA 5MP6L 2FIRT 4HD9A 2D7TL 5D1ZB 1I1FB 1P84J 1U8JA 2AKRA 1I7UB 4PRAB 2V6HA 1NEZG 5D6CA 4LVOB 1FNAA 1A1OA 5J4MA 4M4RA 3LKOB 3VWKC 3QT2A 1KTRL 1ED3A 4NUGL 5MI0C 2MCPH 4ZD3H 5DMKB 4I3RL 1ZT7A 1KCRL 2WUBL 1K5NB 4GKNB 3N9GH 8FABB 2W0KA 3H9SB 3N85H 3RNQA 4ELMB 4LCCB 1C5CL 5I71B 1WFNA 4KGJA 2AJUL 4HDIB 3TIDA 2VDRH 4WI9A 4AIZB 1LEKB 5FEBA 1Z0MA 2YZ8A 2QBWA 2J6EA 4OT1L 2DKUA 4M61B 4F57L 3IYLW 1CFSA 1OAQH 2EDFA 3V6FA 2X4PB 4JO3L 3JBG7 1ZHKA 2ZNXA 2XWBA 1C08B 3BD3A 5GGVL 2IPUK 3CMOL 2D9CA 2QHRL 3QIWC 5CD5C 3ARFB 4NKDB 3MLRL 5CZVL 3HR5A 3LOWA 3KYKH 4FQHA 5EORH 3WSQL 3IFNL 4JPIB 4JEGB 1EMTL 1F5WA 1I3GH 3LQAH 4OLWH 4ZPTA 2NYYD 1VFOA 3CFBB 3PXHA 4K3EH 2BSSA 2VWEE 5LGKA 2V9QA 1YUHB 4NQCA 4MB5A 4NQEB 1BEYH 4LRNH 4PJ5B 5B38G 5CZXD 3IB4A 3T08A 4QGTA 3OKEA 1I8IB 1SVZA 4X8JB 4H26B 2AJ3A 3U9PH 1H5BC 2NX5A 1URLA 2XTJB 4IS6B 4XAKD 3W9DA 4YPJA 3OJVC 4RFOH 2Q76A 3B9KA 3QIUA 4Y1AB 1IILE 1JGDB 2IAND 1VCAA 3VXSE 2D31A 4EI5C 1JYVA 1DR9A 25C8L 3QJHB 4XMLL 1ZT4B 5HHNB 3OJDA 4JDTH 4V2CB 5E8PA 3WN5B 5D1QC 1HHKB 4I3SH 4YHIA 2QQKL 3GHBH 4MNQA 3QDMD 2VDKL 3OG4B 3LH2L 2CSPA 4HUXA 4RCAA 5E94B 4C83A 4YZFF 5KZCD 3LS4L 3GUTA 4JFPB 4XCYA 4KKBD 5D2NB 1C16B 4J4PC 3U4BL 2YD6A 3AAZB 4P4RA 3GEWB 3KLSA 3RWGA 2OCFD 1S7SA 1LE5A 3QUZC 2W9LA 4MNHB 4PRPB 4JB9L 1CXKA 1MFBL 4NBZB 1JV5A 3R06A 4Y2DC 4JDVB 3WFEL 3I6KB 1V7ML 3FQXB 1GC1L 3QUYD 5CBEB 3BJLA 2C3HA 1CFTA 4L8SA 4XBGA 1BF8A 2H3NB 4HMCA 1FP5A 3BIAX 1M4KA 1JTPA 3A6BH 1HXMA 3NIGF 2WINB 4APQC 3RA7H 4Z7WE 2GFBA 3O6FB 2XZAL 4Y88A 5HYSA 5GJSH 4QLRA 4JAMA 2FSEB 5EU6A 1I3GL 3LQAL 2HN7B 5C0DB 4WEUD 2FJHB 3QO0B 3GSOB 4WNQB 5ESQA 1CDBA 3FFCE 3CH1A 4PJHB 3OF6A 1PSKH 4WHYG 3PHOB 5ISZB 1F11B 3W39A 2G75A 1ZMYA 2L7JA 2V17H 5TPWH 4BQBA 5DVLA 2QSCH 2I27N 1JWMA 2B1HH 3S37L 3S35H 3SPVB 5DHXB 4PGCB 4AG4L 2WBJC 1IGYA 4KDTA 4IBLT 4JHAH 3MRJA 3OB0K 3G5XA 1UKTA 25C8H 5GGTH 2HKHL 5IHZA 4NJ9H 1U3YA 1RUPH 4F80A 5FDWB 2VDMH 3O4LE 3ZE1F 3ULVD 5TFSL 3ECBB 3V52L 3GSQB 3D2UB 4JPWL 4P48A 3DVFA 3BPCA 1DLHB 4JGMA 2FWOA 4YDLB 4QHKJ 1LO0H 4P59H 3V0WL 2OI9C 1F8TH 5I2IA 3CFEB 1L4IA 1MUJB 4MQ7A 3RX5A 3QRGL 2X4TB 3QWRA 2EXWD 3MV7D 3DGGA 3EJYC 3EAKA 1WFTA 3PNWA 3QZWG 3MO1A 3P9WB 1PX3A 5FFLA 3VG0H 5IEHB 1QNZL 4E41B 4P2RA 4NOBA 4BH7B 4OQ1A 2DKMA 4Y7MA 1XGYH 5D71L 2WBJB 4TSBL 4DGYL 3OB8A 3JZ7A 4Y4FC 2EE9A 1MLCA 4U0QB 5D1ZD 2VISA 1WAAE 4M9PA 3VRJA 2BSRA 3ARDD 3RWJA 3JWDC 3MNZB 3ZDYE 4D0DA 4XH2A 3WXWL 1ZHLB 5E7BA 5DUBA 4PJDF 1ND0B 3D39E 3DYOA 4F9LC 4P4KD 1H8SA 2UY6A 1W0VB 5F72S 2VR5A 3FTGA 2J88H 3H9SD 4HFWB 1M7IB 1LDPL 4DFHA 2OM5A 3MLVH 5CLWA 3HB3D 5DF0A 5C09D 2FGWH 4NM8H 3ULUH 1QRKA 4M1CC 5KOMC 5TPWL 3RZCA 5T1MA 4O51B 3H3PH 4XVUC 1U8LB 2GJ6A 1BVLA 1FVDB 5KVMC 3MJ9H 1QR4A 1OM3H 1HHIA 4F7CA 1EZVX 4HLJA 5K93A 1EDQA 1FN4B 3DRTB 1O0VA 2WBWB 1UM4L 3CZFB 2AVGA 3ZDXE 4A2LA 3DNKA 3K8LA 3STLA 3MBXL 4LSQL 2B2XL 3HE7B 5JNYA 4TNWF 3OJMB 1AGFB 3DWTA 3JTSB 4MJ2A 5TFSH 4YHLL 2A9MH 1A1NB 4NSKB 4Y5YC 5DHVB 5BVJB 2X4OA 1EO5A 1PZ5B 4JFDB 4NO5B 5J6HB 3TJEH 1OTTC 3UP1A 3KJ6H 3QI9B 4LCYA 5K59F 4AEIH 4RGNC 5SV3A 5DVOA 2OJEB 4U0RB 1X5GA 3QHZH 4PY7A 1LP9E 1M1SA 1UACL 1SMAA 1CCZA 2F8OA 2NXZD 5KSUA 1EHXA 5IR1A 4TYUA 2IFFL 1DFBL 2ADFH 1AGDA 1MCNA 1G7PA 5IFAL 2WQRA 3K74B 2XT1B 3UTSB 1SEQL 4GRWE 2IANB 1U92A 4WFEE 4LHUD 1OSPL 1GGYA 1CF8H 5DD3H 4IOFD 4FNLH 3ORJA 1KJ2H 1KN4L 3ZL4H 3RVXD 1IQWL 2FGZA 3RI5F 1NGXB 5FOBB 2HVKB 4KK9C 5FGCB 4RBPK 4H0GA 4R4ND 2VLKE 3PABA 4MX7A 3QQNA 3SE8H 1HDMB 2Q3ZA 3PJSA 3NIFF 5A16A 4I1NB 3BIKB 4YBLC 2NNAB 5KZCB 3VXRE 3NACH 4BZ2H 4R3SB 3UTTE 2EDTA 4Z7WF 2AJZB 4F7TA 5K9QG 1AY1H 4AT6B 2J88L 4UT6H 2FIKA 3HAEA 5D1QA 4NWTH 2EDOA 1DQDL 4NDMA 3UJTL 2C3VB 5SWZB 4PJFB 1RHFA 3N1GC 1KIPA 1CGVA 2DI7A 3HI5L 1GGUA 5AZ2H 2DQIH 5D2LE 2NX5E 5GGSA 2EDBA 2VIRA 3UTTB 2HFFA 3CVHA 5CAYB 2EIZB 1CG9B 4FQJH 4HPYL 1FV1A 3IFNH 4GBXD 2PNDA 1HSBB 2P5EE 2EC9T 5BZDA 3O8XD 4LU5H 5IB1A 2CK0L 5FOJA 3O3AA 1KJ2A 1ZK9A 3AM8A 4PGJA 4M3JA 5C0RH 3MLWL 3E8UH 4CJ0A 5L2JB 3L3IA 5CEYB 3KXFB 4N0RA 4PJFF 1BQLH 2HJLB 1XAUA 4Y16A 1EFQA 3QQ4A 1T21B 4H1LG 2OR7A 4QOKD 1Z9OA 4I2XE 4XZUA 2V2WB 2J8UB 4E42B 4QHLA 3RKDD 1PLGH 4JVUA 4MLSA 1H0DB 3PWJB 1FIEA 1G6RA 3LVEA 1UJTA 3C60C 1JGVL 2VDNH 1DQLH 3EJZC 5IMOA 3LB6C 3BO8B 4I5BA 4BFGA 1DBBL 2IMNA 2QV2A 1AFVH 3RPKA 3QEUA 1TJGL 2FYYB 2IQ9L 5IW1B 5CEZH 5E8EA 3X17A 5HI4D 4DN4H 1IMHC 3U36A 3PHQB 5ID0A 3BQUB 1DL7H 4NQVA 3PHQA 4X7FC 2P5WA 3D2UD 4P57A 4HG4J 4PRIE 4G8GA 4RMSA 4M5YL 3P0YL 3O3BB 2MPAH 5E2WL 5ESAB 3MACL 4JFEB 5I66A 5I30H 4E42A 1Q0XL 1M6OB 5K9QI 4RAHA 1XR8B 4Y19A 3P0GB 3D9AH 2UWEF 4XP4L 5C86A 4G43B 3QQ4B 4HGWA 4V1DD 4P5MA 4FQXD 1KPRB 3TBSB 3TYGL 2F19L 4AL8H 4QTHB 1RJCA 1S9XB 3BN3B 1INEH 2DYPB 5IJVA 2AGJH 3O9WD 4JFEE 1N0LA 4WO4B 3KVQA 1GC1C 5IB1B 4ZTOL 5TGBB 3HG1B 4M8QA 5BZDB 3TT1H 3W82A 1FV1B 1KENL 4QYOA 4IMLB 4PJXF 1I9EA 5C09E 5D7LD 2ILLA 3B9EA 3S5LG 3LQAC 1WWWX 4WW1B 3BGFB 3ZDXF 4I9WE 3MTRA 4NDMB 1GZQB 1HNGA 1BQLL 1MWAA 3GRWL 5DJ0A 3ARBA 1B4JL 3KPLA 5DK0B 5IMKA 4WUUD 3QR2A 4DZBB 2P8LB 2DQTH 1VKXB 3HCVA 2P48B 3QDJA 2FIKB 2PYFA 3LEVL 3G5VB 3ARTA 3RL1B 2HFEB 1A0QL 1FNGA 4XPAL 3LMJL 1DQML 3G5YA 3ZYOA 4WHCA 2R29H 1K85A 1A47A 3CLEL 2OXHA 4MAYB 2DBLL 3EHBC 4MX7B 4XXCC 5IROA 5HGAB 2O93L 4DTGH 1IC4H 2H2PD 2P46B 3WNKA 4AEHL 1DL7L 3V0VA 2UYLB 3NFSL 3JWNC 3HAEH 2EDRA 3PDOA 3BZ4A 4X80H 2EXYC 3HLAA 4GW1B 4L1DA 5K33A 1QEWB 3RVTD 5GGTA 1Q0YH 5KJRH 3OXRA 5J57B 4JFFD 3N0PB 2OK0H 3CDCA 1XGPA 4NOFA 4I0PA 4OGZA 1G7MA 1OT1A 3MXWH 5C0JA 3ZMRA 3KYOB 3X13A 4UU9B 3GDBA 2DIAA 4YDJB 3VXUD 2XQYG 3V6ZB 4Z7WB 1QNZH 2AJSH 4JPKL 1T89A 3MGOA 3MRFA 3UZQA 1S9VB 1UJ3B 3RPIA 2ZKHL 5E9DA 3MMEA 3QCVH 3ESUF 5BVJA 1A1NA 4NSKA 3JTSA 4M6NH 1TQBB 4L8DA 1RURH 2VDOL 3LKQA 4YFEA 5MEQB 2GT9A 2JJUA 2WIMA 1MCHA 3M17A 3QFDB 5D1XA 3I3EA 1DEEB 5HHXH 1YPZF 4P23C 2CDEB 3MOBL 2NYYC 5C6TH 5CJ8A 3IDXL 5A43C 1J88A 3TP4A 1BQHB 4L29A 1KB5H 4R4BA 5CINH 1MHHA 5E5UB 4NN5C 2W59A 4QTIL 1Q38A 3OZ9H 1NMBL 1EFXA 4JY4A 5GRJH 4Z7NE 3W5MA 3CFDA 3LSOB 3RWDB 4X5LA 2XG5A 3U9PL 5DZNA 5IV2B 5A2FA 2VN7A 2ADGA 5MHSD 3PWNA 3HI1A 5B39B 5HPMA 2WUCH 2OSLB 3GO1L 5I73B 3WE6B 4YPGB 4KK5D 1ORQB 4XMLH 5DUBB 5GXBB 2KL6A 1A6PA 2BSRB 3RWJB 3ULVC 4PJBE 3G08A 5LKNA 1X5HA 1NDMB 5DJAB 3O8XB 3HC0A 3OR6B 1UKQA 3TVMB 4C4KT 1XIWA 2MQ0A 5IHUH 1YMME 3EOBA 1DJSA 5KJRL 3O3DA 3FZUD 5C0BD 2J1KA 5EOTA 2EEBA 4LAJH 1LEIA 4YHML 3Q48A 4Z6AT 3ZE2E 3EYOA 2Y7QA 3ZT7A 2ZG3A 4Y4KA 1FNHA 4MQ7B 4LPCA 4Z95H 3MRGA 4APQB 1CD9B 1I9RH 1MFBH 3MCKA 3FQUA 4NRZB 1D5ZA 5GS1B 5FDYA 2XZQH 1SEBB 4MAUH 4F8TA 3FB6A 1MNUH 1IEHA 2WWMC 4QXTA 2WWKO 5I73C 3QWRD 4RA0C 4JFYA 3OAYH 3ECBA 2R1WA 4U6VL 3ZDYF 3UYOD 4HX1B 2R0LH 3K4ZA 1ACYH 5FDWA 3U9UA 4BFBD 2YC1A 4HIXL 2VXUL 2PR4L 4N8VB 2V2TB 4P3WA 1KULA 1DLFL 5DJCA 5GSRB 1QSED 4FFZH 3DVNA 1Z3GL 1KB5L 4G6JL 1IM9D 4PJXE 2CDGA 3BRDA 5HDBE 3W39B 4LDOB 5AG8A 4G7VL 3QNYB 1RZ8A 3HZVB 2HRPH 3STZB 1IKFL 3HI6H 4MNGA 2XZCH 5AUMA 4XNQA 1HHJB 3QSKB 1JFQH 3M45A 5C9KA 2DDQH 4M93B 4KWUA 3MNVB 4WO4D 3WJLC 4UINH 4WENB 4XVTH 5FHAH 2BVOB 3MR9A 1T5WA 4X6CA 3NTCH 3OX8B 4GXVH 4M43L 1NAMA 1RZFH 4ERSH 2RQ8A 5IG7B 3ILPA 4HZLA 3MRQA 4G6AC 4WI7A 2NY0B 2H32B 4PY8J 3I6KA 4DAGH 3CFKA 1JV5B 5F1IB 2Z8VC 3VXSD 3KR3L 3UDWA 4ETQB 4L8CA 3SO3C 3O11B 5A2LH 4DKDC 1HEZB 4NIKB 3T1FA 3BZFA 4NRYB 1S5IL 1TMCB 3D87B 5M95B 3QUYA 1MLBB 3D85A 4Z95L 5F7FA 1BJMA 4FFVC 4JKPH 5L8JB 1K8DA 2IQ9H 3R8BB 3ABZA 4X98B 5AAMA 1RV6X 1NCBH 4NCC1 5AG9A 3FHAA 5E8DH 2LU3A 1MNUL 2DWEA 1Q8MA 1LILA 3WN5A 2BMKB 1JZ7A 1FE8H 3OKLB 2MMXA 1NANI 3VFTB 4O02L 4QEGA 4JFOB 3O2DL 2XI9A 5EU3B 3PWVB 1ZOXA 3S7GA 5J11B 3DURA 5DQDH 1JYWA 3TNMA 3QDMA 5D2LB 4JFFA 4Y1AA 4TUOA 2Q76B 3N06B 4JFFB 4UNTA 5DR5H 2DIJA 1N7MH 3NCJL 3WUWA 4IS6A 1Y6MR 4PJ8A 5F7LB 2NX5B 2AJVL 1WGOA 1I1RA 4N8CL 3H3BC 3FKUS 1OAQL 3CVIH 4G6AD 1P1ZA 3CDGA 3IDIB 1Y18B 4LLDA 1YUHA 3BH9A 3GIZL 3GB7B 4LGPB 4U6YB 5IVZA 2A77H 3DX8A 3ZZ1A 1K8IB 4RMVA 2V9RA 2JCCE 2APXA 2XPGB 5E8OA 1T5XA 5GZNC 3C8KA 3QEHA 1NC4D 4PIRF 4IEFB 1ZGLP 3T1FB 4C56B 4OTXH 3NBNA 4UB0L 4PJDA 4KI5D 3MJ7B 4TSBH 2YKLL 4MMXC 2M8XA 1ODAA 5FKPA 4W70A 1ZHKB 1FPTH 4EXKA 3HRZB 3K3QA 3VH8G 3P0VH 1UA6L 4M61A 5A2KH 3OKDB 4ODUB 2X7LB 3EOYG 5C9JA 3ARQA 2F54E 3MRQB 4PD4K 1CFQA 4LF3A 1D5XB 4GRWB 3TIDB 1S3KH 3ZHDA 1QUNA 3X3GH 5ECJE 3K81A 3DHJA 3JSSA 4C55A 3CNKA 5IB5B 3ET9F 3CGTA 1NMCB 4B7LA 4ONGH 4J3TA 5J89A 4KZDH 3J8F7 1KEGH 1Q1JH 3WYRA 3S34H 5AYUL 5DMJB 4ELME 3ULUL 1LO4H 5E56A 5EO1B 3L3OA 4ZS6D 1AHWC 1TVBB 3IJHA 3RWFA 3STZA 4F57H 3PXJA 3ARDA 4HXBH 4UTBH 1X4XA 4WEBL 3BOVA 3REVB 4KK8D 3A67L 1YY8B 2ESVB 1FHGA 4KRPB 1R3LB 2D0GA 1Q0YL 4TUJA 4ZUSA 4RFNB 3T0DA 4NM4H 4EOWL 1JPSH 1WISA 2V2TA 2P7TB 1JGUH 5IUSA 4KC3B 2HP4A 5D7JC 2IALA 5BV7H 2YC1B 2CLVB 4LCCC 1ZA3A 4M6MH 3HUJB 3WNNA 2P5WD 5BRZA 3DBXB 4FZ8L 2NY6B 1RZKL 4APQD 1ERNA 4NO0B 3CPLB 4LCWD 1J05A 4P2OB 2GJZA 1BOGA 3D39D 5HVHB 1D5ZB 4U1GC 4P9HH 4JHWL 5EFIB 2AW2A 2HG5B 1EJ6A 2ARJA 4Z7UE 4XC1L 1CGWA 4PRDB 3HUJE 2Y7QB 3KPQB 4PJ5E 4U1IB 4ODXA 2O5YH 4TPRH 4LLQB 5I8CA 3BMWA 3NCYP 2W60B 2R56L 4Y16D 3VXTB 4JFHD 4JRWA 5B4MD 5EO1A 2X1WL 5EZJB 3QULB 4S10A 1DQJA 2NZ9C 5M94B 1S9KC 1KGCE 4R2GD 5C0AB 5C7XH 3VXMD 3OR6A 3WIFB 4CVXB 2XNAA 1BZ9A 1CXEA 2FATH 3HC0B 1CXHA 1NDMA 3VDBA 4KXZH 3BH8B 4UDTA 4C56E 2EH7H 2OR9H 4MJID 4BQ6A 1T0PB 4KI1A 4R90H 5DS8A 3T0EA 3EDEA 3AXLB 3JVGC 1D5XA 3BEWA 1HIMH 3WE6A 4O5LL 1LK2A 5J9PB 5EOCJ 1HZHL 3KXFE 2PTTA 1KEGL 3T2OA 4U1GB 1A7RL 2CUMA 2LAGB 1BFVL 5D7JD 1J10A 4HQQL 1LEGA 4OLZH 5E6YA 2XOTA 2JJWA 1CBVH 3MJ7A 1RU9L 4NBXB 2ERJC 5D1QD 3IFLL 3V4VH 3WLWD 2H41A 4D0BB 1RFDL 2IBBA 3IXAA 5T5NF 4PG9A 2Q6WA 2RAMA 2ZOLA 1F3DJ 2XPGA 3QHFL 1FH5H 4LLUA 2CDEA 4WU7A 2WLYA 3BE1H 3T2PA 3QNXB 3UAJD 4XCEA 5CEXB 1ETZA 4D9RD 4YHKH 2CK0H 2VXQH 1P6FA 5HGDB 5JOEA 3M17B 4JLRA 5GHWH 4FXGA 4JRXA 4MA1B 3WD5L 4OI8A 3MJ9A 1I9RL 4MS8D 4LARH 2R2EB 3U0TA 5IMMB 1L9NA 3WUZA 3BKCL 4G5ZL 1NKOA 4LSPL 4IRZL 3DXAA 2CKBL 1RAMA 5K59E 1J0YA 5LCVL 2JB5L 2I07B 1RIVH 4ESKA 2NY5C 4Q2ZA 2DQEL 3OGCB 1PLGL 2FRGP 1FNLA 1T6WA 1H8NA 5CIPA 2BK8A 4DUVA 1DQLL 2BCKA 4PGDA 3VD7A 1KNOA 2DWEB 3V4UH 4OIIL 5MP6H 3P73B 4X98A 1IE5A 2DM7A 2NX5D 4JQVA 3PDOB 2FGWL 4NM8L 3BYTA 1LO0L 3IDGA 1JJUA 4MAYC 4NRYA 1W72H 1L0XA 1F8TL 2ATKB 2M2DA 4OBRA 4ZUWB 1RSFA 5HY9A 1Z5LB 1EGJL 4FABL 3FFDB 3CFKB 1WIUA 1A14L 5F1IA 4YHYC 1JGEB 2XN9D 5FUOH 4LGRB 5LBSH 1A7NL 1W72A 3QEGH 1XGUB 2FHBA 1CD0A 1IC7L 2H32A 2A74B 4JQIL 2Z9TA 3FQRB 3ILPB 5HHOE 3NZHH 2SEBB 1SVCP 1VKXA 2A9ML 4AL8L 5EUKB 1NAMB 3LN5B 1GGBH 5DC0A 3KPSB 5DJ0B 5EN2A 5T1DH 3BP7A 4N90E 5GZOD 4JY5H 4XVSH 2A6IA 2GY5A 2PUQT 1VGKB 5HD8C 4WW1A 4TOYL 5TH2B 4GAGH 4Q9CA 3GMMB 4XNQB 4KI5F 2UY7A 4NBYB 4OJFH 1U8QA 1Y6NR 2VE6B 4AQOA 3VWJC 5I19H 2X9WA 1G9NL 1TQBC 2VDQH 4QRQB 4YQXH 4MDIB 3HG1A 2CDGB 2UUDH 4N5UA 3UJIH 2AEQH 4NYLA 1MCBA 2L0DA 3C8HA 5C08B 1ZT1B 3KYMA 4L3CA 3D5OF 1FIGH 3V4PH 3WEXB 4QTHA 3VMPA 4U1NA 1T1WB 4KMQA 4H20L 3EYUL 3TBSA 4NFDA 5CKAA 2D7PA 4JKMA 1GXEA 4QXUH 3TYFA 3U9UB 2C7UB 5I16A 5JQ6L 1T6VN 4S1QH 2UZIH 2UZXB 3CCHB 4ALAH 2DBLH 3T3ME 1CU4H 2EO1A 1BWWA 4QNPF 3O6FC 4BZ2L 2B2XH 4QRTA 3KJ4B 3UMTA 2Q7YA 4DVRL 4M93C 4QHMB 1D5IL 3GSVB 4AH2A 2X4RB 1CE1H 1P7QD 5L9DH 3SKOB 4OF5A 4KDVA 4WU5B 3U0PA 4KHTH 2VDLL 4OLVL 4Z0BL 3MRGB 1NLBL 4LP5A 1FVCB 3BQUA 3SE9H 5GRVK 5D9SB 1KIQB 3VWJB 5KS9B 4OCNC 3P9MB 2JB6A 3LHPL 2CGRH 4P46A 2WP3O 5EOTB 3FOLB 3QA3B 2IFFH 4GSDH 4J12A 3I2CL 3F6IA 3NGBC 3RWCB 5IMOB 1FGVH 1KC5L 4AEFA 2NW2A 1KG0A 5I1EL 1OAUH 4HPYH 3IAPA 3U2SA 1G6RB 3K1KC 1TIUA 5GS3A 1NCNA 2BJML 5F71A 1F45A 3QQ9C 2EIEA 5BMFH 4WVRA 5LWYH 3NIDF 1BLNA 4PJDE 4Y5YB 1UCBL 2O61A 3ARGD 5LGJB 3D25A 4RWHA 3I9GH 2VDOH 5I17B 1KJ2B 4JRYE 4LVEA 5H35B 1EPFA 3HI1B 3L7EA 1XH3A 5LXGL 3LB6D 5EBWA 5K9OA 1TCRB 4I2XA 3DVIA 3LSOA 3OAUL 2XRAL 4X6BA 2LV4A 5JXEC 3GMQA 3ROLB 2R0KH 3W2DH 2H6PB 5T1KA 1INDH 1CDJA 3PQYE 4OCXH 1ZA6A 1SY6A 1UT9A 1EO8H 3QDME 1UQSA 4LOUC 5JUEH 5JZ7D 1KIPB 2V17L 4URTB 5IFJB 4K7FB 4PJFA 3RGHA 3V4PL 2BHYA 3E3QC 4QXGH 5DO2C 3MV8A 4WTWA 1DEEA 2RFXA 3TO2A 2DQIL 3CXDL 2OTUA 4P2QB 1VADB 5BZWA 1CD1B 1B4RA 3AFLA 4ZAKB 5D1QB 5I6XC 3UPRA 4H25B 4D9LL 1U3HC 3OAZK 3C5ZB 3HNVH 4ZOBA 1KTKE 1ZWIA 3WDIA 4TSCH 4LAQH 4R3SA 3MOAL 4FTVD 4K55A 1MCOL 1ADQA 5E08H 4I4WB 5J1AB 1M7DB 3RPIB 5BV7L 3SBWA 3I50H 2NY5L 1HDMA 1PJ9A 2EECA 4NRXB 1C7SA 3MGOB 3MRFB 4PJAB 4BSWA 4PJ9C 1CICD 3LV3B 3VA2C 1MCWM 2DMKA 1IM3B 3ULUD 5CSBA 5C0JB 4FG6C 3EBAA 4I0PB 3RY6A 2BDNH 4Z76B 1U92B 1Z0NA 5DSCB 3T0AA 3UTSA 3JWDH 5TE4H 1C8PA 2VR4A 2G5BB 4LLMB 3SE4C 3O2VL 5DSCA 5TJWK 3O41A 4EXPX 3VMNA 2FX7L 1GYAA 3UC0L 1EZVY 1XGQA 2VAAA 4N9OB 3KLAB 3D3VE 3LV3A 2BHZA 1BGXH 4LCYB 4XVUD 3QI9A 5DD6B 1MH5B 1FORH 5MHSE 1FL3A 3B83A 1M7DA 4CU6A 3JV5A 3ZKXB 2KBGA 5DHVA 4LNVA 4DGVH 1PAMA 1PVHA 3IF1A 3HE7A 2PYFB 3H42H 3TA3D 3CVHL 5T1KD 3ETBF 1K4DB 3KPLB 5DK0A 5HYIA 5DZOA 1YN6A 3MV8B 2VDRL 1U91A 4R97C 1VGEH 4JO4L 2VL5B 4LGSB 1KLGB 4DKAA 3O6KL 1EEZB 2UZYB 4R7NA 4QXGL 3HI6L 2J4WH 2H6PA 4YZFE 5IBLD 5BW7C 3H6JA 2FB4H 2BY3A 4FG6D 3HMXA 3L5HA 1NGZA 3EOTL 3FN0L 3PG2A 4I2XB 1MCDA 5GRZA 5SWSD 3MV01 1MCRA 1XH3B 4R96A 4WWKD 4NNXB 1NCAL 2DYPA 1AGCB 1ND0A 3OMZA 3PWPD 3KPMA 4KUZH 4EI6B 2P45B 3D25B 3F7PC 3HZMA 1E6JL 3ZKXC 2XWTB 1EBAA 4JPKH 4OGXH 1MFNA 1SJEA 5DFVC 4S1SH 5EOCL 1TQCC 4G5ZH 1B4JH 3P77B 5IBLC 5ESVB 3LS5H 3LN4A 3QXDA 2BOCA 4NJAH 1PEZA 1ZVSB 1AR2A 1BQHG 1DN0B 5IEHA 4LMQI 3L5JA 3O3BA 4RFOL 4P5TA 4LSDA 5BVPL 4FP8H 2P1YA 4G8GB 2O5XL 2DI8A 1AJ7H 4OBSA 3DGGB 4P57B 3U1SH 5I1CH 4ZNEE 1JNNL 1ONQA 1UXWA 2J8HA 3CFEA 1BD2D 2BVUA 1QFPA 1TTUA 5DDHA 1K2DB 1DBJH 3NFSH 1KN4H 3ZL4L 3MLPA 4J3UA 4AH2B 4YHOH 1N2RB 2EO9A 5IWLA 2WV3A 2VKXA 3BPCB 2EYRA 1N6QH 3EDKA 4DK3A 2VOTA 3GSQA 3SE8L 1I7TA 1ITBB 2UWEE 2VLJD 4LIQL 3ULVL 4HXAH 1UADC 4DGIL 3BEVB 2J8UA 5JDSA 4MJ5B 3MCLH 5KSVB 3ZE0F 5JOPD 1FFOA 2HTKD 3PHSA 3TWCL 3K8MA 2Q7NA 4NN7B 5JW5A 3QEGL 5I1HL 4U1NB 3I3BA 3KXFA 4MDJB 4KVCL 3MV9D 1X5JA 5C08A 3SDAB 1AGBA 2M26A 1FVEB 5I1DA 3VRLE 1NC2A 4QRQA 4EZMA 4PV9A 2VC2H 3CFJA 1U8QB 5DD0H 2XTJC 2PW2B 1C5BL 3WXVL 2IADA 4NQTA 1J7VR 1JZ8A 2ZP0T 3NPSB 3D0VA 3TH3T 3BGMA 3AU1A 1WC7B 1G0DA 5HYSB 1JNHB 2HFTA 5C92A 3ZTJH 3UJIL 5DC4B 4AZ8A 1A4JA 3DUUA 3NABH 1QBMH 1BECA 1UH2A 3JUZA 2AJZA 2XZQL 1OP9A 1IZJA 1NC4A 4NN7C 4ENED 4YBHA 3FQXA 4JDVA 2NNAA 3RDTA 3BW9A 1BQUA 5D7KD 2E7LA 3IKKA 3PJSB 1NGYA 2BSTB 3RUGF 4PRPA 5C0IA 4P3CL 1LE5B 3PABB 4P2QD 3JWOC 4N0YH 4KKBC 4Y5VA 3N1PC 2UZIL 5ICZB 2VDNL 3AAZA 5JHDB 4XAWH 1A6UH 3GBLA 1SYSB 3MROB 2GYSA 3NCYS 1CZ8L 1JNNH 2VDML 1FO0L 1U41A 2F9BT 3M8OH 4HIIB 3RDTC 4PRPE 3VFWA 3BESR 2GIYA 4PJBB 4ZUTA 1KJMB 5C6PB 2J6EH 4XPGL 1YA5A 1KCUH 3DXAD 5FYLD 4IHOA 2B0SH 1T7WA 1AGDB 4TVPD 5B39G 3SDYL 5E8PB 2C1OB 2P5ED 3VRIB 5CIPB 4ISVB 2WIIA 4K3GA 1E28B 2Y72A 3T3PF 1X7QA 2DRUA 3DMMD 4J7RA 4P0DA 3QDJE 5I1EH 2Y1VA 2VKWA 1GHFL 4MQSB 5EA0H 3SE3A 1L0YA 1TTGA 3J7HA 4WY7H 2ENYA 5KVGH 1AR1D 2VL4A 4NO5A 1KF9B 1YJDC 2AJ3B 2NY1D 5L88L 1AGFA 2YPVH 4JM2C 4Z7VF 1BIIA 1R5WA 3BIBX 4NQEA 5IHBA 3HS0B 3MPCA 3IU4L 5C3LD 1ZVYA 5CEXA 4ODTL 2YD5A 4U2YA 3VXQA 5I9QC 2XXCB 3DVGB 3DUSB 2BSSB 2ZG1A 3V7MA 1HHIB 4F7CB 5GPRA 1WEJH 3HZYB 3LRSB 1D6VH 4OD3H 4PG9B 5GIRA 1U93B 3L1OH 4XPFL 1HH9B 4G8EA 3VW3L 1N8ZB 4FFZL 4NKDA 1H3VA 3ARFA 4WUUA 3LPGA 3IDNB 4DFIA 4LARL 4CADA 3BPNC 3S88L 4KFZC 3CFIC 4BH8B 1UYWL 4HFWA 4OZFA 1IZKA 5EG6C 3TO4A 1CFSB 5F7UA 3N50A 4UQ2B 3MJ9L 3TH2T 3O3UN 1J1PH 4ODSL 4WTZG 3E6HB 5E8NA 4MQXD 1A0QH 2HT3C 3MNZA 4D0DB 4HIEA 3HNVL 4UDTB 2VISB 3QO1A 1S7UA 4ELMA 2WNGA 5E4EC 3BP5A 4QT5B 4UDUB 1NMAH 2P8MA 4P5TC 5DR5L 2QQLH 1C12A 4PTTA 4TVSa 3S37X 4BH7A 1N59A 2V7HB 5DRNA 4D94A 3BP4B 5BV7B 2WMPA 2A6JB 3QULA 4OLYL 1G7JB 3S4SA 3ZKNC 5D6CB 3MRMB 1QQDB 1I7UA 3GSNA 3WNOA 3VFGL 2ZCKL 1LVEA 1WAAA 2W9DL 4YBQC 4OQTL 3VFVB 2HG5A 2VZVA 1T0MA 2YSSA 1BFOB 4P23D 4PBXA 2GCYB 1TXKA 3MCG1 3OKMA 5FUZL 4C59B 1BOGB 1NFDA 5IEKA 2ATPB 4ODWA 4P2OA 1BF2A 3CK0H 4JRYB 4G8GD 4ODHL 1J05B 3MLXL 2YD3A 2IH1B 5JA9A 1ZLSH 4AMKH 3GSRA 3RWIA 5C0CD 1R0AL 1BD2B 3G6DH 3T8XB 1ZA3B 5IHZB 1GGIH 1FORL 2ADJB 1LO2H 1QBLH 3GJEA 3IU4H 4G8FA 2FJGA 1MIEL 2X1PA 1IGYB 4NKOB 1I3VA 4XPHH 2D7NA 3HE6B 1CGYA 4PGCA 3CFCL 1U6AH 4ZUSB 3UBXA 1T4KB 2VLJB 3O4LB 1FC1A 5D93C 1FL5B 4OJFL 8CGTA 1YY8A 4OIIH 5JA8B 4CMHB 3VFNA 5J1SC 3IDYC 4KUCF 2G75B 2N7AA 2FECI 3A6OA 1U8HA 5F7DA 2IQAA 1F4AA 4S1RH 3KYNB 4N0CD 4HJGA 3LKRA 1UYWH 3CH1B 1OW0A 1YNLL 2WWKT 3O6KH 3TM6A 1A1MA 4OF7A 3T4YB 2AXFA 2D03L 4KJWC 4RGND 1XCTA 2PKDA 4PJAE 1CXIA 5IB5A 3FQWB 5ISZE 1YC8A 4BM7A 2QSTA 1RIHH 4NQCE 4YC2B 5DJ6B 2WINA 3VFRB 1XF5B 5EC2A 1EVTC 5LBSL 5T3XD 5HDQL 5C0EA 3UO1H 1F90L 1MF2L 5SWZE 1G9EA 1XZ0B 2X7LA 3OKDA 1CFTB 2QQLL 5T3ZE 2ARJQ 3WLBB 1MJUH 3HRZA 4NKMA 2OZ4A 4WGWB 3R06B 3IKCA 2XQBL 3KPPB 3RY6C 5I8KL 4KHTL 3F7VA 3O6LH 4IOFC 1RZKH 4IDJH 3F7QA 4LFHD 5EC1B 4X6DF 4CU8A 1YN7A 4F9PA 3SCMC 4RX4A 4GAGL 4NZRH 4RA3A 4DVBB 5MEOB 4GQPH 4GRWF 3C8KB 3FMGL 3QEHB 1AQKH 5B4MC 4TTDD 3FO9B 3DJ9A 1TVDA 4HBCL 3BZEA 3AROA 1G7QB 1T1ZA 2DS4A 2M1KA 5FYKH 4FQ2L 4LPVA 4UQ3B 4MMZC 4Y1AD 3HMXL 3F12A 1P1ZB 3CDGB 3IDIA 4LLDB 5CWSB 2VDPL 4JFFE 1LK3L 1I1CA 4NQDD 4IRJB 12E8H 3P4OA 2BVQA 4UTBL 5LWYL 4JG1L 1S8DB 5HHNA 4K07A 2Y07H 2EKSB 5KN5A 2ZUSA 1QVOA 4K7PL 3WUWB 1S7VB 3M1BA 4DUWA 5F96H 3K2UH 3PDGA 3QDMB 5D2LA 4GMTL 1N5YL 1S7VA 4EOWH 4DOHE 1UKSA 2NXYC 5D72L 1QKZL 3CFCH 4ZXBA 2P49B 3FB7B 3PWVA 3D85D 3DETC 1T7ZA 3TWCH 4O2EB 5DK2A 1I1AC 1YPZE 1KCSL 3QH3B 3DMMB 4PG2C 4Q9RH 5EOQH 4YR6A 1T22A 5IB3B 4NQCB 5KSAC 1HN1A 4U3XA 1G7QA 1K8DB 1T1ZB 1YMMD 2YA1A 2V7NB 3FT2B 4Z78B 3RUGB 2NPLX 1IKFH 5KVDL 3QUYB 2RHEA 5GGVH 3P3YA 3VJ6B 3BZFB 4JHWH 3O4OB 3HR5B 5FKAA 1H3XA 1YPZB 5EZLA 1NEZB 4UINL 1I1AA 2J7LA 1KENH 5EC1A 4HCRL 4QHUB 3MV8E 2VSCA 4LASH 3IKCB 3O2DA 4ZXBC 5HGGS 3BRFA 5ICXB 4IMKC 3QCUH 4X7EC 3Q6FA 1KOAA 4ODVL 1KPUA 4K9EH 3PE9A 3TN0C 4P46C 4PJEE 2DOCA 4OFKA 3RGVB 1ZLWK 1HWGB 4XB7A 2NY6C 2H9GB 1PW3A 3VFRA 1DQTA 1JL8A 3KR3H 1QRND 1CDHA 5L8LB 4EQ3A 2APBA 1K5NA 3MNVA 4C54A 2Q87A 3MNWB 2AS5M 1IGCH 1EX0A 1QSEA 1CQKA 1F4YL 4XNZC 1INDL 1G84A 3P30L 3LKOA 1J8HD 4G8IB 5CMAA 4PRAA 3L6FB 3F7RA 1DVFB 2IPKB 12E8L 2YRLA 1IGFH 5KSAD 3GHBL 1R5IB 3VFSA 4X80L 3HE6A 4DWHA 2DICA 4OKDA 1P53A 5LAXA 5T3XH 1AGEB 1JZ4A 3WDHA 1CLOH 4OZ4A 1WK0A 1MHPH 1QSFB 1KCLA 1NJ9B 1MCOH 5E08L 2HMID 5E95B 2R2BB 2NY5H 2VRAA 3DO7A 4X9HA 3WUWG 3OR7B 2D7OA 5KVGL 5C0BA 4N8CH 3BGFC 4NC1E 1S5HA 1V7MH 5TF1H 2MSPA 4JRYD 2NTFA 4E41D 3QIBD 1I7RA 1BFOA 4IDLA 2DI9A 2BXZA 1KJVA 2ZCHL 3GIZH 1XIWD 1CI5A 5K9KB 1N4XL 1UG9A 2DQGH 1QSFE 1N3NA 3OJ2C 3EYOB 1HHGA 5J3HC 4NKQB 5IQ7H 5FO7B 1MJJB 5J7CC 1JNLH 5FYJU 3I6GB 2EC9U 3MRHB 2Z8RA 2A6JA 4ORGA 3HE6D 3IJSA 3UC0H 4OV6F 3VW3H 2BY0A 5EO9A 2P8MB 3WIIH 2COQA 3HG1E 3QFJB 4HJJH 3OKYA 1JCKA 5EIVA 1S7UB 2J5LB 3S88H 4XCNB 5DUMH 3VU2A 1FYTA 4L4VD 4WI6A 3OZ9L 4NZDA 4KQ4L 2GK2A 3EZ8A 1S3KL 1G0XA 3AVEA 5BS0D 3CDYA 3BN9D 3VXRD 2H45A 5HGHA 4HIJB 3PWNB 4X4XB 3TO4B 5IV2A 5C2BL 1WLHA 2OL3B 1PDKA 4KV5E 4NNPH 4OKVB 4X6EB 4HWBL 2NXZC 3GI8H 3JV4A 1DUYA 5HHOA 1CGSH 4PJ7E 1UWEL 4G8EB 3DIFA 4R4BB 4F7MB 3TLRA 1IGFL 4JFQA 1WFOA 3LRSA 3HZYA 3TC9A 3TBTA 2BC4B 1TENA 4P2RE 4CN6A 2CLRA 4CVWA 1K6QL 3H9YA 4KQ3H 4ZUVA 2JK5B 3QFDA 2AEPL 1CLZL 3NFNB 3QDGE 3AUVA 3B5TA 3QQ9D 3KLDA 5C2UB 1CL7H 4Q9QH 5ITFB 4RMRA 3OKKB 3CZJA 4E0RB 1OTSD 1TFHA 5SX4I 4Z9KB 1TNNA 1UWGH 1A6WH 3PV6A 3P40A 4YBLB 2XG4A 2BFVH 2AQ3A 3QUXB 4R4FL 1UJ3A 1MHEB 1S9VA 2C5DC 4KJPC 1OOAA 2GHWB 2PYED 4HS3A 3BX7C 5JPNB 1OT2A 4RNRA 3IGAA 4NN5B 3TO4C 1X7QB 2OZ4H 4UU9A 5DZLA 1M05B 4OM0L 1CD8A 1PX4A 1N4XH 2VC2L 2QHRH 3QIWB 4XXDA 1G7MB 1A3LL 4QRRE 2V5YA 1FLRH 3R0NA 1CIUA 1VESA 1Q9WA 4XC1H 4ZODA 5IP4A 4ZUTB 3ZTJG 3MRLB 3B9KD 3QIUD 2VXUH 3IRPX 4XX1G 5KBNC 3RDTD 1GSMA 2UUDK 4PUBH 3T0EC 3BZ4B 4U1JA 1DUZA 1RIUL 4KY1H 1C7TA 1EO8L 2CDFA 4Z0BH 5JHDA 5ICZA 1I85C 4HH9B 3V5DB 1S7WA 3GMNA 2GY7B 1OP5K 4PBWD 1AE6H 1F3RB 1NGYB 2BSTA 5C0IB 2RIKA 2CGRL 5EU5A 3BSZH 4K3JH 4ONHA 3SDCB 1FNGB 3D18A 2DDQL 5E2JA 4JY6B 2EICA 2BZDA 1NUGA 3MREB 1R24A 3RZCD 4U0RC 4D9QD 2Z31D 2P8LA 1A4JB 2I60L 1YDPB 3PUCA 4MS8C 1MWAB 5E03A 1GZQA 3RVWD 4L5FH 5EULV 1F42A 4OFPA 1D9KD 3L7FA 2X4SA 4KGLA 2GUOA 3V5KA 5JIKA 7FABL 3CMOH 1ZLVH 2NY4D 3LH2H 4WV1A 2PW2A 4W4OC 5IJKA 4N9GB 2VITA 2B8OT 4LDEB 3CFJB 4PV9B 2OMNA 2VERN 5DHYA 1RK0B 3EFDH 3WHXB 1FVEA 5HVHC 4Y19D 5INCB 1NBVL 3NFPA 1VFAA 3OB0H 3A6CL 1AKJD 3V8CA 2ZZUT 5AAWA 3CMGA 2E7LC 3CAFA 3WMSA 1G7HB 1J8HB 1RUAL 2IGFH 1F2QA 5DD3L 4WUUE 2VLJE 3D3VA 1B6DA 4G43A 5JDJA 2AAVA 1NBQA 1YEFL 5D2NE