3Q6GL

Crystal structure of fab of rhesus mab 2.5b specific for quaternary neutralizing epitope of hiv-1 gp120
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
209
structure length
209
Chain Sequence
YDLTQARSVSVSPGQTARVTCGGDNIGSKSVQWYQQKPPQAPVLVMSADDERSSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSHHMLFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVEVAWKADGSAVNAGVETTKPSKQSNNKYAASSYLSLTSDQWKSHKSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light chain of Fab of rhesus mAb 2.5B
publication title Structural Analysis of Human and Macaque mAbs 2909 and 2.5B: Implications for the Configuration of the Quaternary Neutralizing Epitope of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 209
sequence length 209
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q6gL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q6gL01
2ITDA 4PJ9D 2FX8L 5KVEL 4JFFD 5C70A 1DQJA 1YMMB 5ALBH 1RFDH 1F4XL 2VSDA 3SDAD 3MLZL 5I8CA 1FYTA 3U7YL 3BN9D 3H9SE 3LQMA 4ACPA 3BPNC 3KJ6H 4TRPH 1CFTB 3UO1L 4TYUA 3IFNH 3TVMB 2MCPL 3EOYG 5TFSL 3PV6A 3BHBB 3O6LL 1TVBA 5DMGC 3LV3B 3HG1B 2GFBB 1OGTA 5D7JD 2XN9E 5GGTL 4RA0C 1FL3A 5EC2A 4KXZH 1B0WA 4EQ2A 5DRNB 5FM5O 2X4NA 3GNML 1VFMA 3RZCD 4JY6B 1JNHA 1RZ7H 2F58L 2Z35B 5IKCA 3VWJC 1U3HB 5KSAD 3FONA 3O4LA 4P5TB 3FMGL 5GS3A 1UWGH 5IMLA 4PJ7B 4LLWA 1CE1L 1FL6B 1KPRA 2UYLB 4PRHE 4YR6B 1N59B 1ZHKA 4OZHA 4EJ1C 2DDQL 2IADA 2X44D 1I8LC 4BFEA 4XNZB 1KG0B 4X6DF 1T3FA 3BPCB 2I5YH 1R6VA 1ADQH 1T5WA 5K9QG 1MUJB 5FYJE 5HGAB 3G5YB 1A6TA 3H9HB 5IVOA 3M07A 3RAJL 5IMMA 5AAMA 2WQ8A 3BX7C 4PRHD 4K71B 1YEJL 3R06B 43CAB 1E6OH 2EXWD 4Z0BH 3CAFA 4MZ2A 5BS0E 2Z0BA 3F12B 3BKMH 1MIEL 3RHWK 4BA8A 4JN2A 5C0BA 3CVIL 3PG2A 4CW1B 3MGOB 3C6LB 1X6NA 5HDBE 4GG6B 1J05B 4Y5YB 5FYJD 3BPNB 5GSVA 1HHHB 1T22B 4MQXC 3C2SA 1PAMA 4E0RB 3JTTB 1MWAH 3MBEA 4QTHA 4WHCA 1CCZA 5DMJB 3IFPA 3D39B 1JZ5A 3HS0B 5JDSB 3Q5OA 3RTQC 3UZEA 1ZANH 2CRIA 4MNGE 5DD1L 2F5BH 4QRPA 4JO3L 4PTTA 4LSUL 4LLVB 5DA0B 5BS0D 4GKSB 3SDCA 1EHLH 2RB8A 1NCCH 3QUYD 1HXYA 4KJQD 2AK4A 3FT2A 1IGJB 3NGBC 3JWDL 1KJ3L 3JTSA 4FQJH 4N8CH 5IMOA 2DM3A 4FTVB 3UDWC 4Q0XH 5E2VH 1S7QB 1LP9B 1S5IL 3ZL4H 3L3IA 3QUZB 5IB4A 2R2CA 2VC2H 1P53A 4W70A 4PGBB 3CD4A 1WCBA 1WWCA 5K59E 2ZOLB 2E5EA 4N0CC 4N8PA 3ZKXC 3HN3A 3CU7A 4PJDF 1AQDA 3GHEH 4F58L 2XXMB 4X80L 5L8KB 1TMCB 1BWWA 2EYSB 4FG6C 1AGCB 4WFEE 5ECJE 3OKLA 1MEXH 4U7KA 3I3DA 1UYWL 2Q86A 3RVVD 1A1MA 1HH6A 1UEYA 2BFVH 3FO2B 5EBLA 1Q1JL 4YGVB 3NFPA 5DJXA 1UB6A 4P57A 4PB9L 4ONHA 5AYQA 1JMZA 1IGCH 3WV0A 4XMPH 4OQTL 3X3GH 1DFBH 1Z0MA 1AGDB 1C7TA 4Y2OA 4ERSL 3P0YH 2ESVA 3DXAE 3CDCA 3AS2A 1UXSA 5C0JB 1LMKA 4GKNA 2VE6B 3V0VA 4WFED 5E8NB 3VD4A 4GBXB 4OGAC 5ESVB 4MXQD 1PG7L 5IB5A 1KXQE 4ZOBA 2PNDA 5AZ2L 3O6KH 3CFCH 4XCFL 4Q97A 3O6FB 3RWIB 4QGYA 3TLRA 1DQLH 3P4LA 2Y5TA 2EE6A 1QFOA 1AD9A 1I7ZA 1UJ3C 4HFUH 1TDQA 2XWBA 3QFDA 1MFAL 3DXAD 1KIPA 4M1GH 3BPOB 1NDMB 4LSTL 2P24A 4ELMB 1T04A 3U0TB 2Y06H 5FKAA 5FO9B 2JELH 4KDTC 4R4FH 3RY6A 3U1SL 1FGNL 1P7KA 4OIAA 1YC8A 4YO0A 3MO1B 3IDIB 4YDIL 1UGNA 2LVCA 3CFBA 1H3TA 2VNCA 3UROR 5E5MA 4WU7B 3RWJB 5GS2H 2R1YB 3QFJA 4DTGH 4R8WH 4PJGA 1WIOA 3OJDB 4OKVA 1BOGB 4KAQH 4L4TA 4PB0H 4WIQA 1I1YB 3WNOA 3DVGB 1DQML 1Q9KA 4MD4A 4LCYB 5F44A 5IG7B 5C09A 5E2WL 5CUSL 2CKBB 1KFAH 3QIWD 4L8SA 4JM4L 2FZ3B 3BP5A 3L5XL 4HSQA 4PP1C 2V9TA 3MRCA 3HE7C 2QQLH 3MREA 4PRAB 3ULSA 4YEFA 2MMXA 1J1OH 2RHEA 32C2B 2ICEA 1W0VB 3QRFM 3QIUA 1S7RB 4S2SA 1J8HB 1EEYB 1DLHB 5I1DA 5DR5H 3RBGA 4Z0XB 3MUJA 5H94A 2N4IA 2OQJA 2DTMH 3D0LB 5ETUB 1FP5A 2IFGA 4LPXA 2DN7A 3PQYE 1ZVHA 4XPHL 2DRUA 1RJYA 5F88B 1HI6A 1VFAA 4G8IA 4HUWA 4CRPA 3QXAB 3K2MC 5FUOL 2YC1A 2XZQH 1AI1L 4WW2B 4M4RA 4ODHL 1A2YA 3C5SA 1KELH 1AHWC 1VACA 2J6EH 4M6NH 5KVFH 1IGML 3LQAC 3HCVA 5JXEA 2NY1D 1IKNA 2YPKB 2AAVA 3EOBA 4LU5L 4H0GA 2W9DL 5GS1B 1QYGL 1RK0B 5BJTB 2P4AB 2L0DA 3L7EA 1I9RL 3PQYD 1JPTL 1S7XA 2BZDA 5CGTA 1IQWH 2Z9TA 1A22B 1IBGH 2FX9H 4GQ9H 3DX9A 2ZCKL 1GZQB 3RPIA 2B2XL 1R24B 2E6JA 4L4JA 2CLVB 2ZG3A 3DHJA 2XYCA 1OT1A 3I9GL 4LNRB 4R7NA 3VFPB 4ZNCD 1KTKE 3P2TA 5E1AA 4O51A 5KSBA 3BE1H 4P9HC 4AH2B 1DDHB 1K2DB 3KPPA 1JGUL 5CJXC 2BXZA 4LF3A 4C56E 4Y16C 3RWEA 1FO0A 4LQFL 3V0WL 5EU5A 4LPWA 1T7XA 4NGHH 4Z7UA 2IANB 2VISB 1N8ZA 3NTCH 4C54A 4BUHA 1EO7A 1NFDB 2ADJA 4R26H 4Q9QL 1G7LB 1FNSH 3VWKD 2GJZB 3P77B 1JRHH 4LLQA 2NNAA 3EZJB 3MBXL 4TVPL 4CGTA 3CMOL 4DUWA 2K7QA 4HH9B 3FQUB 4HPYH 4PLJD 1F90H 4DJMA 1U8HA 5KANI 3C5ZD 3DYOA 4NKMB 4C56D 4ZPTB 3TJEL 2NY4C 3IVKA 4RQQB 3STBA 3U0PA 2LAAA 5HHOA 4AM0B 2UY7A 2PKDA 1XT5A 4FZ8L 4J3TA 2Q8AH 2DWDA 3L5HA 5FHBL 4WGWB 3CDYA 5F71A 3QUXD 4PLNC 1SEBB 2JJSA 5DSCA 4G6AD 1CZ8L 2QHRH 15C8L 1F8TH 1J0YA 1IJ9A 1KN4L 5F1NA 1RUQH 3IFOA 3I50L 4H20H 1WITA 2X09A 4CL7A 1DN0A 4RISH 4PLKD 5AYUL 3QJHB 4EI5B 3NPZB 1F3DH 1WZ1L 2KH2B 1ETZA 4LVEA 4D9RE 2N7AA 3L3GA 3U7WL 3PE9A 1I9JL 3VGHA 1SYVA 4Z7QF 4DOHE 1CTOA 5J11B 4LASH 2K9UA 4O58H 3O6MH 3H9SA 4CVZB 4U1KB 2JJTC 3W5NA 1X5KA 4LIQE 1B88A 3B6SB 5F3HB 4OLXH 1FZKB 2XN9A 3TBSA 4AIZB 4R4ND 5EULV 3DBXA 2JB5H 2AJYL 4Z7WE 1KJMB 3GB7A 3QHFH 4GW4B 4D9RD 4OAWB 3HZKB 4ZFOL 5E9DE 4UOW0 4R9HA 3I6GA 4DK3A 2EXYD 1BQLH 3L6FA 4X7DC 5T1KD 2EKSA 3L3JB 3SKMB 3WXWL 1CLYH 3CXDH 4PY7A 1GZPA 3CFIC 4LARH 3MLVH 4NO3B 2ENSA 3AGVA 2AV1B 3RHWF 5EBWA 1BQHG 4LVNC 3QEGL 2EZ0D 4NNPH 1FAIH 3W11D 3U0WH 4PJXE 4Q6YA 5SWQB 3GSRB 2ITDB 2QKIA 4R7DA 2GYSA 1A1OA 1DQJB 5E9DD 4I77L 1RUMH 1TETH 1I9EA 5FA4A 3PWUA 1OAZL 3GMLA 4HMEA 3QIBB 2W0KA 5SWZE 1FIGL 1LK2A 5I8CB 2COQA 2ADGA 3T0AA 1HOCA 2BOBB 1CQKA 3P9WB 1K3IA 1VPOH 3HMWH 3DMMD 3PV6B 2J8UA 1NBZA 1TVBB 5JMOC 1ITBB 1OGTB 2VR5A 1HCVA 5EC2B 4GW5A 5D1QC 3ARGC 2X4NB 2P47B 3MRMA 3MRJA 1FL5B 1JNHB 1QHPA 1XGUA 3OF6D 3FONB 3O4LB 1F02I 1R0AH 5FYKU 3LPFA 3UAJC 5IMLB 2X7LB 1BBJA 5SWZD 2BMKA 1ZHKB 1MLCA 4OZHB 5LGJA 3GRWH 4IIQA 4YBQD 5HYSG 3ZDYE 2EDQA 1T3FB 1MCQA 1YECL 1D5XA 2WW8A 4JJ5A 2OXHA 3FJTA 2G60L 1T5WB 3S35L 3T4YA 4BKLA 3VH8A 2DOCA 1IAKA 3I85A 3LMJL 4MNQE 4G7YH 4KHTH 3SDDC 2OK0L 5LJYH 4E41E 2DQTL 3S97C 3CVHH 5EU7C 1RPQA 5TJWK 1QRKA 4JRYE 4ZTPL 3D9AL 2DD8H 4GMTH 5D2NC 4D0CA 4JANA 1QRNB 5F9OL 4U1HA 3HI6H 1MY7A 4JN2B 4YDKL 4YXHL 3T2QA 5LXGL 2YKLH 5GSVB 4ODVH 2Z8SA 5CSZB 5BQ7A 3EJZD 2DQJH 5HVHC 5H37H 3WIHH 4MNQD 5IVXE 3EYSH 2AEIT 2ZUQB 3MBEB 4QTHB 2XTJE 1XF5A 4MJIA 3VXMD 5CP7A 4E41D 5DQDL 4OLVH 2WWMD 3KPNA 1FG9C 4J4PD 4JRYD 4HXAH 2V17H 1VESA 4X5WA 3SGEI 5A2LH 4XMKH 1QSEA 4QRPB 4DKAA 4PTTB 1F58H 4P2RB 3SDCB 1HHIA 4KU1A 5GGVH 4WUUE 5CSBA 3LN5A 4KTEL 1HXYB 3IU4H 3MXWH 5IF0B 5DJDA 5CEZH 2AK4B 1KCSL 1X4ZA 3JTSB 4CNIA 4IOFD 4LNVA 4M7KH 3AREA 2XTJD 4OFDA 5KJRH 5J6GA 5ICZA 3L3IB 5IB4B 3UJTL 2HTKC 2I60H 1WCBB 4QYOB 2E27L 3A6CL 4PS4H 3FAWA 2XKSA 4ZMAT 4HMCA 4PJFA 1RU9H 5E8DH 4WUUD 4EN3A 3BW9A 4HIIA 3OKLB 3ULVF 2EYTA 1BOYA 1HH6B 2ZUUA 5E7FA 4YJZL 5E5RB 3PP4L 3NFPB 3QNYA 4XMLL 5ADOL 4ONHB 2OP4L 2VLME 4F9LA 2NY5H 3PIQA 3QEQE 3D3VA 3ILQC 1FNHA 3AC0A 5IESL 4ALAL 5F9DC 5EU6A 2N7BA 3TNMA 2ESVB 4L8SC 4KVNL 4U1SA 2OMBA 4NQCD 4M3KB 2DLTA 4GKNB 5HTSA 3AS3A 1IEAA 4P46C 4POZC 3C08L 4HJGA 1CWVA 4JQVA 3JWOC 4CVXB 4I18C 4ZO7A 4LCCC 3QIUC 1QBLH 4GRLD 1BF2A 2VLMD 1BIHA 3QEQD 1QBMH 2J2ZA 2ZZUT 2V9QA 2LE9A 2RIKA 2ITCB 4XZUA 5DUML 1T0MA 3VMPA 3SOBL 5D71L 1QA9A 4S1SL 1AD9B 1FE8H 1I7ZB 2CR3A 2VAAA 3BKYL 4OZIA 3MGAA 2XWBB 3QFDB 1KIPB 1UZ8A 3BO8A 5E03A 5F7WC 1GGYA 4HF5H 3IF1A 3V4PL 2PO6D 4TTDD 5FKAB 2JIXA 2WIIA 4JRXA 1P7KB 4YO0B 2R2EA 2NLJA 2VH5L 5D70H 5GS0C 1ZEAL 1YC7A 5DJ0A 4KC3B 4MQSB 1MNUL 5JXEC 1UADC 4M7LT 1DQDL 4RFOH 5E5MB 4KJPC 4A6YA 4G6KH 3V7MA 3ILPB 3UJIH 4L8CA 1L4IA 3EAKA 3QFJB 1YEIL 5GRUL 1FSKC 3HNVL 3GMPA 4TOYH 2A77H 4PJGB 3JV5A 5TE4L 3GSQA 2W0FA 4LVOC 5T1MA 1F3DJ 4L4TB 5ACLA 5K9KA 1Q9KB 4P2YA 5C09B 4G9DA 3SE8H 3NBNA 1UH4A 4OBRA 1T66C 3QCUH 5GS2D 3W39A 3ZE1E 2R2HA 3BP5B 2QJDA 5AWNH 4JFED 2W9EL 3ULSB 1S9WA 4UB0L 2Y5EA 5EOCJ 4DKFH 5DJCB 4JHZA 4N90E 4OLYH 2ICEB 4K7PL 3V8CA 2APBA 4S2SB 5I1DB 4LLUA 1JZ7A 3CK0H 4TSBH 5H94B 4CMMA 1I9IH 2N1KA 1N5AA 1OAKH 1RIVH 4OTXH 4YHOL 3EDDA 3WLWC 5A3ID 3OSKA 5BVPH 5GRJL 3HI1B 1WWAX 4XXCC 4WWKB 1CGSH 3P3YA 3PDOB 4PJCE 1RJYB 4Y4HD 2IAMD 1HI6B 4Q9RL 4G8IB 4HUWB 2XTLA 5F7NC 1TZHA 2YC1B 4N90D 3SDXA 1YEGL 4PJ9C 5F8RC 3L3OA 3C5SB 1I1AA 1VACB 1G84A 3HNSL 3QG7L 3ZTNL 1LO2H 2P5EE 4NZUL 3HCVB 2JJSC 4I9WE 3EOBB 5BRZB 1N6UA 1E28B 4AEHH 1BZ9A 2JE8A 3L7EB 1JF6A 4P2CG 1S7XB 2XA3A 1OQXA 1OTTD 5D7JC 2Q20A 3HI5H 5C3TA 2BOCA 3T0EA 1HNGA 3DX9B 2V2WA 3RPIB 4EUPA 4JHAH 1E4WL 4S1RL 3RZCC 5E1AB 4O51B 5KSBB 5I1KL 1TZIA 4WTZA 2R29L 2P5ED 3QDGA 2YPLE 3CZFA 4I9WD 5C8JB 2CKBL 4KRPD 3RWEB 1E4XI 5D1ZA 4YQXL 1Q0XH 3P9LA 3V6FA 2DQUL 3NABL 4DN4L 2ADJB 1YN7A 3ZE0F 1IT9L 2ZSVB 2GI7A 1D3CA 5B4MC 1CGXA 2R69H 2NW3A 4UAOB 1MRCL 4LOUC 4X7SL 1OWRM 4OZGF 2NNAB 3UP1A 3MV8A 3LEVL 4MB5A 4L4VE 1AH1A 4NRXA 2EECA 2YPLD 3BP6A 3F7RA 4RGNB 1QFWH 1U8HB 4Z7WF 1XGPB 3P4NA 2ARJB 2EXWC 3DROA 4WW1A 3IVKB 4Z18A 1MQKL 5IJVA 5HHOB 1KJ2H 1S78D 4HHAA 4XWGH 5HDOA 4B41A 1XCQA 1IAII 3TT3H 2EDWA 3TCXA 2DLFL 3MLWH 3HPLA 3RDTA 3B8YA 5HD8D 3JUYA 2P46B 4K8RL 3QNXB 5F1NB 4L4VD 4X6CB 2A6KA 3IS1X 4JO2L 5SX5H 5TQ2L 4UI2A 1KCUL 2UWEE 1OSPL 2EE9A 2YPVH 4UV4H 2JF1A 1HQ4A 1IM9D 4OD2A 5IHLB 1A7OH 1FQ9C 2HP4A 1SYVB 4ZDHA 3L9RA 2CDGA 3LIZL 5E24E 2KUTA 2Q6WA 3QUYC 1ZVSB 3LKPA 4KJQC 3TZVB 1NMBL 4NZRH 2P5WA 1NC2D 1T03H 4O2FB 1RUKH 3CDGA 1EFQA 1JP5A 5M95B 4ZNEE 4KJWD 3OJMB 4KI5D 4PYGA 3TBSB 3TH4T 4KMTH 3TCLA 3DBXB 2VXUL 2VABA 3PXJA 3AAZA 4LSPH 3RUGE 1SVZA 1F3JB 4WVRA 4AIOA 4EBQH 3FO0H 1NCDL 3L6FB 4KY1L 3OKKA 2EKSB 4KKNA 4QXWA 5FUZL 1OT2A 1NGZB 4PY7B 2M1KA 4RMTA 1GZPB 2QR0A 3D2UD 2C26A 4JY5H 4QRUA 5EBWB 1N4XH 1K6QL 2YD7A 2BNQE 1REIA 2K1MA 4LSVL 3P4OA 2XKNA 2Z8VC 5I1GH 2QKIB 4R7DB 2D7QA 1LD9A 1A1OB 6FABH 5FA4B 3PWUB 2YWYA 1N5YH 2HJLA 3GMLB 1LK2B 1SJHA 1CL7L 5E4EB 4N8VB 2ZCLH 1HOCB 2BVOA 4K2UH 4XPGH 2X1WL 1YMHA 5DMKB 2BSTA 2G5BB 1SYSA 4G9FE 5J89A 1NBZB 5ABDE 1EEUA 2ERJC 2C3VA 2FX8H 3NN8B 3P0GB 3U4EA 5ICXA 5E5UB 2BNQD 1GAFL 4GW5B 5E0QA 4NKIL 5ILTL 3VDBA 4O9HL 2RQ8A 1GOFA 3MRMB 3MRJB 3WFCL 1MIMH 4HGWB 4OF0A 3U7YH 1XGUB 3QUMA 1FNFA 1XIWA 3B2VH 1AR2A 1Y6NR 3UO1H 2ATPA 2MCPH 2P1YA 1BBJB 2CDFB 3IFLL 3P4MB 2BMKB 1JHKL 5LGJB 1MLCB 4DK6A 4IIQB 4LLMB 1OGAE 4WHTA 3AREC 3WXVH 5JXAL 3S5LA 4WDIA 4G9FD 5HDLA 4GW1B 3MXVH 3GNMH 1D5XB 1H5BA 1ONQA 4JJ5B 3V6ZA 1PG7W 2F58H 1VGEH 4HDIA 3G6JE 3T4YB 4BKLB 1T83A 3BMVA 3VH8B 1D5BA 2YD8A 4GRWH 3BZFA 5FGSA 4EN3C 4P4KD 4QRQA 4FQIH 1N3NA 1UCBH 1HCFX 1ZA6B 1CXEA 1X5JA 5ID1A 3BAEL 3NAAL 1MI5A 3TA3B 1OGAD 4OLEA 1NDGA 4KQ3L 3TO4B 5JHDA 4JANB 3AUVA 5MENE 2OZ4A 2A9ML 1MLBA 3LZFL 3MMEB 3MLTA 3HNTL 3RAJH 1C5CL 1WJ3A 5IMKA 5BQ7B 1QFPA 2NY2C 2DL2A 1YEJH 3BGAA 3RX5A 1ACYL 1XF5B 4MJIB 3WS6C 5CP7B 3HC4H 5DQ9A 3HUJA 1U6AL 1EGJA 3KPNB 1XF4A 1MIEH 3EIFA 4X5WB 4PJAE 3MYJA 5D7SL 3ROLA 5CEZE 1QSEB 2VL5A 1HHIB 5MEND 1FGVL 1NUNB 3UTOA 1LDPL 3LN5B 2AGJL 1MY5A 1ODAA 2GJJA 5L2KB 3ARDD 1PKQA 3FOLB 4IOIA 1QQDA 5GGSB 2ZG2A 4HS8H 2OX5A 3AREB 2NY3B 2OR7A 1NBQA 2ED8A 1KENL 5J6GB 5ICZB 5DD1H 1DLFL 4DAGH 4JO3H 5J57B 4LSUH 4LMQE 3MR9B 2YA2A 2YBRA 4BQCA 2NY1C 4IMKA 5CEZD 3ARTA 4M7JH 1CXFA 1DVFD 4PJFB 4JN1L 3AFLA 4KUZL 4EN3B 2O5YH 3BW9B 4HIIB 2YHGA 5FCUL 1S5IH 2MOVA 3H7LA 5K33A 4MCZB 5C9KA 5DVMA 2YD4A 3QNYB 3O45A 3PIQB 2NX5E 4CUCA 3D3VB 1K9TA 1J0HA 1NKOA 1RJZA 5TDPB 3NCEB 5IFAL 4F58H 1D7FA 5EU6B 4JFOA 3TNMB 3NCFB 3KG5A 4RX4D 1UYWH 4FQXD 1JPGA 1T6VN 3S36L 1WZKA 2XACC 1IEAB 1Q1JH 3KDMB 4HCRL 4PB9H 4HJGB 2FH6A 4FQLL 3R8QA 4KUCF 1N64H 5IHZB 5AAWA 5CIPA 3DI2B 5JW3L 1CDUA 2QL1A 5F6HJ 5H37G 3CU1A 3OGOE 2H32A 2NX5D 3LH2L 4ERSH 4XZUB 1T0MB 1OHQA 3ZYZA 1G9EA 5I1EL 1FG2A 1ZMYA 4OZIB 1PG7H 4QWWC 5F7FA 3PWPE 1UZ8B 3BO8B 5LVEA 5AZ2H 1YY8B 4PJ8D 3PL6A 3T0WA 4FMFA 4HT1L 2HFGL 4NOBA 3QUXC 2JIXB 1TTUA 2WQRA 1B4RA 4BSWA 5INCA 4JRXB 5GZNC 1I1AC 3V5HA 5AD0A 2R2EB 3W5MA 2NLJB 5DJ0B 3NIDE 4JPIA 1MFAH 1UM5L 1EEQA 4A6YB 2HYMA 4LSTH 3T3PE 2M26A 1BVKA 3C9NA 3FFDA 3KHOA 2RBLA 4K23H 4L8CB 1F4AA 1ROWA 4XNMA 3PWPD 3GMPB 2XA8L 4ZAKA 3U1SH 3DGGA 2W0FB 2D7MA 3GSQB 4FQCL 4PGZA 1FGNH 2IJ0C 3IAPA 4X6DA 2OJZL 2VDOL 5K9KB 4DQOL 3EYUH 4YDIH 1DL7L 3DX6A 2HJKA 3PJSA 3W39B 3P0VL 1YJDC 1BQUA 2R2HB 5CP3H 1WAAF 2NY6B 4JY4B 4JM2F 2NY0D 2OTPA 2VLLB 4OGZA 5J3HC 2EDFA 5D1ZC 2A9NL 4PRDB 2ZKHH 1N2RB 4G5ZH 4HUXA 4M7ZB 1DQMH 1VDGA 4LLUB 1M05A 3F7PC 3VGAB 1QSVA 5CUSH 2EXYC 4LLYA 4PG9A 2Y6SD 4JM4H 4CMMB 4H25A 2YRZA 1N5AB 3QA3A 1MHHA 5J1AB 4MD0A 1ZHNA 3ABZA 3SO3C 1GOHA 4Y4FD 1TQBC 3MRNA 5D5MF 3O2VH 3W11C 3P30L 1J12A 5HHPB 3OR7A 5J06A 1RULL 1GHFL 3L3OB 1I1AB 3TT1H 1NGPL 1PW3A 5I19L 4KK9D 1JWUB 1TNNA 4LCWE 3GFUA 3I6LE 4QCIA 3RDTC 4V2CB 3SGDH 4XPHH 2H2PD 4OFYA 1AY1L 3DMMC 4QHKJ 1QR4A 3UPRA 1MHPL 1UM6L 1AI1H 5GJSL 5JO5B 1B2WL 2BOCB 3T0EB 4GAGL 3NVQA 4AZ8A 2V2WB 4EUPB 1CICD 1IGMH 5LWYL 2PTUA 3RWGA 3WUWA 1TZIB 4KI5F 5HYJE 1ZLSH 4PJHA 2W9DH 1QYGH 4YH6A 3QDGB 2DQEL 1BAFL 1I9RH 4LCWD 4LSSL 1JPTH 4PJDA 4QOKE 5LQBH 3I6LD 5A16B 1KPVA 2NTSP 5E6ZA 2ZCKH 2FJHA 4YBQC 4XNXL 3P9LB 1YN7B 4L1HA 5JZ7C 3I9GH 4L3EE 4PBXA 4P2QE 1B3JA 2QEJA 2NW3B 4EVNA 1JGUH 1NMCC 2P8MA 2APWA 4UTAL 4X7CC 3KPRA 4DFIA 3LCYA 5HYJD 1PDKA 4NRXB 4ZNEA 2BY2A 4QOKD 3QXDA 3P4NB 2K3TA 1TQBB 3BWUC 3DROB 4Q9QH 4J6RL 3BD5A 3QG6A 2X1OA 5IJVB 2VITA 4S1DD 4HHAB 3RUGA 1XCQB 4LBEA 4L3ED 4U0RC 4P2QD 1S8DA 3MBXH 4TVPH 4MWFA 3CMOH 1P1ZA 1WIUA 5GGQH 5KOVC 5KVGL 4NRYB 3EJZC 5IBUB 3HZMA 3TJEH 1TCMA 1TNMA 5GXBB 3B43A 5F1IB 4RAUA 3GO1L 2BERA 2WWKO 4J4PC 4FZ8H 5FHBH 2NXYC 2CRMA 4GRMA 1X44A 1HQ4B 1CZ8H 3PGDA 4HGMA 3L9RB 1NKRA 2CDGB 4JG0L 4ZDHB 15C8H 3QDMB 3L7FA 2P5WB 4ODUA 3RNQB 1XEDA 4ORGA 4LRNL 1JGLL 2ADIA 1W0WA 3LKOA 5AYUH 1AC0A 2A73A 1WZ1H 1RK1B 4NM8L 4JPVL 4ETYA 4Y0GA 3UTTB 4HG4J 3TCLB 4XP6H 1DN2A 1I9JH 5CILL 3ARUA 2KDGA 4F7TA 1KLGA 2HLFD 3AROA 3C09B 3HKFA 3IDNB 3UTSE 3S6CA 3OKKB 1T83C 5MERA 5D2LE 5D72H 2QR0B 2FEEI 1F00I 4F33B 5SWSE 3P4OB 2XKNB 2J3SA 1MRFL 5B39G 3V4UL 1XGQA 3RL2A 3UTSD 1LQSR 3GBLA 1SJHB 1WTLA 4XAKE 3VG0L 2BVOB 5D7IF 1IM3A 4LPYA 1P9MA 2R8SL 1YMHB 2BVEA 2BSTB 3PWJA 1SYSB 1F4YL 3GMNA 1A0QL 2C3VB 5MI0C 2IBBA 5ICXB 1EHAA 3EFDL 5SWSD 5GRYA 2W60A 4I77H 3RI5K 3ELAT 3AVEA 2FSEA 2HT3D 3QUMB 4ZOAA 3VXTA 1XIWB 4JQIL 3HAEA 1W0YT 3NMEA 4PJ5E 3TH3T 2EIEA 4XAKD 2Z8WC 2PO6C 3QQ9C 4TTDC 4WHTB 5DJZA 4UIKL 4K3EL 1I1CA 2HMID 1AIFB 5CBAA 2IPTL 3S5LB 2YD5A 1H5BB 1ONQB 2HKHH 4IMLA 3V6ZB 4DGVL 4WI8A 4GRWE 4HDIB 3K81A 3MQIA 4IMKC 4U7SA 1D5BB 3GKWL 3G9AB 4V1DE 3GJFH 3BZFB 4LLAA 4PJ5D 4QRQB 3V79C 1JRHI 4EQ3A 5ID1B 3PF2A 1YECH 4U6TA 2PR4L 4BQBA 1MI5B 4ZYKA 1NDGB 2A6JB 2JB6B 1I8IA 5JHDB 2G60H 3S35H 4GMSH 3QWRD 3PABB 1MLBB 3VW3L 2DBLL 3PP3H 4HKJA 4QHUB 3SCMA 3LMJH 1JI2A 5JQHC 1FYHB 5BXFA 1I4FB 2OK0H 1R5WA 5J12B 3CZJA 4V1DD 3ARZA 1U2HA 4ZTPH 3D9AH 2PCPA 5DQ9B 2MJWA 3VMOA 3HUJB 1XF4B 3SKJH 2AEQL 1CFVL 2CK2A 2FATL 1MJUL 4WI6A 3KLSA 4PGEA 3MYJB 4YBLC 4YAQA 4YXHH 5LXGH 3T0DA 3SQOL 4GLRH 4PP2A 5JPMB 3WIFA 4ONOA 2V7HA 3U4BL 3HR5A 1CGUA 2F5AH 3NCJL 1NAMA 2FECI 3DUSA 1PKQB 1U8MA 4DGYL 4IOIB 3GKZA 4MA1C 5DQDH 4TNVK 1QQDB 3T0XA 3PL6C 3BN3B 5DJ8B 1JYNA 3G04A 3UMTA 3TPUA 4LL9A 4HG4K 4LEOA 4FFWD 3GI8L 3FTGA 1U3ZA 4FFYL 1OTTC 1JFQL 1J1PL 4MA7L 3VDCA 25C8L 3LKQA 4ZUUA 3QRGH 3UJTH 4FA8A 1FZJA 5ICYB 4KDWA 5DO2D 5IEHA 4XPBH 3ALPA 3X11A 3ULUL 4JFOB 4RAVA 2YA0A 3U2SB 4KRPC 5FB8A 1JPGB 2A6DA 2VN4A 2WP3O 1IKFL 4G43A 3F7QA 4XMLH 2OBGA 1Q9WA 4WEUD 5CIPB 3VXUB 3VFTA 1ZVYA 4I3SH 4QLRA 4OGYH 2VKXA 4NWTL 4YBLB 1S5HA 2PUQT 3CLEL 1KB9J 1WWWX 2H32B 1VA9A 2OJEA 5HGDA 5IESH 2J1KA 3IT8D 3L3DA 1JTTA 1MH5A 1BFSA 4KVNH 4X6FA 1FG2B 4DZBA 3IS0X 3C08H 5GGVY 5TPWL 2BSRB 1S78C 4FP8L 2ZCHH 2DLEA 4RRPG 1WISA 4U6HA 4M6ML 5HYIA 1JYVA 3AY4C 3U46A 4ODSL 3SQBA 2XKUA 4PJBF 5DUMH 5B8CB 3IAQA 3JZ7A 3V5HB 5BW7A 5AD0B 1YEKL 3HE6A 2HFFA 3D6GA 3MOBH 4S1SH 3BKYH 4ZUTA 1INQA 4HIXL 4KJYA 4M3JA 1BVKB 1NGYB 2FHCA 2VXQL 4ODTL 3C9NB 1HHKA 3S9DB 2UY6A 3V4PH 4HUVA 3VE0A 3ZMRA 3F5WA 4ZAKB 5SV3A 4GSDL 5TGBA 4X6DB 1ZEAH 2J8HA 4I5BA 3U83A 5GRWA 4XTRC 1MNUH 3DX6B 1FFOA 1XGYH 2HJKB 3PJSB 4JDTH 1FPTL 2GJ6A 5ISZA 1NANH 4KJWC 1L6ZA 5DA4A 5GRUH 1G9NL 3F58L 3HNVH 2BC4A 1JGVL 4QKXB 3SJVE 5TE4H 4ZSOE 4CMHB 4HUXB 3BJ91 3BPLB 3E6FA 1R3JB 3MJ9H 4W4OC 1KSRA 2C7UA 3QCTL 1M05B 3TH2T 1XH3A 2I07B 5JOEA 1XGRA 5FOJA 4LLYB 4PG9B 4BZ2L 5GISL 4H25B 4J3WA 3VMNA 3QA3B 5B22A 3THML 4CN1A 2F8XC 1MHHB 1ZHNB 4IRJD 5I6XB 1JGDB 4K7PH 2YN5A 3ROOA 3VI3F 1R3IH 4QRTA 3SJVD 3MRNB 3OX8A 1TTGA 4KMQA 2BY3A 5C0CB 1LDSA 3OR7B 4UV7L 1PLGL 4X4MA 5T3XL 2JCCA 1A7BA 4YHOH 5F7LB 4D0BA 2X4SB 4QCIB 4XB8A 3EDJA 5HSFA 2DL9A 3VFRA 3VXOB 4Q9RH 1KOAA 3H9ZA 4U1JB 1G7QA 1YEGH 4NSKB 3OPZL 1HNFA 3DARA 4AIXA 1PYWA 3HNSH 1WEJL 3ZTNH 2C1PA 4NZUH 1DUYB 1RI8A 3STZB 2IH1A 3RWGB 3WUWB 5ADPL 5DVLA 4PJHB 5HY9A 3MSPA 4LP5A 1NEZG 4JFXA 4M6OL 2GKIA 4IRZL 4P2OD 5K9JL 3MV7A 1NCBH 4PJDB 3ZYOA 1KPVB 3D0VA 2IH3B 3NZHH 3BOVA 2FJHB 4BJLA 3ARBA 4UBDD 2VDPH 3OB8A 1FFNA 4X4YA 2ZSWA 4S1RH 4OJFL 3T65A 1C1EL 3U4AA 5I1KH 5IBLD 4EVNB 2R29H 3WNKA 3EHBD 2AQ1A 4P3CL 2P8MB 4K3GA 2GSGA 4YHYB 1LHZA 1H3XA 4J8RA 5ACZA 2CKBH 1H3GA 5HDQL 4P4KC 1VGKA 2X1QA 1KB9K 3QXDB 3UZQA 1WT5A 2E7CA 1CDGA 3NABH 4DN4H 1OCWL 3B9AA 2ZWLT 1IT9H 3BQUD 1PEZA 3QG6B 3C60A 4TVPE 3U48A 2VITB 2ICWJ 3JVGC 5KSUA 2N56A 1MRCH 4X7SH 4AMKH 4Q2ZB 4LBEB 1GSMA 1S8DB 2AI0L 2C9AA 2AJVL 3LEVH 4MWFB 1P1ZB 5ERWA 2ILLA 1T1XA 3HZMB 5HJ3A 2OTWB 4JFZL 4Q6IC 5F1SA 1MQKH 4HWUA 2GITA 2FD6L 1P9MC 2CUIA 4XXDA 3FB7A 3RI5F 4GRMB 3BKJH 4TVPD 5C0FB 2Z92A 1P7QD 3AM8C 3CX2A 1CDHA 4MS8C 3TIDA 7FABL 2VQUA 3LB6D 4XNUH 4WI4A 1AXTL 4K8RH 3L7FB 4ENED 3DETD 1MCPH 4HWBA 5IROA 5C1MB 3W0WA 1W0WB 3LKOB 5LBSL 1KCUH 1OSPH 2A73B 5AEAA 3MRKA 4P23A 1RZJL 4BELD 1BBDL 3GHBL 1PVHA 2R4RH 1YEDB 5DTFA 3WUZA 2FLBT 4OD1L 5E1HB 4F7TB 4POYA 1KLGB 1E6JH 1NMBH 4WI3A 3OB0K 3BGFB 2HFTA 1DVFC 5HYFA 4D94A 4NRZA 1PZ5B 5GGTA 4HV8B 5C07E 4EDWL 3OKMB 2MTPA 3VDAA 5MERB 1KB5A 1A21A 3TN0A 1E4KA 4GRWF 5IBTH 2VXUH 4QXUL 3K7UA 5F7HA 1RIUH 4NUGL 1U8NA 2EDJA 1N6VA 2Z31D 4XRCA 1NCDH 3EOAA 4KY1H 1QD0A 4YHML 3EYQD 4WO4B 3S98A 3RL2B 3BZ4A 5D7LD 3QP3A 2MQCA 5C07D 1FZOB 4M02A 1HDMB 3WN5A 1K6QH 1Q38A 4NO0A 3PWJB 1CGVA 4LSVH 3GMNB 4ZS7L 5E8OB 3I2CH 2YXMA 1F42A 3FZUC 3QDJE 2CLRA 5HHMB 1S9KC 5IW1A 3NIGF 2W60B 1SHMA 4MLSA 2E7LC 2CKNA 2FSEB 1CL7H 3VXTB 3WFDL 3B9KA 2BDNL 1RZKL 1R3KB 5BO1L 1AJ7L 5CD5D 4YHLL 4ODBD 5DJZB 1S7VA 5CBAB 3R0NA 1FLRL 4S10A 2F74A 1GAFH 5ID0A 3ZLQC 4NKIH 2V9RA 3KYKH 4O9HH 5JIPA 3S3JA 5CLTA 3WFCH 3HA0A 5FKPA 1HEZA 3QDJD 3KYAA 5B3NA 2V2TA 2CIKB 2DYPD 5KN5A 2G2RA 4YC2C 3KPSA 2X42A 3O4OC 3ET9F 3IFLH 3G5VA 1UQSB 2VDQH 4PJEF 2VWEE 3PWLA 4MA3A 1OWWA 4HMDA 3Q48A 3QZWG 4RMRA 3BDXA 1ND0A 1WFTA 2R4SH 4ZYKB 2YR3A 2G75A 3B5HA 4U2YA 3OJ2C 3MNWA 1UKTA 1I8IB 4ZS6D 4GXUN 3LY6A 4NN6B 43C9B 1LEIA 4KGJA 3IDGA 4OZGA 3SCMB 3VXRA 3ZT5A 4RDQF 2VLJE 4FXKB 2P8PB 3MRPA 1R5WB 1U8IA 3MV9B 2ZUWA 5I16A 2EE3A 1MHCA 4MXVE 1NLDL 5E6IA 3BAEH 3NAAH 1CF8L 2PCPB 4JFFB 1ORQB 2WP3T 5DD6A 3TIEA 4KQ3H 3SDAB 2DMKA 1V7MH 1YMME 5IJKA 2A9MH 4NKOA 2Y6SC 5L2JA 4PGEB 1IARB 5KVMC 4YAQB 3HNTH 4C55A 2XZCH 1C5CH 5FV1L 4PP2B 4QNPE 4LSRL 3WIFB 3AB0C 2V7HB 3HR5B 2VLJD 1NAMB 4OQTA 3DUSB 4Y4FC 1U8MB 3HG1E 3QUML 4HZLA 1AE6L 2GY5A 3IDMA 1U6AH 4XVUC 1QNZH 1S7UB 5E00B 1PZUB 1HYSD 5D7SH 2CO6B 4KK9C 1FGVH 1M1SA 2O5ZL 4QF1B 3O9WA 4M1DL 3O8XA 2AGJH 4BQ9A 4PJ7E 3VFOA 3O4OB 3TPUB 2H2PC 4U6VL 2VZVA 1MSPA 2YZ1A 4Z76A 3FTGB 2AJXL 3DPBA 3LKQB 1KENH 4ZUUB 4Y4KD 4GKZB 3DUUA 3FN3A 2E9JA 2XOTA 1FZJB 3FN0L 2EDYA 4O5LL 5HGGS 1Y0LA 2ZPKL 3QT2A 4JN1H 5D96C 4KUZH 5SX4I 4P5TD 4RIRB 4X9FA 3DURA 1NEZA 4RAVB 1S7SA 5EG6C 2OZ4L 3V9FA 3O2WL 5FB8B 5FCUH 1ZS8A 4UINL 2A6DB 4MJ6A 4RGMB 1CE6B 5F3BA 3ARRA 5ANME 3S8WA 2HLAA 3P73B 1MF2L 1YEHH 1JGEA 4K3DL 5MHSD 4QHKI 4Y2DD 4GG6E 3SE4C 2OJEB 5HGDB 3VXQA 3L3DB 3O3EA 5TE7L 1C16A 3S88L 4X6FB 4CKVX 1GC1L 5MP6H 3D39E 4HCRH 1JPST 4MYWB 5A43C 2GY7B 3PUCA 3LD8C 5IGXL 2D3VA 1A4KA 4OF6A 4MHHG 1IC4L 3TBVA 4U6HB 4NYLA 3LH2H 4G8EA 3QB7C 3U46B 1MVUA 3C6LD 3HE6B 2HFFB 5IFJA 1U8QA 5I1EH 5JNYB 3B8SA 1JVKA 3EOTH 4KJYB 4FTVE 1ZTXH 1LP9E 3K74B 5DMGD 1HHKB 3B5GA 5KTEH 1LILA 1CFSA 3D39D 4HUVB 2OR9H 2ARWA 3TWCH 3VE0B 1DQTA 1DUZB 2HFGH 4HT1H 1JTPA 5DLML 2J4WL 1QSZA 1QLRA 5H35A 1JYXA 4FQ2L 5TGBB 5C0AD 3BH9A 1CDJA 3VWJD 4I5BB 4CN6A 1JN6A 1UM5H 1X7QB 2E7BA 1OW0A 2GJ6B 2EEAA 2VDMH 3AMLA 1ZK9A 1UENA 2GQHA 4AQOA 1HHGA 3TBTB 4FTVD 4J3VA 4XH2B 3ZE2E 1UVQA 2RJMA 5HVWA 4FQCH 3QUZD 3SGJA 5DGQA 1HINH 2OJZH 2VDOH 3E6FB 1QSFA 2PYEA 4DQOH 3KGRA 2B5IB 3WHE1 1XH3B 4IHOB 1DL7H 1L6XA 1XGRB 3P0VH 1Z9MA 3DTXA 3KNBA 4NHCH 3WIIH 4EEEA 4PJIA 3REWA 5E08L 2A9NH 2VXTH 3S3PA 5IM7A 1Q0YL 1F4WL 1WT5C 1Y6MR 4DUVA 1L7IH 1GVIA 3LHPL 3R4DA 3OX8B 1J0ZA 3ZHLA 1YPZA 4PUBL 5B38B 4Y1AE 2VL4A 1D6VL 4YDLC 1MJJB 1KTLA 2R0WL 3OBAA 4D0BB 3FT4A 1BFOB 3NOIA 4UOW1 2OXGA 4GBXD 1A5FL 3VFRB 1YNLL 1XZ0A 3P30H 5I8OL 1G7QB 5I9QC 1GHFH 2B39A 1PYWB 5C6TH 4NQDA 2C1PB 1T0NA 2HT3C 2IH1B 4Y1AD 1BM3L 1SEQH 4BSVA 4JFXB 1MCLA 3MV7B 1AY1H 3CFJB 4K7FB 4OFIA 4NNYB 1RAMA 5IROC 1NCUA 1B2WH 1L0XA 4X99B 4YHIB 1A7RL 3WE6A 3ARBB 2PW2A 4P23C 1HHJA 1FFNB 4QEGA 2FHFA 2ZSWB 5IUSA 5JW4N 3QIWB 3GBNL 2X89A 4NQUA 3T65B 5LWYH 4N0CD 2VSCA 1DBJL 1CK0L 2QHLA 1BECA 2DQEH 4JB9L 4LSSH 2GSGB 1W8OA 5TDOA 3HMXL 1JF5A 4J8RB 4JREB 5ACZB 4XC1L 1VGKB 3K1KC 3Q6GL 4XNXH 3E3QE 1TZGH 3TN0C 1J8HE 5D6DA 1V7NL 5BV7B 3C60B 5EO9B 1WFUA 3JWOH 5KSUB 2OTUB 4R4BA 2HJFA 2ATKA 4NQED 2B4CC 5I71C 1IEHA 2NW2B 5ERWB 4U49A 1UB5B 3RFZC 1CLZH 1T1XB 1Z5LA 2W59A 3BFOA 4OM1H 5EU4A 2FGZA 5HJ3B 5I73C 3G08A 4S1QH 1UH2A 5DUPH 4MA8L 2VMFA 5I9QB 2GITB 4UQ3B 2F19L 1ZXQA 4PGJA 4O2EA 3HRPA 3I3EA 4XXDB 5E6YA 1J8HD 1VADA 2QSTA 1JNLL 1G7HA 1D5IL 4IJ3C 4YDVA 3TIDB 2R2BA 5KVGH 4WV1A 5KS9F 5GS0H 4J3XA 4IRSA 3E1F1 2WUCL 5EC1A 5IIEA 2XICA 2AXHA 3GO1H 2OI9B 3W0WB 5IHBA 4LAJH 3B9KC 3K4DA 3KWWA 1RZGA 2FLRT 2FECL 3LVEA 4OIBA 1CR9L 1UKSA 3ARVA 2QQQA 1SBBA 5DTFB 1HKFA 3OR6A 5E99L 1BPVA 4K8RD 4ZD3L 1BFVH 3WKNA 3CPLB 3STLA 4FFWC 2I9TA 2D9CA 1W72A 4LRNH 1JGLH 4NO2A 1V3LA 2VLRE 2IANE 2MNUA 1WAAA 3T0VA 1KB5B 3WNPA 4NM8H 1NFDE 3S96A 4JM2A 1FO0H 3U30B 5CILH 2OLDA 1D5MA 4K07A 1SY6A 2CRYA 2VXSL 2NR6C 3Q6FA 5LCVL 2APXA 1U8NB 3HLAB 4K9EL 5DO2C 3EO1A 3JWDC 5EB9A 3JV4A 3Q5TA 3C5ZB 1VFUA 2HTLD 3EOAB 4L1DA 5FM8A 4YHNA 4PP1D 4KPHL 1EK3A 4P9ML 3HE7D 1NFIA 5JLZA 1A14L 5I73B 2P49B 1GGBL 5F8QC 1WK0A 3MRLB 2FIKB 4JO4L 2VLRD 2IAND 5ESQA 5CZVH 4F57L 3WN5B 4NO0B 2EH7H 4MVBC 1FAKT 5D5MA 3N1FC 1YDPA 3BGMA 3SGDI 1MRFH 2CLRB 5IW1B 1BJ1H 4HJ0D 3V4UH 5GHWL 3SKOA 1XCTA 12E8H 5L88L 4W6YB 2DQIL 3VG0H 5DS8B 5DHVB 4MGXA 1FLTX 2H1PL 2R8SH 1EO8L 1PY4A 2IG2L 1F4YH 3MRHA 1U8LA 1A0QH 1S7VB 5A2IH 2Y4SA 3EFDH 1YMMA 2F74B 3BEWA 5ID0B 5IW6A 5DURB 1HEZB 4U1GB 1YEEL 3KPQA 5DUBA 2CRZA 4WFGE 2V2TB 3CXHJ 3IU3B 3O8XC 4JQIH 3TVMA 2G2RB 5KN5B 3KPSB 3BHBA 1VERA 3G5VB 1EXUA 3HG1A 2Q7NA 2BVTA 1MHEA 3PWLB 1T1WA 4P4RA 1PBYA 4DEPC 5CD3A 1I7TA 4G8GE 4FS0A 2AVGA 5BOZG 3U82B 4DGVH 4JY6A 4DOHB 4XVJL 2G75B 5FYKH 2DM2A 3MNWB 1U3HA 2ZUSA 1F11B 1JPFA 1Y18B 2I25N 1LEIB 1FL6A 4YR6A 1ZLUK 3IDGB 4OZGB 1L9MA 4KZDH 4GUPA 2IPKA 4WFGD 4OT1L 3RZWA 4Y5XC 1Q72L 1U8IB 5F70A 5I16B 3O81A 4F37K 4JPWL 3BPCA 4H5SA 5E6IB 2PR4H 2W38A 5F6IC 1HILA 3QDHA 4G8GD 3TIEB 3C8KB 5EZJA 1ZE3C 1MUJA 2DKUA 5HGAA 3G5YA 4NKOB 3VW3H 5L2JB 4DN3L 5KG9A 2A74A 3RL1A 1FYTE 1OP5K 5DFVC 2C3GA 3EJYC 4YHKL 5C08A 1P6AB 43CAA 1WQVT 5JORA 2W91A 5HVFB 4KGLA 1NMAH 4PRIA 4HZLB 2IMNA 3IDMB 1UM4H 3FL7A 4OFVA 1CFVH 1PG7X 2FATH 1MJUH 3MGOA 4QRSA 4Y5YA 1T22A 3D85A 3N0PB 1IEBB 3UJJL 3O4LE 3O9WB 1JZ4A 3U4BH 3GDBA 4W4NA 5DGRA 1FYTD 3QHZL 5FYLL 4F9PA 4Q7DA 5C0ND 4Z76B 4OZHE 4ZO9A 1G7MB 1P4BL 1UG9A 4DEPB 4F3FB 2AEPL 4HH8A 4OUOA 3OKNA 3DUUB 2V5SA 5GRVK 3TO2A 2P42B 2VZOA 5D1XA 2F8VA 3WBDA 5FEBA 3ZT6A 2HFEA 2B1HL 2E6QA 4H0HB 3TYGH 1IGJA 1Y0LB 2PTTA 5ALCL 3GI8H 4OLWL 5SV4A 1QP1A 3O4LD 1A3LL 3DURB 4FFYH 1S7SB 1CS6A 1JFQH 1J1PH 1OW0C 5AG8A 2XZAL 1MOEA 25C8H 1ZS8B 2FGWL 4UBDC 4XVTL 1K5NA 2VOTA 4LHUA 1XR9A 5F3BB 4OCWL 2ZOLA 5CFHA 5DD5L 2HLAB 5IBLC 5C0BE 3BRGC 1JGEB 1AGCA 1MRDL 3VXQB 3ULUH 2DQGL 3UBXA 3QI9A 4MJ4A 2EDTA 2IQ9L 3O3EB 4KVCL 1C16B 5ESAB 3VXMB 4JRYB 1IKFH 5JHLH 4Q9CA 2CGRL 4CU7A 4HUUB 1E4XH 4LRIC 3BQUC 3MRIA 5EH1A 5D7IA 3EYFB 4MXWL 1A4KB 1NAML 5FO7A 4NN5C 4QRPE 4NWTH 4GXUM 4NQXA 4YIQA 3CLEH 1L0YA 4NYLB 5IHUH 3MV11 4JKPL 5C0BD 4K3JL 1MVUB 1EAJA 2CR6A 2KQNA 4WJ5B 2F53A 2AK4E 2VE6A 1HXMA 1U8QB 5E8NA 4ZOEA 5ESVA 2D7PA 4X4ZA 2XTJB 5J6HA 3W9EA 1Z3GH 5KVDL 3GMOA 3MBED 1KLFA 4U2ZA 5CAYB 3MA9L 3O6FA 4Z7OF 4FP8H 3RWIA 1WLHA 3O11A 1ZHBA 3OAZK 5EOQL 3CXHK 1QLRB 4M6MH 4FQQA 2EEBA 3BZDA 1MCKA 4ODSH 3FQWB 4QRPD 1H8NA 3SDCD 1U9KA 2BNUA 1RUAH 5HPMA 1ZT4A 1FNLA 1JN6B 1E4JA 3UAJD 4HIXH 4IDLA 4QXGH 2AK4D 1J88A 2R0ZL 4ODTH 4ELMA 2E9BA 3U0TA 1JWMA 1OAYL 3SDYL 1RHFA 1HHGB 1M7XA 1OAUL 3MNVB 1UVQB 2VZSA 3W81A 1MJ8L 1YZZA 4GSDH 4M1CD 3IDIA 4F15B 5JR1L 1QSFB 4H26A 2Z4QA 1HN1A 4NQCB 1PQZA 3DRQB 2NCMA 4OZFA 2ESVE 2R1YA 1FPTH 3T3MF 3DTXB 3KNBB 5FYJL 3BDYL 4UIMB 1JZ6A 4AL8L 2QTEA 1IILE 4JHBA 2GK0B 5CSGA 1R3HB 1JGVH 3OJDA 4M43H 1AFVL 3REWB 5DXWA 3AU1A 2BNRA 4GRLB 4Z6AT 5IM7B 5IG7A 4LCYA 1OB1A 4L8DA 2Z31C 1K8DA 3QCTH 3QPQC 5D6DC 3GZKA 1YPZB 4MHHI 4M5ZL 2FZ3A 4YFDB 4AEEA 3EO0B 1Q9OB 3FO1A 4MJ5B 3BESR 4PRAA 3VFNA 1KTLB 3THMH 1I8MA 1NFKA 2ESVD 3FT4B 4RNRB 2UZXB 3NH7H 2DMCA 4R2GC 5EO1B 1W0VA 5DMIH 1EFXA 1OAQL 1DLHA 1XZ0B 5KW9L 3CLFL 4WI5A 1MFEL 2Q1EA 1A6UL 4N1HB 4DKDC 4UV7H 4NO5A 4G6JL 5T3XH 3WLBA 4JCLA 5ETUA 4NQDB 5KANG 1JK8A 1KGCE 1KUMA 1T0NB 4RCAA 1AR1D 5BVJB 4BSVB 5F88A 1R5IB 3QFJE 3QXAA 5ITFA 1RQ5A 4ZUVB 4A6YH 1K4DA 4PJGE 1AD0A 3MLRL 4H8WL 3OPZH 3WE6B 4L4TE 4LDOB 2PW2B 3V6OA 1WEJH 2HTKD 4GS7B 4QT5A 5C09E 2OR8A 1AC6A 1V3JA 1FV1A 2HWZH 5ADPH 4JFEB 1QVOA 5BJTA 4M6OH 4IRZH 5B3JE 1KGCD 2PN5A 5TDOB 1VFOA 4NCC1 1GZQA 3DJ9A 3DSNA 4Z7VA 4FZEL 3QFJD 3QXWA 2XQBH 2W0PA 3R1GL 3MTRA 4TQEL 4OJFH 1C1EH 4OCMC 3ARYA 3ILQD 4L4TD 1K2DA 4LEXL 1QR1A 5A2JH 4R4BB 1MCDA 4K7PY 5C09D 2HJFB 2VZ1A 2ATKB 4C83B 5F21B 4GAYB 4X6EA 3X3FL 3R8BB 4CJ0A 4Y4HB 5HDQH 3IKCB 1H8SA 2IAMB 1Z5LB 5EU4B 3GSVB 1OSZA 2P7TA 3TGXA 2VWEC 3QAZC 3G08B 1OCWH 1HYRC 5EUOF 5FGCB 8FABB 5E2UL 1EZVY 2K7PA 4QY8A 3DECA 4O2EB 3QIUD 1H3PH 1OARH 4FFVD 4MB4A 3WDJA 1CT8A 1VADB 2GTWB 3MROA 2AJVH 4BZYA 4JHWL 1G7HB 3BJLA 4HH9A 5IQ7L 4YDVB 4IEFB 2R2BB 4WV1B 4PJBA 3W9DA 5HBBA 4IRSB 5I18L 1YYLL 1T1ZA 4S0SD 4LVHB 5IIEB 1KEML 2LTQC 4Y5VB 4I0KA 4G6FD 3KWWB 1RZGB 4BK5A 3RX7A 2D0FA 2CDEB 5KSBE 5EU3A 3ULVL 3RWDA 5GS0D 2IF7A 3OR6B 4EUPH 1AXTH 1KNOB 4I1NB 3SPVA 4F7MA 5JXED 4NJ9L 3TP4A 5CJOL 4FQHA 1KV3A 1W72B 1IC1A 5GJTL 3TVMC 5LBSH 4LSQL 4EI5A 4Z7UE 5CCKL 1MREL 4JM2B 2FL5A 3C2AL 1RZJH 3LAFA 3S96B 3GHBH 3ALWA 2Q8BL 2D9QB 4OD1H 2V5RA 4WI9A 3Q6FB 4MAUL 2EDRA 3JV4B 2YPLB 4FFZL 5BV7L 1T66D 1U3HC 3HZYA 5DD3L 4FRWA 4I0PA 3GBML 4P5TC 4F37F 4CU6A 3S35X 3QAZB 3EDFA 4Q9BA 5HHOE 3TPKA 1FHGA 5JW4M 3LN4A 4XNZC 4GW4A 5ESQB 4QXUH 2VERN 2X4UA 4N1CA 4ODWA 5D5MB 1YDPB 3BGMB 4APQA 3QXTA 3KYOA 3WLWD 3SKMA 4YHMH 2D0HA 3MFFB 3SKOB 1UCTA 2X9XA 4J3UA 1MPAH 4K71C 3F7VA 4TTGA 5F9WB 1JZ8A 5IR1A 1QLEH 4YK4B 3GSRA 3MRHB 1U8LB 4ZS7H 1FVCA 5HHOD 4HWBL 5C9JB 1TQCB 3TNNB 1A6AA 3Q5YA 1QPPA 3BEWB 4LKXA 5IW6B 1NC2B 3C6LC 3QIBA 1XF1A 5T1LA 1OPGL 4Y5YC 5DDHA 2BOBA 3KPQB 5DUBB 3KPOA 1ITCA 4KHXL 2BDNH 1RZKH 2E7MA 5CZXD 1EXUB 4YHLH 4F9PC 3MNZA 3L5WB 3MJ7A 1MHEB 3VD3A 1T1WB 5FYKE 4P4RB 3E6HB 5CD3B 1I7TB 3RJDA 1KB5L 5FK9A 1FL5A 2E3VA 4KKCC 4FNLL 2O61A 3UPAA 1JPFB 1NSNL 5LGHL 2X7LA 2R56L 3H9SD 2B4CL 1JZ3A 1FBIL 4GUPB 1EDQA 2IPKB 2AXJA 1T4KA 1UA6L 5FHAL 4P5KA 4OM0L 4Z9KB 3QUZC 1PD6A 4H5SB 2XN9D 3BT2L 4ZTOL 1U8KA 5FYKD 5GQBA 1QKZH 3SKNA 5B4MD 1FNGB 1HILB 1Z9SA 4LOUD 5IWLA 5EZJB 2GSIA 3QBTB 7CGTA 4NZTL 1C5DA 1F4HA 1TITA 1C8PA 3TBYA 4HX1B 5KG9B 2A74B 3RL1B 5C08B 1A9EA 5JORB 1NLDH 2B20A 2J8UE 3H2WA 3ZKQD 4PRIB 2M2DA 4ETQA 2HT4C 3SO5A 1QRNA 3EYVB 5CJ8A 4MZ3A 1U3YA 2DJSA 1ULVA 4D8PA 3GIZL 4AG4L 4QRSB 5I74B 4GFTB 2MQ3A 4HCRA 1IGTA 3D85B 4OD3L 5CSZA 4QRRA 1CG9A 4ESKA 2MPAL 4LSRH 3PDGA 3C87A 4AEFA 3ZO0A 1NEUA 4GBXC 3QUMH 1XF2A 1AE6H 4G9FB 1TIUA 1JI1A 3FRUA 4PG2C 1TLKA 5I1IH 1G1YA 3O6FC 3MUGB 4OIIL 3OKNB 3IGAA 35C8L 4P2RA 2UZIL 5C3LD 1PSKL 1UWEL 3TO2B 1I75A 2O5ZH 5D1XB 1LNUA 3EKCA 2NY7L 5IF0A 2HFEB 3HTLX 5DC9B 1BLNA 4U6VH 2PTTB 1U36A 2QADB 4GH7B 1EH9A 2DM7A 2AJXH 3BPOC 4N0UA 2OL3A 3NIFE 3QPXL 1IZKA 4LIQL 1K5NB 5EFIA 4LHUB 1XR9B 2H2SC 4QYOA 3QEUA 4L3CA 3MGTB 3ULUE 1RJLA 3FFCA 3WD5H 2ZPKH 1BJ8A 3K4ZA 5GRXG 3VRJB 1JZ2A 4BZ1L 2OZ4H 3QI9B 3RGHA 2Y36L 3UBXB 5JTWA 1NL0L 3O2WH 4UINH 3M1BA 4MJIE 3EYOB 1BEYL 3SGKA 1X5YA 4D9QE 1CDCA 3MRIB 5D7IB 3O3DA 1IAOB 1SQ2N 5F72S 5FO7B 1MF2H 5DRXA 1QSEE 5I66A 1UJTA 1RFDL 1CL7I 4K3DH 4K7PX 4NQXB 5CINH 1EGJH 2VDLL 4YIQB 3ULUD 3EJJX 4N8VG 2RFXA 5TE7H 3S88H 3IFNL 2F53B 4IBLT 1X5GA 3WJLC 1HXMB 2H3NB 5J6HB 3W9EB 3MC0A 1JNNL 5T3ZL 4CVXA 3GMOB 3FT3A 5IGXH 1WFOA 4MJID 1EZVX 3ES6A 3E3QC 4D9QD 1IC4H 5FIEA 3O11B 1ZHBB 3FKUS 4FQQB 1RZ7L 2ITCA 3RX8A 1FORL 1QSED 4PV9A 2BNUB 3IDYB 5HPMB 3TJHD 4PJFE 1Y6KR 4CBPA 1ZT4B 3U9PL 3RNKB 2FJFA 3BP7A 3VI4E 1JWMB 4PJEA 3ARED 2NY3D 5DLMH 4WW2C 5F7YC 2UZYB 3D3VE 2YA1A 2C1OA 3P11L 3V6OC 1MCBA 3ALXA 4K8RC 3VH8G 4H26B 2Z4QB 1UZ6E 2EEDA 1PQZB 5EU6E 2EDXA 3ZDXF 5GS1C 4OZFB 1XMWA 3ILPA 3SE3A 4EN3D 5L0QB 1I1FA 3MRGA 4LPVA 3G6DH 3RIFK 1E6OL 4Z0BL 2R1XA 1C7SA 4M7LL 5IQ9B 3VU2A 3AU1B 2BNRB 4POUB 1EAPA 3BKML 3VRLE 4Z7NE 1KC5H 1OB1B 4L8DB 5B3JF 1K8DB 1U95A 1YYML 1GPOH 1ZA3A 3D3VD 5CIPH 4ZXBA 4KQ4H 2HTLC 3E8UL 5DHYB 3T08A 3FO1B 3VFNB 2H32H 5EU6D 4OZIE 1MWAL 1I8MB 2NY2D 5DJCA 5E08H 3MLYL 3V5DA 2WBJA 5JOPE 2W65A 5T3XE 1KIQA 1EFXB 4JZJB 1Q0YH 1F4WH 4OCLC 5I75B 2I26N 4NO5B 4JRXE 4JQXC 4PUBH 1NCCL 3QCVH 3WLBB 2QV2A 3ZYIA 4HJ0C 4OCSL 4AEIL 1JK8B 2F8OA 3VRIB 3INUL 3HI1A 3V7AE 4WWKA 4N8CL 3PDOA 2BJMH 5L9DH 3QWQB 4AT6B 1A5FH 3H42L 5ITFB 5JOPD 1K4DB 5C6PB 2VC2L 1AD0B 5T3XD 1GGIH 1HIML 3PNWA 3NCCB 4I2XA 4XNYH 1XF3B 5C2BL 2JIXD 1T2QL 4QT5B 4HJJL 1FV1B 4JRXD 2V5YA 5BRZA 1QVOB 5HVGB 2PXYA 1E28A 2AXGA 3O3AB 5C2UB 4DKEL 4KH2A 2BRQA 3S4SA 1I85A 3C8DA 1AGFA 1ZT7A 1A7RH 2CK0L 2FIRT 4Z7VB 4EI5C 2I9LA 5BZDA 3WNMA 5F96L 4XMPL 3RGVA 2EO9A 5DFWH 1QR1B 3VGFA 1DBJH 5J11C 1CK0H 3ETBF 4N9OB 4JB9H 3ZDZF 2LU3A 4Z7UF 5C8JA 4X6EB 1P4IL 1TJGL 2X5PA 4UOJA 1U58A 4XC1H 1CQYA 2VTFA 1OAXH 1OSZB 3DX8B 3Q6GH 2P7TB 3CFCL 1SJEB 3HC3L 1QFUL 2ZSVA 3SDXE 1A64A 3CC5A 4TUKH 4QY8B 3J7HA 1CT8B 1BJMA 3SKUD 3MROB 4JO1H 1UFUA 2D03L 2HKFL 3T09A 2NXZB 4APQC 2BHUA 4M03A 4XHQA 3QEHB 3OAUH 4PJBB 3W9DB 1XGPA 3BUYA 2ARJA 4QWWD 1T1ZB 2NYYD 2BRRH 3ARFA 3OMZA 2Y06L 3T0EE 1R3LA 2F19H 3A0OA 1CICB 3CH8A 4EIZC 2VQ1A 1D5IH 1NUDA 1I1AD 5EU3B 5GZND 3RWDB 5CEXB 3V7AG 3QDGE 3QNXA 4M5YH 2O5XL 5JW4R 3SPVB 4F7MB 3QIBC 4LCIH 2WUCH 4X6CA 5IB3A 1GYAA 5C0NC 4FQHB 4R8WL 5DT1L 3BIBX 9CGTA 4WFFE 4Y88A 4PB0L 2FL5B 1NCAH 3T0ED 2GAZB 1CR9H 3S34L 4WI2A 1I3GL 2ZJSL 4ELKA 1ZVSA 4BFGA 3TZVA 5JMRA 4ZD3H 3MV8E 4JDZA 4O2FA 3HZYB 5EO0B 2QQLL 4I0PB 3QDGD 3O2DA 1KBGL 2BHYA 5J3HD 5D1ZD 3VGEA 4Z8FL 3TC9A 2AKRB 2AJSL 3LN4B 3ESUF 4WFFD 4OGXL 5LCVH 1MQ8A 2VXSH 2X4UB 1F3JA 4WWID 3N9GL 4YZFE 4K9EH 4HAFA 4ODWB 1P4LB 4ZFFA 2IQAB 2EIZB 4APQB 5IWLC 4WEMB 3KYOB 4P9MH 3CFDB 3MV8D 1M6OB 4U6YB 1A14H 1OD7A 4TUJA 1KJ2B 1NGZA 2DJ4A 1GGBH 5DRZB 1DR9A 5C71A 4JO4H 2XZQL 3F7VB 2WUBL 2VLKA 5IR1B 3GSWB 3A6OA 2J6EL 4PR5A 4HAGA 1FVCB 2DLHA 4M6NL 1NGQH 1J1XH 1A6AB 4LKXB 2P5WE 5L88H 2J8UF 5T1LB 4N8VA 2Z8RA 2DQIH 3RDTD 3IJSA 5DDHB 3KPOB 2H1PH 5DMKA 1EO8H 2ZUQC 3MBEC 5DEFA 2G5BA 2IG2H 2ID5A 1YEFL 3MNZB 4EUPG 5GZOD 3MRQA 2DKSA 3MJ7B 3NN8A 3VD7A 1W72L 5HDBF 3LDBB 4HKXB 4JLRB 5GGRB 4WTZG 5BZWB 3V8OA 5FK9B 4HGWA 3SDCC 2O61B 3H6JA 1U0QA 1YEEH 1SY6L 1RZ8A 2CDFA 3P4MA 2P5WD 4HPOL 4KV5E 2YK1H 3VD5A 3QO0A 2CMRH 1MAMH 4LLMA 4U31A 2VYRE 4M62L 1T4KB 1J10A 4P5KB 1TCRA 1GCFA 4GW1A 2UVFA 5JZ7D 4KK8D 1U8KB 4M1CC 2QSCL 4KDVA 3V4VL 4PIRF 3R0MA 4XVJH 3SKNB 3V0AC 5DMYA 1LVEA 2GSIB 1C5DB 4ISVA 1F90L 3TBYB 1N26A 1SJXA 4EI6A 4GQPH 5J1SC 3HFML 5K59F 1A9EB 1ZA6A 1J0JA 1U8JA 4JPWH 3V5KA 2E8YA 4P3DA 3TA3A 1CFBA 4M9PA 5JUEL 2Q8AL 2W9LA 4ETQB 4O2CB 3SGKC 3TO4A 2AP2A 3S36X 3QXUA 4NP4L 4J12A 4D8PB 3MMEA 2QHRL 3DO7B 5IBUG 3DVNA 5JA8B 1MJ7L 2EE2A 1IGTB 5ITBH 4QRRB 1CG9B 1RUQL 3D87B 4YHKH 4J3SA 5KS9A 4RISL 2XRAL 4NT6A 2BXYA 1XF2B 2VXVL 4PV8A 3KLAA 2EDKA 4FABL 3FRUB 3HAEH 4R0LB 2NXYD 1RZIB 4OF5A 3N1MC 3IGAB 3AXLB 1E27B 1LNUB 1KYOJ 5D9SB 1AR1C 5L2KA 5EOCL 1BLNB 3DO3A 3FOLA 1NBVH 1XIWD 1F2QA 5GGSA 3TEUA 3PWNA 4N0UB 2OL3B 1P4BH 3DIFA 2LU7A 1MI5E 3MR9A 5EFIB 2MWCA 1IGFL 4ZPVA 4PRPA 5JHDE 2DQCL 3RY6C 4GRWB 3QEUB 3PHQB 4L3CB 3TFKD 1BQLL 1RJLB 3BSZL 3FFCB 2CIIB 3RIFF 2ICWA 3G6AA 2FWOA 1A3LH 5DJ6A 1GGTA 3MLVL 3MRBA 2XZAH 4UT9L 4MCZA 2FGWH 3M1BB 5I1LA 2EC8A 2MHAB 2R1WB 3HUJE 2WBWB 4OCWH 1K4CB 2HH0L 4TSCH 5BMFL 3O3DB 1MI5D 5TDPA 1QTYT 4J7RA 5DRXB 4GAFB 5I66B 5IV2B 2V2XA 3JWNC 5JHDD 1NC4A 5F7EL 1MRDH 2RFXB 2IQ9H 4KVCH 3VXSA 4GXVL 1PKQE 3KDMA 4YXKH 4Z7NF 1T89A 4M48L 2CGRH 2FX7L 5L7XH 5IHZA 3FT3B 4MXWH 1NAMH 3ES6B 1GGUA 4FFVC 5A2FA 3F8UB 4R96B 4G8FA 1QACA 4PV9B 5I0ZA 2WBKA 4F8QA 3MACL 1EPFA 3ORJA 4B50A 2Q87A 3MRFA 4M4PA 1LE5A 2FJFB 4KRNA 1QHOA 2E9IA 3GRWL 5KVDH 1G6VK 4WWKC 1ACZA 1YY8A 3BP7B 1FCGA 3MA9H 3S5LG 3QQ9D 3X13A 2A2QT 3MZTA 4PJEB 3RA7L 4X9GA 4OSUL 1D5ZA 2XFXA 3GI9L 2C1OB 4NBXB 4PYHA 3OHXB 5CJBA 1IKNC 3DI3B 1GXEA 4KHTL 1CBVL 2LQRA 2VUYA 2R0ZH 3CVHL 2APTA 1I1FB 3MRGB 1OAYH 3SDYH 5E4IA 4ONGH 2R1XB 3UYPA 5M7QA 1EAPB 4TN9A 4PD4J 5JR1H 2FBOJ 3KPMB 2WINB 3HI6L 1U95B 1ZA3B 1SBSL 1EBPA 5JW5A 3HC0A 4ZXBB 3MCLL 5JW4Q 4JY4A 4AL8H 3EYSL 4JJHA 2VLLA 4XPAL 1AFVH 4PRDA 3V5DB 2WBJB 3OKDA 1ZGLA 1N2RA 2W65B 4J2XA 1KIQB 3D25B 4NDMB 4XMKL 4HS6A 4RGOL 1F6LL 4UAOC 3MXWL 3FRPA 5CEZL 5GGSY 1FFPA 1HSAA 5J1AA 4MD5B 3B9VA 1HQRA 4RGNC 3SDXF 2P48B 1OAQH 5KJRL 1KYOK 5J13C 5HHPA 3CLFH 5DFTA 4LDLB 1A6UH 2WNGA 3K2UH 3PL6D 1HZHL 3PNWB 3LN9A 4G6JH 4F2MA 4I2XB 1CGYA 4X6DE 2ZUVA 3DX7A 1JWUA 4M93B 4PS4L 4ZFGL 4ONFH 4HWEL 5E8DL 1DANT 2PXYB 2AXGB 2IBZY 3UX9B 1G7IA 5CZXC 4YUEL 4KTYA 4KKLD 3S4SB 3ZZ1A 5JO5A 5E2TL 1AGFB 1ZT7B 3MLRH 4H8WH 4HBQA 2NY5L 2I9LB 5BZDB 4ZAKD 3RGVB 5D8JL 3T77B 1DSFL 3WFEL 4UQ2A 2DQFB 3FB8A 4O02L 3TZVC 3QXVA 4E42A 5A16A 2MFNA 3KJ4B 1ED3A 2DIJA 4JKMA 3LRGA 1U58B 3SJVB 3B9EA 5KAQG 2NZIA 3R1GH 4UILL 4UTBL 4LEXH 3CC5B 1QBML 3KXFA 1DTUA 4WCYL 2FR4A 4AENA 4S0TD 3GGWA 3X3FH 4OCXL 2NPLX 4BH8A 1Z9LA 5T5NG 3EFFA 5FV2A 3NCYP 4FOMA 4MAYA 3BUYB 3RTQA 3UYOD 3O41A 5DF0A 4HF5L 5J13B 4HIJA 5E2UH 3ARFB 3LEXA 1R3LB 1FN4B 3WFBL 8CGTA 1XGTA 4W81A 5D70L 4JHWH 5IQ7H 2VQ1B 3FB6A 4NRYA 2F54A 4PJHE 1CD8A 2JTDA 1A3RL 1DP0A 3LS5L 5I18H 1YYLH 4PJDE 4PJXF 5E4EC 5IB3B 5F1IA 1KEMH 5JQ6H 4X9IA 4OFYD 2A77L 2IPUG 4JAMA 5DQJB 5HHQA 2WAHA 1X3DA 2Z93B 3MLPA 4I8DA 2DB8A 4YEEA 1A7PL 3ULVH 2RCSH 1FDLH 4ELKB 1A3QA 4C59B 2A6IA 3IRZA 3QDMA 2JJUA 4XTRD 4NJ9H 4P49A 5I76B 5AWNL 3KPRE 4JDZB 3RNQA 4Q58C 5CJOH 4YHZL 4RMWA 4U3CA 5T33H 4PD4K 4FHBD 4DVBA 5J8OA 4N5ED 4DKFL 1RK1A 5CLWA 4K94L 4OLYL 3UTTA 1MREH 3C2AH 2Y7QB 4IIQC 4OF7A 2Q8BH 1AXSA 1FIEA 2B1AL 4MAUH 4JFDA 3U36A 3BXNA 3CK0L 1KCRL 5HYQA 3IDNA 2DQHH 2GEEA 4FFZH 5BV7H 1OAKL 1RIVL 2PTVA 4ZFFB 5DD3H 4P48A 3JSSA 3ZDYF 3KPRD 4TUJB 1BREA 2D4FA 1WIPA 1FNEA 5SX4H 4F33A 1GRWA 3PHSA 1CVSC 2VLKB 3TA3C 1NAKL 4XX1G 4PR5B 4G7VL 2D7NA 3TO4C 4LKCA 3ULUC 4JPKL 1DBML 5IW3A 2AXFA 4CVUA 4ZUWA 4U1MA 3WO4B 3IJSB 4JKWA 3TBWA 2WLZA 2AERT 2BP3A 5DEFB 3MYZA 2MKLC 2HVJA 2JJWA 4XP5L 3MRQB 4HWBH 5C0DA 4RMVA 5KVEH 3WUWG 4XHJD 2B8OT 2SEBA 4NPYB 3X12A 4WFHE 1F4XH 5IVXF 3MLZH 3FHQA 2ZOKB 4PPTA 4NHUB 4RFNB 1OPGH 4TULL 3TJHC 2A83A 4KHXH 2VZ3A 1RZ8B 4KROC 5TFSH 4M6AA 3O6LH 3QO0B 4NQVA 1DZBA 2EDLA 1Q0XL 2DIAA 2NY3C 1AIFA 5GGTH 4X7EC 1MCSA 5MEQA 4OCRL 1TCRB 1PX3A 1KB5H 3N85L 1IRAY 5HHXL 4D9LL 5DD0L 4TNWK 4WFHD 3FMGH 5D7LB 5LGHH 1TVHA 2R56H 1DBKL 1CE1H 4ISVB 3SBWA 1QFWL 2B4CH 3QISA 3MA7B 1FBIH 3DV4A 2DDQH 4EI6B 2LAGB 2ZUYA 4OM0H 4ZG1A 3I3BA 3V5KB 1U8JB 1KJ2L 3BT2H 4FXGA 4P3DB 4XWGL 3RU8L 2A6JA 2JB6A 3BKCL 1YY9D 5EUOA 4TVSa 4F9LC 1UT9A 3PABA 1LEGB 3MLWL 1T20A 4QHUA 3DVNB 4PGCA 1I4FA 3M17A 1G9NC 5KS9B 2DM4A 1BIIA 5DRWA 4NT6B 4HGKC 1T89C 4PV8B 2ZP0T 3KLAB 4JQVC 2BY1A 3CVIH 3GIZH 4AG4H 3IETA 1KTDA 5FYLE 1HKLL 1H8OA 4MS8D 3A67L 4NZRL 5JPMA 5C0RL 2MPAH 1RUKL 4KROB 2X1PA 3Q3GA 4X6BB 1PY9A 1A8JH 1X5XA 4XVSL 3OWEA 3PWNB 3KYNB 3DIFB 4KMTL 1LO4L 1V05A 4OIIH 2V7NA 35C8H 4R90L 5CJXA 4LSPL 1PSKH 5DJ8A 4PGDA 2VB5A 3VFVA 5JA9A 4ZPVB 4EBQL 3PDDA 1MAJA 4PRPB 3FO0L 2NY7H 4UU9A 3O3BA 3RP1A 4Y16A 1OF2A 3JWDH 2IBZX 1KJ3H 3F7YA 1AKJA 2ICWB 3G6AB 2FWOB 5DJ6B 1G6RA 1YN6B 3MRBB 4JY5L 2HN7A 4HIHB 3BWAA 3ZKND 2X40A 3FB5A 1N4XL 4QXTA 5I1LB 4OF3A 4JFFE 2L7UA 5I1GL 2AK1L 2J5LC 1RVFL 4YPGA 1AXIB 1Z6JT 5ICYA 2J12B 2V2XB 6FABL 1NC4B 4X80H 5IVZB 4ZO6A 3L5IA 3U2SA 3MLXL 4BZ1H 3SCMD 4D2NA 2NY6C 4K2UL 3VXSB 4XPGL 4XCEA 1OTSC 1KLUB 1B6DA 4LCUA 4JFPB 3VXUA 4EOWL 1MFDL 4ZOCA 4XAWL 4XT1C 3ZE1F 1I8KB 2H26A 4M7ZC 4KTDL 4OQTH 5KBNC 2XY1A 4MQ7A 3VGAC 3FZUD 2VDLH 1MIML 5IP4A 3D69B 3MODL 3MRRB 1YQVL 4G8FB 4RMSA 5T5NF 4Z7QE 3B2VL 3HPJA 3HAEG 2H9GA 1G9ML 3PGCA 3QDAA 1JNNH 3MRFB 2NYYC 4Y4KB 5T3ZH 3RKPA 1LE5B 2BSRA 4Y8AA 1GL4B 3GUTA 4XCFH 3WXVL 5L8JB 2R9HD 3X13B 5I0DA 3MXVL 3QO1A 3RVXC 4KRMB 2OL3L 2RGSA 2ENYA 1VGEL 1FORH 1D5ZB 2XFXB 5B8CA 2JJTA 1CIUA 3M8OL 5C92A 4PJCF 1Z2KA 1IMHC 3U9PH 1NGYA 5AUMA 3S37L 1DBBL 3B4NA 3OG6B 4FQIL 1A1NA 1UCBL 4XCYB 4H0IA 3T0EC 2EIBA 2J5LB 3WS3B 2H41A 4E5XB 1F45A 3P11H 4Y2DB 5C0EA 4OZ4A 3CSYA 4F7EB 1OVZA 1JL8A 1BVLA 5ACMA 5JW5B 3HC0B 1WZMA 4OCYL 3VJ6A 4GO6B 1DBAL 2X1XR 1RZJC 1WSST 2P8LA 3HC4L 4M7LH 3OKDB 4RFEA 3LKSB 1ZGLB 2X9YA 5ANMB 1R3JA 4LPTA 1YYMH 2I07A 4HS6B 4P3WA 3HMXA 5E2WH 3L5XH 1KT2A 2YD1A 3E8UH 4WUKL 1FFPB 1HSAB 1YQ2A 1KCKA 1WBYA 1IAMA 4UDUA 1HQRB 3MLYH 4P59L 4HS8L 5DVNA 1JGDA 2HA1A 4MAYC 2GCYA 1NH6A 1MCCA 3ARGA 5D1QA 2HT2D 4XVUD 5C0CA 4DAGL 4GG8A 4H1LA 4MDIA 5C0AB 3OGCA 3VWJB 4F2MB 1CYGA 3DX7B 1TFHA 1WGOA 4M7JL 4OCSH 4AEIH 4XCNA 2X4SA 3INUH 3GMQA 3WO3B 2O5YL 3HE6D 2GJ6E 5C7XL 5ISZE 1G7IB 3I75A 3VXOA 5FECA 4MMZC 1OM3L 3H42H 1S7WA 4U1JA 5FUOH 4ODHH 3DRTB 4NSKA 5GZOC 3WDIA 4HWZB 1HIMH 1KJVA 4JE4B 5DK2A 4PJHF 3SHSA 2OS7A 5C2BH 1T2QH 4HJJH 1DUYA 3STZA 4UZGA 3DNKA 4LU5H 3SDDA 4UQ2B 2UWEF 1RZKC 3FB8B 3MOAL 5EIVA 4DKEH 4E42B 2FO4A 2EIDA 3MFGB 1V3MA 2IH3A 4YHPB 1ED3B 3QYCA 2GJ6D 5ISZD 1DJSA 2CK0H 5D2NA 2B2XH 4HW6A 3V52L 1N64L 2YXFA 1KIUA 5F96H 4KK8C 1Z9OA 2ORBL 2X05A 3VGGA 1RURL 1A4JA 4X4ME 2JCCE 3PGFL 3KXFB 3ZYJA 4RA3A 3C09C 2FR4B 4XB7A 4M8VA 4AENB 3GGWB 1P4IH 1TJGH 5GGUB 4LQFH 1FRGL 3V0WH 5I1AA 4BH8B 4PRNA 3EFFB 4MAYB 3RTQB 2CPCA 1F97A 3NA9L 4NC1C 3RUGF 3O41B 2Y23A 3HC3H 4EXKA 1QFUH 4DW2L 4HIJB 3LEXB 3RQ3A 4Q2ZA 5FGBA 1XGTB 4Y1AB 3VFUB 5BCAA 3IDJA 2D03H 4BYHA 3NGBB 2HKFH 4FXLA 3FB6B 1JHLL 2F54B 4RMUA 1EMTL 2ZUTA 3MV7E 2OTWA 4K23L 1YUHA 4WTWA 3CFEA 1Q9LA 4JGJA 3IJYB 3ULVE 1FVEA 4JAMB 5HHQB 1CVRA 3DYMA 5C0FA 1INDL 4HK3N 3ZKXB 4NC2B 4P5MA 1D9KA 3EYUL 2FJGA 2AJUL 1X5IA 1KN4H 1O7SA 5E2JA 5SX5K 3BIKA 2A6IB 2O5XH 5KSVA 3RJQB 1F6FB 3L3HB 3I50H 2YSSB 1XIWC 4U4BA 5CEYA 3T8XA 4DVBB 3MV7D 5DT1H 2ZKHL 4G80A 4L29A 4G5ZL 5HI5C 3U7WH 1NLBL 3S34H 3ULVD 1YEDA 3ARBD 4TNWF 1AXSB 1I3GH 4NQEB 2ZJSH 3TFKC 4JFDB 3U36B 3BXNB 1H5BC 5HYQB 1WBXA 1PZ5A 1X6LA 5IB1B 4P46A 1J86A 1VENA 4HV8A 3OKMA 4AK1A 3RWHB 1SVCP 3SBWC 4X7TB 1K8IA 2X4PB 4I18A 1KBGH 1FNEB 4LCCA 4JVWA 3O2VL 2AJYH 4Z8FH 1BZ7A 2AJSH 3G6JF 4OGXH 5B38G 3N9GH 5F89A 1AO7A 3TT1L 3C60D 3VD9A 1UJ3B 1U93B 2QQNL 4LKCB 5JOFA 4WO4A 3WXWH 3QWOA 2AXFB 4ZUWB 4U1MB 3N1PC 4I3RL 1JMXA 1FZOA 3MX0A 3TBWB 1HDMA 5J12C 3W0WE 3QEGH 2WUBH 3QH3A 2HVJB 5F9JB 4LFHD 2CO7B 4NZJA 4KK5C 5E8OA 2X70A 5C0DB 4ZUSA 1EA9C 2SEBB 4YGAB 3X12B 5E8PB 1ZLSL 3TV3L 1OAZH 3OQ3B 1FIGH 1GC1C 2A83B 3EGSB 5LQBL 4X5XA 1BWMA 3OZ9L 2XWTA 1R3KA 4DWHA 2G5RA 5EA0L 5KZCB 1LO5A 4HD9A 1B6UA 4PJAF 1YEFH 4NQVB 3DVFA 3D18A 3W0WD 1W72H 2DLIA 1AP2A 5MEQB 4JFYA 4P23D 3O2DL 4N0RA 4MNHB 4Z95L 3DV6A 3CGTA 3LKNA 3EUUA 3HE7B 5MEPA 3P9MA 2CIKA 1BD2A 1SY6H 1ZAGA 2FNBA 1TVHB 4HPOH 1N0LA 1UQSA 2GTZA 5FOBA 3OKYA 2VLRB 3DV4B 1LEKA 1X5LA 4M62H 1DQQA 5EOTA 2A0LC 2FYYA 3BVNA 1ZV5A 3GM0A 3TN0D 4FXGB 3CUPB 3OG4B 5CKAA 2QSCH 3G5XA 3V4VH 4PRBA 5DK0B 1LGVA 4HC1A 5EUOB 2I24N 43C9A 3VGBA 5GGQL 1VKXA 4RSVA 1T20B 2UUDH 3OJVC 4I48A 4PGCB 4XXCA 3QQNA 2A38A 3M17B 2XQYK 4FXKA 5FCSH 2P8PA 2DQTH 3MV9A 4LFHG 4Y19A 3HFMH 5K9OB 4PJ9A 1BIIB 5DRWB 3CMGA 1ZHLA 1LO3L 1VCAA 1AHWB 4JFFA 3WYRA 1ORQA 5JUEH 3SDAA 4WHDA 5F7DA 1SJVA 2F15A 3PV7A 4NO0D 4NP4H 4QHMB 5F9OH 5A1AA 4YDKH 1MJ7H 3IETB 1KTDB 2YUXA 1RZFL 3RKDD 5D7JA 3Q3GB 3KPSE 2VN7A 4J1UA 2XRAH 1UXWB 4XWOC 3WHE0 2VXVH 5IVNA 3B9KD 1S7UA 5E00A 4FABH 4XP6L 1NJ9A 3RZCA 5EZIL 3HR6A 3ARXA 4M8QA 3GEWB 2V7NB 5KSAA 3VFVB 4PGDB 3ZE0E 2YN3A 4QF1A 2BHZA 4KTEH 4UU9B 3O3BB 5B8CC 4Y16B 1OF2B 5DURD 5EOCH 4NCDA 1KCSH 4OZGE 3VXRE 3F7YB 3GSOA 4N0FA 1AKJB 4KKLC 5D72L 1G6RB 3KPSD 1F6AA 2HN7B 4GKZA 3BWAB 3FB5B 4E9LA 1EHNA 4G8GB 4QXTB 1IGFH 3NIDF 2D0GA 2DQCH 2E27H 2NR6D 3BP4A 4YPGB 3A6CH 4ZAKC 3ISWA 4C58B 3T3PF 3BSZH 1JCKA 1LO0L 4PRHA 2XQYG 4RIRA 5AG9A 2NY4B 4JCMA 3VXRD 4UT9H 1Q8MA 4XCEB 3PP4H 1CE6A 4HZAA 5ADOH 1G0YR 2OP4H 4LCUB 4CMHC 2D7OA 2HH0H 5BMFH 3P73A 4MVBD 5E6ID 2H26B 3BPLC 1WV7T 4FQ1L 1KIRA 1T7VA 1FZMA 4MQ7B 2E8ZA 5F7EH 4ALAH 1J0IA 1BF8A 1FYTB 5T3ZE 4LLDA 2IGFL 4XNQA 4GXVH 3HPJB 3DWTA 2H9GB