3Q6GL

Crystal structure of fab of rhesus mab 2.5b specific for quaternary neutralizing epitope of hiv-1 gp120
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
209
structure length
209
Chain Sequence
YDLTQARSVSVSPGQTARVTCGGDNIGSKSVQWYQQKPPQAPVLVMSADDERSSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSHHMLFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVEVAWKADGSAVNAGVETTKPSKQSNNKYAASSYLSLTSDQWKSHKSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Light chain of Fab of rhesus mAb 2.5B
publication title Structural Analysis of Human and Macaque mAbs 2909 and 2.5B: Implications for the Configuration of the Quaternary Neutralizing Epitope of HIV-1 gp120.
pubmed doi rcsb
total genus 47
structure length 209
sequence length 209
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q6gL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q6gL01
2X1QA 1KTLB 4PJ7A 3RWCA 3PGCA 4PJ9A 3OL2A 2NY4C 4XTRC 1XGYL 4X7EC 1GL4B 3RAJL 3SE4A 2GK0B 5C0CE 1UVQB 2AERT 3B9KC 3HMXH 1DE4A 4YUEH 3UZQA 1CLCA 5HJ3B 2I9LB 4LPCA 3L3JB 4TVPE 3V4UL 4KJPD 2B5IB 3C60C 3T0DA 4LSPL 1B2WL 4AG4H 1YY8A 1ZLVK 4PB0H 1MY7A 3VXUB 3NACH 1AQDB 1C12A 2YSSB 3W5MA 1ACYH 3BZ4B 5DYOA 1OAYH 2VXVL 1D3CA 4ZNEE 3BW9A 3V8OA 5EZJA 4PLKC 3ZKND 5KSBA 4MA7L 3RWEB 5I1JH 4GOSA 3PDOB 5JIPA 4XMLL 5E00A 5B39A 4HC1H 1RPQA 4WO4B 3TO2B 1EJOL 1QVOB 3MLWL 1LO2L 1YEGH 2AK4D 2FEEL 1FO0A 5IB3A 2NXZC 5IVZB 4XMKL 4KI1A 2PXYB 1EGJH 2XZQL 4OQTA 3TESA 5HYSA 4NM4H 4YLQT 2OR9L 2WIIB 4WFHD 2MPAH 3L3GB 5F1KC 4YAQA 5KSVA 1EZVY 3QCVL 4PS4L 1FFPA 3PGDA 4Q0XH 3X13A 1LO0L 3C2AL 4KZEL 5BCAA 4QKXB 3OG4B 5BJTA 2ZCKH 3GSOA 5TQ2L 5I8CA 2BZDA 1IGYB 1E27B 5E99H 4WJ5A 3D25A 3TJHC 4R97B 1UJ3A 4DJMA 3CFKA 4X7CC 3VFOA 1BFOA 1F4XH 2G5RA 3I02B 4IM8A 2EH8L 5C6PB 1U3HD 3GZKA 5EOQL 1OF2A 1U8OA 1VEOA 3TH4T 5JW4M 1G7MB 3LKRA 5F6HJ 5TPWL 4N0UA 2X4QA 1G9MH 5HPMB 3RWIA 1X5XA 3MBEA 4Z7WF 5FK9B 3QO0A 4YBLB 4XVUD 4ZQKA 1JWUB 4LCUA 4U6YA 5A16A 4NQUA 3AREA 3QJHB 3CK0L 3LEXA 3MCLH 4UINH 1I1AA 3VXRE 4FOMA 4X5LA 5FIEA 5JMOC 2H45A 2P8LB 2FO4B 4GRLA 1KJ2L 1ZA3A 3JWNC 3VXMA 3TLRA 5F7DB 5I30L 1ONQB 4E5XA 4UTBH 1QBMH 4QLRA 3VGFA 4YHKH 2K9UA 3REWB 4QT5B 4HWEL 5FYLD 2CLRA 4GKSB 2X4OA 1FG9C 1X6NA 4NRYA 5E2UH 4TQEH 2EE2A 1SBBA 4Y4KD 3OAYH 3Q6FA 4OM1H 3HE6D 1JWMA 1KTRL 2DJUA 4OCWH 3WBDA 2CXGA 3QDHA 3H9ZA 3RDTD 3BZFA 2NY2B 1LEKB 5IROC 4PJCE 1A14H 3C9NA 3AAZB 1NBZA 1YJDL 1G7QB 1EPFA 1PKQE 1TZGH 5BOPA 4K2UL 1MIEL 3GSXA 2YWYA 4U2ZA 3NFSL 4MA8H 3BPCB 5ABDE 3FHAA 3U7WH 4DOHB 5BS0B 4A6YA 3GMQA 3O4LA 1YEHH 2KH2B 1KULA 2RR3A 3VRIA 2X89A 5DJ0B 1S5HB 3KAAA 1RZKL 4CVZB 1KB5B 5C2BH 1KC5L 3BEWB 1XGTB 1XH3B 1TQBB 4P57B 4JAMB 5T1LB 5J06A 2QV2A 4L8DB 5INDA 2ZG1A 3WIIH 3EO0A 4U1JA 3FRUA 1JV5B 1BVZA 2OBGA 4CGTA 3EFFA 2OI9C 5CSZB 5L0QC 1GGUA 1CZ8L 5DT1L 3RA7H 1KT2B 2ZP0T 1MVUA 4XPTL 1YMME 2YK1L 3DTXA 4HV8A 3B9KA 3LQZA 5T3XE 3LRHA 2GUOA 2PF6A 3C60A 1ZSDA 4WCYL 3B43A 4PY7B 3I50H 3QA3B 4MZ2A 5AZEH 3ARFB 3FQWB 4KPHL 4QHUB 4LSTH 5C0BE 1IC4H 3UROR 5H94B 5BZWB 2E6JA 1ZE3C 2HT4C 1MVFA 2ZOKA 4WI7A 2IJ0C 2YPVL 4IRJC 3VG0H 4GQ9L 4X6FA 4GXUN 2YD5A 1KB9K 5F72S 2HG5B 3UYOD 3U1SL 4EDWL 4LCWD 1CR9H 1FNHA 1RUAL 1NQBA 3RUGA 1PKOA 3W9EA 1F42A 3FOLB 2HWZH 3CFDB 1JPTH 1ZLSL 5B8CB 4C54A 3PL6B 1Z0NA 2DQEH 4IRZL 4PJXF 3T4YB 1FSKB 1FC2D 1A0QH 3HPLB 1QO3B 5F9AC 4HKJA 2XIDA 4NQCA 4CNIB 5HI5D 5A43C 1IEAA 1UCTA 5JXEC 2E7LA 1CGSH 1RJYA 1QR1A 4EIZC 1LEIA 2IBGA 4I4WA 5FOBB 3T08A 4I3RH 4ODUA 5CMAB 5HHVH 3EZJB 2XZAL 3CDGA 3WDHA 5I15H 4WEMB 3L6FA 4DK3A 4KZDL 2X4UB 3GJFA 4Q9CA 3M8OL 1ED3A 5IMKA 1N0XH 4QOKB 4GJTB 3IDYC 4P3CH 4R6UA 4QHKI 4LFHG 1OGAD 5DD0H 4JM2C 2FJGB 5FYJH 3EUUA 1QKZL 4QGYA 4JQVA 3QQ9D 4JFFE 3D39A 3ILPA 2VC2L 4FA8A 1C7SA 3G6JA 3F6LA 5CEXA 3DX7A 1ORQA 1MJ8H 1CK0H 2X44D 1NLBH 3C8KB 3QSKB 5F96L 4OCXL 5GS0C 5E6ZA 4IBLT 4ELMF 1BOYA 1YN6B 3GRWL 4WUUA 1OP5K 3O3EA 2GHWB 2R1WB 1KLGA 1UEMA 1T1XA 3IKKA 3G04B 4LSUL 4CVXA 1RU9H 1TCRA 2Y6SC 2ESVA 1ZK9A 3DX8B 4MD4A 5I1GL 4C55A 3H0TA 4CAGA 3GBNL 4XVJL 5HBBA 1P4IL 1KNOA 3Q5TA 5C0DA 3WNNA 4LARH 1EMTH 4YXKH 1UM5H 4LP4A 4LCCC 4WHTA 2PO6D 5AUMB 2DN7A 1AO7D 3UJJL 3MV01 2VKWA 1WK0A 3THMH 5HHQB 3QDMA 5IROA 4JCMA 4TTDC 4KH2A 4LLYA 3V7MA 4UAOB 3H7BB 1FDLH 1U6AH 1HKFA 3WHE0 3UBXA 5LBSL 4JLRA 2VLRE 1N3NA 1N8ZA 3OJVC 1HXYB 3KPNB 4WV1C 4XBPB 2NXYB 4OFKA 3G9AB 4LL9A 2A6DB 4XHQA 1BP3B 1TXKA 4PJBA 3QXAB 4X6CA 5GJSH 5CD5D 3HZKB 4Y1AA 2FECI 3U7YL 2FGWH 3FJTA 3STLB 2V2WB 5IWLA 4IOFD 4PJXB 4OLYH 4PP1D 4NJ9H 1EO8H 4YX2H 1TITA 3RTQC 5EWIH 1FYTE 4U49A 4Y5XB 1DUZA 4EVNB 1TZHB 5J0BA 4QRPB 1F4WH 4NZTH 4ZFZB 2Y72A 3MV8E 5E95B 4OI9A 5CIPH 4KVNL 1KIQB 3FO2B 2VLKA 2E7MA 4I0PA 1C1EL 3TPUB 3DMMA 2Z91B 1OAKL 5C3LD 1KB5L 5I16A 4WUKH 3DROB 4JZJB 5IG7A 4YK4B 5D5MA 3DXAA 3BT2H 4GG6A 3S96B 5C07E 1IMHC 3VFGH 4UNVA 2F53E 3MCKA 4NQVB 3AXLB 3IKCB 1JGUL 4F7PA 1T04A 3D2UA 4EKXA 5DRZA 2CGRH 3W9DB 4ODTL 4ELMB 4H1LH 2Z31D 4GLRH 4FQLH 3ARBA 2DQIL 2VXTL 5F89B 5FGBC 3X17A 3IF1B 3ARDD 4U1GC 4PPTA 1OAQL 1Q9LB 2OTWB 4Y5YB 2YZ8A 5ILTH 5D7LD 1RMFL 5C0CA 4E42A 3M07A 2XKNB 1KIPB 3OPZL 3VGBA 3A6CH 1RIUH 1HKLL 1W72B 4GRWE 4JPVL 5JXEA 2OS7A 3VJ6B 4O5LL 3QFJB 2VDKH 5SWSB 3V6OE 1T7VA 2VXUH 4PTTB 1I3RA 1YECH 2BHZA 5I73B 3D1MC 3RGVC 4JRXB 5T1KB 4AEEA 3TBTB 1MFCL 4LCYA 4M6OL 4YFEA 4ZNEA 3MFGB 2JCCE 4P2OC 1MFEH 2YUZA 4DKEL 3ULVL 1MJ7H 4HGMA 2EH7L 2X1PA 1QEWA 5D7IF 2GY5A 5ISZD 5BV7B 2GAZB 2YN5A 5SWQB 5JPMA 5DJAA 1T2JA 2N56A 4ZOBA 5BQ7B 4EOWL 5CWSA 3ARPA 4TUKL 1IGTA 2OJZH 3NPSC 2DLIA 4YHLH 3HC0A 3HZVA 2VITB 5BRZA 4LSQL 2C3VB 5E5MA 2XNAA 4Z77A 3ZTJG 1G7IA 1XF5A 4AMKH 3LD8B 1SBSH 3BKYL 3SDAB 2FHCA 2F58H 5KANI 1F4HA 5HYJD 5JW4R 1IZKA 3D0VA 5GGRY 2P24B 1JYNA 3O3DA 1KLUA 3MNZB 5F1SA 3VFNA 4RFNC 3V2AR 1T0MB 2D0GA 4L3ED 5DEZA 4LCCA 2H9GB 3MUZ1 1P2CB 4CMHB 2Z8VC 4KK6C 1KFAH 4OZ4A 4DAGL 4RMUA 3HB3C 2A1WH 4Q6IA 5H37H 1U58B 1U93B 3TJEL 5GGVH 4IDJL 2BX5A 1MCWW 1B0RB 3O2DL 3S88L 3V7AE 1X5IA 4UV4H 5CCKL 4GQPH 5J13C 3CLEL 3LQMA 1OAXH 5DS8B 3WNMA 1CFTA 5ACLA 4DN3H 1AI1L 4NCDA 5CBEB 3VXRA 1U92A 1KJMA 2AEPH 5SX4H 3E2HB 5I17A 4X8XA 4P3DB 4PYGA 5IEHB 5JOFB 4FG6D 5CFHA 5IMLB 3WFHB 3I9GL 4OD2A 4B50A 2QQLL 4M8QA 1ZT1B 3O8XC 2R0KH 3QXDA 2AXFA 5T3ZD 1OAZH 3LMJH 1ZLWH 5KS9B 1XF1A 3F7VB 5ITBH 2R0WH 1QBAA 1IGFH 4O4YL 3U46B 2ZCLH 4F7TB 4PJCA 5KSUB 2OJEB 3QH3A 3QEHA 1SY6H 6CGTA 3C08H 5D96C 3G5ZA 4HZAA 1PKQA 5F7HA 1YEEH 4QHKJ 3ZMRA 2OXHA 3E6FA 1ND0B 2R23A 4LGPB 4QO1A 3SKMA 1QNZL 1UACH 1IEHA 3QG7L 4ODVH 2ENSA 4UDUA 3ARGB 5DR5H 3FTGA 3BD4A 1DQLH 4XHJC 5D70H 1FH5L 4H20H 2HKFH 1GGTA 3F6IA 2Q7NA 1H15B 4GAFB 4D0BB 3VI4F 4M6NL 3NGBC 2C9AA 4L8BA 4GAGH 4DCQA 1K4DB 4AEHH 1AR1C 3HLAA 3OXRB 3U83A 3MLYH 5DHXB 2E9WA 5IHBA 1CD8A 4LVNB 1QYGL 1MCEA 1BFVH 1IGMH 1N6QH 1HHJB 1KIRA 5EC2B 4K71B 3MLTA 1DDHA 2QKIA 3L3KB 5TE7L 4Z7NF 3RZCD 2WIMA 1QSZA 1C16A 4KFZC 4U31A 1Z0MA 5HYFA 4H25A 5E8PB 4I9WD 1IQDB 2XZZA 1R3JA 1U95A 5C0BA 1I1FB 2WW8A 3P11L 3RGVA 4KV5F 3S37L 4BJLA 2OL3B 5DMGD 3S98A 1U8NB 4P2OA 1ZHKB 4H0IA 5ERWB 4AYFA 3CVHB 5F3BA 4Y19E 4FFYL 3H42L 4YR6A 3QDJE 4R4FL 3W0WD 1FJ1A 1W72L 5IHUH 1AJ7L 1KPVA 2IEPA 2EZ0D 3GUTA 1Z3GH 3MRDB 4Y8AA 5IM7B 5BS0E 2C7UB 3MJ9A 3DV6B 4BELD 3PDGA 4ZO7A 4WWKB 3PIQA 4J12A 1P7QB 3JTSB 1QSED 2IANA 2WM0A 1YJDC 2ICWI 3Q1SL 4PUBL 2C3HA 3U82B 3C6LD 3HFML 3CNKA 5F44A 2EEDA 5DHYA 2ITCA 3V6ZA 1NAKL 5L9DH 5JW3L 1EEZA 5GGVY 5DJYB 1CQYA 5FM4A 5GISL 3C5ZB 1EFXA 2LTQB 4X80H 3WKMH 3BP7B 4Y4KB 3IXTB 3LKNA 3CLFL 1SEBB 1BQUA 4BUGA 4BSWB 4WFGD 4WI6A 4ZO9A 5E8NA 1MREL 1RZKC 5ITFB 5DMIL 1CICD 4KAQL 5JDSB 5EBMB 2B1AH 2FYYA 4D9RE 4JFFA 5F1NB 1NL0L 2FEDD 1FNGB 1P69B 1ZXQA 4R96B 4XC3L 3CXDH 4JFYB 3O4OB 1MAMH 4NZDA 1UB5A 3TWCH 1VCAA 2UUDH 4PGCA 1T0PB 1KSRA 3TA3B 4P46C 4F7CA 1PG7X 1YNLH 5IUSA 1H8NA 1W8OA 1JZ8A 3MV9B 5MEND 1VFUA 3WLBA 3ZHDA 3ARQA 5EU3A 4Z7WE 3PABB 2OQJB 5F9OH 5D6DC 4G9FE 3LSOB 3Q3GA 4AT6B 3FB8A 5HHXL 4KHTL 5DD5L 4HJGB 2DJ4A 3O8XA 2Q76B 2PCPB 4MAUL 4OF6A 3GIVA 3LEVH 1Z9LA 4GW4A 1OQOA 3V9FA 4DN4L 2B5IC 5MEQA 4OB5H 4H5SA 4JRYA 3DRTA 3F58H 4U2YA 1VFAB 5C0JA 1CI5A 1IAKB 1FCGA 4S1DD 4PJEB 1S9VB 4XNXH 3K2UL 4LIQL 2P46B 2W65B 1P53A 2BHUA 4DVRL 3SJVB 4HGWB 4FQ1H 2D4FA 3MYJA 4LOUD 2HLFC 4ZUSA 3BP6B 2VLRA 4WFFE 1S9WA 3AS0A 4EI6B 2R8SL 4WO4C 4ZMAT 5TF0A 2BVQA 1NCWH 1H3VA 4U1LA 5J7CC 1EXUB 1SVCP 3QDAA 1V7ML 4UT9L 2BCKA 2CMRL 3HZYA 5AAWA 3HN3A 2EO1A 1ES0B 4JFEE 5F7MC 1TMCB 2PXYC 3QNYA 5E56A 1OM3L 3A6BH 4ZFGH 1CDHA 3AUVA 5GSRB 3PJSA 2YUWA 2H32H 4X4XB 4N0FA 3SQOL 5HHOE 1TVBB 4N0YH 5HYQA 1Y0LA 3TNMB 3UYRH 2Q7YB 4FXGA 5DEGA 5CZVL 4WI9A 4NKIL 1JNHB 5F9JB 5J12B 5CJOL 3BJ91 4R97C 5IKCB 4JKKA 1QSFB 8FABB 3CCHA 3WN5B 5J3HC 2R0ZH 1IILE 4DQOL 4P9ML 1MFBL 3O9WD 4IJ3B 4RGND 2A6IA 1T89C 5C07A 1EHLL 2XN9E 2H26A 3FO0H 2Y25A 4L8SB 4KJYA 5A2KH 3ARRA 1R5WA 4J3SA 1A3RH 1CIUA 5C3TA 2WBKA 5T33H 3DETC 1QPXA 4PJ5B 3SE9H 4KJWD 5EOCJ 2WANA 1JRHL 4QYOA 2YPKA 2Q8AL 3VGHA 4F3FA 4YBLC 5F71A 1O0VA 1BJ1J 3EJJX 4PRPD 3SDCD 2DKUA 3OX8A 4KVCH 1WIUA 3HRZB 4KUZH 5DTFA 1EX0A 4XCCH 4C56E 5MEPB 3FT2A 4HPYL 4QRQB 3S3JA 2AVGA 4HUMB 1KEGH 3A67L 4RMSA 2PKDA 1DN2A 1JYVA 3VH8B 2HH0L 3RVVD 2VDPL 2VDMH 1PY4A 3TN0D 4PJXE 4P4KB 3MRJB 3QHFL 1CF8L 4BZ2H 1RZJL 5ADOH 4O02H 2JELL 5E7FA 1AO7B 2XG4A 2NTSP 5JO5A 3EAKA 3FQUB 2AW2A 3VH8G 2NY2C 4QRTA 1QZ1A 3B9VA 4XNQB 1G9NL 1AXIB 2QSCL 4LQFL 3LRGA 4X0KB 2VDOL 4R2GB 3ROLA 4HK0A 4FABL 1RIHL 1IC5H 4M02A 3PWNB 4Y89A 1MF2L 3D9AL 5FOJA 3MRKB 4PBWD 3VXSD 2XWTA 3W81A 5IMOB 4J4PA 1ZVYA 3MGOB 1ETZA 2FL5A 5IVOA 4PRHD 5DHVH 4V1DE 4P46A 5CUSH 5HGBB 3NABL 3ARXA 2VQ1B 3OF6A 4NKOA 4ELKA 3BYYA 1FVCA 3GMNB 2DYPB 1H3WM 4NGHL 5LXGH 2DDQL 4ELME 1TQBC 2XV6B 4KTYA 5D6DA 1KTLA 1N5YL 3AVEA 3ZYIA 25C8H 4P2QD 5CZKA 2ZKHL 2PTUA 2GK0A 1F3DH 8CGTA 2OXGA 1BQHB 4P4RA 3HC3L 3PP4H 5HJ3A 2I9LA 3QWRD 2G2RB 3L3JA 3KLHD 2A73B 4XMPL 3QFJE 3ARFC 4X6BB 3VXUA 1MRFL 5DLMH 1CLOL 1FNFA 2DQUL 3W2DH 5I1HL 3DURB 2JKXA 3BZ4A 3KPRE 3S6CA 1NC2B 3ZL4H 2K3TA 3NIFF 1BQHG 3MRBB 1BD2E 1X44A 3RWEA 4K3GA 3PDOA 4WO4A 5IVXF 1C5CH 4U1MB 4KTDL 5DD1H 4XPBH 2B4CH 4FZ8L 3MXWH 3TEUA 2APFA 2Z8SA 5IVZA 2B0SL 5B8CC 3ARDB 3PL6C 3OXSB 1GIGL 1DBJH 5D7LB 4M7LT 4OCYH 2ICWJ 1CDIA 1FSKC 2NTFB 4JFQB 1PEWA 4NYLB 2WIIA 5ADPL 3MV7B 2D7PA 2MCPH 3UTSD 3UYPA 4OKDA 1U41A 3OZ9L 1GZQB 3NCFB 4KRPB 1IGYA 1TJGL 1E27A 3GRWA 5MP6L 1JPFB 3TT1H 1RZGB 1VFBB 3L95B 1U91B 4JY4A 4P49A 5CAYB 1QOKA 3I02A 1CLZH 1I7ZB 1KEML 2H2SC 1G7MA 5HHPB 1U8MB 2W0FB 5HPMA 5DMYA 5IB2B 2WV3A 2V5RA 1UQSB 3ES6B 4U6TA 5FK9A 3TVMD 2BVOA 3MLRL 5K9QG 1JWUA 1WSST 5GS2D 1JF1A 4L29B 4UDTB 5E2VH 4LEOB 3HZMB 3QJHA 3QISA 2YA0A 3P9WB 2HMIC 2P8LA 1VGEH 5HYJB 5F7DA 1ONQA 3OBAA 5GGTA 3OAYK 4KK5D 1UM6L 3REWA 4QT5A 2V2TB 1AD0B 5MHSD 4GKSA 1BOGB 4Q9QL 2HVJB 5IBUB 3GI8H 5IBLC 1DSFH 4ZYKB 5HPOA 3ET9F 2VLJD 4ZUTA 4M7LH 5FA3A 5LJYH 4BQ8A 5T5FL 1LQSR 4M48H 3QEQB 4PJFF 3K74B 1LEKA 3NN8B 2AEIT 5E08H 4OF0A 4UAOC 1G7QA 2DQFB 2JIXB 4OF8A 2VAAA 1P5VA 5IBUG 1GC1L 2RIKA 4P48A 1NCDH 3BPCA 4M61B 2DL2A 1F58L 3ALWA 1NCCH 2FWOB 1MCHA 5BS0A 3JTTB 2NXYC 1RVFH 5D7IE 3VDCA 4E41B 2PR4L 4YFLF 4O58L 1A3QA 3KLDA 4WEBL 2BNRB 5DJ0A 1FG2B 1S5HA 1C5DB 5I8OL 4RWHA 3AB0B 4CVZA 3BKML 1X5FA 1NCTA 3BEWA 5EU6D 4DEPB 1HK6A 1XGTA 4FXLA 4PJAB 1XH3A 3X11B 5B3NA 4P57A 4JAMA 5KVDL 5T1LA 4Y5XC 4HIXH 3QR2A 4L8DA 3KHQA 2UZIL 5H35B 1BJMA 2EDNA 1HN1A 4CUCA 1JV5A 1TVDA 1U8JB 5C86A 5CSZA 5CEZL 1KT2A 2J88H 4NP4L 3CSBA 2W0LA 4FFZL 4P5TD 4I3SL 3ZKSD 5DJDB 4Y4FD 2ZNWA 4JG1L 5A2FA 4O9HL 4U1NB 1RY7B 2C1PB 4JZJC 2ADJB 2VWEE 3QA3A 4YK4C 1CN4A 3ARFA 2WWKT 3FQWA 5FUZH 2ED8A 1XGQB 5DXWA 4UIKL 2FATL 1KOAA 4N68A 3WMSA 4F57H 3QPXH 5JQHC 1A3LL 1BQLH 3V95A 3GSUA 3QDGB 2P49B 2IQAB 3ULUD 1MPAL 3BH8B 5D1ZB 3QNXB 1B6DA 2VE6B 4G9FA 1J5OL 3FOLA 3R0NA 2C4FT 1KB9J 2YEZB 3CFDA 3RIAK 5B8CA 1BVKB 3I84A 4EI5D 4Y5YC 4LAJH 3VD9A 3T4YA 4JR9H 3HPLA 1Y6KR 1JGVL 2NPLX 3IFPB 1KCVL 4YHPA 4JM4H 5I1AA 2CRMA 4ZPVB 3MOQA 4CNIA 4YFLI 4P2RB 1VEMA 3NCJH 3UZVB 2R9HD 1G6RL 4KDTC 4OZHB 1G7LB 3VMPA 5CMAA 5I73C 4K3JH 1LK3L 5ESQB 5F1OB 4MAYB 2X4UA 3BE1L 3S36H 4FFVC 3GMRB 2E7CA 4ERSL 4KHXL 2FJGA 2CK0H 1A02N 3QZWB 4RGOH 5BV7C 4HF5L 3WHXB 3DECA 4XPHL 1KN4H 4AL8L 2EDYA 4Z5RB 1JMZA 4R26H 1KUMA 3C8KA 1TPXB 1FPTH 2A0LC 3IB4A 3P30L 4HBQA 2DLEA 2ZSWB 4JFEA 4YHZL 1YN6A 1QSEB 2NY0B 1TJIH 3EYQC 4L5FL 3EDEA 1N2RB 2R1WA 4FZEH 4PB9L 1KENL 3VFUB 3VWKD 1HHKB 2V9RA 3QZWG 5C09B 3Q6GL 3EIFA 3G04A 5IT2H 4XCYB 5AG9A 1KCUL 1I7RB 1P7KB 5DO2C 3LD8C 1OP3H 3SDAC 5I1KH 2IPUK 4Z7UF 3QJFB 3VI4E 5GGSA 4MA3A 4KGJA 3W39B 2BMKB 3DX8A 3ARYA 1CFQB 4BFIA 4P5KB 5FUOL 2ZUUA 1X9QA 4YPJA 3FCTB 3JUYA 3FQXB 4WWID 3O2DA 4R7DB 1IC7H 4KKBD 4P23B 5DGRA 4MJIB 3DRQB 3BRFA 5IW3A 3QCTH 3EYOB 3QAZB 3NTCH 5GRZA 5AUMA 2DM4A 2IADB 2HFFB 4Z7NE 1LO3L 4CMHC 3PGFH 4G6JH 5EULV 3P0VL 4PG9A 5D2NE 5A3IC 3CMOL 3KPPA 1MCRA 2HJKB 4KV5E 4HDIB 1SEQH 4KK9D 3H7BA 3TIEA 3QNZA 3KS0J 1KTDA 3L5IA 5CD3B 4ZUVA 3T2PA 1JNLL 4N8VB 3WFCH 5KSAB 1HXYA 3KPNA 2FJHB 4XBPA 4ZTPH 4F9PC 5C0EB 1KV3A 5JOPD 2A6DA 3E2HC 4ZODA 3LPGA 5FF6B 1FZJB 3QXAA 3HZKA 4HX1A 2ED7A 3STLA 4CVUA 1I8MB 1CE1H 2V2WA 3VA6A 1QBLH 2OX5A 1TJHH 4PJXA 3VXPB 1ZMYA 1V3LA 5DWUL 5MI0B 3VDBA 1VPOL 3E8UH 5IVNA 1S7VB 4Y5XA 4EVNA 5LCVL 4M7JH 4KJPC 4QRPA 2Q87A 2GTZA 4ZFZA 3VDAA 4IHOB 3UJIL 4Z78B 1U8PB 3QRGH 2CKBB 1EO5A 3KYMA 1KIQA 4XBEL 3MXVL 3TPUA 4ZDHB 2MKLC 4U1HB 1Z9SA 3BPNB 1RUPH 4HCRH 2XQBL 2Z91A 1QSFE 5T3ZL 2NY7L 1EEUA 5C0GB 4U33A 1OTTC 1EEQA 3SDXB 2G60H 3WIHL 3S34H 3S96A 3WFBL 1DQTA 3SDYH 3ARGC 4V1DA 4NQVA 3T2OA 1J1OH 1QFHA 4N5ED 5HGHB 3AXLA 3IKCA 5IHLB 5BW7C 1A5FH 4XXDB 5F7FA 1FORL 3RKDD 4WEUD 4ELMA 4LSVH 3CD4A 4PLJD 2D0FA 1TDQA 1RZFL 3LS4H 4K8RD 5F89A 5K9OB 4AQ1B 3IF1A 3MBED 1Z9OA 1Q9LA 4Y5YA 4Z7UB 2EDJA 3RL2A 3V6FB 1ZS8B 3T3PF 1G0XA 4K71C 3ARED 5SV4A 4CADB 3OB0H 5E70A 3MOBL 5LGHL 1W72A 1I1AD 5FO7B 3VJ6A 3GMLB 3QFJA 1H3PH 4GRLD 5SWSA 2OSLB 3BX7C 3VXMD 1MRDH 4H0GA 2MSPA 3K1KC 4JRXA 5T1KA 5JPNB 3TBTA 3KPRA 5TF1L 3MRIB 4M6AA 3GDBA 2O5ZL 4YHOL 3BO8B 1EHAA 4XVUC 2GAZA 1RZJC 4X4ZA 2R4SH 4S1RH 5BQ7A 3INUH 1S3KL 3FONB 4DGYH 3SKNA 3MRCA 1K2DA 3IU3B 5FV2A 2AJSH 4OCLC 1UKQA 1IM3B 2A6JB 3BKCH 4WWKC 1G9NC 2VITA 2KQMA 2CH8A 3TNNB 4WNQB 2C3VA 1WLHA 3V5HB 2XTJB 4K94L 3TN0B 2ZJSL 4OJFL 2F8OA 1U8KB 2H1PL 2Y36H 3O4LD 2LTQC 1FVEB 4Y4KC 1T1YA 1B9ZA 2X89D 4P9HL 3T1WA 3CFJB 4YHNB 1E4XL 4H88H 2P24A 4OT1H 5FDWA 5KG9B 2BRRL 2XZCL 1CBVL 5IOPB 1XGPA 4XX1G 3HAEH 1T0MA 3SY0B 2XQYK 4XTRD 2H9GA 3DPBA 1AQKH 4NQEB 1YC7A 1P2CA 4DW2L 5ESAB 3BZEB 3I6LD 3F5WB 4A6YH 1U58A 1U93A 3B9KD 3O4OC 3FB7B 1JPST 3TA3C 3WS3B 3C60D 3FHQA 3QWOB 1PX4A 4XP5H 4PRAB 5DS8A 4NQDB 2EKJA 3WL9B 1QUNA 3HHRB 5CBEA 3SN6N 4YNYB 2QHRL 3AROA 1CDUA 5EU4A 1DQDL 3IJSB 4P3DA 5JOFA 3H9SB 4L3CB 4PLKD 5IMLA 4CDHA 3WFHA 3EO9L 4XNZB 1ZLWK 1QFUL 2MCG1 1UKSA 1ZT1A 4C57C 2IH3B 4M5ZL 4DZBB 2BP3A 4M7KL 5IMMA 3C87A 4HIIB 1L7TL 2NXZD 1F11B 5KS9A 3BOVA 5D7KD 3F7VA 1CIDA 1J1PL 4OLEA 1ZTXL 1I9RL 5EBWB 3EW3B 3U46A 3HG1E 5LAXB 5KSUA 2OJEA 3GNML 1QFWH 3MOAL 4NQCD 3RX7A 1L0XA 1WZ1H 1SM3H 4UOW0 1ND0A 3X12B 2YRZA 1N59B 2P8PA 3D69B 2R0LH 4EUPG 5LGJB 5CZXC 4UUJB 4RDQF 3S5LB 3DBXB 5C08B 35C8H 3ARGA 3TJHD 3QUZB 1K3IA 3U4AA 4KWUA 5GIRB 3L3DA 1LP9F 4K7PH 1AFVL 1I8LC 2X42A 5I6XB 2XFXB 5EA0L 1QPPA 5BW7A 1H15A 4D0BA 4FP8L 4G7VL 1NKOA 3D39D 2G5BB 1NC4B 4HWUA 4ORGB 1YN7B 1K4DA 3G5XB 4FQ2L 3S5LG 5I1EH 3OXRA 5BO1L 3RPKA 1FE8L 4PRNB 5ICXB 2YD7A 4HUKB 1WVZA 4HPOL 4WUUD 5D71L 1VACB 3G5YB 2WWKO 4KKLC 5EC2A 4JVWA 4P5MA 5J12C 5FKPA 1ZGLB 1OCWH 3SE8L 4BKLA 2E7HA 5HDLA 3WN5C 1DBAL 2ESVD 5DC9B 3SBWC 4LSSH 5IQ9A 4MZ3A 2ARJQ 4IJ3C 2YD4A 4G8FB 1ZA6B 2NY6D 1Y18B 1A7NL 2OL3A 2BVTA 3MQIA 2NY3B 3MLSL 4L8SC 4NUGH 2DLFL 1INDH 2C3GA 3ME0A 2JB6A 2X6MA 1U8NA 5ERWA 4XWGH 3CVHA 1JN6A 3S35H 5E8DL 2AKRB 1IGCL 2D2OA 2EYRA 4O2FB 3NIFE 2BVYA 2WWMC 3T2NL 5HHMB 3QDMD 3C5SA 5IM7A 2QQNL 3BDYL 3ARSA 2C7UA 1KTKE 3DV6A 4G9DB 1NCBL 1CGXA 5IVXE 2AJYH 4E41E 4WWKA 4TSAH 4NM8L 1P7QA 3REVB 3VMNA 4Z7OF 3DSNA 4YFDB 1QHPA 1CU4L 1GC1C 2YUVA 5E9DB 4P4KC 5DJYA 3GSWB 1MELA 3A0OA 4TNVK 3C5ZA 3BP7A 4HFWB 4WFED 3IXTA 1SEBA 4BSWA 1KIUA 4OGYH 4H26B 4Y1AD 5C92A 4F9LC 4AQOA 3KGRA 4DGVH 5JXAL 4JO3H 2JJSC 3GGWB 5JDSA 4R2GC 3WFEH 5EBMA 2UUDK 4ZD3H 2NLJB 4G6AC 1FNGA 4R96A 1T1ZB 2VLKD 4DUXA 1J8HB 4OZGB 4O51B 1BZ9B 4I0PD 3BPOB 2VDRL 4J23A 3CIQA 3DO7A 4JFYA 2YC1B 5CBAB 1V8HA 3DMMD 1I9IH 2YD2A 1YEKL 3TA3A 5CD5C 1JHLH 1KPRB 1L7IL 2E8ZA 4Z7VB 1CFSA 3PV6B 3QDGE 4HKXB 3MV9A 3DXAD 1LP9B 5I76B 5EU6B 1WBYB 1FRGH 5EU7E 1YQVH 2RGSA 3PABA 2OQJA 3V0WL 2HT4D 1CL7H 5ID0B 1NMAH 4UQ3B 2DQHH 2YR3A 1YNKL 3H7LA 3GMOB 4AT6A 4M1CD 3WYRA 3D2UD 3I2CH 4QXWA 2Q76A 3MLZL 3PWLB 5AZ2H 1P6AB 3L1OL 2PCPA 4J6RL 2PYEE 2Y07L 1A7OH 1C5BH 3KPSE 2R4RH 5GRJL 4K7PY 4EIGB 2YPLE 1J1XL 2X9YA 4HJ0D 4WDIB 5L2KE 1VFAA 3VFRB 1IAKA 1BFTA 5I2IB 2DM7A 1RIVL 1SMAA 2P8MB 1ODAA 2CDFA 3TYGH 5C0CD 15C8H 2PYFA 2KDGA 3EYSH 3SJVA 2G9HB 1T7WA 4TVPD 1JIBA 5SX5H 4EEEA 5JXED 1KJ3L 5E7BA 4PJFE 4UBDC 2WLYA 3BP6A 1NGZB 2D0HA 4EI6A 3O2WH 1MCDA 1T7YA 1RULL 3FAWA 1JTOA 5KVFL 3D18A 5MERA 5FYKL 4FQHB 4PGBB 3RIAF 4YDKH 4G7YH 1DQML 2ITDB 5KVMC 3ARDC 3T65A 3WJJC 3GHBL 3K81A 1I8LA 1PFCA 4OF7A 1ES0A 3ELAT 2BY1A 2DF3A 1PSKH 4M9OA 5GSRA 1DQJB 4M1DH 4X4XA 3JVGC 2F5AH 1HCVA 5GS0D 5BRZD 3TNMA 2Q7YA 2BERA 1A7RH 2D03H 1MUJB 4KRPC 3SGJC 4GO6B 1V5JA 3L3OB 2BJMH 1B6UA 1DN0B 5F9JA 5JHLH 5CEYB 4MJIE 5IKCA 1QSFA 3DARA 3H6JA 3MLXL 3WN5A 1R3IH 4HG4K 2EECA 3TCLB 2Y6SD 1G0YR 5JLZB 1I85C 4OFPA 3SBWA 4O2EB 1SYSB 4PJDB 1JZ4A 2O93L 4G8IB 1Z2KA 4HT1H 4OD1L 4L8SA 4M00A 1P5UA 2YRLA 4MJ4A 4XP6L 2VXQH 4N8CH 4PY8I 2J8UF 4BUHA 4PJ5A 3F12B 2FX7L 1KBGL 1MIML 3B4NA 4KMQA 3MR9A 4B7LA 3X14B 3LAFA 1T7XA 3IDJB 2APWA 3EOTH 5D7SH 1SYVA 2VZVA 3ZE0F 2I5YH 5HHNB 4NHUB 5CINL 3HRZA 3QCUL 4TTDD 5MEPA 4QRQA 2NW3B 5IBTH 1M7IB 3G5VB 4F58H 5L88L 4HH8A 4X7TB 4CN1A 1T03H 3VH8A 3U0PA 1LO4H 1ADQL 1J18A 3O6MH 2JJUA 3VXRD 4MQXD 5CP3H 5EIIB 4P4KA 3S7GA 3MRJA 5CGTA 4PJ7B 3PHQB 4PJ9B 4N90D 3FQUA 4HJJL 1GGYA 4F9LA 4L3AA 1RHHB 4G6MH 1YC8A 3PWVA 4C83B 5IW6A 4XNQA 4BH8B 4ESKA 1DE4B 3HMXL 2J4WL 3HI5H 4HH9B 3O41A 1AR2A 1OPGH 3VFTB 4UB0H 4PB0L 1RZ7L 1YEFH 3PWNA 3T0XA 3IVKA 4OLUL 4HBCL 5IMOA 1ACYL 2Z4QB 1F45A 1OAYL 3BW9B 3MGOA 2AJXH 3NOIA 5EZJB 5ESVA 4K7FB 1RUKH 5KSBB 3NPZB 2QSQA 3RBGA 4RNRA 2VQ1A 4GUPB 4WI3A 1DBML 3GMNA 2ORBL 3FFCE 4HC1L 2DYPA 5DI8A 4DEPC 1MJJA 3MUGB 2WSKA 1YEGL 2H2PC 4LLDB 2YA1A 3MBXH 5IB3B 4HIHA 1IAOB 1CCZA 1L0QA 4K3EH 1WT5A 5K9KB 1HH6B 2WUBH 4Z7UE 2N7BA 4G8GE 5C0NC 4X4YB 3KPLB 4OKVB 1ZHLB 5B39G 2EIZB 4HZLB 1R0AH 1CE6B 1BQHA 5GGQH 2MPAL 4RA3A 2G2RA 2A73A 4HS3B 4Q0XL 3PQYB 2F5BH 2YD6A 4X6BA 4P99A 1H3XA 2HFTA 2VXSH 3B9EA 5INCB 1NBVH 4L9DA 2RCSH 1U8LA 5GRXG 1D6VL 5E99L 3D25B 2GCYB 3VFOB 1MOEA 4XH2B 2X5PA 2J8UB 1F4XL 5C0BD 2X10A 4JQIH 5EU7C 2HLAB 5D1ZC 3RGVD 4U1MA 2Z9TA 4NN6B 2DMKA 5IEKA 1PLGL 4P2OD 1BVLA 1IBGH 3RWIB 3QXWA 3WJJA 3EHBD 3OXSA 2X09A 4LCUB 3UJTH 3MRLB 1E6OH 3B8SA 4BQ6A 3NFPB 2XTJE 4MA1B 3MV7A 4NPYA 1Z9MA 4FQXB 2VDLH 1XEDA 3LEXB 3MCLL 5D8JL 3ULUL 3JVGA 4G6KH 3ZTNH 4TUJB 4GH7B 2CUMA 1QLRB 4HWBA 1GZQA 3OKMB 4E5XB 3HG1A 1YPZF 2IAND 1QBML 4JB9H 4YHKL 3SGJA 4FS0A 4XP1H 2CLRB 4ZUUB 5CJBA 1JPFA 2X4OB 3TFKC 3FMGH 4K94C 4ONFL 1EFXD 4NRYB 1WITA 3CU7A 5GJTH 1I85A 5E2UL 5E2WH 5F93C 1KGCE 3WO4B 4UT6L 4NQEE 2EZ0C 2Z8RA 4UILH 4JQXA 3UO1L 4P9HC 3BN9C 3O6LH 3IFLL 1V05A 1ZHNB 2W0FA 1TPXC 4LPUA 1UQSA 4D0DA 3ES6A 3ECBB 1TZGL 3L5JA 5EORH 1BGXL 3GSXB 2NY0C 4U05A 4JFFD 2GI7A 1WICA 4K07A 5D4QA 4L29A 4UDTA 4GLRI 3U7WL 4KK6D 4LEOA 4NQDE 3U9PH 2AEWA 2CIIB 1FNEA 1LWRA 1VHPA 4DKFL 4LF3B 1YEHL 1V3JA 4POYA 3H9SE 4GSDH 3T09A 1OARL 4EBQL 4LLQB 1D5MB 4YE4L 2OP4H 3V4PL 3IDXH 4R8WH 5L7XH 4P23C 3P77A 5C2BL 2BDNH 2HVJA 3T3PE 1CGUA 3QAZC 4ZYKA 2E8YA 2X7LB 3WIIL 4KI5F 5CJXC 4XCEB 3HNSL 4WW1B 1A6UH 3MSPA 4XPGH 3RA7L 3O8XD 3QEQA 3DTXB 2BRQA 1GCFA 3NN8A 3EDDA 5FO9B 4M6ML 2GUOB 4HWZB 3KYKL 1EUUA 2DQFA 2JIXA 4JRYD 2GFBB 3I50L 4AY0A 1D5BA 4M61A 4LSTL 3OHXB 4FFWC 3V4UH 5KSAC 3JTTA 1GGIH 1B2WH 4LSPH 5FGCB 3JWDL 5GZNC 4E41A 5SWZB 2E27H 2B1HH 3VG0L 2BNRA 4X6FB 5DK2B 2VLRD 2V5MA 1C5DA 2Q8BH 4LAQH 4NHCL 1J10A 2HFEB 3IT8D 5MI0C 3X11A 5JTWA 3N85L 3TIDB 1QP1A 4XHJD 3WIHA 4JFXB 5F3HA 5H35A 1EJOH 3MLWH 3PXHA 5FHAL 1LO2H 2UVFA 4S1DC 1U8JA 3U9UB 5HVHB 3FRPA 1JF5A 3NZHH 1YPZB 4NQCB 3BPNC 3LV3B 4XMKH 1IEAB 4NKMB 5DDHB 4U1NA 2C1PA 2ADJA 1FO0L 1KLFA 1EERB 1NFDB 1U36A 3QCVH 4X6DF 4M43H 5CHNB 5HHVL 4LRNL 1LO0H 4PY8J 3GJFB 4BYHA 1ED3B 2HP4A 1AE6H 1LEGB 2DBLH 4OQTL 5DD3L 1AHWB 3QDGA 2IQAA 5FYJL 3HRPA 4FQIL 3SPVB 4IMLB 3BH8A 3D39B 5D1ZA 5C07D 3QNXA 4RAHA 2VE6A 1GGBL 3QIUB 5HHME 5CEXB 3DX7B 4U4BA 1OTUC 1S7RB 1MJ8L 3ISWA 3S36X 5EOQH 1CK0L 3IRPX 4LVHB 2AK1L 3O3EB 5I74C 2ZUYA 2D7TH 2W60B 5TPWH 5LQBH 1KLGB 3WNLA 4YBQC 4FTVE 5DMKB 2NY5H 1K9TA 2CD0A 5FKAB 3KPSA 5KAQF 4P2RA 3JV6A 5E9DE 1RU9L 3K8MA 4QRRB 1KPUB 3D3VB 4NN7B 4OZHA 2FDBP 1G7LA 5L6YH 3T0WA 3BIKB 2AEQL 2NY6B 4WI5A 3FN3A 3UTQB 1P4BH 5ESQA 1KJ2H 1NANI 4MAYA 3PWPB 1M6OB 3GMRA 5DSCA 4LARL 3ZYOA 1UM5L 2XRAL 4IOSD 5ACZB 3HUJF 3THML 3WHXA 4OGXL 3O6FB 3OSKA 2KZWA 5E2TH 3GKZA 3OKDB 1J8HE 1BPVA 4IDLA 3ARTA 3QIWA 4JPKL 1IRAY 2ZSWA 1OP3K 4M1GH 1U6AL 5L2JB 3UBXB 1T66C 2XTJC 4HS8H 3VFUA 4IOIA 1HHKA 3TN0C 1YJDH 5C09A 3FO9B 1MRCL 3BMWA 1LP9E 4QNPF 5JQ6L 2ZUWA 4LNVA 4K2UH 4TNVF 1B4JH 1P7KA 2JF1A 3RX8A 4J4PD 5DUBA 1UJTA 3QJFA 3KVQA 3W39A 2BMKA 1GAFH 1CFQA 4P46D 4I77H 5EB9A 5GJSL 3RVTC 5JDJA 3OF6D 3FCTA 2OZ4H 3FQXA 3MODL 3TH3T 4WI2A 4R7DA 2CR6A 3UBXG 1OSZB 2FBOJ 4P23A 2PTVA 4NJ9L 4MJIA 1EO8L 5SV3A 3DRQA 5C0AB 4JE4B 3MRFB 4F2MB 4ODBD 2IADA 5CJXA 2HFFA 3V4VL 4I0PB 3L5XL 3U0TB 4X6DB 3DMMB 4EQ2A 1BHGA 1B0WA 2L7UA 1CZ8H 1X5KA 5DT1H 4CJ1A 4XPTH 4HDIA 2YK1H 3VA2C 1XIWB 2WBJB 3UTTB 4CU7A 2E3VA 3DXAB 3KJ6L 4LLMA 3VXUD 5CD3A 1AGEB 3BT2L 4KUCF 5EUOF 5DRXA 4KDVA 4LPVA 4N8VA 1G1YA 1CXIA 5KSAA 2FJHA 1S7TB 5KTEH 1A1MB 4ZNCD 5IQ7L 4KPHH 3QI9A 4F7PB 4ZO6A 3BRDA 2HLFD 1M71B 4JFPB 2DM2A 4XNZC 1C7TA 1QFOA 1X5JA 2MWCA 1I8MA 2CGRL 4QHNB 4WO4D 1FL3B 4MS8C 2YPVH 5DFWH 2BSSB 4GQ9H 3ARBB 4HK3J 3E3QE 4FQLL 1WWWX 1S7VA 5FFLA 4Z7OE 1PYWB 3OAUL 2E5EA 4EDWH 1QQDB 1XGRA 2FB4L 4IHOA 4LP5A 2OMBA 1U8PA 2F9BT 2CKBA 2DQDL 5ILTL 5E6IB 5C0CB 1ZLSH 1YYLH 2EC9U 4JKWA 4WGWB 4ZDHA 4NRXB 3O2VH 4U1HA 1F02I 1ORSB 5KW9L 3UTPD 2Y5TA 3RJDA 1LILA 3BVNB 4FQCL 5C0GA 4Y16B 3MACL 4L1HA 5FYLE 5F7KC 3SDXA 5HVGB 2MMXA 1RFDL 3LHPL 3HUJB 5DEFB 3QUZC 5IB5A 3AM8A 1MFEL 4KK8C 1WFNA 5HGHA 1QFWM 5J3HD 1MJ7L 2XZAH 2VNCA 1QEWB 5I6XC 1QTYT 3ZT5A 4JKPL 2LAAA 2W1NA 4XVSH 5K9OA 1IQWH 1IGTB 5HD8D 4JFZH 3OB0K 4MB4A 1DBBL 3HZVB 1FLRH 4Z7UA 1KCSL 1ZS8A 3ARZA 4PJGF 3SGEI 4ONHB 1HOCA 3EZ8A 1DQQA 1G7IB 4CADA 3HMWL 4AMKL 3RNKB 2EEBA 5IB4B 1JFQH 1SBSL 5FO7A 4HAFA 1DANT 2F58L 2IFFH 1I3GL 5E24E 2OSLA 5IGXL 4LSUH 4GKOA 3LN5B 2MHAB 5JPNA 2NY3C 4W4OC 4PR5A 1REIA 2OR8A 4JZOA 1U3ZA 1ZHBA 3JWOH 5I1GH 2YXFA 3B2VL 3GBNH 3BO8A 4XVJH 4ZS6D 1P4IH 2DI8A 5FDYA 5IESL 5BVPL 2XG5A 4OZ4B 1HSAB 1KFAL 2EDEA 1OT1A 3FONA 3GHEH 3UJJH 4Q6IB 2A1WL 3IU3A 5AD0B 1NSNL 5GGVL 1PW3A 2FGZA 4G6FB 4UV4L 1D7FA 3X3GL 3TNNA 4WNQA 4N1CA 3V5HA 1JNNH 5DUPL 4DN3L 3SKJH 5BS0D 1QACA 3VXRB 4G43B 1U8KA 2R56L 4NNXB 4K3DH 5I17B 5DRWB 4KROB 1FVEA 5CSGA 1P6FA 1NCNA 1W0WB 4LCWE 3CFJA 4YHNA 4M8QB 3ZDXF 1BWWA 5KG9A 1AD9B 3QXDB 2AXFB 2R0KL 1RHFA 5GHWH 1QFPA 2F54B 5FYJE 4OV5B 1UGNA 2N4IA 5T1LD 3U7YH 2G75B 4V2CB 1CDGA 5C70A 5ITBL 2VN7A 4NQEA 3MZTA 3BZEA 4D94A 4TN9A 4MDJB 4PJHF 2FCBA 5EC1A 3BPOC 3QEHB 3K4AA 4XB7A 3FZUC 3C08L 3FB7A 4KVNH 1YEEL 3IAQA 3WS3A 1EHNA 3QWOA 4PRAA 4YHYB 4JVUA 3RP1A 1YY9C 2BOCB 3ARFD 4A2LA 2J8UE 2H32B 3GKWL 4NQDA 1HIMH 2V7NB 5GRUL 1OAKH 1KB5H 4ODVL 5KVGL 3G08B 4OIAA 4YNYA 4ODSL 5BVJA 3HR5B 1OAUH 5D70L 1HHGB 3RWDB 3IJSA 4H20L 3ZE0E 2I9TB 3H9SA 4U1IB 2D31B 2Q3AA 1S9XB 4RAVB 5J6GA 2IH3A 2W38A 4GKNB 4L8BB 1X5GA 4G9FD 4GAGL 3B5HA 3QIBB 1KCRL 4MX7B 4JZNB 1F11A 3MLYL 3DYPA 2NMSA 5I66B 3MREA 3PHOA 4K7PX 4YC2B 5EBWA 1YMMB 3UC0L 2DQIH 5LAXA 4ZFOA 1KIRB 5E6YA 3A6OA 3UZEA 3MLTB 2QKIB 3H3PL 3DSFH 3EO1B 2CDGB 3S8WA 1RMFH 3KPQA 4LU5H 3X12A 2BHYA 3UDWC 3OPZH 5C0BB 1N59A 3D69A 3ULUC 1LD9A 4RGMB 3SKOA 5LGJA 5TFSH 3S5LA 1OD9A 3DBXA 5C08A 1EH9A 3TF7C 2C1OB 3QUZA 2B7DT 2VH5L 5GIRA 5F3BB 1MFCH 4WFFD 2XFXA 4XRCA 4YR6B 1FJ1B 2J6EA 4TVPL 1J0IA 1JNJA 5IHUL 1L6ZA 1KPVB 2H2SD 5EZLB 3ULVH 1MNUH 2G5BA 3E3QC 1NC4A 4ORGA 3G5XA 2PW1A 2R9HC 5EOTB 4PRNA 2D4DA 4YBHA 4EOWH 7CGTA 12E8L 3T04D 3S35X 1ROWA 5IIEB 1VACA 4TUKH 4Z0BL 1ZGLA 1EEZB 2Z92B 5L9DL 4ODWB 2XWJA 2HMID 4BZYA 1HWHB 1EFXB 4MHHI 4X80L 1D9KA 4N0RA 5FYKU 5HI3C 3HE7B 4G8FA 5IHZB 1DFBL 3BKYH 3MV11 5DHVB 2F15A 4W4OA 3EYFB 5I9QB 5GS0L 3OJMB 4NOBA 4K9EH 4QRUB 5IBLD 3CZFB 5J1AB 3VXTB 4CN6A 1XGUB 3BGMB 2GQHA 2B1AL 1A6WL 4N9OB 1Q0YH 2AKRA 3R06B 1VESA 4N9GB 5E8OB 1DEEA 1XF2A 2QJDA 5DQDL 1EA9C 2EEAA 3CXDL 4G9DA 4AIXA 1UB5B 5FGCE 1MAML 3F7QA 4GXUM 4TYUA 5SWZE 4F7CB 4L4VB 1OD7A 1YNLL 2M1KA 3HMXA 4ZXBB 1NFKA 3TJEH 1MLBB 1S7XB 4ODXA 4OCNC 4TRPL 4XNMB 3BP5B 4ZOAA 2GY7B 2A77H 5E9DA 1EVTC 1GGCL 3CLEH 5DA4A 5E4IA 3GSWA 5F9OL 3VG9B 4PJ9C 4OLVL 1AI1H 3IDNB 3MUY1 4S1QH 2XYCA 4LSRH 5T1DL 2APVA 2P44B 4H26A 4TSBH 4LVOB 1HINH 3I3EA 1I1RA 4OI8A 1N64L 4CJ0A 4HC1A 1YPZE 4GW4B 3TT3H 3GGWA 4S11A 4EQ3A 4QRPD 5EO0A 1GH7A 2ZCHL 5C0JB 2NLJA 4OLXH 2GTWB 1A9BB 5JNYB 3LDBB 1J8HA 4O51A 4M7ZB 2OYPA 2YC1A 4O4YH 3VW3L 1EGJA 4LNRB 3C6SA 4RBPK 3TGXA 1KPRA 4ZUSB 4Z7VA 4HXAL 4XNUL 3DX6A 1LP9A 2ICES 5I76A 2BVQB 3KR3L 1FHGA 3GSVB 1V3KA 1HSBB 1Y6MR 5K93A 4YXLL 4V1DD 4MGXA 1TETL 2BCKB 5ID0A 1WWCA 4UQ3A 3GMOA 3NAAH 5D1QB 4BQ9A 1FH5H 2W9EH 5DJZB 3PWLA 1T20A 1FYTB 4ALAL 4R7NA 3WXWL 4XPAL 4PGEB 1A8JH 4M6NH 3U6RB 4XT1C 3MRRB 3MV8B 1M7DB 3D3VE 3EFDH 4GAJH 3DI2B 4WDIA 5SX5K 4MMZC 2Z0BA 3GMPA 3UYRL 5DEGB 4NKDB 5JIIA 1BZ7B 2P8MA 1G7HA 1MAJA 4DK6A 1BEYL 4KI5E 4YDIH 1QYGH 2G9HA 4UIMB 1BF8A 1JHTB 2R0ZL 3QFJD 5SWSD 1NGZA 3EYVB 3H3KA 2A6IB 5C07B 4JRXD 2H26B 4W6XB 5T1KD 4Y2OA 4NN6C 2F53B 3KPRD 4S2SB 3MJ6A 3P73A 4FQHA 1A3RL 4PGBA 1HILB 2ITDA 1OSPH 3SE9L 4FFVD 5T33L 3P11H 4TOYL 1HDMB 3S37H 2O26U 1BBJB 4QYOB 2EDBA 4TULL 5T3XL 5TE4H 4Q74A 2I27N 2X4TB 3VD5A 3TC9A 3OX8B 3AREC 1F2XK 4MA1C 4KVCL 1R3HA 1OLZA 2NR6C 3J7HA 4FFYH 4FQXC 5DTFB 1DQJA 2SEBA 3H3BC 2BNQE 4LBEB 4EJ1C 1AJ7H 5J11B 1G84A 1KEGL 4L4TB 1MI5E 4RMQA 3EYQD 2VDML 2QSVA 2Y23A 3L3OA 2GT9A 5CEYA 5DO2D 5C0AE 3FT3B 3TCLA 2VMFA 3MZGB 5JLZA 3HFMH 4O02L 2FH8A 4O2EA 1SYSA 4PJDA 5JO5B 3WO4C 3ZTJH 4ZG1A 5JW3H 4L1DA 1HXMB 3MJ9L 4G8IA 3P0GB 5GISH 4HG4J 2YWZA 5DZOA 3M17A 4QRTB 2JCCB 1TZIA 5E5UB 3CLFH 3VRJB 3BI9X 3TP4A 4R90H 4X6DE 1D5XA 3BDXA 4Q2ZB 4J8RB 3L5WA 4HMDA 3SCMB 3X14A 3BYTA 5L8JB 1MREH 2AABH 1VKXB 5DMIH 1HNFA 4KAQH 5I75B 1J0KA 3RJQB 5A3ID 4AJ0A 5CLWA 1NL0H 2NW3A 3H2WA 1M7IA 3G5VA 5FCSH 3NIDF 4X7TA 5CUSL 4XC3H 2R39A 3FO1B 2MQCA 3P0YH 3PHQA 4X8JB 1BX2A 5D72H 3NA9L 1F6FB 3VFWB 3U36A 3SKUD 1RHHA 4C83A 4JFDE 3WFZA 4P4RB 4BH8A 1TFHA 4PREA 5HHXH 5DD5H 1WEJL 4FNLL 4CMMA 1UA6L 2FNBA 1SVZA 3F62A 1PZUB 1D5ZB 4HH9A 3VFTA 4MAUH 3CSYA 3QB7C 5DLML 1IAMA 4OBSA 4U0QB 4DN4H 2HJFB 2WK2A 2X4NA 2Z4QA 4H8WH 4I9WE 4N1HB 1H8SA 3HUJE 5ID1B 3K2UH 1CLYH 3QXUA 4K7FA 3AS1A 2I25N 1N5AA 4DUVA 1F6LL 1IKFL 4GUPA 3K3QA 5E1HB 1VSCA 4Y8DC 1OTTD 2WP3T 4Y2DB 3OKLA 3KYOB 1C5CL 3QRFM 4ZOEA 4Y4HB 3MUGA 5KJRL 3S3SA 2N1KA 4LLDA 3ARGD 2B4CL 3LZFL 2R8SH 1IAOA 3W0WE 4BH7B 3OJDA 3CFBB 4QNPE 2J8HA 4WW2B 3V7AG 4KRLB 3TO4B 5K9KA 1HH6A 2BXZA 5HVHC 1F3DJ 2GKIA 1BBDL 4IIQB 4UT9H 3KPLA 4OKVA 4X4YA 1ZHLA 5T1MB 2EIZA 4HZLA 4YXHL 1CE6A 4YHIB 4BFEA 5GRWA 3KXFE 4DZ8B 1B4RA 1T0NB 4Y88A 1J0ZA 2E7LC 1OM3H 4HS3A 1GJIA 5HYEA 3PQYA 4PGJA 4HWNA 5INCA 1G7JA 2RBLA 4W4NA 3VXOA 1K8IB 1RK0A 2GCYA 1IAIL 1KF9B 5J89A 3TT1L 1MHEB 2HJLB 1BFSA 1IVLA 4JY4B 4XH2A 4YHMH 1AHWC 2J8UA 1CLZL 5CJOH 4JQVC 2HLAA 4DQOH 3UEZA 3QIUC 1MFBH 2Y5EA 4AIZB 1VDGA 4ZFFB 2X9WA 1R3LB 5EUOE 5EO9B 4K55A 2VYRE 3WUZA 1EHLH 4LVHC 3P9MB 2GJZA 1K3ZA 4WTZA 2BVOB 4EN3B 4MCYB 1DLHA 3MRLA 5IJVB 1JF1B 3NZ8A 3NFPA 5E2VL 3WDIA 2Q8AH 4FQXA 4UT7L 2DTSA 5DJ8A 1F8TL 3BKJL 1XCTB 3LH2H 4B7IA 3GSNH 4TUJA 5HGGS 4M8VA 4NN7C 1QLRA 4WWKD 3CSPA 2R1YB 5MENE 3OKMA 1P7QD 2NY6C 3N1GC 4KI5C 4BSJA 3BZDA 3A67H 3L5HA 5FYJU 4ZUUA 1KCKA 5FB8B 2HH0H 2VDPH 1N4XL 1T1WB 5GGRA 2F54E 3C5ZD 4QTHA 1DSFL 4ZUTB 4M7LL 5FA3B 4XBGB 4D3CL 5FECA 1CF8H 4M48L 3P2TA 1RZJH 2JELH 3O6FC 1K5NB 1XZ0B 1ZHNA 3OKEA 4QF1B 4Y19B 2IPKB 1OB1B 3QDJB 2C3XA 3ECBA 2VAAB 1FNLA 1NCDL 1EEYB 4LQFH 4CRPA 1NCCL 2JJVA 2CIIA 3QUMB 5FYLH 5D9SB 3GJEB 4NUJB 1RIHH 5CIPA 1INQB 4LF3A 1BIHA 3TA3D 1MF2H 4P3WA 2GK2A 4XXCC 3D9AH 4ACPA 2O5YL 2C4XA 1D5MA 1QRNB 4LLQA 3MV9D 5IWLC 4LCIL 4S1SL 3ETBF 2NNAA 1NH6A 1RZ8B 4XNYH 3TH2T 5IFAL 2XKSA 2D7NA 4PJGE 3GO1L 4QXGH 2X7LA 4NGHH 3ZKMD 4QHMA 4XCEA 1G0DA 4WW1A 1LE9B 1BLNB 1CVRA 2J88L 1MJUL 1EJ6A 4I0PC 3IJHB 1R24B 5FO9A 3DMMC 4HWZA 2ZKHH 1D5IL 4BFGA 4KRNA 1FCCA 2WBJC 2GFBA 3G6AB 2M26A 5DK0B 3HC3H 3OHXA 4O00A 5FUZL 3VD4A 1ZEAH 3KDMB 2RJMA 2DS4A 3SJVD 2QTEA 1FGVH 1MRFH 5SWZA 2ICEB 3CVIH 3D48R 1CLOH 3QPXL 4RGNE 3MRQA 1WF5A 1X3DA 2DQUH 3GSUB 5DK2A 4M1CC 3VCLB 3PP3K 2I60H 2A9MH 1JF6A 3H9YA 4YWGH 1ZANH 2HFEA 4XCNB 5CZXD 4Z7WB 1F3JB 3ARBC 4G9FB 4V2BA 5M95B 3DOSA 3TIDA 1O7VA 4JFXA 4HJ0C 4PRPE 3SEPA 1A1NB 3U9UA 5E6IC 3BQUB 3EJYD 4JR9L 2OK0L 1YMHA 4YHPB 5I1AB 1YPZA 4JY6B 4JM4L 3LV3A 4NKMA 1PBYA 5DDHA 3RUGF 3ZDXE 4GS7B 1YA5A 3KG5A 4Y16C 1BWMA 2QBWA 1NFDA 1WZMA 4U3HA 4K3JL 5CHNA 3OZ9H 4KKLD 4G42B 1K85A 4YDLB 1KCLA 2WMPA 1QSFD 1LEGA 4JO4L 2NW2B 4PJHE 1TJGH 1AHWA 3JV4A 4XP9H 3GM8A 1INEH 3W82A 5C2UB 1UCBH 3SPVA 4IMLA 3IAGC 2JJWA 3QIUA 4RMTA 2H3NB 1KN4L 1S7RA 4PJ5D 3BHBB 5CP7B 1FPTL 3QPQC 4JFEB 5DFVC 1M05A 3AMLA 4L4VE 2W60A 3VXSE 3HAEB 4FZEL 5JW5A 2IBBA 2QADB 2WWMD 5DMKA 1HWGB 2EDDA 3IXAA 4PRHE 2J3SA 2Y7QB 4JDZB 5FKAA 1SMOA 3K4ZA 4QRRA 5K33A 1KPUA 3D3VA 5HHOB 5GGSB 4MA3B 4BFIB 3PXJA 1DBKH 3BIKA 5FUCE 4WIQA 3UTQA 1WQVT 1IC7L 1CD1B 1QFWI 1UENA 4Y7MA 3PWPA 1M6OA 4P4KD 1B0GB 3SO3B 4P2YA 3LKSB 3JV0A 1UWXH 1UM6H 3FL7A 3WO3B 4XPGL 4CBPA 1UB6B 2XN9B 5ACZA 4NSKA 1PZ5A 4HLZG 1WGOA 3O6FA 4PG9B 4Q6IC 3OKDA 4F7EB 3C09B 3T2QA 1E0OB 2FHBA 5T5FH 3KPPB 4N0CD 5GGTL 2UZXB 3TIEB 5F6IB 4LASH 2NX5B 4R2GD 1NMBH 1IM9B 5L2JA 3QNZB 1KTDB 4G6AD 4ZUVB 1MCKA 2XTLA 3HNVH 3WHE1 4PD4K 3FT4B 3FO9A 4C56B 4MQXC 4M62L 2BNQA 5CEZD 4KROC 1F58H 5GZOD 1NAMH 1MI5A 4XXCA 4HX1B 3E6HB 1SY6A 3T8XB 2DYPD 1QBLL 2VABB 2VO5A 1OSZA 4BQCA 4WEBH 4NZJA 5C0AA 4ZSOB 3E8UL 1NGXB 2R69L 1VGKA 4YJZL 3MRFA 4IMKC 4F2MA 3BKMH 2AI0H 1UG9A 2GTZB 3QUML 3QRGL 5KVDH 3LQAL 5KVEL 3KYMB 5C9KA 4PRBB 4XC1L 2UZIH 3UTSE 2EDTA 7FABH 1HZHH 4KY1L 4NFCA 3U0TA 4X6DA 1FAIL 4HCRL 4OTXL 4EDXB 4NP4H 1XIWA 4MJ2A 2VUOA 2BVEA 2WBJA 4YHYC 4I3SH 3UTTA 1AGEA 2IMNA 2W0PA 4PRIB 4JG1H 4O9HH 4ZPTA 3S34L 1P1ZB 4U6HA 1S7TA 3WSQL 4MXWH 1A1MA 1NC2D 1A4KB 4V1DB 3ZKXB 1F90L 1J1OL 1E6JL 5C0FA 4UIKH 3EDKA 4UBDD 2FATH 4HHAB 2J5LB 1M71A 1N7MH 3DIFB 4JFPA 3SDDB 4J3VA 5IFJA 2IALB 3HKFA 4QHNA 3RWGB 5D5MF 1FL3A 1A3LH 2F8VA 4LSVL 2BSSA 3V0AC 4GG6F 3LRSB 2DBJA 3LS4L 1MPAH 1PYWA 3SGKC 1QQDA 1FL5A 1NLDL 3RL2B 3SGDH 4L4TE 4YC2C 4JFDA 2O5XH 5E6IA 5JR1H 3P4MB 4F33B 3MV7D 2P5EB 4NRXA 1ORSA 3ZT6A 4WHCA 2FX9H 2DJSA 2BSED 3BVNA 2V9QA 1JGVH 4JDTH 4Y16A 3UTZB 1KCVH 4J7RA 4RGMC 4UTAH 1A22B 1G6RH 4KRPD 5TE6L 5JA8B 3KPRB 4X9GA 3VI3E 2WP3O 3LY6A 3HUJA 5DEFA 1T3FB 3RWJB 1BD2B 3T0AA 1LK3H 3EHBC 1MWAH 5IB1B 1MHCB 1K8DB 5M7QA 3BE1H 4RX4A 3O0RH 4ERSH 2R2HB 3SKNB 3MRCB 1K2DB 1ZT7B 3LOWA 2AJVL 4FMKA 1CL7I 4HF5H 5IJKC 3BKCL 5D93B 4XPHH 4AL8H 4E0RA 1RK1B 4BM7A 4NKQB 1WTLA 4JM2F 3RQ3A 4ONHA 1AP2B 2IGFL 3KXFA 3P30H 3RNKA 5F8RC 2IF7A 5IB4A 4L5FH 5LKNA 4PB9H 2BFVH 1KENH 2Y36L 5C8JB 3HE7C 1T1YB 3UTOA 3RPIA 1KCUH 2VERN 4I48A 3LN5A 2MHAA 5FDWB 1T21B 3BFOA 3VFMA 5I9QC 1UH2A 3DYOA 5FUOH 4GBXB 1Q0XL 1XGPB 1KXTB 4AEIL 1F13A 4JFHE 2CUIA 1E4WL 4S10A 1HSAA 1X5AA 2DRUA 3QEQD 1I1YB 2DD8L 2AJ3B 5EUOA 5AD0A 4YQXL 2P5WB 2ARWA 3MROA 1OWRM 2JIXD 3P0VH 4R4NC 1SJXA 1XF3B 4XP5L 1EVUA 4ONGH 4ZXBC 5GRVL 3CMOH 3HNTH 5E03A 4OI7A 3RFZC 4G43A 2N7AA 4P59H 4NNXA 2HN7A 3VG9C 5EU4B 5DRWA 4E41D 1JNLH 1W0WA 2BNRD 4XP4H 4LVOC 3RVXC 2DTMH 1AD9A 1I7TB 5IMMB 2H2PD 2F54A 4OV5A 4X98A 5KANG 2G75A 5HI4D 4IMKA 1MFNA 1JPGB 5DQJB 2VUYA 5DWUH 5T5NF 3WUWB 5DC4B 2B4CC 2ZOLA 1PAMA 1EK3A 2Q6WA 3LDBC 1WWAX 5C0ND 4MDJA 4DUWA 2JJTC 1NANH 2P43B 3DHMA 4M7ZC 4KMTL 1BREA 4XBEH 2P8PB 3QEGL 2BOCA 1I4FA 2H32A 2V7NA 2XQBH 4LLWB 3WUWG 5D7IB 1OTSD 5T3ZH 2NY7H 3G08A 1WCBB 3WLWC 3HR5A 3RWDA 1HHGA 3ZZ1A 2I9TA 3WIHH 3L3DB 1A21A 4K7PL 4U1IA 2VL5B 3QDGD 2D31A 5D1QC 1S9XA 3B5GA 4RAVA 3MPCA 5D1ZD 1NCAH 3NIDE 4GKNA 1FGNL 1KN2H 3QIBA 3OMZA 5I1EL 4MX7A 1JPSL 4JZNA 1JE6A 1FORH 2DL9A 1UYWH 4MJ6A 4R0LB 3SGKA 3VFVA 5I66A 4XWOC 1NCUA 1YMMA 3VWJA 2FECL 1CFVH 2MJWA 3VGAB 4P5MB 2ADFL 1DVFB 5FKPB 3BISA 3EO1A 2CDGA 3KPSD 1S8DA 1FFRA 4BKLB 4P2RD 3SOBL 2P48B 1MCJA 3I85A 4JO1H 5E8EB 5IQ9B 1L0YA 2VN4A 1IC1A 4YIQB 4QY8B 3QUXB 1OY3B 5LGHH 3B8YA 5ALCL 2DMCA 3O3AB 5F7NC 4NUGL 1J05B 2JB6B 4MAYD 2C1OA 4N8PA 5I8KL 3TFKD 3ZDZF 4CN4A 4XWGL 3G6DH 2F74B 1JN6B 3DGCR 5TF1H 1NUNB 2EYRB 5EZLA 3WD5L 2VZTA 4YHOH 3C5SB 3BN9D 2FO1A 5LGKA 5EOTA 1WUNT 4BZ1H 5J11C 5IJKA 2LU7A 3Q5YA 1U3YA 4PV8A 2NY0D 5IIEA 5JOPE 2J12B 1QRNE 3QP3A 1YYMH 5C09D 3NCYS 2Z92A 3TYFB 4ODWA 5KOMC 5BV7L 3I6KA 3V6OC 1PX3A 2ZJSH 3UX9B 3HE7A 4OJFH 4XAWH 3B9DA 3K80A 5IHZA 4U3CA 1YNTB 5DURB 1RAMA 1F6AA 1S5IH 2DAVA 5DHVA 4UNTA 1HE7A 3EYFA 4P23D 4JO3L 3T77B 4MJID 1E4XH 2JB5H 4QRUA 3CZFA 2FX8L 3QUYA 5J1AA 3VXTA 1XGUA 3BGMA 3SCMC 1JGLH 2BRRH 2XZCH 3GK8H 1CBVH 1CTOA 3RTQB 3R06A 3CU1A 4N9GA 5E8OA 3T1FA 5I75C 3DO7B 4J4PC 4DW2H 1IGIH 5B4MC 2ICWB 1I9IL 3V5KB 1Q72L 4L4VA 5C6TH 5CILL 1CFSB 3HI6L 4ZXBA 1ZVSB 4RSVA 3AU1B 1MLBA 3GSQB 4FFWD 1S7XA 2EIDA 5FM8A 4KDWA 4XNMA 5KSAD 3BP5A 2A9NL 1YQVL 5B21A 2AXHA 1L9MA 5GZND 3P40A 1CDJA 3IDNA 3QI9D 1NMAL 1MCNA 2DQHL 4JVPA 1DQDH 3SGEH 1A6VH 3N50A 4ZAKB 1A7PH 1UXSA 5E1AB 5AZ2L 4M5YL 3IGAB 3JBG7 3K0WA 1QFUH 3CJJA 3SHSA 3QT2A 1T6WA 1V7NH 1NUGA 2GTWA 1A9BA 5JNYA 5FCUH 5D2NB 2CDFB 3TYGL 2PYFB 1YEJH 2JJTA 1J1PH 1ZTXH 1I9RH 2Q86B 4J1UB 4LNRA 4Z95H 5J57B 4JANB 3T0BA 5JZ7C 3GNMH 3MOAH 4Y2DC 3UAJC 2WINB 4Y4HC 2MOVA 3D18B 1HSBA 3GSVA 5EUKA 5MERB 4PGDB 6FABL 2C5DC 4OF3A 2A6KB 4POZD 3BSZL 1X5ZA 3T65B 5EOCL 4WW2C 3TO4C 5D1QA 4UI2A 4ISVB 1AY1L 4IIQC 5DJZA 1FYTA 1AH1A 4LEXH 1OTUD 4NC1E 3N1FC 4U6XB 4PGEA 4G7VH 3U6RA 3MRRA 2KPNA 1M7DA 3MV8A 4UMGA 5JOEA 5KZCB 3S37X 4UOJA 4L9LA 1FFNB 4MNQB 4NKDA 4G5ZL 1BZ7A 4U7SA 4WHDA 1T2QH 4QEGA 4YBQD 2LVCA 3O4LE 4KMLB 4UIMA 1PQZB 4KKCC 3RI5K 1JHTA 5I18H 5HDBF 3LKQB 3EYVA 3NMEA 2HTLC 3SE8H 4YEEA 1J9CT 1FFQA 5C9JA 4HT1L 2F53A 4JO2L 2EYSB 1IL1B 4S2SA 1FV1A 3NCEB 1HILA 4GMSH 5HD8C 3ZHLA 4U0RB 1HDMA 1A7NH 1BBJA 1I9JH 3GBML 3MLSH 3PG2A 2DLFH 3MR9B 3DHJA 3I6LE 4EN3C 2NX5E 2X4TA 4Y0GA 1JZ3A 1VA9A 4E9LA 5D7SL 5TDOA 1SYVB 1FZMB 4LSDA 5E8DH 1IGCH 4LBEA 3VE0A 2OL3L 3T2NH 1NJ9B 4L4TA 4NO3B 1T03L 3U0PB 2FEEI 3BDYH 1GOFA 1CYGA 1LO4L 1T66D 3QHZH 1NCBH 2XTJD 4HXBL 3QQNA 3CVHL 2COQA 1HHIB 3RX5A 4ZSOE 3FT3A 3V6OA 3RGHA 1CU4H 3ZLQC 4ZS6C 1PG7W 3RVTD 1J88A 1HXMA 5FEBA 5D1XB 4OM0L 3RUGE 3WEXA 3UP1A 3PWVB 4DFIA 3ZO0A 5IW6B 1NGPH 2JCCA 3L9RB 4LPXA 3VRJA 3CDCA 3I75A 1W8NA 4Z76B 2OLDA 3RWHA 4OZFH 1KGCD 1IEBB 3O41B 4J8RA 4K23L 4Q2ZA 4IRSA 5JXAH 3SCMA 1OPGL 2IQ9L 4PYHA 4NQED 4UB0L 1VKXA 3OGOE 4RWYL 1AGCB 3IVKB 4PRIE 1RJLB 3CSGA 3LQAC 5ESVB 4MYWB 2XACC 4NJAL 4RNRB 2QQKL 2E9IA 2VDRH 4AK1A 1E4KC 3FO1A 4NQDD 1LE5B 3BRGC 5DI8B 1MJJB 4WRLA 1DLFL 4HIHB 3IU4L 4X8JA 2F19H 3H9SD 2BVPB 1BAFL 1ZVHA 2K1MA 4OZIF 3VFWA 2DM3A 2WUBL 1A6AA 2A83B 1UEYA 4MS8D 1R0AL 2L0DA 4ONOA 5GGQL 1SJEB 2P5EE 1MCSA 2DQJL 5GS3A 3U79A 1D5ZA 4WUUE 1OP9A 3EJZD 3AMKA 4J6RH 2F5BL 4UU9B 5FYKD 2Q20A 1TQCB 2FH6A 3KLSA 1JGDB 4HQQL 1BMGA 2VXSL 2HJFA 1NBVL 1X5HA 2RCSL 1U8LB 4OIBA 4NZRL 5ID1A 5AWNH 1RIVH 2EDWA 3MRGB 4X6EB 1PEZA 4RFOH 3IJYB 4PJ8A 1QD0A 4Y2DA 2R1XA 1YDPA 4QXUH 1KJ3H 4JQIL 3KYOA 1MCOH 2FIKB 4Y4HA 2AAVA 3V0VB 4KC3B 2B20A 5C08D 5IEKB 2YZ1A 3QUZD 1J87A 3MLUH 1BVLB 2V6HA 5F1IB 4BH7A 4KK8D 4NWTL 3S4SB 2EE9A 3CFBA 4EUPH 4WW2A 3EDFA 3TO4A 3QDME 4PTUB 3F7PC 1DQMH 3BQUC 2DIAA 2ZPKL 4IIQA 3UJTL 1E6OL 1ZT4B 5T1MA 4NPYB 1NC4D 4YHIA 4NO0A 4DZ8A 1T0NA 1CVSC 5I1IL 3HPJA 4G6KL 3TBVB 3ZTNL 4GS7C 1A6ZB 2EO9A 3HG1B 4OLZL 3S4SG 1X7QB 2OTPA 4U6VL 4XP1L 1OLLA 2W91A 4U1SB 1K8IA 1I8IA 4WFEE 4YDLC 1JCKA 5EIVA 3FMGL 5H2BB 1MHEA 2HJLA 3HCVB 3L7FB 5E2WL 4BK5A 5HVFB 2VB5A 3F7YB 4WY7H 3MLXH 4QTIL 2NY3D 1IFHL 4AIZA 3ESVF 4ZFFA 1A47A 1R3LA 5EO9A 5I1DB 1F97A 5EO1B 1S7SB 4D0DB 2P5WE 4HLJA 3P9MA 5EORL 2VLKE 2V5YA 4EN3A 4MCYA 2YMXH 5IJVA 2AXGB 2QADC 5HHMD 1KBGH 2L4OA 1MIMH 2VLME 4NC1C 4LPWA 1FNEB 1XCTA 3FOMA 1T7ZA 3BAEL 1GPOL 1GOHA 5D5ME 2DWEA 1J0JA 5CINH 2R1YA 3QCUH 4XPFH 1JWSB 4GG6E 1CFNB 4R8WL 5L88H 3P77B 5K59F 5CS7A 5E9DD 5FB8A 2YUXA 3SO3C 1ADQH 2IWGA 1T1WA 3DI3B 4HW6A 4Y5VA 4JFOB 2EDFA 4XBGA 5BMFL 5ICYB 2UWEF 1A6UL 3BIBX 5GS2H 2ZG2A 3CH1B 3C09C 1K5NA 1XZ0A 4HJJH 1A7BA 4QF1A 1UWGL 4Y19A 2IPKA 1OB1A 3QDJA 5F6IC 4YGAB 1EEYA 2VZUA 1D5BB 2VTFA 2J4WH 3QG6B 4XZUB 4NZUH 1J8HD 3QUMA 4QWWD 1GGIL 5D9SA 3GJEA 3GMMB 4NUJA 5IVXB 3FZUD 3IYLW 1RZ7H 1INQA 2LU3A 1GHFL 3DO3A 2E27L 2B1HL 2C4FU 3WJLC 4OLUH 2AQ2A 4HBCH 1YY9D 1QRNA 2Q8BL 4HCRA 4LAQL 1E4KA 1EBAA 1DR9A 1RZ8A 1HEZB 3GIZL 5IW1B 1DBMH 2ORBH 4HAGA 5F3HB 4OF5A 4JG0L 4OIIL 4X9FA 1LE9A 2W07A 3T3MF 2QL1A 1BLNA 2XXMB 5E4EB 4U1KB 3NZHL 3IJHA 1R24A 1BIIB 5BRZE 1O7SA 1RUQH 2BOBB 3G6AA 5DK0A 3LKOB 3D0LB 4W81A 4HEME 3KDMA 5DA0B 4M43L 3R8BB 3FB5B 1F2QA 5DJCB 4QRSA 3STBA 4N1EA 3FRPG 3F7RA 4KTEH 3ZKXC 1AE6L 2ICEA 3LEYL 2DBLL 4TTGA 2PN5A 1MQKL 2J5LC 3VCLA 1D6VH 3SDDC 4XCNA 2ATPB 3MUHL 1RUML 3IFOA 4Z7WA 3WIFB 5IFHH 1F3JA 2HAZA 2BXYA 4JJ5A 1R6VA 1A1NA 4ZS7L 4MD5B 1VB9A 2D7TL 1PLGH 2C3WA 3BQUA 3DUHA 3T4AA 5LQBL 2PYEB 2HRPL 2CDEA 1ZWIB 2ZZUT 2NY5L 4JY6A 3KPSB 5CGYC 3JV6B 1QHOA 2YPLB 3IETB 5L2KB 1KXVC 2A74B 5L6YL 5D8JH 3ULUH 3AGVA 2VDNH 2BSTB 4R3SB 1P4BL 5ENWA 4RZCB 3ULVF 4G42A 3O11B 4X7SL 2UWEB 3SQBA 4N90E 3BH9A 4PJFB 5DSCB 4X5WB 3EGSB 2EXWC 4CVWA 2LE9A 2NW2A 4MLSA 4GG8B 5HI3D 1DP0A 1T83C 4U7MA 2HKHH 5CJ8A 4ONFH 5B38B 2H3NA 4HWBL 5E2TL 5CJQL 4UT6H 3QIWB 1CS6A 3BHBA 5CP7A 3H8NA 4X7FC 5D93C 3UO1H 5B22A 4M1GL 1KXQE 1CXEA 3IFLH 2BVUA 3HAEA 5KN5B 4IOIB 4JN1L 4HS8L 4N5UA 2LQRA 1R3KA 4MDIA 3X3FL 3MA9H 1WFTA 2Y7QA 4JDZA 1BGXH 2J2ZA 1B4JL 5F7LB 5DUBB 1IGJB 3DVGB 5B38G 1GZPA 5HHOA 4APQB 2BSRA 2R2BB 1GAFL 1LO5B 1TVHA 4I77L 2B2XL 4KGLA 2AS5M 1UWXK 2OZ4L 4LHQB 4DKFH 3CUPB 1H3TA 4I18B 1CD1A 4GXVH 4GBXC 4EBQH 1OARH 1B0GA 4UV7H 4YE4H 3LKSA 4J3TA 1Q9OB 3V4PH 4PJ9D 2X4SA 1UB6A 2XN9A 1NUDA 4PRDA 3P4OB 3PDDA 4LRIA 3FQTB 3OKYA 4F7EA 3HNSH 4LDOB 1ZAGA 4NWUH 2NX5A 1IM9A 2D7QA 2GJ6B 4LLMB 1A7QH 4M6MH 3ZDZE 3KYKH 5DRXB 3OKKB 3FT4A 4MXQC 4RRPA 4C56A 3T0EB 5KTEL 3P4LA 1FZKA 4ENEC 3OR7B 3QI9B 4PD4J 3B3IB 1HI6B 1UH3A 3WJLA 3E6HA 2O61A 3JWDH 3T8XA 1ERNA 1AIFB 2VABA 4ZSOA 4N8VG 3FFDB 3FN0L 1NGXA 4NHCH 1RZIA 1XGRB 3LB6C 2P42B 5DJXA 2DQTL 4GW1A 3N85H 4PRBA 4HUVA 4KQ3H 4MNQE 1YYLL 1MCWM 5FHAH 3QFDB 2ICCA 1MFAH 5FYJD 3O2VL 2Y5TB 2AGJH 4LGRB 4EDXA 3KNBB 2IANE 2XI9A 3PQYD 3O6KL 3MFFB 4PRIA 1VFMA 1P1ZA 2HTKC 5GSVB 5IB5B 1FO0H 1A4KA 4XB8A 2C26A 2YBRB 4HHAA 2WUCH 3FFCB 3DIFA 2CLZA 4LRNH 4M3KB 3SDDA 1MEXH 3KPOA 2IALA 2YKLH 3RWGA 5F88B 4OQTH 5DD3H 3BP4A 3LRSA 5C0IB 4FQIH 4XVSL 4LKCB 1IQWL 3MGTB 4R0LC 4JFZL 1X4XA 2IC2A 4LVNC 1GGBH 1FLRL 4G8GB 1MCPL 1HOCB 2W9DL 4FXKA 1DQQB 1MFDH 3P4MA 4F33A 1LVEA 3VGAC 3UPRB 1DVFC 2P5EA 2NR6D 4FQXD 3RI5F 3UCRA 2AK1H 4NFDA 5E5RB 1EBPA 1JFQL 3MLVL 5D7JB 3U4BL 4LMQI 2VWEC 2IFFL 3UTZA 3QUXC 4LK4A 4LKXB 3T0VA 1FNSL 4PR5B 1WBZB 4F15B 1QLEL 4JZOB 1T3FA 3W5NA 2AEQH 3RWJA 1ZHBB 1BD2A 3JWOL 4K8RH 2VZ3A 1XAUA 1XR9B 5EBLB 5IB1A 1MHCA 3KWWB 1K8DA 1T83A 5JHDE 5A40E 1HH9B 4QXTA 2NZ9C 2HT2C 5AYUH 1CGTA 2R2HA 2XRAH 3GHEL 2Y1VA 4JRYE 1ZT7A 1HYSC 4I8DA 3B83A 4OGXH 3RKPA 3Q0HA 4TVSa 2IBZX 1RK1A 2D3VA 1ZGLP 4NRZB 3CX5K 1JNNL 3GI9L 4QHLB 1AP2A 4JPKH 3SKJL 1S7UB 3OTTA 3N0PB 3NH7H 3IAPA 1JHKL 1AXTL 4K3DL 3C5ZC 1JTTA 3K7UA 1HQRA 3CX2A 4MVBC 5C8JA 1MRCH 5JQ6H 3U0WH 5HGAB 1T21A 5GGUB 4JCLA 5CSBA 5EZIL 5GHWL 2IH1A 3GB7B 4GBXA 2GITB 3L3HB 4OGAC 1U42A 3MODH 5IR1A 4WU5A 2VJXA 5DFTA 1UZ6F 1NEZB 4P0DA 5DUMH 5C0RL 1Z6JT 4X9BA 4DVBB 4OCRH 1F4YH 1FYHB 1GVIA 2OCFD 4WHYG 5EC1B 5HDBE 3MNVB 1I1YA 2AJ3A 4R4BB 5I1CH 3V4VH 2P5WA 3RL1B 2VDQH 3D85B 1XF3A 2DIBA 3L5XH 3G9VA 3BD3A 1OGTB 1NEZG 1HIML 1UM4H 2WNGA 1ZKAA 4PG2C 3DV4B 1Q1JH 2Y06H 3N9GL 4MB5A 2Z35B 5BVJB 3RY5A 3GFUA 1OAUL 3KJ6H 4Z6AT 5SWZD 2FLBT 2WQ8A 3ZKMC 1RJZB 4LHUB 5DD6A 3IRZA 5IQ7H 4JHAH 1CQKA 5J6GB 3BJLA 4OQ1A 4JHWH 4ZAKC 1I7TA 4XVTH 3TZVB 4IRJA 2VQUA 3W11C 1JPGA 5DQJA 3MREB 3WUWA 3PHOB 1TNMA 3RRQA 4J3OC 3EKCA 4XI5C 2E9JA 1FP5A 1RI8A 2X40A 4ZFOB 4LHUG 5D2NC 2FBJL 5EN2B 4CU8A 3OAUH 2FB4H 3JSSA 3DSFL 1JGEB 2EDKA 2DQDH 3KPQB 4DTGH 4Q9RH 2KZ1B 4OLWL 4LU5L 4XAKD 3R1GL 3ZT7A 2M2DA 4TNWK 4UOW1 4Q6YA 5KS9F 1LD9B 3SKOB 1A1OB 5KW9H 4LLWA 5TFSL 4RISL 5D7IA 3LCYA 4OD3H 5DMJB 3BIAX 4FQCH 4MD0B 1WCBA 2IAMB 5FHBH 3MACH 4G8EB 2CKBL 1A4JA 4GMTL 3CAFA 1NFIB 2VR4A 4UNUA 3MA7B 4BFBD 2VL5A 1RFDH 4XRCB 3LHPH 2DQGL 3EJYC 1A2YB 4NO5B 1UKTA 4L4JA 4MNGB 4OV6F 1MNUL 4QGTA 3QIUD 4JM2A 2PW1B 3BEVB 3TBSB 1AKJB 1T5XA 4R0LA 2B39A 4JKPH 3LN4B 2QHLA 1L9NA 3CFEB 4JGJA 4NQSB 4NT6A 3S9DB 1I8KB 4Z18A 1DBBH 3CPLB 4LPYA 1DVFA 3D6GA 4NNPH 4OZIE 3GJFH 1Q9WA 2XWJB 1KCSH