3Q6GL

Crystal structure of fab of rhesus mab 2.5b specific for quaternary neutralizing epitope of hiv-1 gp120
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
209
structure length
209
Chain Sequence
YDLTQARSVSVSPGQTARVTCGGDNIGSKSVQWYQQKPPQAPVLVMSADDERSSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSHHMLFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVEVAWKADGSAVNAGVETTKPSKQSNNKYAASSYLSLTSDQWKSHKSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Human and Macaque mAbs 2909 and 2.5B: Implications for the Configuration of the Quaternary Neutralizing Epitope of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Light chain of Fab of rhesus mAb 2.5B
total genus 47
structure length 209
sequence length 209
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q6gL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q6gL01
4KFZC 4MCZB 4BSWB 5I2IB 1TJGH 1CLZL 2YPLB 1HEZA 2MQ0A 1XGTA 2D03H 1CFSB 1I1CA 1FO0L 5FXCH 4BZ1H 2EYSA 3HLAA 1WFTA 1E0OB 3SE8L 2PYEA 1OTUC 4Y5YC 5D93B 2IAMB 1MJ7L 2NY5H 4QYOB 3RX7A 1GGBL 4FQQB 5B3NA 2BVPB 5C0CB 5F8RC 3RL2A 4P3WA 4NQCE 1OQXA 3P4MB 3DV4B 5DS8B 3D87B 4L1DA 2CR6A 1WITA 1T2QH 4X0KB 1WEJH 4DCQA 1QSEB 3LEVL 3KPQB 1OVZA 3DIFB 5DEGB 4K7FB 1I1AB 1ZTXH 2WWMC 5E6YA 4JY6B 5L2JB 1HXMA 3V0VA 2WINA 1KLGA 2GW5A 1FV1B 2FWOB 3U6RB 1CT8B 2CDFB 3N85H 3WLBA 1KBGH 3HE6C 2FSEB 4HULB 2YR3A 4PB9L 3T65A 1BBDH 1QSFD 3C60C 4HQQL 5KJRH 2ATPA 2DJUA 3H9SB 3QDJA 3K4AA 1O7VA 4UTAL 2PO6B 2QHRH 2DJSA 1CVSC 5C2UB 4JFFB 3BZDA 4QF1A 2DYPD 4Z7VA 5DO2C 3V5KA 5JNYA 6FABL 4O9HH 1QZ1A 5E2TH 4NP4H 2OR7A 3N9GL 4XPFL 4X6DF 3VFMB 4NRYA 3EJJX 4G8GE 2ICWB 3PGDB 2DYPA 1JNJA 5CJQH 1FZOB 1EEYA 2PTVA 3PP3K 3U0WH 3QDGB 4LDOB 3SJVA 2CJUH 5EN2A 1KT2A 2XV6B 2OL3L 1LE5B 2AKRB 4NRZB 1QLFB 2GSGA 4PJFB 5L2KA 1X4XA 3JVGA 32C2A 1ITCA 1Q8MA 3JTSA 1QA9A 4APQC 5LQBH 5EIQA 1RK1A 2IFFL 5C6WH 5IVXB 2X89D 4Z7WA 4LCYA 4E41A 4XP1L 3K2UH 4IIQC 2QHRL 4M1GH 5C71A 1NPUA 1XR9B 4L9LA 3OAZH 4LIQE 1EZVX 1EK3A 2IADA 1OAZL 3U36A 5JZ7D 1BIHA 4FFWC 3GMMB 3QUKB 3QI9D 4DGYL 4AQOA 1TPXB 4KKLD 2ZG2A 1IL1B 3BGMB 4FQJH 1SJEB 3DVGB 1LNUA 5AYUH 5I71B 5HBBA 2X7LB 4NN5B 4CU8A 3OG6B 2QADB 4FQIL 1ACZA 2ZCKH 1NCUA 2BSRA 2FO1A 4N0FA 4GLRH 5F71A 3TT3H 3MMEB 3PL6D 1YN6A 1UG9A 2DQGL 4I3RL 1IJ9A 3I2CH 1CGWA 4JM2F 1J87A 2P48B 1JPST 3LSOB 4LPXA 2G9HB 3L5WB 2VXUL 4QRPA 1G0DA 1MH5A 1OAKH 4MNGB 4PTTA 3RWFB 5KVFH 4IOFC 5D96C 4Z7UF 4NZRH 3VFRB 1A7PH 4JN2A 4OLWH 5I1KL 1FZKA 1GSMA 4HWUA 4IRZH 3SOBL 5EORH 3VXUE 5F7HA 5DQJB 5F96L 3CIQA 1FG9C 4JJ5B 3MRNB 4XAWL 1NFIA 4JFHE 5IVXE 4P57A 1NGZA 1AGFA 1T2JA 2HT2D 1XGUA 3MNZA 1KIRA 4YGVB 3FB6B 5DJDA 3QXVA 4MD0A 4WUUB 4KHTH 1NEUA 1X5FA 1K9TA 1SY6H 3IXTB 2E9JA 3O0RH 4UQ3A 1D9KD 3ARTA 2WK2A 5C2BL 1GGIL 2ZKHL 1R3LB 1BFVH 3TP4A 4RQQA 4P4RB 5J6HA 3VFMA 4ZPTB 4X4XB 2MHAB 2B4CL 1VACB 2BVTA 3LEXB 5T1DH 3LSOA 5A40E 1UH2A 1KCRL 3U46B 4OCYH 4I3RH 3TJEH 5I1IL 2Y5TB 3B9AA 3X3GH 1IM9D 1PKQB 3MRMB 4YXHL 5I6XC 3T04D 5LWYH 3PG2A 5HDBE 1YZZA 4Z7UE 3HCVB 3QHZL 5ISZE 1FL5B 4S0SD 3QQ9C 1B4JH 3VFUA 1NEZG 1I1YA 3S37H 3DXAE 5KW9H 1FFQA 4LSSL 4OGAC 1AHWA 4MWFB 3AB0C 4ODVH 4PJGA 1QBMH 1FH5L 4JAMA 1F45A 1TVHA 4U1IA 1A6WL 2HFGL 4YR6B 2VXQL 3TM6A 4DN4L 5D7JD 1JRHH 2AVGA 4XPGL 4F7PB 2OQJA 3ARYA 4F8TA 5J7CC 5FB8A 4XTRC 2VMFA 2AJSL 2H2PC 2NNAB 4YH6A 4IRSC 2YD1A 1KT2B 1NANH 4R7NB 4LVNC 5GRVL 4ZPTA 5F97E 5E9DE 4RMTA 5C0CE 1EGJH 4EIZC 5CEZE 1VFBA 1QPXA 1OTUD 1J1PL 3HC3H 4FQJL 4JQVC 1MIMH 4CN6A 4NC1C 3IDIA 2NYYC 1IARB 2FBJH 4M7JH 1NAKH 3MNWB 2NY2D 4O2FA 1C5BL 1XT5A 1FPTL 1HOCB 2DQEL 1I9IH 1IC7H 1YPZE 4XNQA 4LIQH 3RKDD 1RMFH 4N0UE 1CG9A 1DUYB 1YDPB 3RVTD 4DN3H 3O81A 1ZAGA 5E2VL 3T2OA 4XNMB 5ADPL 1Q9OA 3TA3D 4IOSD 3PIQB 5TDNB 3IFLH 2HFFA 3S35X 1OAKL 4WEUD 5KN5A 4P46C 5CGYC 4QY8A 1KB9K 2NY7H 4ZD3H 3VWKC 3VU2A 4UAOB 4GG6B 3P30L 5IB1B 4JFOB 5EUOA 1WF5A 2VLKB 3BPNC 2FEDC 1U8PA 2DQDL 5IT2H 1A02N 5GIRB 4TPRH 4J6RH 3X13A 4NWUL 2NXZB 3WMSA 5ACZA 3DVNB 4XP9H 4KRPD 3V6OA 5DA0B 3TBWA 5B38A 2DQTH 5E00A 1VGEH 4NBYB 1S8DB 4ONGL 3L3IA 1P4IL 1DUZB 4WFFD 3K74B 4Y5VB 3WFHB 3SQOH 5DC4B 4UILH 1I7ZA 3CK0H 1HNFA 4L8SB 2RCSH 1S5HB 1S7QB 3ARBA 1BVLB 3S3PA 4NGHH 4HF5H 4P9HL 3PABA 5HHOE 3BZFB 3QEHB 2VB5A 4JRYD 1XGTB 4FG6C 1FRGL 3QDAA 4RWYL 3O2WL 4OLVL 5IMLA 2Y36L 5IJVB 5EUOB 4OM1L 5D7IA 4ZXBA 1IBGL 5GS2D 1IQDB 4FA8A 1X4ZA 4X6DA 4I18C 3AAZB 4PJEA 1WC7A 1QLEH 5DVMA 3CFEA 4KDTA 1CD1A 1BQHB 1N0XL 3PV6A 4LCUB 5F3HB 3EFFA 1AGDA 3D3VE 1PSKH 3JUZA 4APQD 1ZA3B 3WEXA 5I18L 1U2CA 3VD5A 4Y2DD 5GISH 3IFPB 3O4LE 4YHPA 5CD3A 3UPRB 1WBZA 1DVFA 3RZCD 3OXSB 2AS5M 3MV8A 3W9DA 1T3FB 1OGAE 1BGXH 3JWDH 3ULUL 1R3HB 3T3MF 3SBWA 4X80L 1WZMA 3NFPA 3QWQB 2RAMA 1KJMA 3ECBA 3MUGA 3SN6N 5ILTL 1J1OL 2E3VA 1A4JA 3QUXC 4P2RD 3REVA 1EUTA 1D9KC 4L1HA 3WFEH 4MB4A 3ZYIA 3KR3L 1AO7B 3PL6A 1ZLUH 1Q94A 4X0KA 3WIIH 4DVBB 1KXVC 4L9DA 4NQEB 1AQKH 1JHLL 5IROA 3VG0H 3KNBB 5JMOC 3CFJA 1KACB 4O5LL 4WI3A 3IU4H 3ROLA 3PWPD 1C1EH 4GJTB 3KPRA 3VXOB 5I9QC 1CU4L 4PRIE 3BMWA 3TO4C 4ODUA 3RWDB 5ITFB 2AJXL 5T3XD 4WO4C 3NIDE 1RU9H 3S98A 2W0LA 4U33A 3LD8B 5D1QB 4F37F 2PW1A 3ME0A 1HINL 2YMXH 4JFZH 5D1XA 2H26A 1ZGLA 2VKWA 2NLJB 4NKMA 25C8L 2CSPA 5DUBA 3OB0K 4LEXH 5D7LD 2ESVD 3PHOA 3DBXA 3IU3A 4WWKB 4PB9H 4OF6A 3BT2L 1QRND 4OLXH 2YWZA 4CL7A 1E6JH 5FKAA 1CL7I 2RFXA 3QIUB 2P5WD 1RSFA 2FIKB 1BFSA 3OAUL 4AM0A 4PY8I 3HG1E 2AABL 2UWEE 1SBSH 2D31B 3OXRB 1RURL 5I1GL 5ALCH 3GSUA 4EDWL 4GLRI 2IPUK 1X5KA 1GGBH 4HIXL 4P3CL 3RNKB 4DK6A 2XY2A 3GRWA 4JG1H 3GHEL 2ADFH 4XTRD 1LE9A 1HHGA 3MRFA 4L4TB 2LV4A 3SCMA 3R1GH 4PJ8C 1LGVA 3VFNB 3C9NA 4HCRL 2G75A 2X4SB 3VXSD 3S97C 1SYSB 3GMMA 1KEGL 4PG9B 4QRRA 1M7DB 3WN5C 2XG4A 4R3SB 4P23D 3R8BB 5I1HL 3F5WA 1UKTA 3WKML 4OBSA 4MXWH 5EZIL 3PHOB 3ZKXB 4CADB 5AZEH 2B1HL 2BY0A 5FYJL 1INEL 1XF4A 4KTEH 5A2IH 5JMRA 1NAMB 1U6AH 2QR0A 4ZXBD 2WZPD 2OJEA 1FJ1A 5E99H 4JZOB 3SKMB 2CPCA 4LFHG 5I71C 3OWEA 1INDL 5EO9A 1WZ1H 1MJ8H 2PTTA 5T5FL 2B1AL 1NL0L 3UJTL 4F7TB 2NY0C 1Z6JT 5I9QB 5GSVA 5HI3C 3OHXA 4NZTH 3C5SA 1FL3A 4AEIH 5FA4B 4YHKL 4I0KA 5L7XL 1JHLH 5KSAC 1G7LA 3RWCB 3QWRD 5MEPA 3O6ML 4YDVA 4KWUA 3TZVB 3SDXA 3QJFB 1EVTC 4X8JB 2NY3B 3EHBD 4M1CC 4H1LB 5C0JA 4BUHA 5SWQB 1MCSA 2F53D 2V2WA 1MCJA 2IALA 3RDTD 5H37H 4ZFFB 5C3TA 2E7CA 2VLJD 2V7NB 1UM4L 5KVGH 2J6EA 4P2QB 4LGPB 3MQIA 1LDPL 4MQ7A 4P23A 3T8XB 1DEEA 4ZNEE 4CNIB 5FECB 5CJOL 2BCKA 1RU9L 3QXDB 2DKMA 3LEYL 1XFPA 3QUMH 2V9RA 5I73B 1UJTA 1JGDB 3BO8A 3ULUH 5DD0L 1I3RA 2FX9H 1G9MC 1NKOA 2NNAA 2HTKC 4NPYB 3S3SA 5HJ3A 1PLGL 2CMRL 2VXQH 1BVZA 1JFQH 1DBMH 1S7WA 3MOBL 4DWHA 4POZC 1E4JA 1W72L 5JLZA 3MLZH 4OD1H 4LCWE 4KVNL 1GOFA 4Y16C 1S9VA 5A2FA 1F4XH 3SO3C 4Q9RH 2UYLA 5DLML 3MLRL 1FNEA 2BNQE 5HVWA 3FOMA 3DTXB 4NDMB 3VXQB 5IQ9A 1JNLL 3HCVA 1MIEH 1R0AH 2V7HB 1AY1H 4KKLC 2PR4H 4LSVL 1YEDA 3GHEH 2DYPB 4GRWH 1U8KB 2XWJB 3EIFA 1V05A 3T0VA 4LQ1A 4X4XA 2JJSA 1AH1A 1IAKA 4R26H 5HHXL 1G9ML 4NM4L 2VZUA 3DNKA 3HMXH 2OTUA 3EOYG 3K8MA 2PW2B 3LIZL 4Z0XA 3VXRA 5BOZG 4YIQB 1F4YH 3RZCC 5GJTL 3KYNA 4OZIA 1NC2A 1HK6A 4ZTPH 5EOQH 4NNYB 1JI2A 1VFBB 3QUMB 4PJXF 1IAIH 3Q5TA 3VDAA 5HGDA 4U6VH 5EFIB 3SE9L 2HFFB 4OT1H 5EO0A 2V17L 3VFTB 1PVHA 3DRQB 4EI6A 2HFGH 1UYWH 1GHFL 3RTQC 5E08H 1ORQA 4X83A 2OQJB 2QEJA 2C5DC 1U8QB 1JYXA 1T1WA 1I8MA 1JYVA 2EZ0D 2W65B 2RR3A 1N64L 5K9JH 4U1SA 2NW2A 1QP1A 1PJ9A 3TA3A 3W5MA 4P5TD 4DKAA 4UZGA 1C5DB 4XNXH 1YN6B 3EDFA 4FFYL 3GSOB 2E9IA 1T66D 4GRMA 3BP5A 3MRJA 4F37K 1UJ3A 4BFEA 5GGTL 1E4WL 3DTXA 1KCRH 4JHWH 2EIBA 3QUML 2A0LC 3GMRA 1ORSA 5SWQA 3QT2A 3QDMA 3IDMB 4RAVB 3O2DL 9CGTA 3I85A 5DQJA 2GJJA 5DVLA 4GRLD 1N8ZB 3RHWK 3GSVA 3ZYOA 5M95B 4A6YA 4L4TE 3BKCL 3QUXB 4X7DC 4QRTA 4N0CD 3C5ZA 1LWRA 3DI2B 1X6NA 1J0ZA 1NMCB 4ZSOE 3MYJA 4RGMC 2P8PB 3BEWB 3QG7L 2KKQA 5JW4N 1ZE3C 3O6MH 1LK3L 3MUZ1 1L7IH 4ONHB 4PJXB 4AT6A 2FO4A 4HPYL 3HI1A 2BSSA 5L6YL 5C08B 2J5LB 1IZJA 4X8XA 4R7DA 3FZUD 2IBBA 5JOFB 4QHNA 3CK0L 1B0WA 2X05A 1R0AL 4HG4J 5FF6B 4WI4A 3F7YA 1DN0A 4YPGA 2V6HA 5EU6E 3U30C 5BJTA 2PYFA 4GKSA 5KVGL 4HKZB 3QNZA 4WW1B 3WDJA 1OOAA 1KULA 4HH9A 2MNUA 3DETD 1FYTD 4OCRL 1AQDB 5GRJH 4PJIE 3RJDA 3BI9X 5IG7B 3WNPA 1YEIH 4B5EA 4ZPVA 5ICYA 2P24A 3HZYA 1NGZB 4RRPG 3SGDI 4JFFE 2P8PA 4KVCH 2Q6WB 3WS3A 4QOKE 1CXHA 4K8RD 3MV9D 2W0FA 5CEZD 5E8PB 3FFDA 2H6PA 1F6FB 4JN2B 3U82B 4QRSB 2HLAB 3WFCL 4PJDA 1BZQK 1KGCE 1VACA 1P7KB 1U8NA 2OTWA 3D0VB 2EYTB 3WHXA 5GHWH 2GFBA 1BFOA 4FQXB 4LKCB 1XGQA 5KS9B 2OMBA 4C56A 3EO1A 2NY1C 3DARA 3IAGC 2ICWJ 1MCDA 5DRWB 4ELMA 5E8EB 1CBVH 1KELL 4K7PH 5E2TL 4PRPE 2LU4A 2YMXL 3BKMH 4JFZL 3U9UB 5DR5L 4LVOB 4JFEE 3E0GA 2FIKA 3ZLQC 1NGQL 5D1ZC 4JKKA 2YRLA 3CDFA 8FABA 5AUMA 1XGYH 5LGKA 4WI9A 4MSWB 5I1DB 2YSSB 2JJTC 1MY5A 1UQSB 5E7FA 5IVZB 2R0KH 3UJIH 4Z7NE 1RHHA 4JANB 4X7SH 3AS2A 2AAVA 2H8PB 2GTZB 5JXAL 4FZEH 4J1UB 2ICES 5HHMD 3VJ6B 3ULSA 1CE1L 4PJBB 1DLHA 1U0QA 1N64H 5K9JL 1VKXB 1EJ6A 3ULVE 1J5OH 2F58H 3RPKA 2F19H 1BHGA 4J4PC 3MV9E 5C07B 2VLRE 5IW1B 1P7QD 3BMVA 2GCYA 1S7UA 3GSRA 5D2NA 5KG9B 4XPHH 5E8OA 3RWEB 2QADD 2LTQC 1Q72L 1E4KC 5IGXL 1U93A 3T0EE 2VDRL 5JQ6H 5F7NC 3LKQA 2K1MA 4LSDA 2X4QA 5F1IB 4R2GB 4X80H 3MCKB 4Y1AD 3MJ9H 5D2NC 2ADIB 1E4WH 4JHWL 3L3JA 4I3SH 1IQDA 2ICWI 5E9DD 3KXFD 5IKCB 1YNLL 3VW3H 3GSNH 3Q5YA 1AE6L 4KDTC 5T1KA 3WJLC 2F54A 3VD7A 2FSEA 3R8QA 4RNRB 4JCMA 3BT2H 2Y1VA 2WLZA 1FVEB 1BWMA 4K9EH 5C0AE 2HKFL 4HUUB 3HRZA 2EDFA 3MRKB 1JNNH 1J8HE 4Y5XA 5CBEA 4M1GL 2J4WL 1JZ8A 4QXGH 3HKFA 1NFDE 5IW6B 4B53A 1RULH 4K7FA 3ETBF 1OD7A 3T0XA 1D5XA 3GSQB 3BD4A 1MOEA 2DICA 2DDQH 3QDHA 1F2XK 4MNQA 3VGDA 2ZCKL 4XH2A 3VI4E 2X70B 1T0PB 4PGBB 4MXVE 3GIVA 5HI5D 2NX5D 3T0EB 3MRPA 2CD0A 2A73A 3TFKD 1MLCB 1P4BH 1TIUA 1UEMA 3S36L 2D7NA 3MNVB 5C0DA 1S7VA 4NBXB 4LKCA 3EHBC 4I3SL 2P5EB 3RUGA 4XBEH 1EAPB 2GUOB 1O7SA 1FYTE 1MCPH 3QA3B 4CVXA 1QVOA 2EICA 1CLYL 3OJDB 1J8KA 3EYSL 3EKCA 1G1CA 1YJDL 3EDDA 3X13B 1VPOH 1LDSA 2DQCH 1NJ9B 3CXHJ 5GGUB 5F9OH 2XPGA 3TYGH 5HD8C 1DN2A 4OZGB 4ZS6D 1ZHKA 2DWDA 4C4KT 4MNHB 2HT3C 5IMLB 1F4XL 3W0WE 3FZUC 2HTKD 4OIIL 4OLYL 5KOMC 4OKVA 3NH7H 3VI3F 1EBAA 4WWID 2VAAA 4FZEL 3RPIA 3RY6C 3D39A 4JM4L 1XCTB 1OM3L 3GFUA 5K9QI 4G8EB 3GSNB 4PJ9A 4WV1A 2APBA 3RWFA 1LO2H 3OQ3B 5IB5B 1Z9LA 3UTTD 2YPVH 4HFWA 3BJLA 3MJ8A 2NZIA 2LE9A 3HG1B 1IC5H 3D1MC 4JFDE 2H32A 4X98B 3OKLB 4ONFH 1TJGL 3I02B 4K7PY 4GKNB 5DC9B 5DJYB 1UM4H 1F4AA 4RRPA 1E6OL 1GGTA 2E7BA 1JPFA 1A6UH 4Q6IB 3V7AE 3WIHA 3LRSA 4JQIL 2W60B 5E7BA 3SY0B 4V2BA 1D5MB 5KAQF 2MCPH 3HUJA 4AYFA 3GMLA 1WWCA 4LAQH 5F1NA 4JRXD 2PO6D 2N1KA 2W92A 2X4TA 1NEZB 4DQOH 5FYJE 2BVOB 2P7TA 4GG6E 2CIKA 1GGCL 1BIIB 2IGFH 1BVKB 3WYRA 4TNWF 2RHEA 4LVNB 1HSBA 4Y4FD 3NCMA 3NIDF 1YC8A 1GZPB 4JDZB 1KEMH 4RCAA 2QL1A 2V5RA 2OL3A 2JB6B 4MS8C 1VGEL 1H3UA 1TTFA 5IMKB 4G7VL 3CD4A 4M7ZC 4OKDA 4U4BA 5E5MA 4KK9C 1QEWA 5F7UA 5DJXA 3SPVA 3I6LD 3RL2B 2VH5L 1HSAB 1KPUB 2ED7A 3B9EA 4TULH 5K9KA 4Z5RA 3LS5H 3SE3C 4F7PA 1YNLH 4IJ3B 1Q94B 3VW3L 2Z31C 1UACL 5DJ0B 4PGJA 2P8LB 2XTJC 3TJHD 5DJDB 5C08A 3W39B 2CLZB 1U3YA 3UTOA 5BQ7A 1EMTL 1RJLA 1KPRA 2YPLA 4PJHF 4PS4L 1EEUA 1T7ZA 2UUDH 1R5WB 3T2NH 3NOIA 4F7MB 2AEIT 1CGVA 3PWNA 4XPBH 4R4FH 4U2ZA 1MIEL 2R4SL 4G7YH 1PEWA 5DMKB 4MAYD 4JLRB 3JVGC 3HNTH 4OZFH 2DLFH 4WNQB 5D1QD 1LO4L 1DN0B 1DUYA 3QISA 4QOKD 2VZ3A 3WV0A 2HVJB 1FFOB 5HGBA 2FX7H 5J6HB 1F11B 2L7JA 4MD4B 4ODWA 3B83A 3UDWA 3KGRA 4M6MH 3WE6A 12E8L 4BYHA 2AJXH 2OL3B 2FNBA 3S4SG 4YFDB 3EYSH 4IRSB 2FD6H 1EGJA 1I7RB 1K4CB 3HPLA 4Y88A 4L8CB 1BBJB 3NZ8B 1XF2B 1KPRB 3QAZC 1U95B 4HKXA 1N59B 4HXBL 2IQ9H 2BSTA 4HWBL 4JO4L 5E1AA 4HFUH 3GHBL 3AC0A 4LPTA 3UYOD 4P99A 5IMMB 1N8ZA 3GSVB 4NSKB 1Y0LB 3UEZA 5LJYH 2MCPL 3WIFB 4OZHE 3V95A 3HZKA 4KQ4L 1KJ2L 1XEDA 1K6QH 3EZJB 1X6LA 3V5KB 3SY0A 5JNYB 5EBLB 1RZFL 4OFVA 4IIQB 4ZFZA 3B9VA 5CD5C 4R4BB 1PG7X 3ILPA 2ZNXA 5MENE 4P2QA 4XNYL 4UV4L 4MQ7B 1JNLH 1S7RB 2OK0H 2ZUUA 3H9SA 3RIFK 1KJ2B 1JL8A 1GC1C 3OKDA 4UU9A 3WE6B 4FQXA 3MACH 3ULUE 1T0MB 1TCRB 5IHUL 3T0EC 5DTFB 3PWUB 4NZUL 4KY1H 2PF6A 4XXDB 3MO1B 2VDPL 4GAGL 2NTSP 3BUYA 4OFKA 1PYWA 5B39G 5FM5M 2YKLH 3MXVL 5ID0B 4X6EA 4FG6D 4U1GC 4O4YL 5B8CA 2HJLA 4MZ2A 4ORGB 2EEAA 3DLQR 4JREC 5FUCE 3MLSH 1TJIH 4UTBH 5FA4A 5EO0B 5TQ2H 3MRDB 3CLFH 1IGYB 5T1MB 1NLBH 4F7MA 2I07A 2A74B 1U8JB 3PGFH 4Y2DC 1A7PL 4P5MA 5I1KH 5FM8A 5I19H 2B2XH 3MLVH 3WUZA 1YNKL 4I48B 1A1NA 3IGAA 4OT1L 3OKKB 1H9VA 3S96B 3LH2H 5M7QA 3IS0X 1DANT 4OLUH 3UC0H 2EKSB 3UTPD 3IETA 1CICC 4JM2A 5C0BD 3C2SA 1EXUB 5D1ZB 4X99A 3MRRB 5HVHC 5CMAB 1CLCA 1A9BA 1WVZA 3G5ZB 4LLMB 4M7LT 4NO2A 1WIUA 3FQXB 3O3AA 5JHDD 2EDEA 3CXDL 1KLUB 3STBA 4TSCL 3PWUA 3S35H 1UXSB 2XXMB 1HXYB 4PTUB 5KSBF 5IHLB 4LOUD 5HYJA 4M48L 3CPLB 3TNMA 5I8KH 4K3DL 3VXSA 3HNSL 4E42A 5FDWA 4XMLL 3FT3A 4WVRA 3MJ9L 2Y23A 3NCJH 2XKSA 1CD8A 2FH6A 4DGIH 2WMPA 1BLNB 1OWWA 2Y6SD 1AFVH 1FL6B 2ZPKH 3FQNB 3V5DA 3GJFA 1TQBC 3QHFH 4UT7H 2XN9D 2I9TA 3LS4L 3CVHB 4U0RB 3MV9B 5D7LA 4DN4H 5C0FB 5GGRY 3RGVB 2PW2A 1YEIL 4TNVK 3OGCA 3VWKD 1ZA6A 2BY2A 1J1XL 4LLAA 3KYMB 4KRPC 4U3HA 1CE1H 2XN9A 4M8QA 5ISZB 1B6DA 2C3VA 2LABA 3L3OB 3OR7B 3VFOA 1XF2A 4PJFF 1IC4H 4ZAKA 3HNTL 3L5JA 1C12A 1DE4A 3CFBA 1Q0YL 1KIUA 2X4UA 1TXKA 1S7VB 4ISVB 2OMNA 3GEWB 5D1QA 3S5LB 3DO7A 3IB4A 4ZAKC 2EDBA 1WAAE 2BVUA 2KQNA 3TH2T 4EJ1C 4DUVA 2OK0L 4E9LA 3C8KB 4QRRD 1MFDH 2VLJA 5I1LA 2VQTA 2X42A 3BPOC 3DMMC 3ZKND 4LIQL 5CCKL 4P2OD 3NGBC 4YQXL 3WLWC 5ICZA 1M05B 2X9YA 5AWNH 3V5HA 2QSTA 2GK2A 3P77B 5D2LE 4XWGL 2IQAB 3MNZB 1BOGB 4PREA 4LSTL 1IKFL 5DRZB 25C8H 4P2YA 3DROB 5JXAH 5DC0A 2AJUL 2DQDH 2ARJA 3KPNA 4HK0B 3H3KA 5LGJA 5GS0L 4OCMC 5H8DA 4G6JL 3UJIL 1KN4L 1MNUH 3P9MB 2CDEB 4TTDC 1MJ8L 3QXUA 2NYYD 3EYVB 3NA4A 4GW5A 4PRNA 1ZOXA 1JZ5A 1KTRL 4QCIA 5I76A 5J3HC 4PLJD 3T1FB 3WFDL 4OD2B 3PE9A 1UXWB 2MCG1 2VLJB 3GJFH 5I1LB 3G6JF 3TH4T 4PJGF 5SX4H 4PJIF 4L3EE 2Z92A 3FT4B 3ULVL 3I02A 4NHCH 4ESKA 2X70A 1FPTH 4NQDA 5ETUA 4G6FD 4OZFA 1T0NB 2YKLL 3MXVH 1H3GA 2FJHA 4QXUH 2VQ1A 4HFWB 1CIUA 2FLBT 5A2JH 4GS7C 1J18A 5TE6L 3L7FA 3TT1L 4Z78A 2YD2A 1MI5B 1IVLA 5FKAB 3LN4A 4JDVA 4Y5YA 1FDLH 1QO3A 2H8PA 3E8UH 2CIKB 1F4HA 5CJOH 1NEZA 4OB5L 1MVFA 4NKIL 2EXYD 5GS0H 5MEOA 5CGMA 4ZYKA 1HIML 2YN3A 4QRSA 4ETQA 2VQUA 1U8HA 1D5BA 3F65A 5F88A 1T03L 1M6OB 3B9KD 3IFOB 3PWLA 3P73A 2WNGA 4S1RL 5KVEL 2ZOKB 3EOAB 5GS1A 1DBJL 5IFHH 3SE4A 2JELH 2EDLA 1BVLA 3RVUC 2OBGA 4FFZH 4NRYB 3QHTC 3MJ7B 5DZOA 1P9MA 3ZT5A 3IJHB 2JIXA 3ARBB 5DJZB 4XP4H 4AENB 1AKJB 2F74B 3M1BB 4G8EA 5AZ2H 5SWZE 1QOKA 5A43C 2JK5A 3L3HA 3SHSA 3WDHA 1TJIL 4UTBL 1IGJB 1WWWX 4NQUA 1WICA 3U2SA 4YHIB 3BP7B 1SVCP 1R5WA 2H6PB 4R0LC 3GZKA 3JSSA 4F9PA 4F7TA 2VAJA 4M4RA 3G04A 1FGVH 4KMTH 1QR1A 3ELAT 2F8XC 4MCYA 3INUH 3V8OA 3S4SB 1D7FA 4YDJA 3DVIA 2FL5A 3O4LD 1I75A 4J1UA 4WFFE 4MMZC 1GC1H 4JQIH 3K2UL 3S36X 3V5HB 4F9PC 2BNRA 3TVMA 1R3HA 3MLTB 3CFKB 3KPSB 4G9DA 4D9QE 5C0RH 1L6XA 4EZMA 4MAYC 3BPCB 1LP9E 4ONOA 2HJKB 1DVFB 4HUXB 4PJAB 1NMAL 4P5TA 5DD3L 5J4MA 1IC1A 3QO1B 4LCWD 3CUPA 3HG1D 1DFBL 2YA2A 1ACYL 1B0GA 4BK4A 3RAJL 5BXFA 4QRQB 5K9OB 3QR2A 3EBAA 3AXLB 5GS1B 4HUVA 4TULL 1EFXA 1T21B 4KH2A 3WL9A 4E41D 4XPFH 1A64A 3UTPE 2NY3C 3CFJB 5D96B 4IMLA 1S7XB 4ZYKB 4KZDH 4AQ1B 1FYHB 5EC1A 2K7QA 3QEQA 3QFJD 4WEBH 5KVFL 2A9NL 4KJYA 3X3FL 2ADGA 3RY6A 3N1FC 4V1DB 4XVTL 1Q38A 1F42A 4PRHE 1J1OH 2J6EL 1JHKL 4N1EA 3TWCL 5IHZA 1U8LB 1N59A 3BKJL 4DEPB 5JHDB 3IFPA 4YHPB 3G6DL 3HMXA 4BSWA 2XXCB 4PBWD 4KROB 2W0PA 2EZ0C 2GI7A 2R56L 3IDNA 4RIRB 4FABH 1PQZA 4JFEB 1OP3K 4FTVE 4GKZA 2R4SH 5IIEB 1CXIA 1AGEA 1PKQA 4XHJC 3RZCB 2AJ3A 3G5VB 1EBPA 1XR8A 2OTUB 5C09A 5DRXB 1NCCH 3MA7B 4JRYA 1E4XI 5FYKH 4H8WC 4PJBE 1FN4A 1RMFL 3VGBA 4HUUA 4WJ5B 2DS4A 1VADA 4HLZG 2NXYC 4EI6B 4I48A 1KIRB 4YGVA 1M71A 2CGRL 2VXUH 3QEQD 3CFDB 3HRPA 2FO4B 2UZIL 4PJ7F 2XTJD 3TJHC 4U6TA 4OD1L 1QLRB 4EUPG 4HH9B 3L3KA 4WU7A 2YXFA 2CIIB 3FN0L 2YN5A 1WSST 1I9RH 3FCTB 2EC8A 3STLA 4LLWA 1JWMA 2B5IC 4YHZH 3R4DA 4UNUA 1N26A 3GO1L 2VRAA 5C0DB 3KWWB 2FGZA 4PJCF 4IRJA 4HIXH 4U1JB 5FHAH 2C1PA 2QHLA 1CGYA 3D3VB 3QI9A 4OTXL 3AFLA 4RA0C 2ICEB 3JTTB 4HZLA 3NPSB 2CKBL 3BSZL 3V6OC 5DI8A 2XRAL 1J8HB 5DK0B 1JJUA 1BF2A 3F58H 3U1SL 1NMCC 1C5BH 3H2WA 1YMME 1Y6KR 1I8LC 1NC4B 1T22A 2WV3A 4PRDB 4WI6A 4PJAF 1FGVL 4KMTL 1B0RB 5FB8B 1LO5B 4O58L 2R0ZL 3T0DA 4TTGA 3FRUB 3C60D 4NCC1 1EDQA 3QCUL 4HKJA 4NQSB 5GGTA 4FQHB 1CGXA 1FL3B 2I9LA 1QYGL 1CGSL 3HI1B 1UT9A 5GZNC 1OD9A 4KKCC 2I5YH 4Z95L 5C0RL 4RSVA 3ARFD 3ESUF 4XPGH 4H20H 1R3JB 3FAXA 1BAFL 4QY8B 1P7QB 4E42B 1UZ6F 2CKBB 1ONQB 4OV5B 2X9WA 4GH7B 3A6BH 5ANMA 4ODWB 4WUKH 4YFLF 4A6YL 3EYQD 3RTQA 4N0YL 4ZNCD 4C58B 1H0DA 4QRPD 4P2RE 5JXEC 1CFNB 3U4EA 3FQXA 1NC4A 5GRXG 4NO0B 3DUSB 1KYOJ 4ZO7A 1F58H 3MRQB 3WS6A 2Z35A 4PIRF 2EE3A 2RIKA 3W11D 2B39A 1MREH 4RMQA 5BZWA 4MVBD 4RX4A 3C6LC 3MLYL 4PY8J 1KIPA 4BSVA 3CU1A 3FQUB 4G9FA 4KKBC 5FUOL 1HZHL 3X11A 4K3EL 4HH8A 2IPTH 4PRHD 4LLWB 3MXWL 3RQ3A 3WXWH 5CEXA 3TZVD 1XCQB 4DZ8B 5C7XH 1LO5A 4GXVH 1FCCA 2EE6A 4OF5A 3C8KA 3NA9H 1F6AB 2DD8L 3LH2L 1GOHA 3V0WH 4LSPL 5DJXB 3SPVB 3OF6D 3JV5A 3W82A 2R0WL 1LP9B 3H0TB 3ARBC 4MNQD 1YEFL 5DI8B 4P2RB 1KC5H 2QQKH 2YPVL 3KDMB 3QDGA 1FNSH 4WU5A 4H8WH 5DURB 1AXIB 2HAZA 3ARGC 1PZ5B 3L95A 1KIQA 3BH8A 3JV4B 2FHCA 5CGYD 3BP6B 5MI0C 1BEYL 3A6CH 1F00I 3CH8A 2NW2B 4QNPF 4HPOH 4I18A 4P4RA 1PLGH 4FQ1L 5IR1B 3LIZH 1IKFH 4KK6C 4QWWC 1A3RL 4U3XA 2DF3A 2J8HA 1VB9A 4G8GD 2HYMA 4YUEL 4PRHB 5D1XC 3KXFA 5BV7B 1EEZA 3SOBH 5DFVD 1OW0A 1JTTA 5D7KE 5ILTH 1CDBA 3I9GH 4PP2B 1HEZB 2R2BA 3RKDC 2FGWL 4PS4H 1RJYA 3FKUS 3ARZA 3BWAB 4MCZA 4XCCL 4Y4FB 1QFPA 2J1KA 5HVFB 4F8QA 1C5DA 1YEGL 4ZUUA 4JFQB 4EOWL 1QSFE 4KHTL 3NZHH 1L7TL 1GIGL 2BRRH 1Q0YH 3QUYB 1Q9KA 4U1LB 4HBCH 1U8QA 3W9DB 5ITBL 3QA3A 4F2MA 1KTDB 2GAZB 3P0YL 1QNZL 4GBXB 1NLDL 3F58L 3SBWC 5TPWL 3EYFB 5SX4I 5ANMB 3IJHA 3O4OC 2QBWA 1DDHA 4NP4L 3HN3A 5F7EL 2ESVA 1OSPH 2GSIB 1KTLB 1TJHH 5IESH 3E6FB 2PKDA 2A77H 4WW2C 3NABH 1Z3GH 1LK2B 3P73B 5TFSH 2DWDB 3WO4B 1KV3A 4MNGE 2GEEA 3RGVC 4U1HB 3SDDA 3Q3GB 4OD3L 4AIZB 3EJZC 2DWEA 5LVEA 1F97A 1I9RL 4GXVL 4AG4H 5D71H 1EHLL 4LGRB 4LBEB 3IDXL 5FCUH 3TV3H 1BF8A 4WW2A 2AXGA 2EO9A 4PJEF 2AK4A 5L2JA 3PWPA 1FP5A 3DBXB 5EIIA 4X9IA 1JUFA 5HHOB 3GSNA 1RUKH 5D7IF 3UPCA 1N6UA 3O6LH 1MLCA 1A5FH 2OCFD 3TBYA 2B4CH 2H26B 4LSQH 2X4NB 1MRCL 3HZVB 2E9WA 3BZ4A 4HXAL 1IGCH 1P2CA 2EDYA 4Y19B 4MNQB 4FFZL 2VDML 2EE2A 1NCDH 5CSGA 2BJMH 4AJ0A 5JDSB 1FZJA 4HS3A 4P46D 4XPAH 4V1DA 5FYJH 1MCWW 3NGBB 4LF3A 4P2OB 5HYSG 2O93L 3AU1A 1UB5B 4B0MM 4HDIA 2LAAA 3MRHA 3INUL 2DKSA 4NIKB 3RX5A 4E5XB 4LLDA 2XWBA 2X2YA 1PDKA 4Z18A 5TE4H 4BQ6A 4W6YB 4I0PD 4R0LA 1FFNA 3CCHB 3QCVH 4ZOAA 2CDGA 3E6FA 1HKLH 4KTDL 4WO4B 2OJEB 4TRPH 5BXFB 2NY4D 3O2VL 4X4MA 3MFGB 4EUPB 4JFED 4XP4L 4M00A 3BDBA 3TVMC 5KSBE 1M7DA 1F3RB 4XPHL 5MENB 3RVXD 4LVHB 4FRWA 2XTJE 4AL8L 2FR4A 1KCUL 4NN6C 2XACC 1XCTA 2ZP0T 4XMKL 5DZNA 3DX9B 3PQYA 4CMHC 3UTTA 5I16B 3QHZH 3U9UA 1AGEB 5JW5A 3EYQC 4P48A 5FGRA 4X6CE 5HDLA 5EU6B 1FGNH 4WTZG 4I77H 3WNLA 4NZUH 3LKPA 4KAQH 4NQTA 2HMID 5HHVH 3NCFB 4U2YA 1ZA3A 4HUKB 3OL2A 3ABZA 4CW1A 1U8PB 4XBGA 1IZKA 4S2SB 5JIIA 1X5IA 2BVOA 4LHJB 1TCMA 2XWTA 1T83C 1YQVL 1CD1B 3B2VL 2I24N 3PWPB 4NQXA 1UACH 3L9RB 4L9LC 1UB5A 3V9FA 5F9WC 1VEMA 2EDQA 2MJWA 2VLKE 4NJ9H 5IMOA 3OKMA 1Q9LA 5DLMH 4C54A 3C8DA 3V0WL 3B2UD 3JWOL 4KKBD 2FHFA 4XAWH 2F53A 4XP5L 4XP9L 4CUCA 1HH6B 1U95A 3T8XA 1BM3L 3MSPA 4MHHI 1F90L 1JPSH 4P23C 3GSWB 3VXTA 3B5HA 4M9OA 4NCC2 4WWKD 1SM3H 3QJHA 5E6IC 2XZAL 1IAII 1T3FA 4J8RA 1G0YR 4RMWA 5IW6A 2IEPA 4HXAH 2WW8A 4LKXA 5IHBA 1AIFA 1JE6A 5A2KH 4ZFOB 5IWLC 1LDPH 2IANB 4YBLB 1R3LA 4E0RB 1KJVA 4Y5XB 1ZVSA 1RUAH 2CDEA 1JPTL 3STZA 3KLAA 2Z8RA 4XC3L 2NY1B 3QWRA 4WI8A 3K80A 5FA3A 2VQ1B 4L3ED 1RVFH 2HLFD 4CVZB 1MEXL 1YNTB 1UGNA 4R90H 2DQFA 4PD4J 1N5AA 1XZ0B 2AK4D 3VFUB 4JFXB 2DIBA 1PSKL 5DHYB 1YNKH 3MGOB 2P5ED 2ARWA 2FBOJ 4ONGH 5CD5D 4IS6B 2BDNL 2BOCB 4NO3B 4U6YA 1NCCL 1X4YA 1INQA 1T80A 1T4KA 3ESVF 5KSVB 4AENA 4GAJL 1KN2L 4R2GD 1BECA 3B8YA 3H3PH 2XFXA 4B7LA 3QP3A 4O2EB 3TT3L 1KFAH 4G42B 1AD0B 2YUXA 5CJQL 1I3GL 4TVPH 3BWUC 5CWSB 1SMOA 4WHTB 4XWOC 5BZDB 2Z31D 1QQDB 2IMMA 4F33B 1A4JB 5EC2A 2JKXA 1SEBA 2BC4B 1WUNT 5LXGL 3QIWC 3VG9B 3QCTL 3KYKH 1C16A 1N6VA 4OJFL 4WIQA 4M6NL 5F88B 1G7IB 3U1SH 2NXYD 2DM2A 4HF5L 1NJ9A 4BZ1L 1T04B 3MYJB 1DL7L 2EH7H 3FOLB 4L4VE 2HRLA 4Z7OF 1RPQA 4EBQL 2IBGA 4YHNA 2QV2A 5BV7C 1YMHA 1HHKA 1EXUA 4NZJA 2AEWA 1T1WB 1I8MB 4ZFOA 3T0WA 3ARVA 3DXAD 1CF8H 1W0VA 3MA9L 2P5WA 4HQQH 4ODSL 5JORB 4J2XA 2BFVH 5E1AB 4LVEA 3O6FC 5I30L 4TN9A 5EZJA 1N3NA 5T1LA 4BZ2H 5GRZA 2Q6WA 4U3CA 5BMFL 4U7SA 3UJJL 4JHAL 3EDKA 3MPCA 3ZKMC 1MIML 3ARWA 1JGVH 4C83A 1DEDA 1BLNA 1OAXH 4GRLA 1YA5A 1LO3L 2QQQA 1CD0A 5F3BA 4DKDC 3BH9B 1JN6A 4MA8L 3VXRD 2AQ2A 4JY4A 4ZAKB 5FYLL 2GIYA 3QUXD 4Z76A 3BXNA 1CTNA 2EYTA 3WHXB 4PY7A 2A83A 4QNPE 4GUPB 5HGHB 3DVFA 4OAWA 4PRAA 4XHQA 2VISA 3D18A 1JP5A 1HYRC 3L3DB 5E2VH 5ADPH 2J7LA 4K94C 4PJCA 1HWGB 1A6TA 5EZOH 1BPVA 4LLUB 4ODVL 3KJ6H 4YBHA 3N06B 2R2BB 4S1QH 3L3KB 3LQAH 5HI3D 3IGAB 3HHRB 2C4FU 4S1SL 3RVVC 3HZMA 1NCAL 2Y07H 1Z9OA 1HHJB 4UAOC 3QFDB 3DYMA 1GCFA 4O51A 4HGKC 4G7YL 1WFNA 4NQCA 4LAQL 1SJHB 5LG1A 1A6VH 4CN4A 3BVNA 1CL7L 3CPLA 3TNMB 1S7SB 2A1WL 3SDAD 5D2LF 4NFBA 3BIKA 3HE6D 3MV7D 1ITBB 5T33L 5FF6A 5EBWB 3T4YA 3OTTA 4F2MB 2N56A 5INCA 2GJZB 3GKZA 5MP6H 4PRPD 5ICXB 2AGJH 4IOIA 2DI9A 4U6HA 4ZAKD 3RGVD 5F9JA 2E27H 1UA6L 5DEFB 4ZTOH 4BFGA 5C3LD 4YBQC 5EBGA 4P3DA 2PO6A 3KDMA 3O6KL 3DUUA 4XB7A 3CX5J 3U7YL 4YZFF 5JR1L 5CCKH 3MLSL 4PJ5B 1U8LA 3S8WA 3G6JE 4LHQB 2UZXB 2HKHL 5GJSL 1XH3B 5IEHB 3AREC 4HIEA 2PETA 4WO4D 1EMTH 4M61A 3P30H 4MA3B 4ODSH 4UNTA 1QSZA 2NX5E 1MRDL 3PDDA 4Z7WB 2VISB 3EJZD 5FOJA 4I4WA 3QNXB 3MYZA 4Z7VF 5SX5K 3X3FH 4F9LC 2YK1L 1NCWH 4F7CA 4G6JH 4IDLA 3EJYD 4PJ8A 4NNYA 2PCPA 2D9CA 5I1AB 4M9PA 1QRNA 1FIGL 5AYQA 3MLXH 3N1QC 3KPSE 4JFYB 3IRPX 4LVHC 5ACMA 1EEYB 5EU6D 1HILA 3SDYH 2DLFL 3MRQA 1HI6A 1U3JA 5FHBL 1FCGA 4ZUVB 3WFDH 4BH8B 3BW9A 2ADIA 3CZJA 1LP9F 3RWIB 3WSQH 1ETZB 4F3FA 3TC9A 3FQRB 3ROOB 3H3PL 4QRPB 3DSFL 1ACYH 1B88A 1XGRB 4LCCB 4PJXE 3MTRA 3HE7C 1KPVB 3UTZB 4NZRL 2WWMD 2VXTH 5DQDH 3FB5B 2C26A 1IGMH 3D85D 4MMXC 3F6LA 1OCWH 2VDLH 2IANE 3TNNA 2Q7YB 1INDH 4L8BA 3PWNB 3DX6A 2LU7A 1NFIB 4GMSH 1QG3A 4XP6H 1KTLA 4Z7WE 2YUWA 4XPTH 5TE4L 2EH7L 4W6WB 3LKNB 1PY9A 4D0CA 1NFDF 5GGRA 2D7PA 3IFNH 2Z9TA 3GDBA 1II4E 5I2IA 5A1AA 4BK5A 4YHIA 3VXNA 2ZUSA 1EPFA 4TPRL 2HJLB 2W0KA 1DQTA 2P8MB 4HMCA 2VLMD 3TO4A 3WDIA 4RWHA 4M1DL 1H3XA 2MHAA 1IAKB 3U4EB 2BRQA 4BZYA 4F3FB 1MCLA 5T3ZL 5EU7E 1AKJA 2F74A 1MY7A 5J1TC 4DGVL 2J8UE 5DQ9A 3TJEL 1RI8A 3LHPH 2P43B 3KPOA 3SDCC 1PFCA 1UZ8B 3SGKC 4CW1B 5IBTL 5DEGA 1GXEA 1T7WA 2VAAB 2ZCLL 1RZJH 3DYPA 4AT6B 3BZ4B 5DMIH 3IJSA 4P59L 4JO2H 2N7AA 2F5AH 1OGTA 3UTSB 5I16A 2VDPH 3CZFA 2ZUWA 4I2XA 3O2WH 3QH3B 4NM4H 5T5NF 2VXVL 3HZKB 1I4FB 1ORQB 4WFEE 3QIUA 3BD3A 4C59B 4LLVB 4TVPE 1DQJB 4NN6B 4NYLA 3OKMB 2BFVL 3UO1H 4ZMAT 3MLTA 4NQEA 4PGDB 2CO6B 4MWFA 3AY4C 1RUMH 3DX8B 5HSFA 4NKMB 5E8NA 5J3HD 1UENA 4HC1A 3X12B 1OAQH 3QIUC 1KCSH 3MLVL 4YE4H 3EOBA 1M4KA 3DX6B 5T33H 2VDKH 4JZOA 4X5XA 2XPGB 3FQWB 1K8DA 3QRGH 1ZWIB 4EI5B 1KCLA 5K59F 4HAFA 4YK4B 2H2PD 4ZOBA 2H32B 3MFFA 1IEHA 1AIFB 4YDVB 3ZKMD 5GGVH 1N7MH 2NTFA 1CQKA 3BIBX 4HC1H 5JR1H 2FR4B 5EOTB 7FABL 4FFWD 3G9AB 3VGGA 5ERWB 3V7AG 1NCBH 3MRLA 1N6QH 4Y1AE 3OG4B 4LEOA 1JK8B 1D5MA 1N4XL 5HHNB 3RI5F 3VXME 3O8XD 2DQIH 2ATKB 1T1XB 3W0WD 3QHFL 1U92A 1WK0A 2R23A 1URLA 5JHDA 1CLYH 1RJZA 4R8WH 5TE7L 2DOCA 2G2RB 1F3DH 4ZDHB 3QDMD 4NUJB 1A3QA 1R6VA 3WO3B 4XMPH 1WIPA 3TNNB 5JOEA 2YD4A 2CDFA 1AQKL 4NPYA 1T83A 3L9RA 2V5TA 1SJXA 1AHWC 1SHMA 5BRZB 4OSUH 1A9EA 4HKBA 4OV6F 2WBJC 4MAUL 5E9DB 5JIPA 1ZT4B 4HHAB 2GTWA 4XNXL 5DVNA 3L1OH 4HJGA 4QGTA 4K94H 4KMQA 1QEWB 1DBKL 4RFEB 4PRIB 2PTUA 2X7LA 2R0LL 1AXSB 1H8OA 4MJ5A 1JRHI 2AEPL 2FEEL 3BZFA 4DUWA 1JK8A 1G0XA 2HN7B 3BN3B 3ARED 3CVHL 3VFWA 4MAYB 5LXGH 1CCZA 1I7ZB 1QFWL 5TDPA 4YXLL 5DJAB 3ZE1F 1W0VB 3RIAK 2P7TB 3U83A 5BV7L 2CKNA 2YSSA 3DX7B 1PD6A 3LPFA 3N50A 1B2WH 1Q1JH 3EOTL 1FC2D 1SEQL 1XF3B 1WBXB 4RDQF 3G5YB 5I1JL 3QUYC 1TZGL 4I5BB 3I75B 1UEYA 2UZIH 5D7IB 4ZXBB 4OFPA 5BVPH 2R29H 4X6CB 4GSDH 4K2UL 1FORL 2FJHB 5E2JA 4ODHH 3U79A 3V52H 1A7NL 4IRSD 5T1KB 3BDYH 2DBLL 3JTTA 1S9KC 4PV8B 4YGAB 2VDNH 4ELMB 1RZGB 1NC2B 2Z92B 3TN0B 5DA4A 3TIEB 5D6CB 2WLYA 3G6JB 3EO0A 4JB9L 4OAWB 4M03A 3KPMA 2F5BH 4LMQI 5ERWA 2J2ZA 4EQ3A 4YX2H 1JUFB 5HHOA 3GMQA 3K3QA 4NHCL 5HHPB 3RP1A 3HR5A 4WWKC 5JDSA 1D6VL 4HX1B 3G5XA 2UY7A 4HKBB 3GSXB 5TH2A 4JG0H 1K85A 1AP2A 4MA7L 2YPKB 5C1MB 3HMXL 2QQNL 1GGYA 2L7UA 1UVQA 4CDHA 3MLYH 5D70L 5DJ8A 2HJFA 2A6KA 5BS0A 3AS0A 1JHTA 1N3NB 5T1LB 2CDGB 1R3JA 2KDGA 4XBPA 1WZ1L 1AGDB 4R0LB 1NGQH 2DQIL 2BY3A 1MNUL 1NGXB 1MWAL 4LRIC 1V3JA 3OMZA 4TUOA 5HHNA 5SWSA 4YUEH 3FO9A 4OIAA 4UUJA 1J0YA 3NA9L 3FONB 1JGEB 4WGWB 5GSRA 1MEXH 1N0LA 3VGAB 1CR9L 5H35A 3D25B 4NUJA 4LRIA 1LEIB 1PEZA 1A7RH 2C9AA 1G6RB 1I7TB 1WZKA 2E27L 1A6AA 1UKSA 4OF0A 5GHWL 3MBEB 5MEQA 4FXKB 3D0LA 2AQ3A 1OGAA 3MBEC 2B20A 5DJCB 2BSSB 4ZUWA 4KK5D 5JOPD 2PXYC 4HJGB 2C7UA 3EYUH 3ZT7A 4PJHA 4LMQE 3M45A 3H0TA 3JBG7 2VUOA 3MR9B 5GRWA 4M7KL 1WBYB 3VFVA 3UYRL 12E8H 1ADQL 3E2HC 3FQTA 1TZGH 1Y0LA 2XA3A 1TVBB 2BNQD 3TBSB 4DZ8A 3WIFA 2PYEB 4F57H 4GRWB 3OKEA 4G6AD 1INEH 4XCFL 3ARDB 1XCQA 4UUJB 3KPPB 3K0WA 1I7UA 1CFBA 4OF7A 5I1AA 4H0GA 3BGAA 2CKBA 3LQAL 4WFHD 5HDQL 1HZHH 3GJFB 4HFUL 4FQCH 1YY8B 5ICYB 1RULL 5H2BA 4NZTL 3ZTJG 4P3DB 2O5XL 4HMDA 1YUHA 5F6IB 1S9WA 1DTUA 2VXSH 2XICA 2HP4A 1J8HD 1DUZA 3QIUD 1KPVA 1DBAL 3CDYA 5DD5H 4TOYH 5HI4D 4GKSB 4OCXH 4W4OC 5CP3H 6CGTA 2AK1H 4R7NA 2W9EH 3NCJL 2VITA 3DVNA 3T0BA 4XCEA 2VSDA 1IILE 3C5JA 4MJIA 1HI6B 3TYFB 1QFWI 5JOFA 1T1YB 5B4MD 3S5LA 1FRGH 1D6VH 3DO7B 5IHUH 2FL5B 5KOVC 4D9QD 4KHXH 5HYSA 5C0BA 4HWEL 3BPLB 2PO6C 5BOPA 4LDEB 3ZTNH 3ARFB 1YNTA 1EEZB 3NVQA 2UWEA 1BJ1J 4G6ML 1VESA 1I8LA 3GK8H 3O3UN 3LB6C 3A67H 4ZS7L 3AMKA 2JB5H 5E8DH 1A7NH 3ILQD 3OPZL 3OKOA 1YDPA 4TRPL 5CEZL 1TVBA 3TBSA 5BVPL 4ALAL 3GKWL 2EYRA 3CX2A 5DHVH 4H26A 2IBZY 1DANU 3Q48A 2J8UF 3N1PC 2ITDB 4GRWE 4ODTH 5T3XE 1QSVA 1IC4L 4X5LA 3WL9B 5GISL 1RUPL 2VIRB 4JZNB 5J56B 2CKBH 3G9VA 1SEBB 1OAZH 5EDXA 1AY1L 4C55A 3A6OA 1C12B 1JF1B 3PP4L 2FJGB 1RZKC 3L6FA 4LP5A 1V3KA 4P46A 5A2LH 2VDRH 1MF2L 3QXTA 4KTYA 5DR5H 2AXFA 3DYOA 3O9WA 4XCNA 1AR2A 4C57C 3VD3A 1CLOH 2P4AB 1DVFC 2QLVB 3FFDB 5HVGB 2GJ6A 3PWJA 32C2B 1H3TA 3JTSB 1IGML 1J12A 4AZ8A 3ARSA 1SJHA 1FORH 3QH3A 5I17B 1BQHG 3PGCB 4PJAE 5BS0D 4J4PA 1DE4B 3R0NA 1LK3H 2UYLB 1E27A 2W1NA 3BP4B 2MQCA 1IE5A 2CUHA 1ZHBA 2R56H 3ZHLA 4TQEH 3PNWB 4WDIB 2CLZA 5FCUL 3TV3L 1J0HA 1U8IA 3KPPA 3WFEL 1UM5H 1R5VB 1MCOL 5IB3B 1IEAA 3ARGD 3C6LD 1G84A 43C9A 4Z7QE 6FABH 1M7XA 3PHSA 3GNML 4KKAD 2EXWD 3WHE0 1JWSB 1JWMB 5FHAL 3VFGH 3OGOE 1YYML 3ZHKA 4ZSOB 4QF1B 1JVKA 1SJVA 4KPHL 1TDQA 5I75C 3ZL4H 1GYAA 2BMKB 4HSQA 1DR9A 4WGVB 3FO1B 3V6FA 4XBEL 2EDKA 1FE8H 3HZMB 3NTCL 1X5YA 1ADQH 4DFHA 5IOPA 4GMTL 1GAFL 1T2XA 4S1DC 3BEVA 2RFXB 3L3DA 4JPVL 1GHFH 4PJCB 1ZXQA 4Y4KD 1SQ2N 2BNQA 2LQRA 3O8XC 4PJ7B 2WM0A 3SDDB 5SV3A 5A16B 4HKXB 4ZS7H 4YJZL 1EFXD 2E5EA 4Z77B 3G6AB 4PLKD 5I74C 1HNGA 3P9LA 3HPJB 4LU5H 2VERN 2Y72A 4GAFB 1KOAA 1EVUA 4NT6A 1FZJB 3Q6GL 4HS3B 1CFSA 5DK0A 5FM4A 1RUQH 3K46A 3VFNA 4YZFE 1C5CH 2OJZH 3QUZC 5DD1L 3SKUD 4DCQB 2BNUA 3BSZH 2AJZB 5E94B 1TETH 4ZFZB 1A6TB 3RKPA 3S88H 5EU3B 1XR9A 3VXRE 2F5AL 1G9NC 3CSYA 2IADB 1PYWB 1BJ8A 4RFEA 1D5XB 3GSQA 3RU8H 3RY5A 2VABA 4DZBA 3PJSA 3ROLB 1YEEL 4RQQB 2ZCLH 2VL4A 4C56D 3GSNL 1FAIL 4PJ9B 4S11A 4WV1B 4Q97A 5BO1L 4ZG1A 3THMH 1WBXA 2VLLB 2BHUA 4N90E 3U6RA 3MV11 5E70A 2BVYA 2JJSC 1OSZB 4TTDD 4YAQA 4EUPA 3QZWB 4PP1D 5IVOA 4IIQA 1L7IL 3L5XH 2PW1B 1NGYA 2DMCA 1RZ8A 4N8VG 2NCMA 4P2OC 2XI9A 1G1YA 3GIZL 4BUGA 4I5BA 1SMAA 5IB4B 2F58L 5DEFA 4YHOL 5ITFA 1X3DA 4NO0A 1CT8A 5DS8A 1X5GA 5IB5A 5L2KD 3NCCB 5HDOA 5GS0D 4JB9H 2KPNA 5KS9F 5FUZH 1A7QH 1HHHB 2V5MA 4R4FL 2Z8WC 3LN9A 3UAJC 3GSXA 4D0BA 1YEGH 2GTWB 4HHAA 5F89B 1G7QB 4JG1L 4YDLC 3BYTA 1ZGLB 1GGIH 2ZKHH 1P1ZB 1BFVL 5JQ6L 3D39B 3MGOA 1JGLL 4YXKH 1ZTXL 5MI0B 3Q6FB 2BP3A 4PG2A 1UWXH 5HYQB 3ZTNL 1HHGB 4L4TA 3MNWA 4R97B 3B43A 3U30B 3TH3T 1XMWA 2C4FT 2DLTA 5FA3B 1V7ML 1ZHKB 4KI5C 4OI8A 4ZO8A 3BHBB 5CLWA 3BX7C 2QSQA 2HRPH 4JO1H 4K3EH 4PJ5E 1S7WB 1P5VA 2QJDA 2H3NB 3OKNB 4IS6A 2IH1B 4ZO6A 3U4BH 2R0KL 1I3RB 3P11H 2DQCL 5T5FH 2W60A 4PB0H 2X4SA 2J5LC 3D6GA 1CDGA 1QPPA 3DSNA 1H15A 3LOWA 4OIBA 2VR4A 1NBVH 1EFXB 1T21A 1W72B 2UVFA 1A8JH 5GS2H 4MB3A 5FYJD 3C60A 3OAYH 3P0YH 3SGJC 2YD5A 4M48H 2AJVH 4YPJA 4MA7H 5KVDL 4KY1L 5HHQA 3NCYS 3OR6A 4Y19E 4R26L 5HHXH 5MERA 1DFBH 5D5MF 4LHUA 3B8SA 1S8DA 1D5ZB 4JFFA 3MUHL 3OJVC 4YXHH 5DVOA 1OT1A 5TJWK 2XKNA 5AG8A 2YD8A 4YHNB 1YYLL 5EU3A 1WC7B 3JXAA 5F7EH 4UIKL 3NN8B 1YJDH 4OLWL 3VXNB 4LVOC 4PYHA 4YC2B 3ZT6A 3KYOB 5TGBA 4U49A 1AD9B 2FZ3A 4PJDE 2X4UB 4WEMB 2YA0A 3UTSA 3TPUA 1JHTB 3WFBH 3ULSB 5HYEA 1AGFB 4F58H 4KTDH 1IMHC 1FZOA 4PRBB 4PREB 5CAYB 5EIIB 1NH6A 4K3HA 4BKLA 5DXWA 4GRLC 4U1KA 1H3VA 4LASH 1AD0A 4C56E 2JIXD 1IKNA 3SO5A 5L6YH 2HVJA 2XFXB 3WIHH 3UDWC 1KCUH 3TO2B 2NTFB 4GW4B 3ARDC 5MERB 3SKNB 1U42A 3SQOL 3B9DA 5I0ZA 2A83B 5HGHA 1MUJB 5C07A 2F8OA 2JJVA 4DVBA 2ENSA 3FFCA 5CS7A 2AEPH 2KZ1B 1IEBB 4FQPA 4BFBD 4OCLC 2ZOKA 3NMEA 3THML 3WEXB 3FMGL 5HI4C 3DVGA 2ARJB 3KPNB 4HK0A 3SKOB 1F5WA 4R4BA 4JO1L 1WCBB 3WFHA 2EO1A 4U0QB 1K4DA 2BX5A 2VR5A 4I3GA 1ZHNB 5LBSH 2BHZA 1UFUA 2NY4B 3I75A 1KNOA 5EU7C 3X12A 4IRJD 2HT2C 3CVIH 3T4YB 3UBXG 3MRHB 3P2TA 4HT1L 1U58A 1QO3B 4DW2L 4GXUM 1YMHB 3I6GA 5FGSA 2R23B 4EN3D 4X7TA 3QIWB 1OTSC 5J13C 5C9JA 1P2CB 1EO8L 4N9OB 2A6DA 2VL5B 2OSLB 1JF1A 2VDQH 3KJ4C 4JPIB 4OFYD 4P5MB 3RY4A 4IOFD 3T0EA 4XC1H 3V8CA 3VGEA 2OR9H 5J9PA 4UTAH 1ZLWK 4M5YH 3GO1H 4EDXA 4ZFOL 1F90H 3CSPA 2QTEA 4GW1B 2DQGH 5CZVL 4OFYA 3GBNL 4CRPA 3O9WB 2AJVL 3RWJB 5CMAA 2W65A 4Q58C 2J3SA 4LLYB 3AREA 2QSVA 2ZNWA 1JWUA 1U8OB 5EOCL 1ZGLM 3MRRA 4NQXB 1Q0XH 1QFUL 2OS7A 3GRWL 2XWTB 1H3PH 3NIFE 4FOMA 3UMTA 1TVHB 4LDLB 4M7KH 4R96A 5FDYA 3O6FD 1ONQA 4J3TA 4PJ8B 4G6AC 1J11A 3MA9H 1V3LA 1XGPB 2X10A 2DKUA 1TITA 1GL4B 2EC9U 5JZ7C 1BX2A 5T3ZE 3QIBB 4MNQE 3OKOB 1VDGA 5F9JB 5J12B 1MRFL 3WXWL 3MODL 3X11B 2X1PA 4U1IB 1CR9H 1EFQA 4ZO9A 4NHUA 4HIIA 1FLRL 2HH0L 4HUWA 5HVHB 4TSCH 3CXHK 4LKXB 1MFNA 1R5VA 3MACL 1FL6A 5DMIL 2XTJB 1R3IL 1RJYB 5AG9A 1FYTA 3VWKB 1MJJA 1W0WB 2NY3D 2Z4QB 4I1NB 4HGWB 1T20B 4DOHE 2ZUQB 2XQBL 1IRAY 1QRKA 1A14H 1PQZB 3ZE1E 5KS9A 4OZGA 5AZ2L 1BFOB 3VFSB 5DMGD 1LQSR 2YBRA 1CE6A 2P5EE 5CP7B 4MXQC 4OGXH 4FXLA 1MFCH 3BKML 5C0EB 4HWNA 1NLBL 4Q9BA 4PJ7A 2XT1B 2YEZB 3I50L 2EKSA 4Q6IC 5HPMA 3HA0A 5L8JB 4IRZL 5TF0A 3PHQA 3R06A 3D39E 5IOPB 1FVCB 4QTHA 5SWSD 3CZFB 4I2XB 5ESQA 1IM9A 1A6PA 4OQ1A 3FTGB 1C16B 5IG7A 3QRGL 1EJOL 2B0SL 4ZPVB 4Z7VE 5SWZB 4HS6B 4ALAH 1J1PH 3HC3L 4JANA 4L4VB 4YHKH 5L7XH 5IJKA 3WFZA 4FTVD 3TCLA 2GQHA 2V7NA 3BDYL 3FB5A 4WHTA 3EYFA 5DYOB 4XCCH 5HGAB 1T20A 4JFDA 1R3IH 3PGDA 2ZG3A 3TYFA 4S0TD 2A9ML 1B9ZA 2X4OB 1DQMH 4Q7DA 5HI5C 1UM6L 4M02A 1BQLH 4JRXE 4QCIB 4WTZA 5E00B 1JZ4A 1P7KA 3BW9B 3AS3A 3EYVA 2AJYL 4GW5B 5KSUB 2XZCL 5DWUH 3EGSB 3VMNA 3SO3B 5LBSL 5EU5A 4IM8A 3HUJE 2V7HA 3FT2A 1F13A 5IMKA 4PP2A 4X4ZA 4AH2A 1XZ0A 4LFHD 2ZUTA 1MAMH 1S3KL 3B3IB 2ZUYA 4GOSA 1GZPA 1T7YA 4E41E 2Q7YA 4LSUH 2HFEB 5HD8D 4HS8L 5DJ0A 1P69B 4Z0XB 3VXRB 2MQ3A 3O45A 4NKDB 2AXJA 5F72S 1ZT1A 3MV8D 1EX0A 3OKEB 1RUKL 1V3MA 4J6RL 4IDJL 1NC2D 4G42A 1EERB 3L1OL 1G6RH 2D7TL 2E8YA 1VFUA 4TSBL 2GSGB 4PJFA 5L2KB 5IT2L 1PGRB 4ELKB 5I1GH 4ZQKA 3RWHA 1BJMA 1FZMB 1HQRA 4HGMA 4M43L 1TETL 2YC1A 2HWZH 2FJGA 5CZVH 3T2QA 1X5XA 3O6KH 2ERJB 5L8KB 4QRPE 1JPGA 4Q2ZB 1DLHB 3I3DA 4NGHL 5F9DC 2NY2B 3CDGB 4APQB 4ORZC 4HCRH 5IGXH 1IL1A 2CK2A 5HGBB 5C8JB 3RA7H 2V2WB 1NUGA 3VXUA 1XF1A 2GHWB 2IPKA 2WBJD 2SEBA 3FB7A 3E3QC 5CIPA 4ZTPL 3UCRA 1A22B 2YPLE 4MD5A 4MLIA 4OZ4A 5D7JA 3EZ8A 2VC2L 3STLB 5IVXA 1DQDL 4J23A 1W2KT 3BVNB 3DRQA 4JLRA 2IAMA 3ARXA 2QADC 1B0RA 1YUHB 5LAXB 2DTMH 4LPCA 4J12A 1CYGA 1EHAA 3ULUD 4HS6A 3ARFA 2JCCE 3QUMA 1JFQL 5FGCB 2UZYB 1R5IB 3RGHA 4YNYA 4Q74A 3SDCD 4WTWA 3O2DA 2A38A 2D0FA 2CUIA 1GPOH 5F1SA 1QSFB 2VIRA 4NQDB 1NUDA 1QKZH 5ETUB 4PGEB 1CFTA 1PX4A 3ARFC 3RWDA 2XKUA 4Z7UA 3F12A 1JZ6A 2AXFB 1MQKH 3ORJA 4HZAA 4JY5H 5DJAA 4D0BB 4JY6A 4RMSA 1QFUH 4MX7A 2BOBA 5HY9B 4O2CB 1F8TL 3QPXH 3IJYB 5DJ2A 5D9SB 5GJTH 5DJZA 5AAMA 3V2AR 1U8MB 2AJYH 3MRPB 1UJ3B 4GG8A 4NUGH 4OM1H 4PGBA 2J8UB 3HE6A 3MV7A 1FIEA 4XRCA 5DHVA 3VFPA 5I66B 4PRBA 1A7OH 3NCBB 3LKPB 1CZ8H 1F6LL 4HKZA 1NL0H 2V9TA 3UJTH 5E9DA 5IBLD 3OKLA 1FDLL 3VH8B 2BVPA 5B8CB 5C0CA 2WUCL 1VPOL 2BZDA 3GB7A 4G6MH 4LPWA 4J3VA 4MD5B 4CVXB 5EC1B 1U9KA 3QEQB 2FATH 5CJXC 3H9SE 4AEHH 1DBJH 3PV7A 1HDMB 4OM0H 3QPQD 1T5WA 5K93A 3B9KB 5I8EA 3SDYL 3D85B 5KANI 2C1OB 5CSZB 3W2DL 3B5TA 3MLXL 1MHPL 1CXKA 3OBAA 4N0UA 3SKJL 3U2SB 1I3GH 1RK0B 5LWYL 1R24A 4JDZA 1HQRB 3ARBD 1MUJA 4JRWA 5EUOF 1HSBB 3N0PB 4KJPC 4N9GB 2XZAH 3B6SB 2DAVA 2VLME 1DQDH 2ADGB 5HHOD 1FAIH 1YMMB 3VRLF 7CGTA 4HUNB 4BM7A 3QCUH 5IMOB 3WJJC 5GPRA 5A16A 3FO9B 3GK8L 4Y0GA 1N5AB 2HLAA 4OFDA 3HB3C 4DJMA 1E6JL 4QWWD 5GZOD 3WIIL 5KVEH 3V6OE 5F6HI 3CVHA 3TA3C 3QFJE 4G43B 2OZ4H 5BRZE 3MXWH 1NAMA 2QR0B 1CICB 3KR3H 5DRNB 5HPOA 1QFWM 2DL9A 5E6ZA 5F6HJ 1B0GB 2HTLD 3RHWF 3VRJB 2WUBL 3W11C 2IFFH 2YRZA 2XZQH 3MBEA 3ULVC 1N5YH 1L4IA 5LAXA 1TZHA 1S5HA 3AREB 2GYSA 5EA0L 3CMOH 3SDCB 3P9WB 4F7EA 1RIHL 2BOBB 5HY9A 3VFVB 5CUSH 1C08A 2OLDA 1EAJA 4PYGA 4QHKI 3QJFA 4RFOL 4JQXA 3QDJE 3BPNB 4I0PB 1Z9MA 4LCWB 5B38B 4QXUL 2V2XB 3G08A 2ZUVA 1TTUA 4HWEH 2RJMA 2BNRD 2NXZC 5AWNL 5E8EA 4X6DE 1NGXA 1MCRA 5FGBC 4AIXA 4U1NA 4PJEE 3HZVA 2X4NA 2VH5H 4U1HA 4UMGA 2BY1A 2YS4A 3O3EB 5EBMA 2OM5A 1RAMA 3KS0H 1G7MB 3BAEL 5BS0B 4UNVA 3LMJH 1L6ZA 4OCNC 1M05A 3IDJA 2VE6A 3DHMA 3RBGA 3BKCH 1F2QA 5DK3A 2GK0B 2FATL 2NY6C 3MRLB 3QFJB 5IFJB 3F8UB 3ZE0E 5GRYA 3V4PH 3QI9C 1O0VA 3KPLB 3RRQA 3SJVE 5AUMB 3FOLA 4HDIB 5E6IB 2DWEB 1LEKA 2NY0B 4Y5YB 3OPZH 5D93C 1RFDH 5DD3H 4CN1A 1KTKE 3C6LB 3MCLH 4OLZH 3I84A 1WAAA 2D7MA 3QO0A 4MQSB 4YBLC 5EA0H 1V8HA 3CMOL 5L2KE 1R3KB 2AJSH 1E28A 4HPYH 1RJZB 3SKJH 4HBQA 3ARGA 3RWGA 5JPNB 4KROD 4HGWA 3TZVC 2JELL 3GBNH 4JHAH 1J0IA 1CBVL 2YZ1A 1UWEH 4KQ3H 1MJUL 5DD1H 1IGIH 3TBYB 4KMLB 1E4XH 4Z6AT 4LEOB 2G60L 4QTIH 4OD2A 1U93B 4DAGL 3MLPA 2L0DA 1Y6NR 3TA3B 3RNQA 2P45B 4UT7L 5DMGC 3QULB 3VGHA 3GJEB 3H9HB 2VE6B 4PRNB 1JMZA 5J1SC 1K8IB 1IAMA 4M3KB 5IB4A 3DWTA 4BKLB 4U6VL 3SE9H 1IM3A 4GSDL 3ALWA 4K2UH 3ZE0F 5TQ0H 4Z78B 1K8DB 1GAFH 4PRID 5LKNA 3P4NB 1OP5K 3AM8A 4U1NB 5I1JH 1U92B 1A6WH 1RQ5A 3BP7A 1I7RA 4ZXBC 1NCAH 1A1MB 2Y07L 4Z0BH 4JR9H 1FG2A 5HGGS 3FT4A 1KBGL 2DQHL 4IBLT 1U8HB 1ADQA 3KPRE 1N2RA 2I9LB 3BKJH 1L7TH 3W2DH 1MJ7H 4OIIH 1T1YA 2R1YA 3DX9A 3PQYB 4UV7H 3WS6C 4KK5C 1HXYA 3VXMD 4Q9CA 3MX0A 5JPMA 1CFVH 4NQDE 2FLRT 4XVUC 3MBXH 1RUQL 1SYVB 1T6VN 5KSUA 2O5ZH 2R2HA 4JGMA 3U4AA 5ACLA 4L3EB 3CFKA 4Z7WF 1JYNA 3D3VD 3RPIB 4FXGA 3CJJA 1G9NH 5FYLH 1A3LL 35C8L 4AEFA 2EDOA 1IC7L 4DEPC 1J10A 2HFEA 5D5MA 2Y06H 4U7KA 1S7RA 1A7OL 3TPUB 3QDGD 3REVB 4B50A 5IQ7L 3VWJC 1DLFL 3X14B 2DLHA 3GMOB 3JV6B 1KJ3H 5JOPE 4UQ2B 1D5IH 1JF6A 3CMGA 1IQWL 4XB8A 3O11A 2J88L 5ISZA 5INCB 4D9RD 3OJDA 1PG7H 2XKNB 1Z9SA 2R2EA 4QHLB 1SY6A 2I60H 4JM2D 2X4PB 1YEHH 5DURD 3DXAA 1RFDL 4LU5L 2O61B 3D69B 3TWCH 5IEHA 1J0KA 4PJGE 4Q6IA 3DJ9A 5HHQB 5ALBL 4M62H 1FFRA 2OXGA 3QIWD 3RWIA 1PX3A 3P11L 1ZEAH 1YC7A 1P7HL 5GGSB 3LKNA 3O2VH 3MBXL 2E7HA 2I07B 4O2FB 4WFED 5E6ID 5I1EH 5F7WC 4ZODA 1MELA 3L6FB 5FO9B 3CDGA 2BMKA 4QRRE 4AK1A 4JGUA 5IP4A 3FFCB 1Z5LB 5J57B 5BZWB 3JWDC 1L0XA 1ERNA 1YEEH 3P0GB 1TPXC 3CFBB 1KYOK 1OF2B 5J6GB 4FFYH 1WISA 15C8L 4GW4A 3S88L 5DUMH 1KB9J 3G5ZA 4I9WE 4EEEA 1P6AB 1P4BL 1DLFH 4NKOB 3F62A 2WP3T 4QHNB 1TQCB 1U3HD 2VZ1A 4ODBD 4R6UA 1L0QA 3DMMA 4IHOA 3MRCA 4LSUL 2EDXA 1U36A 3ZDXE 1ZMYA 1YPZA 2D9QB 5SWSB 3LS4H 5DDHB 4FNLH 3NIGE 1R5IA 1SBBA 2PCPB 5ESVB 3WNKA 4ERSH 3EFFB 1F4WL 3AROA 1JPFB 4KVCL 3PGCA 2Z93A 2EECA 4S1RH 4L8SC 4K9EC 5F8QC 4WUUE 3N1MC 5HYJB 1GPOL 1IGTA 1A6ZB 1BM3H 2EDNA 2P8LA 4QT5B 2HWZL 2HMIC 1FC1A 2X09A 2R1WB 4H1LG 4Y4KA 3SGEI 4WUKL 3UTZA 5ADOL 3LY6A 5F93C 5EUOE 3IRZA 2W07A 2XG5A 2IBZX 4LLYA 2W9EL 5FOBA 1V5JA 3HE7A 2XYCA 43C9B 4YDLB 3TO4B 2BOCA 4ZFGH 5IM7A 3QXDA 4TOYL 5DD5L 4PJHB 1GOGA 4GAJH 3LHPL 5E2WL 2ZOLB 1OTTC 2IG2H 4DVRH 1KC5L 5GGQL 3TVMD 2XQBH 1CU4H 4LHUG 5FO9A 1OGAB 5JTWA 4RISL 4NQVB 2FDBP 1UZ8A 4FQIH 4KJQC 4ZFFA 2R0ZH 3CH1A 5BQ7B 4XI5C 1CLZH 5HYIA 3VFOB 4LSSH 4U0RC 4I77L 1YY8A 4EN3B 1FVCA 2Q8BH 2V2TA 2O61A 3D69A 2M2DA 4WJ5A 5D7JB 3V7MA 4ZS6C 5DMKA 5IBLC 1D5IL 1FV1A 4XP1H 3BEVB 4H20L 1WTGT 3LVEA 4KROC 3BHBA 5EORL 1PKQE 3SDXF 1QBBA 1BBJA 1BD2A 2F54B 3QZWG 1B6UA 1GZQB 4BH7B 2JJTA 1U8KA 2XWJA 2ADFL 5C09E 1EGJL 3CU7A 5GS0C 4P9MH 3BH9A 4J4PD 3R0MA 1LNUB 1V7NH 4A2LA 2DB8A 5D9SA 1JCKA 4HWBA 1MJJB 1W0WA 2ZOLA 1NBZB 1F58L 5C0ND 4L9LB 4N5UA 1H5BB 2ADJA 3LQMA 5IWLA 2C1PB 3D3VA 4L3AA 2WIMA 4HIIB 3E1F1 4OI9A 4OCRH 1VFAA 3N9GH 3NFSH 3QIBC 3T1FA 1KELH 4XCYA 2APWA 2BSTB 3FMGH 2DM4A 4JO2L 3ULVD 1VHPA 4L8DB 4HXBH 1NGYB 3BKYH 1NSNL 5FYKD 4M5ZL 3QFDA 2A9NH 4O51B 2E7LC 4ERSL 3WKNA 5HXMA 2B1AH 4P57B 5FYJU 2YBRB 4M6OL 3QQ3B 3QXAA 1UCTA 4NQVA 1AXTL 1OAYH 2ITDA 1LO0H 1H15B 5A3ID 3J7HA 4IMKA 1XIWD 2ZJSH 4LARL 4N1CA 2ATKA 3VD4A 1YEHL 2APFA 2R15A 3QUZD 4N5EC 1U3ZA 3U4BL 2YXMA 2B5IB 4DW2H 2E7LA 1DP0A 2NXZD 1CFQB 4NSKA 5HPMB 2R69H 5EO1B 4XCEB 3BUTA 4HMEA 4MJ6B 4R97C 4XVSL 1IFHL 4Y5XC 5MEOB 4XAKE 4UDUB 2CUMA 5EOTA 1T0MA 1TCRA 1OY3B 4HLZH 5E5RB 5ESAA 3MODH 5FCSH 1ZKAA 4LHUB 3K8LA 2DQFB 1CE6B 2OR9L 3QXWA 1I1AA 1ZK9A 1NMAH 4NJAL 4FFVD 1NCDL 4WDIA 4QXWA 1ZLVH 5D7JC 3ILPB 4U6XA 1NBYA 1MQKL 4X5WB 1NMBH 3BGMA 2Q86B 3LN5A 4ONFL 1CGUA 2YD9A 4N1HB 3GIVB 4JZJB 1DL7H 4QTHB 2VLRB 1AO7D 4GO6B 4W68A 3GMPA 2CRZA 1JRHL 4ORGA 2C3HA 4I13B 1ZV5A 1W72H 1A9EB 4V2CB 1U6AL 4XCNB 2HKHH 5GS1C 1B2WL 1Q1JL 1QBML 2D0HA 3MJ9A 1IBGH 4TUJB 5EO1A 5FGCE 4DQOL 3G6DH 5ANME 1K3IA 1NCNA 3IDUA 1KNOB 1P9MC 5EB9A 4IMLB 4XBPB 5FYKE 4HJ0D 4YDJB 4JJ5A 3UTSD 2ED8A 4M5YL 1C7SA 2HN7A 1MI5E 3PDOB 4G80A 5EU6A 4G5ZH 3GI9H 1GRWA 5KBNC 2PUQT 3NN8A 1MCWM 5ABDE 2F9BT 3RVWC 1E28B 3H9HA 4Q6YA 4FN0A 3S5LG 2AV1B 1FO0A 3D25A 5I75B 4U6YB 2Y4SA 1QNZH 1QBAA 3KG5A 4MDJB 3SDXB 5IW3A 3OR6B 4K3DH 3JZ7A 3HI5L 2QKIB 3DSFH 3AVEA 5BVJA 2FYYA 4JQXC 5IFAH 5IFJA 3ISWA 3WCYA 4EDXB 3RIFF 4M8VA 3CLEL 1AC0A 1LE5A 4PV8A 1FG2B 5JHLH 4YQXH 1DQLL 2H2SC 2OSLA 1I1YB 4JPIA 4XXCA 1K2DA 2Q8BL 5H37G 2IAMD 4HAGA 4TNWK 5C9JB 4KK6D 1AD9A 1K8IA 5JA9A 1VADB 4A6YB 3TYGL 4X6BA 3VMOA 4P5KB 4U7MA 2XN9B 1C7TA 4M8QB 4LNVA 2YPKA 5F9AC 2BNQB 4MVBC 3BGFC 4UV7L 1BQUA 3LV3A 4Y4FC 5E2UL 5I8OH 2DLGA 4ZFGL 4W70A 4Z7VB 2AV1A 3FO2A 4P49A 4PRPA 5DSCA 1J05A 2ICCA 2C3WA 4LPYA 4O00A 4JM4H 1LO3H 5DHYA 1EUUA 4FQ2L 4JFEA 2A6KB 2FBJL 4M7JL 5KTEH 1ULVA 3ZSSA 1MHEB 2NX5B 3T0ED 3OAZK 5I18H 3HI5H 2FJFB 3BDXA 3MGTB 3JUYA 4L4JA 3DROA 3I6GB 1I7UB 4DTGH 3KXFE 1AJ7H 1NDGB 1BQHA 1WWBX 3KJ4B 4NNXA 1CXFA 4HW6A 1M7IA 5HDQH 3O2DH 1I9EA 4WW2B 3VFTA 4Z5RB 3LS5L 3LKSB 5EOQL 3VCLA 4AMKL 1I9JH 1KPUA 4CBPA 4JM2C 3Q5OA 4RBPH 1KJ2H 3MV9A 3HS0B 2VLRA 4XC3H 3MCG1 4PJ5D 2M26A 4L4VD 5D2NE 4OZIB 1TVDA 3A6BL 5TDOA 1CICD 1NBQA 3U7WH 3AM8C 3M8OH 3L3GB 2A9MH 1UJ3C 1JWUB 1U8OA 5HYQA 4NC2B 4LCWA 4UIMB 5DJ2B 3P40A 1OW0C 1NUNB 3MRMA 2I27N 5CHNB 1SM3L 2QKIA 5FAAA 2M8XA 1HCFX 2XNAB 1D3CA 4P4KA 1UXWA 4MLSA 5CKGA 4M6ML 2IF7A 3W0WB 3MFFB 2ENYA 4U1SB 3ZKSD 4K71C 4GAYA 3QCTH 2FX7L 1VCAA 4PJEB 4XGZB 4MXWL 1YYLH 2AKRA 3VGAC 5C0AA 4DAGH 2P47B 3TN0D 5EOCJ 1NCTA 2JF1A 2G2RA 1AO7A 2EH8L 3BGFB 4NQCB 1PG7L 1VERA 4QO1A 1I9JL 3MC0A 3W9EA 3QBTB 3HAEA 1OTSD 4N8VB 1Z2KA 4LAJH 5I8EB 5LQBL 4LLDB 3P77A 5TQ0L 3MUGB 3NFNB 1BOGA 3T2NL 4BZ2L 3WFBL 4AEIL 2ZSVB 1FZKB 2ITCB 1P1ZA 5IM7B 2EIDA 1RURH 1XH3A 4KV5E 2FB4L 3GI9L 4CU7A 2O5XH 4Y4HD 5IF0A 4X7CC 2X4RA 1FQ9C 3HNVH 3S35L 3UTQB 5CP7A 3X17A 4OGYL 2FJFA 1B90A 3MGTA 4FP8L 4QT5A 2DQEH 3L95B 15C8H 4V1DE 3VFSA 1KIQB 3GMRB 2A6IB 1U8IB 1AI1H 5J8OA 4OV5A 2AEQH 3EOAA 5JW4M 3BZEB 1MHPH 3D9AL 1XIWA 3T4AA 4JFYA 4RZCB 4JY5L 4HPOL 4K23H 4M1CD 4G3YL 5J11C 1MFDL 5ESVA 4TVPL 2YC1B 3DHJA 3LZFH 1ZGLP 1AE6H 1KLUA 3MRDA 3G5YA 5C0GB 3BQUB 1L9NA 3W5NA 3LKOB 3BQUC 3NCYP 4H1LH 1MVUA 2NY7L 5EUKB 4ZD3L 3WUWA 1ZA6B 1MRDH 4X6EB 1S9YB 3MBED 2MTPA 1H8NA 3IDYB 3BUYB 3QDME 5ENWA 4QRUB 2VSCA 3BP6A 3IDMA 4YEFA 1YECL 4BFIA 2V2TB 1X44A 1A2YA 3U7WL 3I6KB 4MJ2A 5KSBA 3G04B 2X1OA 1TTGA 2FX8L 2P24B 3NAAL 1JZ2A 1ZT7A 5E2UH 4FZ8H 3PQYE 1NFDB 3CFIC 1Q9WA 3C5ZB 1C5CL 2EDTA 2OJZL 3E3QE 3IDIB 4OF3A 2V2XA 3G08B 5JW3H 4X7FC 2R4RH 3DUUB 5EU5B 1IEBA 4ZSOA 4H5SB 3H42L 4L8SA 4HX1A 5TH2B 3FAWA 4GBXA 2PYFB 3U9PH 2DIJA 1KB5H 4JN1L 5CINH 1VFAB 1YEJL 4HV8A 3S9DB 4DK3A 1U8NB 3O3AB 4JFQA 4RISH 5D1ZA 3MJ7A 3HMWH 2VXTL 5DQDL 2APVA 4U05A 4R7DB 1CFTB 4ZUUB 3UROR 2IAMC 4J3UA 4NM8H 7FABH 4BSJA 3VH8G 4GMTH 4WU5B 5MEQB 3KPOB 2VLKA 4RAHA 4NWTH 3OXRA 4U1GB 5JW4R 5D70H 1BFTA 4GKOA 3E6HA 5AZEL 4GG6A 3RVXC 3HTLX 1FZMA 2ESVB 4WW1A 4YDKH 4L8DA 5KSAA 5EH1A 4WFHE 1NUFA 4JCLA 4OLUL 2VLLA 4HK3J 3P4OB 4PJIA 4Y4HC 4N68A 4LPUA 3PIQA 5TDNA 3UYPA 2VN7A 2YOCA 4NFDA 4YHLL 2BDNH 5EUKA 1BZ7A 3BN9D 3WUWB 3Q6GH 3SGKA 3VXPA 1OAQL 1TENA 2R2HB 4QOKA 3VA2C 5HHMB 3F12B 5D7SL 1X9QA 2Q87A 4M4PA 1OF2A 3TBVA 3BFOA 2NMSA 3ULUF 5IFHL 1C1EL 4NJAH 2Q86A 1DCLA 4X5WA 4OI7A 2YUVA 4GKZB 4H0IA 4DGIL 5D5MB 5EC2B 3QUYD 2DIAA 4ISVA 4NT6B 3EOBB 3FRPG 2CXKA 4W81A 3OKYA 4CVWA 4IRJB 2B4CC 4U1JA 5DD0H 4PJ9C 4WV1C