3Q6GL

Crystal structure of fab of rhesus mab 2.5b specific for quaternary neutralizing epitope of hiv-1 gp120
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
209
structure length
209
Chain Sequence
YDLTQARSVSVSPGQTARVTCGGDNIGSKSVQWYQQKPPQAPVLVMSADDERSSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSHHMLFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVEVAWKADGSAVNAGVETTKPSKQSNNKYAASSYLSLTSDQWKSHKSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Human and Macaque mAbs 2909 and 2.5B: Implications for the Configuration of the Quaternary Neutralizing Epitope of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Light chain of Fab of rhesus mAb 2.5B
total genus 47
structure length 209
sequence length 209
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q6gL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q6gL01
2H1PL 4YHLL 2C26A 4Y5VA 5GGSB 4PG2C 1HHHB 3MC0A 4I3GA 2EECA 1A3LH 5GXBB 4JN1H 4LRIC 4PJXE 3IXTB 2W38A 4X9BA 5KVMC 3CFEA 3CH8A 3HUJF 4XB8A 5D6DC 4I3SH 3RZWA 3L6FA 2R1XB 1E4WH 5IF0B 2FR4A 3H9SE 3W0WD 1NEZB 4R4FH 3EYSL 4DOHB 3MGAA 2XG4A 4UIKH 3EDEA 1PY9A 1IC1A 4L8DB 1VACA 4NO2B 2E27H 4OIBA 1TTUA 4U3CA 3DSFL 4LLYA 3MA7B 3ZDZE 3RKDC 5F71A 4XNQA 5D96B 1OQOA 4CJ1A 1MLBB 3MRCA 4K7PX 2X7LB 1EXUB 4X6FB 4L3AA 2GUOA 3VH8G 4KVNL 5F97E 2Q3ZA 1DQDL 3ZHLA 3IU3A 1KIRB 1G1CA 1H5BB 4HS3A 3UTSA 1ZAGA 5IHLB 3V6OC 4UV7L 3NIGF 4PLOB 5SX4I 4I18B 3CNKA 5BXFB 5C8JB 1NMBL 3B5TA 2WBJA 4NZRL 2OS7A 1J1PL 3EO0B 1XF2A 5EU7C 3VD7A 1CFSA 5MENB 2Y5TA 2CGRH 1IC5L 1YUHA 3RI5K 4LF3A 4ZTOH 5CUSH 5I66B 3VGAC 1ZMYA 2FEEL 5K9KA 1QBLL 3RZCD 3D3VA 1AH1A 4HUKB 4YR6B 4ZUTA 1I1YB 3VD4A 1BWWA 1H3VA 2WV3A 1WISA 3ZYOA 3HMXL 4OJFL 4PGDB 2E7MA 4ZFOB 1FRGL 3QO1A 4PJ5E 2J88L 5EU7E 1I8LA 4PJCB 4OCRL 1ZLWK 1P53A 5JW4Q 2BK8A 3MRFB 4D9RD 3LN5A 3HI6H 1JYWA 3BMWA 2WSKA 1X4YA 4Y2DC 3O2DH 4ZOEA 2VIRA 5E2WL 3T77B 4PLJC 4WRLA 1ZSDB 3I2CL 1CVRA 4NNYB 5TDPA 2DQIH 2G2RB 3U4EA 1V3JA 1P4LA 3FMGL 1L7IH 1IGJA 1UM6L 4NGHH 2DTML 2QSCL 4FFWD 4NRZB 1UZ6F 4YBLC 4XCYA 5C0CB 2XWBA 4X9IA 4ELMF 1WFTA 4P59H 2DL9A 4Z7UF 1URLA 2EZ0D 5D70H 4AM0B 4X5LA 3I75B 1ERNA 2D31A 3V5HA 1BOYA 5E00B 1DUYA 3GMQB 3NVQA 1CFNA 3FTGB 5K59F 5BRZD 2X4NA 3MLYL 4RWHA 5J6HB 3WIIL 2BSSB 1HXYB 4LP5A 4L4TB 3OKEB 2AKRB 3DIFB 3VXTA 3O3AA 3QHZH 1OSPH 2V5MA 1KPRA 4QXUL 4HJGB 4GO6B 5HPMB 2AJZA 2WBJC 2VLME 3IGAB 1XIWD 2B4CC 5GISL 4P57A 4JPWH 4Z8FH 3LIZH 4OV5B 1SBSL 1AP2B 5FHAH 1K3IA 3BAEH 4HIEB 2I9TB 3SKNA 3FFDB 2BFVL 2CLVA 3ARTA 1EERB 3ESUF 5HHMD 1JPST 1YC8A 1MAJA 2W07A 1GGCH 2GK2A 5EWIL 3RPKA 3KPOA 3LH2H 3O6FA 1FH5L 3ARWA 3FB6A 2YN3A 3R0NA 3C09B 4G6JL 3O6LL 1H8SA 5L2JB 1NCBH 1CL7I 4EQ2A 3VWJD 5DMKA 4Y1AD 3WO3B 4I5BB 2YA2A 1TXKA 3GSVA 4MYWB 3HRZA 1U8PA 3WHXB 1FO0L 4XGZA 5E08H 4OGAC 4PRAA 4WJ5A 4AZ8A 5J0BA 4PJ9D 5GGRA 3PHQA 3SCMB 3Q2CA 4YWGL 1DBAH 4H8WH 5JW3H 1LDSA 4Y4KB 4G8IB 4TOYH 3P4MA 5J89A 2CKBH 4FQIH 1OTSD 2ESVE 4WV1A 2GCYB 4LLUB 5CBAA 4ZUSB 3NABL 2XZAH 3TT1H 4WWID 3D39A 1KPUB 3WFDL 1FE8H 2F19L 3DJ9A 4JFDD 4I5BA 2EYTA 4KI5C 3LQZA 2H2SD 3SDDC 3U46B 2DYPB 2J12B 4OZIF 1BQLL 1FNAA 1PSKL 2VLRA 4OLUH 2IQ9L 2YPKB 3FB8A 5LXGL 1I8KB 3MUGB 1NSNL 3KJ4C 2A2QT 1INDH 1A7OL 4H0IA 4U05A 5HYIA 1N5AA 4V1DE 4OCWL 5D2LA 5DK0A 4M1DH 4YPGB 3QFJA 3J8F7 4GW5B 5B8CA 4PJ8D 5ADPH 3U2SB 5BJTB 2BC4A 3QQNA 2V2TB 3DROA 5D2NE 3ZT5A 2QQQA 3H42L 5DHYA 3UTQB 4Y88A 4RFNC 2UZYB 1Q9WB 2G9HB 4L5FL 5HHPA 5FA4A 5EIVA 5CSBA 3QIUA 3S35X 1KN4L 3IF1A 3U36B 5GQBA 3JWOH 3IAGC 3V6ZA 2W9LA 4CVZA 5F9WC 1BGXL 2EYRB 4C54A 5EN2B 4FQQB 1G7IB 5MEQA 3KPSE 5ALCH 4K8RL 1JHKL 5FOBA 5KVEH 3MLVL 1RURH 3LS4H 4D8PB 5LQBH 4GG6A 1DEDA 4F8QA 1QBML 1UXWA 3MJ6A 4LCUB 3WJLC 3C9NA 1KCRL 1I85A 3ALPA 1QTYT 4BFBD 2CKBB 1K8IA 1IAII 1JNHB 4PRHD 4YGAB 5CJ8A 3CXDL 3G5XB 4HK3N 2N7BA 5DMKB 2ZWLT 5AWNL 4PGCA 4ISVB 4PRNB 5KSAD 1AGCA 2A74B 3WJJC 3QPXL 1WZMA 4H25B 2DLFH 4KXZH 2IAMB 4CN4A 2FECL 3HNVL 5HHXL 2JB5L 1S5IL 4LP4A 4U7SA 4OM0L 5GZND 5HYEA 4HIIA 4BZ2L 4OD3H 1TFHA 1B0GA 1NFDE 4JFFD 2EDKA 4YGVB 1UXWB 3LDBB 4L1HA 4I77H 4C4KT 1A14L 2LE9A 4OD2A 4XBEL 1KEGL 1N59B 3CAFA 5A16A 3DUSA 2BJML 4Q9BA 3D39B 4P23B 3GMRB 3K81A 1FNEA 1VFBA 2VN7A 1FZOB 4QOKD 5E99L 3PWLB 4NC0B 3PGDA 5EO9A 2HKFH 5HYJE 4RNRA 3QA3A 4PBXA 1T04B 2AXFA 3PGCB 3WFBH 4YX2H 5ITFB 1BAFL 4YXKH 3WHXA 3UYPA 3OKLB 2VXQH 1YMMD 2ZSWB 4LARH 4NN7B 4PY7B 4UQ2B 3UZVB 1CGYA 5FF6B 2C1OA 5IESL 2ARJQ 2VLLB 3VH8B 1M71A 3BGFC 3L3OB 1BJ1H 1S9WB 1YDPA 1CL7L 5F7EL 1MHCA 3H9YA 3EAKA 1PG7X 3OTTA 4J1UB 1CU4H 3RTQC 1ES0B 2YXFA 1X5FA 4X6BB 4RMTA 4OUUB 1K6QH 3OKMB 1T2QH 4HDIB 2UWEE 4Y16A 3A6CH 4JFZL 3QYCA 1ZHBA 5E8EB 4FQQA 4LKCB 4P3CL 5CJOH 4DKAA 1H3PH 1OARH 1HOCA 3QP3A 1YNLH 3HI1B 3BP7B 3BSZH 3MLTA 4R2GC 1KCSH 2GCYA 5TE4H 5CGMA 4OV6F 3GMOB 1YN7A 4PJ7F 5CBEA 3B9KA 1JV5A 2A0LC 1MVUA 4J3TA 4WO4D 3SN6N 1MCBA 1QSEE 3LKRB 1KYOJ 2XYCA 4PLKC 4JZJC 1G7QB 2BSTB 4HEPG 4YHOH 2B1AH 2E8ZA 2Y7QA 1HQ4A 1ZK9A 2E7CA 4JPIB 5BVJB 4A6YA 3BIBX 1XGYL 2VTFA 4K3DL 1OAXL 1LO2H 5CJQH 1PKQA 3K8MA 3PQYB 3NCBB 3HE7D 3UTSB 3GM8A 1EZVY 1NAKL 1F45A 5FXCH 1RZ7H 4LLMB 4KFZC 5F72S 4PGEB 1OP5K 1YEHL 5C8JA 3LKOB 3OJVC 4ZD3H 4CMMA 5D7IB 2V2XA 1HIML 3P40A 1LQSR 1QSFB 1YEGL 3C60C 2VDNL 3QUZB 3TBWA 3NCFB 5BOPA 2P5EE 4NNXB 4FFYL 3O4LE 5TQ2L 4YQXH 2OP4H 1MWAH 3NOIA 3IVKA 5LBSL 4NP4H 5HGHA 1KULA 3FT2A 4N0YL 3E3QE 1EXUA 3C6SA 5F7KC 4PJ5D 1G9NC 2YWZA 5F8RC 3GJFK 1MIEL 4P3WA 3HE7A 1KPRB 1I9RH 5I66A 4YIQA 2VLKA 4LSVH 2IPUG 2RB8A 3AS3A 5MHSD 1NCNA 2OZ4A 1Z3GH 5DJ8B 3OJDA 3WS6C 5JDSB 5F7DB 3KJ4B 2LABA 5C0RH 1CICD 4ODTH 1KTRL 4YH6A 1JTOA 3FJTA 3WKML 5L6YH 5DF0A 1H8OA 5D6CB 4P2RB 4ZPTB 4L3EB 1G7PA 3MNWB 4L4VD 4HAFA 4Z7VE 2YK1H 3QEQD 3WKNA 4XCNB 4HPYL 5I1EH 5IVXB 1RUKH 4B7IA 3DPBA 2X89A 3P30L 2K7QA 1D9KA 1A6WL 2IGFL 4GBXD 3TIDA 3FO0H 1OAUL 3L3JB 4H26B 1FNLA 1S7WA 2WWKO 1NDMA 3PWPB 5MP6H 4JY6A 3CLFL 5MEPB 5D7JC 5DEFB 1XGUA 2XQYK 3RDTB 1I75A 3LHPH 1MI5E 1U6AL 4HWEL 4KQ4L 1XH3B 5K93A 3RWEB 3REVB 1QKZH 4Y7MA 5IHZA 2IPKB 3FB7A 3MRLA 1EMTH 1UKSA 4WI6A 2N7AA 2A83B 2FRGP 1A6VH 3IS1X 3GJEB 4GW1A 1FVCB 3DX9B 1A7RH 5D5MB 1N6VA 2AW2A 5DQDH 3TEUA 4PJ7E 4YDJB 1BBDH 2EDEA 4XNZB 1CF8L 5FFLA 4HS6A 4WWKC 4DZ8B 2FGWL 5F1NA 3TA3A 4ZO9A 3N9GH 4WCYH 4G8GD 1FZMA 3VXQA 1T2JA 4K94C 1ZWIB 3KPSD 5A3ID 4OQ1A 2R0KH 3SBWA 2WBJB 2H8PB 3HZMB 2FX9H 5JQ6H 4S1DC 3WIHH 2F53A 4Q9QH 3ROLB 2IQAB 1P2CB 3EOAA 4R7DA 1ODAA 4GQPH 1IM3A 4Y4HA 5CIPB 4HHAB 5DRZB 3SDDD 3X3GH 2PNDA 1LEKA 5CEZE 3KWWA 3MOAL 3X3FH 3GMNA 4P9HH 1P1ZB 3HKFA 1L6ZA 5C0EA 5JOFB 4O00A 4EQ3A 3KDMB 4I2XA 4TTDD 1X5XA 1QFWH 3BUYA 3O9WC 4R0LB 3BD3A 1PZ5A 5IHUH 5KVDL 2P46B 3JV6A 4PY7A 2OZ4H 4ZTPL 3PL6B 1M05B 3ILPB 3HG1A 4YO0A 3V7MA 5IKCA 3RA7L 5ITBL 4O02H 2FHCA 3BIAX 3OKDA 3T0EE 4MVBD 8CGTA 3OXSA 3BKJH 4S1RL 3V0VA 5IIEB 4FZ8L 5DYOA 3HS0B 4XP9H 2WBKA 3WNPA 4NWUL 1NMCB 4D9LH 5HGHB 4I13B 4V1DB 4FZEL 4N8PA 5HDLA 2FJFB 3AU1B 1UM5L 4E41A 1NGQH 2ADIB 5JMRA 4HWUA 3LRHA 1ORQB 3E8UL 3IDIA 4ZXBD 5A2FA 3C8DA 3QUZA 1T89A 3CVHH 3V6OA 3Q6GL 3SQOH 4GKZB 1NUDA 2HJFB 3DUHA 1JZ8A 4K71C 2XZQL 3IKKA 4YHKH 3ULUF 3MROB 4Y19D 4Y19B 5I71B 3OZ9L 3F7YB 3LRGA 1EA9C 5HI5D 4RSVA 4U1SA 1QYGL 5FO9B 1EFXA 1EDQA 1OD7A 4BZ1L 5IJVA 2FWOB 4BM7A 4YHML 3DURB 4FQ1L 4M61B 5LGHL 4I0PB 1FG2A 2IFFL 1MF2L 2PO6C 4M7JH 2Q7YA 1I4FB 4LNRB 3OX8A 2IPTH 3I9GL 5HHME 3PV7A 1MY7A 2E9IA 1G9NH 3HAEB 4ELKB 3C08H 3QAZC 2XXMB 4OLXL 3UBXG 2GK0B 2VR5A 3MJ9H 5IHBA 1OGAE 2NYYD 4OLYH 2AQ3A 1X5HA 5C09B 4MQXD 4MZ2A 3ZE1F 2XIDA 5I30H 4NFBA 2DM2A 4LDLB 2WINA 1BM3L 2NTSP 3G04A 1Z9SA 2CLRB 4P3DA 6FABL 3RNKB 2P42B 1CFTB 3TYFA 1FVCA 3V4UH 3W5MA 2EIBA 4NNXA 3QEGL 9CGTA 1QBBA 5FM8A 2R29L 3QI9D 5J4MA 3MLUL 1AQDB 1PAMA 4HC1L 2GSGA 1UCTA 1FVEA 3M17B 5FKAA 3SJVA 3ZYJA 3ORJA 1MFNA 1U8MA 4RIRB 1IGIH 4ZMAT 2NW3A 1SY6A 4WFEE 4ZQKB 3E6FA 4WHTA 3TCLA 5LGKA 4D0DB 2JELH 2J6EL 4ZTOL 5C08D 1UT9A 2HJLB 1NBZA 2RHEA 1ZTXL 4M5ZL 3DARA 1K2DB 2X9YA 5DRNB 1EX0A 1JFQL 4QXTB 1Z0MA 5DRXA 4MXVE 5JZ7C 4ZUWB 3PABA 2E7LA 3HZKA 2HRPL 4MNQE 5TF0A 4W6XB 1NDMB 4PR5B 2EE2A 3W11D 5BZDB 3ZDYF 2V5SA 3GSXA 4H1LB 5EU5B 2ZKHH 3UDWC 2UVEA 4XPFL 4XVSH 3WFZA 1CTNA 5DS8B 1VGEH 4F7EB 1AR1D 4HT1H 4BUGA 2FBJH 1DANU 4CL7A 2DLTA 3QEHB 1HQRA 1IFHL 2DM4A 3DRTA 1AXIB 1UM6H 3PL6A 3GMMA 1ZVYA 3IRZA 4KU1A 3MV9A 3V6BR 2CRMA 1E6OL 5FCUL 3RZCB 1FZKB 2F5AH 3GZKA 2VZOA 4RZCA 2XZZA 2A77H 4BH7A 1LHZA 1TCRB 4XCEA 3D39E 4OCSL 5FUCE 1C16B 1EEYA 3MOBL 4DJMA 3BJ91 3MJ8B 2VABA 1Q9OA 1OW0A 1TJGL 3QZWA 4PJFA 1J8HA 1MELA 4JPVL 2VLJE 3CD4A 5FF6A 3NTCL 1C7TA 3KPPB 2NX5A 4MD4A 1NBYA 1CFTA 3TYFB 3V5DA 4DGVH 4KHTH 4M6OL 3U30B 1C7SA 3TZVC 3QIBA 4LCIH 4NQCD 5BO1L 5K59E 5EOCJ 4E5XA 3E6HB 4ESKA 4ODXB 3B2UD 2ZUVA 3VXSE 1ZA3B 2J8UA 4LLDA 4V2BA 1F6AA 4O2FB 3AM8C 5B4MD 4F58H 1T7ZA 1FDLL 4ELME 4XPBH 4U49A 5FV2A 2ZCHH 2VISB 1T89C 4LHUB 4G8GE 4OFYA 3ZKXC 5L88L 1JVKA 1RUMH 3TJEL 3TT3L 1NCCH 4UT6L 2NY0D 3VMNA 5I75C 1GIGH 1S7RB 1HZHH 2YKLH 3RVXC 3SOBL 3WHE1 4Y1AE 3LRSB 4Z5RA 2A9NH 2FYYA 5CP7B 2FHFA 3P77B 2APTA 1MFDH 3L5JA 5D2NB 4P5KB 5DJ0B 5I1IH 4LCWB 3MMEB 3T0DA 3CDGA 2R4RH 3GSWA 2XRAH 4EKXA 3IDMA 2EDDA 1F58L 2JJTC 5EIIB 4HXAH 3ROOA 1UM4L 3UTSD 3V79C 1W72L 3ZSTA 2E27L 3T4AB 2BOBB 5FUZH 2M26A 3O2VH 4QTHB 2RAMA 5L0QC 2YBRB 1KTDB 3BT2L 3NPZB 1MWAB 1S9WA 4WU7B 1C5DA 3KPQB 3WCYA 1QEWB 4PJAF 3VFGH 4GKSB 4HSQA 1AJ7L 3X14B 5JXAL 1DSFH 3EFFA 3ARFA 1GSMA 4QRQB 1IEAA 5IB4B 2WP3T 4MJID 3O2WH 4FOMA 4HFWB 3GEWB 3GO1H 2HT4D 4KJYA 4CMHB 4DQOL 3CLEH 4JQXC 1P7QA 4Z7NE 5KZCB 1ZHLA 1KB5L 1T7VA 3AXLB 3MRNB 3K4DA 3FRUA 5E1HB 3C6LB 1IEHA 1GHFL 1QPPA 1YYLL 1VESA 1F13A 5ADPL 3BUYB 4HUXA 4OF5A 1N3NB 4LSSH 1NUFA 3H42H 3BPLC 3QRFM 1KB9J 4NO0D 3GJEA 1BP3B 3O3EA 1WCBB 1MCDA 4X7FC 5IP4A 4WUUA 5LVEA 1IGTB 3RGVD 3G6JF 4WFHD 4B50A 3BXNA 3QCVL 1H3WM 5JLZB 3LB6C 3O8XD 3QA3B 2NR6C 1YMMB 3HMXH 4OJFH 5DGRA 1JPGB 4NNPL 1XCTB 4CN1A 1FRGH 2AKRA 3DIFA 1T0MB 2X4TA 4OCRH 4OI9A 1KCRH 2YD5A 4GRMA 5EUKB 2XWTB 5DLML 3KHOA 1WT5A 1IBGH 2ZSWA 1G1YA 3TCXA 5FM4A 4EI5C 4W81A 1BFOA 2C3VA 1IILE 5LAXB 1BFSA 4JRYE 4KRPC 3FOLB 1RZKH 4HK0B 1T7WA 2Q8BH 5K9OB 1XGTA 2VDLL 2UWEB 4XHJC 4UNVA 4H20H 1G9MH 5TFSL 5JMOC 1Q9KA 2DDQH 2HTKD 2CDFA 1CDCA 4JO3H 4U0RB 5D70L 4WV1C 4BSJA 1A14H 2VIRB 2W0LA 5T1LA 2DLIA 2XTJB 1FFPA 5DDHA 3MCKB 5J12B 5DHYB 5AEAA 1MAML 2W9DH 4OB5L 4EI5A 4WI8A 1CCZA 2H41A 4HKJA 1FORL 5L9DH 2AI0H 5DI8B 1HNGA 3MR9A 1PKQE 2GJZA 2JE8A 3MXVH 2AS5M 3ULVD 1G7IA 1B2WL 4JKPH 4WI4A 2CDFB 3O3BB 1KJ2A 4FQLL 4GRLB 3FTGA 2AAVA 2F5BL 1MFBH 4EDWH 1CZ8L 2VAJA 3OXSB 2C5DC 3TLRA 3HR6A 1JNHA 5GJTL 3TH2T 5I8EA 5DVNA 5AZ2H 3CFBA 3F7PC 5IQ9A 1R0AL 3NMEA 3JWDH 5KOVC 3BMVA 3FN0L 2HP4A 3ARFD 3MLRL 1WVZA 4MGXA 1FH5H 4KPHL 4N0CC 4OD1H 1ETZA 5B22A 1K6QL 5DD0L 3NIFF 1RFDL 4ODBD 1AGBA 1NEZG 2PO6A 4PJGB 3SEPA 4NKDA 3O6FB 1OLZA 4KVCH 1BD2A 3LQAL 4F37K 3G08B 2N1KA 5SX4H 1UB5B 1FO0H 1CG9B 1P5UA 3S5LA 2W9EH 3F6LA 3ZTNH 1I1AD 4NNYA 3D5OF 4P5TC 1BJMA 5FHBH 3NAAL 5B3JE 4Z7VA 4X5XB 1AI1L 1PEWA 4QYOB 3F7VB 5ICZB 1B4JL 3F5WA 4N9GB 4P4KB 5KSVB 3MUHL 4HUMB 1YJDL 1E28A 4X8XA 3PQYA 3QUYD 4LQ1A 5K9OA 4ZFZA 1MI5A 5CZVL 12E8L 4MA1C 3QWRD 4NC1E 1MUJA 1YEDB 2D7NA 4HGMA 4JZNB 4GG6B 5DEGB 3WNLA 3MBED 2EYTB 2NQCA 2EIZB 4UILH 5CGTA 5TF1H 1FFRA 1MCWW 4M43L 3T2OA 5IGXH 1CGWA 5KAQF 1PEZA 4OIIL 4QHUA 3GDBA 5AZEL 2GT9B 2IH3A 3QQ3B 1UWGH 2VDNH 5C92A 4HKZB 5F9JA 4K3EH 4Y8AA 4M1CD 3JTTB 1ITCA 5CD3B 3L5WA 4RGNB 5KN5A 4POZC 2EEDA 5IB2A 4NQCA 1TCMA 5J7CC 1D5ZB 5D1XB 4LASH 4JFPA 4HS8L 1I9RL 4PV8A 3WNNA 4ODVH 3D3VE 3SKOA 4HMCA 4QHMB 1MJUL 1JWSB 1BF8A 3H3PL 3EYOB 4LLAA 3CX5J 3OR6B 1KTKE 2MHAB 1BGXH 4NT6A 4YXHH 1ND0A 2EO9A 1FO0B 4OCXL 3O3AB 1DQML 4OZGF 3V4PH 2Y06H 4F7CA 1VEPA 5IW6A 3NFSH 3PHQB 3GSQA 2HLFD 1EH9A 2ZUUA 2ZNWA 3L6FB 5DWUL 4BSVA 4OFIA 1NKRA 5HD8C 2AJYH 5GS3A 4I0KA 1U8IA 3GMQA 3FAXA 3G5VB 1S9YA 2R56L 1E27A 1WBXB 3UTTA 4HPOL 4KHXL 2G5RA 2AJ3A 4ZUSA 5TDOA 1HKFA 3LD8C 4FFWC 5IMOA 4GMTH 2PW2B 3QIUC 1INQB 4IDLA 1CK0L 1TENA 4OF0A 5J6GB 3ULUL 4X6FA 4HCRH 3P0YL 1BIIB 1OLLA 5AYUL 1EAJA 5BZWA 1UEYA 3RIAK 3QZWB 4RAVB 1RJZA 3UXFA 1A1NA 3FRPG 1T1XB 1QO3A 1MHEA 5DJ6A 3GHBH 3THMH 3AREB 5C0BE 3ARED 2ENYA 2G75B 4MJ6A 2P24A 4DW2H 2HMID 3EOYG 4GOSA 5TPWL 4XCCL 1WBYA 4PPTA 4NWTH 2WNGA 3K8KA 3DVGB 4TVPH 3REWA 3VI3E 3HB3C 5EO0B 2XOTA 4P23C 4X7CC 5FYLL 3EYUL 4QCIB 1P7QB 4W4OC 5KN5B 1N4XL 2AXFB 2AGJH 1FFPB 1B6UA 4MWFA 3P4MB 1HH9A 2DBLL 2QADD 4XCFL 1P4IH 5BV7C 4UAOC 2BNRB 4XVUD 3FQWB 1KELL 2A6KB 4RFEA 3ARXA 1FN4B 4RFOH 4UT9H 3VFOB 1W2KT 1DQLL 4M7ZB 1GZPA 5IV2A 1MCIA 3OXRA 2F58L 4RMVA 3RVWD 2DI7A 4N0CD 4X5XA 3M45A 5CEZH 1KLGA 2OX5A 1OARL 3A0OA 1NGZA 4XNMB 4JDVB 3WUWA 4U7KA 3D85A 4A6YL 5IMKB 5KANG 4ZAKC 1IC4H 1T7YA 4DAGL 3ULVL 3MJ7B 2O5YL 4R4FL 3PIQB 2GITB 4X0KA 3TO2A 3VXSB 5F9WB 3V52L 1BF2A 1I1RA 3KJ6H 3V7AE 4XBGB 3ESVF 3LEXB 2FL5A 3P9MA 3QULB 3W5NA 7CGTA 2X4SB 2VXVL 1X5LA 4LHQB 5DK2A 2XTJC 2VITB 1AGDB 2HFTA 1UM5H 4WV1B 5CJQL 3GSOB 5A40E 1F2QA 5C0BD 2L7UA 1T2XA 1BQSA 1YPZE 5D71L 1VB9A 3KLHD 2CUHA 3D0LB 2HN7B 1DQDH 4L9LC 3QNZA 4NFCA 5IB1B 3OGOE 3RBGA 1E6JH 4HS3B 4MA8L 3VD9A 3ZHKA 1JNNH 2VDQH 1K9TA 1ZT1A 4EI5B 3HMWH 3MBEB 5EPMB 5JXED 2EYSB 4LCCA 5EG6C 1S9YB 4FQ1H 1OPGH 3LEXA 2FLBT 3ELAT 3AB0B 3B5HA 1WZ1L 2ZG2A 1MRCL 1HWHB 4Y16C 4Q6YA 2Z35B 4Z7UA 2GIYA 3KPSA 2QHRH 1U58B 3WS3B 2EKJA 3BKML 4OLYL 5SWZA 3UJJL 4M3JA 4GG6E 2XTJD 3R1GH 3DV4A 3WKMH 4OTXL 3EOTH 3JSSA 3AROA 1F3DH 1MCQA 2G2RA 4R26L 1HXMA 1R5WB 4OZHE 5IW1B 5BCAA 2FJHB 4F7MA 4Z76A 1NEZA 4WTZA 3ECBA 3QEGH 3DX6A 1RUKL 3O9WA 1U8MB 1GZPB 2B39A 4KUCD 1A0QH 3FQUB 1AIFB 1P9MC 1D5ZA 1JPTL 2BVQA 2ZCLL 2WMPA 4DKDC 3OKNA 5DR5L 1R5IB 2ARWA 4M5YH 3UCRA 4MNHB 1RJYB 1FQ9C 2IH1B 5LKNA 1K2DA 4P9MH 5I76A 3RL1A 1FHGA 4RQQA 2NXZB 4JE4B 1AKJB 1XGRB 1RU9H 2VDKH 1RZGA 1J8KA 3BP4B 5E24E 4N8VA 4IS6A 4ZODA 4CN6A 5KSVA 3E6FB 1JUFB 3T0EC 5DQDL 5F9DC 3BEVA 5C0DA 3U7WH 3AGVA 2PETA 4K94L 4KQ3H 2PTTB 1RZ8B 1TTFA 3L1OH 5KTEH 2O61B 1N2RA 2EDOA 43CAB 1YECH 3UEZA 2FGWH 2QTEA 4PJAA 2ZKHL 2FSEA 1JRHI 2IAND 4J8RB 4XVSL 2CH8A 5A3IC 5KVGL 1XZ0A 5CP3A 1FYTE 1UGNA 3KPLB 5BV7L 3TVMC 5JW5B 5I73C 5HXMA 4JPWL 5D7SL 4Z95H 1D9KD 2X89D 1E6OH 1EJOH 1EZVX 1AXTH 2Q76A 3U9PL 4L4VA 3L3IB 4D0BA 4NO2A 3K46A 5FYJU 4JO1L 3TV3L 3VDAA 4KK9D 2IBBA 1S9KC 3NIGE 4ZXBA 3HRPA 2FX7L 2NPLX 3VFUB 1G0XA 5ELIA 4XI5D 43C9A 5FB8B 5J06A 2ADFH 3NZHL 5FGRA 3TIEB 2X1WL 2QV2A 1IGJB 4LCCC 4HJ0C 3IFLH 5KS9F 4GAJH 3BN9D 1A3RL 2BOBA 4PJEF 1QRND 4YE4H 5T3ZE 4I18A 1WCQA 2XG5A 2NY1D 3GM0A 3ARBC 3AMLA 2F54E 5BS0A 2PYFA 3MGTA 4Q58C 4X4ME 4Y4FA 4RGNC 3HR5B 4Z7VF 5I1DB 5IVZB 4P3DB 1JPFB 3RWJA 3VXUE 3DOSA 3WBDA 3HE7C 4PREA 4NBXB 2PXYB 4NQDA 4UTAL 4MXQD 4DCQA 1R5VA 2LTQB 4GQ9L 5JUEH 3VXTB 3T8XA 5FGCE 3VXUD 2YKLL 3CVHL 1A3QA 1GYAA 1CXKA 3N85L 1U95B 3P4OA 4JJHA 1YC7A 4OGYH 4N8VB 1GL4B 3D3VB 4OLUL 3QJFB 1L7TL 4R2GD 4WNQB 2NLJA 4MXWH 3TP4A 1WAAA 3RWCA 3WFCL 4MJIB 4PJCE 5DFVD 1H5BC 1NKOA 3AFLA 1A7OH 4MS8D 3VFWA 2F53D 1F58H 3NA4A 4GXUN 4JDTL 5DUMH 2GTZB 4LU5H 4ZS6D 4G6KH 5ICYB 3WNMA 3MLYH 3LOWA 5DMYA 4Q9CA 1XZ0B 3TA3D 1FL6B 4M6NH 5FEBA 3QWOA 3SPVA 1A6UL 5E8DH 4Y16D 4J4PC 4NJ9L 3T4AA 4N0RA 4DN3L 4X99B 4HFUH 1R3JB 1F02I 3OBAA 1PZUB 4NDMB 5EC1A 1FPTH 3NIDF 5HDQH 1I3GH 2JCCA 1WFOA 5HYJB 2ID5A 5MERB 1QBMH 2XKNA 4NM8H 3GNMH 4HLZH 5ICYA 4YDLB 3EYFA 3RX8A 5I17A 4M4PA 1S8DB 3OJ2C 5DFTA 5ILTL 1FL5B 4GMSL 5CP7A 3DRTB 1IGIL 1RIUH 1N7ML 4L3EE 1FZJB 5GS0H 4HH9B 4XBPA 4G6JH 3SDYL 4X6DA 2DOCA 4PP2B 4NQEB 1XF3B 5IVXF 3T3MF 5HHXH 3UTOA 3S5LG 1T1WB 4QOKA 5HGAA 1HYRC 2BMKA 2CIIB 5T1LD 5HI4D 1QLEH 5JW5A 1U8HA 1VEOA 5EU4B 2X4TB 5E9DE 4AMKL 1JRHL 3BPOB 4PRIA 3DI3B 1UZ6E 3GK8L 3T0VA 2EDLA 4HUUA 2BNQE 1SYSA 3MRIB 4I0PA 4FXLA 1FE8L 4XP1H 4APQA 4X4YA 3BRFA 1WBZB 4DFHA 5CEYB 1HHIB 1QLRA 1ADQA 4V2CB 3KLAB 3BPOC 2R0LL 1VGKB 1C1EH 3VXQB 4JEGB 1HQRB 3BEVB 4XNUH 3FFCB 4HUUB 5IM7B 3DETD 2Z91A 1BBJA 1IAIH 5E6IA 3PWJA 4RWYH 3WJJA 2NY4B 3V95A 4EN3C 4Z6AT 2AK1L 2C3XA 4NO0A 5IUSA 2W9DL 4YDKH 4BQ9A 4MQXC 4G43B 3AS2A 5GRJH 3QXDB 5I8CA 4QT5B 4ZS7H 2VAAA 4D94A 2J8HA 3T8XB 1K4DA 4JKMA 2QLVB 5J3HC 2OJZH 4OFVA 3EUUA 4JKPL 4X4XA 5AAMA 3P73A 1FAKT 2K9UA 4ZNEE 4GG8A 4HGWA 3VMOA 3BPLB 3TN0A 4S2SB 5TQ0H 4NKIL 3PDGA 1RURL 3GRWL 2CLZB 4KZEL 4QXTA 2XZCL 3FFCA 4XMPL 3MYZA 3VGHA 3JWDL 1NAMH 3SO3B 4QEGA 4MAYB 2VR9A 3QWQB 1AY1L 1CD1A 3MLRH 4JM2B 1JF6A 2QQNL 4KKLC 4ZFOL 4RGND 3QUMA 2VOTA 4LQFH 4C59B 1QRNB 4NHUB 4X4XB 5T3XE 2JCCF 2GYSA 2HA1A 3GSNB 4B53A 2JB5H 3VA6A 4S2SA 5ESAA 3QDJB 5EH1A 4KRMB 1RZ7L 1IGCH 2VISA 3T3PE 3EDDA 3PG2A 2ICEB 5DC0A 1D5XB 5EC2A 5I74C 2OI9B 3DX8A 4U1JB 1I9IL 4M7KL 1XF5B 1WGOA 1YEGH 1JK8A 4G5ZL 4OLZL 5E0QA 1F8TL 1WZKA 4X6DF 2YEZA 4O5LH 5TQ2H 5FO8A 5D7KD 4U6HB 1D9KC 4KMTL 4UIMB 3FRPA 4PGZA 4Y5VC 1NEUA 1SY6H 3HZYA 1G6RB 1DL7L 3GSNA 5E5MB 3VGEA 1XIWA 2FDBP 1LE5A 4X6DB 5EZIL 3P4OB 1RHFA 1P6AB 3WFBL 5L2JA 5D2NC 5DJ8A 5C2BH 4FTVD 4ODSH 5FYJE 2P5EB 5ERWA 5DEZA 3KYMB 4P0DA 1T22A 1UJ3C 2HLAA 1YPZB 4UOW1 2CRIA 5IESH 3MRJB 4DQOH 3RDTC 3GI8H 1W0YT 2R2BA 1KTLB 4KGJA 1KB5H 3LCYA 3M8OH 3O11B 3IKCA 5E4IA 1DBKH 5I1AB 1S7VA 1B3JA 4KAQH 4JY4B 3L3JA 4MSWA 2OYPA 4LSSL 3CLFH 3HHRB 4Z0BH 1EAPA 3QWOB 3SPVB 3JTTA 4M9OA 4LIQH 5CMAB 2FEDC 5GRXG 4PRHA 1P69B 1S7QA 2IPKA 35C8H 4JHWL 2ATKB 4DGYL 4KMLB 1BVKB 5E2UH 4WW2B 4YFEA 3QNXB 4NQSB 1DQMH 1SEBB 1RQ5A 1NGXB 1FGVL 4NKOB 4X7TB 3BE1H 3GSNL 4WHCA 1MCEA 3WIHA 4PGCB 2UY7A 1SJHA 3DXAB 1FL5A 4PRID 1X44A 1IQDA 4YPGA 2OR9L 5FA3A 3MV8E 4M6MH 4PY8I 4JRXA 3B9KC 4U7MA 2ZUSA 5IVNA 2C4FT 4JHAL 4J7RA 3RAJL 4PLKD 2FATL 1U91B 5DD3L 3ARGA 5CLWA 5EU6E 2Q8BL 1II4E 1YEFL 2VDLH 2EC9U 2X4QB 3HC0A 5D1QA 4MDIB 5F9AC 1G9ML 4U31A 2EH7L 2QQKL 5EU4A 3ZYZA 2FX9L 3V6ZB 3L3IA 1G0DA 3HZMA 2YEZB 1HE7A 3HNSL 1HSAB 3OB0H 1A7BA 1K8DB 2H2SC 1ZS8B 2WBJD 1KPUA 2MCG1 2VAAB 2L7JA 3EYQC 5CP3H 5C08A 3MBXH 1FFNB 4JZJB 3WYRA 1QUNA 4FTVA 4NQXA 3RUGB 4ZYKA 1HQ4B 1NCTA 3GGWA 3OB8A 1LK3H 3CH1A 3HS0A 3U0WH 1IAIM 3TIEA 2BNQB 4LSVL 5JO5A 4NKMA 4KGLA 4Z78B 3MRRB 3VI4F 2ZCKH 1A5FH 4HDIA 4H25A 4HF5L 3CFDB 3NPSC 5ANMA 4XNXL 4OZGA 5L8LB 1MHEB 2ARJA 4ZTPH 4BSVB 5AD0B 2BVQB 2OJEB 3LAFA 3BP7A 1CYGA 3ARDC 2YK1L 1HI6B 5C0FB 1NMAH 3SKMA 3GJFA 4M8QB 1QQDA 1N6UA 3SDAA 1BOGA 4FZ8H 4XCFH 2CJUL 4Y16B 1TJHH 5C0NC 4Y1AA 4NWUH 1XAUA 2DQDH 3T65B 3F62A 3AB0C 3GI9H 2GQHA 1KLGB 1AO7B 3IF1B 5GS1C 4JAMB 1JHTA 1U3HC 5B38A 2GJ6E 4G6FB 3HE6D 3Q5OA 3O6FD 1KJ2L 5F89B 4M1GH 4AEIH 5EDXA 4OBRA 5B39G 3VGBA 1EEUA 3ZKSD 1EFXD 4NZUL 4OZHA 4XX1E 4P2RA 3R8QA 3H9HA 1N2RB 43CAA 1MRFH 1AI1H 4OLVL 5EBLB 4L8DA 4KKCD 4Y4KA 1NCDH 3T0AA 4EBQH 2FO4B 4GAYB 4I0PC 4NN5C 4PB0L 3V52H 4JKKA 5BS0D 1CXFA 3KGRA 5C0CD 2WUBL 3IVKB 32C2A 3MODL 2PYEE 3U46A 1N6QH 3REVA 2BVYA 1GOHA 1BECA 1TQCC 3QDGE 2A83A 2BX5A 4LSUH 1CDJA 2WQ8A 2R0KL 2VDOL 5I6XB 4FS0A 5D6DA 2DQIL 3EW3B 1T5WA 4LLQB 4KROC 4Q9QL 1YYMH 1NLBH 1T66D 5J13B 4RISH 4PBVC 1IKNC 4PP1C 2J5LB 1JJUA 4W68A 3RQ3A 8FABB 1KXVC 2P49B 3D0LA 3HMWL 4P9HL 4XP6H 4M7ZC 3SDXB 3ET9F 3S37X 1WZ1H 5DMJB 2OTUB 1NC4D 1PYWB 4KROB 2WWKT 4LGPB 4PJ8C 4PJDE 5I6XC 2HT3C 1DVFA 3VXRD 5HYSG 4IMLB 2EDBA 2QJDA 3I50L 5FYKD 1R3LB 2D7QA 4YXHL 1MCLA 3ZZ1A 4JFEB 3SDDA 3SE8L 4I48A 5C71A 1WBYB 1S9VB 2CLVB 3EFDL 4FQCL 3I6GB 3VWKA 3MLXL 3KYOA 3OAZH 4OZFG 4PRNA 5F1OB 2O26U 1VENA 4MZ3A 4JGUA 4QYOA 2I26N 3UAJD 1C5CL 1KLFA 2MHAA 1XEDA 4JDZA 1FYHB 4UTBH 4ZO6A 1J5OH 3RGVB 4OUUA 5EOQL 4N1EA 1G7JB 4ONGL 4KZDH 1BFTA 3RWEA 4PJIB 1DBJH 1QR1B 3G5VA 4M5YL 3ZT7A 2YD1A 3BUTA 3D9AH 4J4PD 4NPYA 2JTDA 1FNSH 3O6LH 4HMEA 4XXDB 5F7WC 4GBXC 5E8OB 3K3QA 4IS6B 1IFHH 2XZQH 3VXNB 4H0GA 4JFEA 1A6AA 1DUYB 4Y5YA 5IVOA 4PJGA 2I07A 5M7QA 3NCYP 5E08L 2F15A 1I8MA 2Z92A 1I3RB 4UINH 3CVHA 3I6GA 1MVUB 5CILH 4OCMC 4BH8A 4XGZB 2DRUA 3LD8B 3PGDB 5EO9B 2UYLA 3JVGC 4OF6A 1I1CA 5DJDA 2AJSL 3QO0B 1TQBC 4FXKB 1YMHB 5T33L 1KC5L 2V2WA 5H2BA 4WFFD 4CRPA 4IJ3C 2DIBA 4S1SH 4WTZG 1R24B 2F19H 1SM3H 4X6CB 1CDIA 1OP9A 3L95A 4IDJH 3ZL4L 4NQDD 4Q74A 4CU8A 4BQ8A 4F7TA 3GMPA 5D7SH 4Z95L 4GS7B 4YK4C 3LQZB 5DK0B 3CFCL 4PRDA 4U1HB 1N0LA 2FNBA 3V0AC 3IFPB 1EPFA 1N64H 4BK4A 4JO1H 1GPOL 5D1XC 2BCKA 2J4WH 2QSQA 1RUML 2VLKD 1OAYL 4HKZA 5F9JB 5INDA 3QI9B 4JGJA 3UX9B 3MXWL 5T5NG 4UUJA 3A6OA 4TUJB 2FO4A 4KV5F 1M4KA 3TNNB 1FIGH 3OB0K 3Q48A 3TH3T 1B4RA 3RZCC 3VFOA 1UYWL 3VRIA 4JDVA 3JWOL 1BZ7A 4Y2DA 5J6GA 2O5YH 1JFQH 2RFXA 3B9KB 3BP6B 3KPTA 4GKNB 4OSUH 2XN9E 1CG9A 4NQED 2DQEL 3FQRA 1LVEA 2NY7L 5FA4B 1IZKA 2QL1A 4QRRD 3NFNB 5E95B 3CFKA 1WIUA 5D7LD 1QD0A 2I5YH 3QR2A 4TYUA 4LEOA 5F1SA 3B9AA 2VXVH 1IL1B 1CXLA 2P7TA 4KRLB 3OL2A 3C60B 3QUZC 5T1DL 4KJQC 3G6DL 1QSZA 2C4FU 1CGSL 2DMKA 2YBRA 4CVXB 2GJ6D 1YMME 4IMLA 5D72H 1AGDA 1VA9A 4UUJB 4EUPB 1FIEA 2Z92B 1J0ZA 2HYMA 1OF2A 3PXHA 3CDCA 5JXAH 5D2LB 5C0CE 1BQHG 3QRGL 3VDCA 1KB9K 3BX7C 5IW6B 4FXKA 1T66C 3H2WA 3MRDA 3V6FA 4LPWA 1CBVH 5K9KB 4PRPA 2BNQA 2Y25A 3BIKB 5FUCC 1U9KA 4NUGH 5FECB 4NZTH 3MOBH 1G7JA 5C07E 4WFGE 1LO3L 3B6SA 3S36H 1IL1A 5SWQA 3Q1SH 4XP5L 3CMOH 5CD3A 1MREL 2JJVA 5JOPE 3R1GL 4C83A 5LGJA 4QRPD 3M1BA 4OTXH 5D1XA 2XTJE 3MYJB 1FZOA 1OTTC 2IALA 4Z7WF 4EI6B 4ZDHA 1RIHL 5I16A 4Q9RH 5HDQL 1S7TB 4J23A 2OXGA 4TVPE 4PV9B 2FJHA 3HC4L 4F7MB 4F33B 2CRZA 5ENWA 4BKLB 3B6SB 3ZTJG 3QI9A 4G9FA 2V6HA 3QAZB 3OR7B 1IRAY 4W6WB 1VDGA 1KN2H 1C8PA 2OTUA 2FL5B 1IE5A 3FB8B 2OI9C 4LDOB 5GS0L 4HGKC 2NNAA 3WN5B 2BZDA 4QRPA 1QSFD 3MLPA 2A9NL 3S3SA 1HK6A 1MFDL 3RU8L 5KSAC 1I7ZB 1F97A 1V3LA 1WWAX 4NRXB 5HYQA 1A9EA 5DQ9A 3UTTD 1ZHNA 1UADC 3DUUA 5F1KC 2ZUTA 2XRAL 4TSAL 4G8GB 1XIWB 4GAGL 1RUQL 5KTEL 1CLYH 4LHUA 2ZG1A 3WDHA 5GSRA 2GSIB 5KZCD 2Y1VA 3GHEL 2F74A 1N5YH 3U36A 2H2PC 1KNOA 5HHOE 5HY9A 5KSBF 5DO2C 2VDRH 3JUYA 3U1SH 2HT4C 3MXVL 5IG7A 2VQUA 1Z9OA 4QO1A 4X98A 1G6RH 4HIXL 2JIXA 1KTLA 2CR6A 3VFPA 4U1GC 1NGPL 1L6XA 5BV7H 3QFDA 1NBYB 1N0XH 1DSFL 4MD5B 5T5FH 1NAKH 3W11C 2XA8L 4PUBH 3SDAB 3UYRH 5CWSB 5GJTH 4OQTA 3FO2B 1DQQA 5FO9A 1HIMH 2WP3O 5E2TL 1J05A 3QXVA 3OSKA 4F9LC 3QHTC 5B38B 1UG9A 1A7NH 4QTHA 1T21A 1BJ1J 1F3JA 2Z9TA 4OCYH 2WUCH 2Q86B 4OD1L 2FX7H 4HKBB 1AE6L 2KL6A 4Y2DD 5T1MA 4F2MB 5I1KH 1U8JB 1FV1A 4AEEA 2EIDA 4PJ8A 1OAQL 4ZUUA 5ID0B 2D03H 3S9DB 5FV1L 3VG9C 5C9JB 4NKDB 1V8HA 3UTPE 3NA9L 3EZJB 4KJPC 1LDPL 4UIMA 5J6HA 4RGOL 4V1DD 2RGSA 1Q9KB 2GSGB 2G5BB 3BW9B 3CU1A 4NNPH 3UTQA 5C6WH 4WDIB 3GRWH 1KYOK 2QADC 2GT9A 2VC2L 2XV6B 4M7LT 4Q6IC 2XZCH 4FQXD 1OTUD 2X4OA 2QBWA 1QFHA 2VLRD 3LKNA 1IT9H 3EKCA 4XWGL 5DD1L 3I84A 3I6LD 4S1QL 2J8UE 3PP4H 3VGFA 2FEDD 2FB4L 2BY1A 2CUMA 2R2HB 4P23D 2R2BB 3N85H 5T3XD 4JY5H 1LNUA 1KFAH 5EZOL 2WAHA 2HLFC 3KPOB 1U6AH 4UILL 2DKSA 5D7IE 4H20L 5IJVB 1FSKC 1EMTL 3QG7L 3MRQB 2R8SH 1P6FA 2RCSL 4JN2A 4K8RC 1XH3A 2YD4A 2LVCA 1IEAB 1RJLB 2UY6A 1DANT 3DXAD 2Z8SA 4DKFL 5HHQA 3H3BC 1AR2A 3IS0X 1BLNA 2P8PA 3O2DA 4OGXL 3EOBA 3VW3L 4N1HB 5C7XL 4G3YL 4LASL 4WFFE 4HC1A 1NC2B 4ODVL 2P47B 1A6UH 1CQKA 5E8DL 1B2WH 1FGNH 4KKAD 1UQSB 5F6IC 1S9VA 2R2EB 5HVFB 3LKSB 5J1TC 3S88H 3U9UA 1VACB 2BOCA 3DGCR 1G6RA 1CDGA 5DUPL 1FPTL 3O11A 1REIA 3CC5B 4YJZL 3ZDXE 1TJIH 3EO9H 3WIHL 3QQ9D 4L4JA 4ALAH 1A64A 3L5XL 3MGOA 4G80A 2VABB 5F70A 3DETC 1XCTA 3HN3A 3CU7A 1MQKH 3CSYA 5C3LD 4BFGA 4GXVL 1P4LB 2O5ZL 2VB5A 3X3FL 1R3JA 4K2UL 1RIUL 4KHXH 4OZHB 3SE4C 1ZGLB 2R1YB 3OAYK 3S7GA 1ZS8A 1Q72L 5E03A 1X7QB 3CX2A 5B39A 5DRXB 5GGRY 3TPUB 2J1KA 4XMKH 3AM8A 4FFZL 1AD9A 4XPGH 4MMXC 2YC1B 4MJ4A 4EIZC 1RHHA 4GSDL 4RA0C 4HCRL 1MJ7L 3S3JA 3IYLW 3OKEA 2HKHL 5CCKH 4NQEA 1YEIH 4WFGD 3BPNC 3NCYS 4QOKB 5J9PB 1CFQB 4M6ML 1HYSD 2FEEI 4PYHA 5E00A 3PWVB 2EDTA 5EZJB 1YY8A 4G42A 2J6EA 4L8SB 2FIRT 5IOPB 1NBVL 2W59A 3NIFE 5DD3H 1Z5LA 2I07B 3S4SB 4GS7C 1HCVA 3QUYB 5C09D 4K3JH 3TZVA 1HSAA 3ULUD 4LVOC 1RZIB 4JVPA 5FYLH 4ZFFA 2AK4B 2B20A 4JREB 3MRPB 1EIBA 1GOGA 5CS7A 4ODWB 4RZCB 3QIWB 5IROC 3FO1A 5DZLA 5GGUA 4QKXB 5FKPA 1DLHB 2B5IB 3CSPA 3QEQE 3MBXL 1L0QA 3EDJA 4UV4L 5IM7A 4LVNC 3S37L 4PJEA 3OKOB 2P8MB 1NLDH 2W0PA 2AJXL 4XP4L 1XGQB 1DQLH 5JDJA 2VQ1B 3L7EB 1JGVH 5EO1B 5HHOB 3PQYD 3QUYA 4ZPVB 3RTQB 1XF5A 5HYSA 2EDYA 3VGAB 3WXWH 1VERA 5FM5M 4DZBB 1RZJH 3HZKB 4PIRF 1GC1H 4JB9L 3ARFB 4MD0A 5GRUL 1NFIB 5IR1B 5D4QA 4GRWF 3JWOC 2KZWA 1VHPA 4RQQB 1BM3H 2DWDB 1FVEB 2Z8VC 1EV2E 3IFNH 3STZB 4O51B 5IMLB 2Y36H 3FHQA 4RMRA 3HPJA 5JA9A 3ZLQC 4M62L 5KG9A 1U3ZA 5E2JA 3RJDA 1P5VA 3LKQB 3RHWK 2CLRA 2V5RA 5EIQA 2ED7A 2HFGH 4M6AA 4ZQKA 5KVFL 2VO5A 3HR5A 1I1FB 4P48A 4F57H 1AHWC 4MA3A 5EBGA 2GJZB 1CK0H 2P48B 4PJDF 5EO1A 3B3IB 3SDCC 4OZFB 4JN2B 4F15C 2WWMD 4W4NA 5DRNA 3QNYA 5I71C 1F90H 1JZ2A 3GMNB 2A1WL 2MCPH 5LCVL 4Z7WA 2WIIA 4HIJB 1CLZL 4OFYD 5ESAB 4H0HB 5I8KL 2UZXB 4BK5A 1VKXA 3P0YH 5L2KA 3DURA 3H9SD 4M61A 5F3HB 3W0WE 1E6JL 2W0KA 3TBTB 4R8WL 1U3YA 3UAJC 1LEIB 1S5HB 4J3XA 1QFUH 1MJ8L 1CLOL 1A1MB 1SMOA 4FG6C 4Y5XA 2BRRL 4MQSB 5MI0B 1DL7H 5HI5C 4IIQB 1A4KB 2BVOA 2B5IC 2H32B 3WXVH 3LMJH 4OKVA 1OT1A 1ED3A 5D1QD 3VCLB 1EEZA 1G7QA 2BSTA 4TVPL 4BJLA 4RNRB 1DLFH 1OTUC 3HPLA 4R96B 4YNYA 4HT1L 5E94B 5EU5A 2BSED 4XC3H 3RL1B 1JZ5A 2R1WB 1HHIA 1IAKA 4TUKL 3BPCA 1M7IB 3MFFB 4UQ3A 3DX6B 4JQVC 3V2AR 2YR3A 4NSKA 4QWWC 2XY2A 2ZSVA 2LAGB 1U3JA 4N68A 2P8PB 4PJFB 3LKOA 3PGFH 4G6MH 4MVBC 3T2NL 4JANB 4Z0BL 3NFPA 5FO7B 4Z0XB 5CJ5A 2NX5B 4OCSH 1EEZB 4N0UE 4JG0H 4NRYB 5IB3A 1N5AB 2B8OT 5E9DA 5I18L 4MNGE 4NHUA 4NQVA 3OKMA 3WMSA 3AVEA 2DQGH 3NTCH 1EEYB 3Q5TA 5CKGA 4EN3A 1KJ3H 2FWOA 3DYMA 3U4BL 5JNYB 4HUVA 1DBMH 1HNFA 2BNRE 1U92B 4NN6C 4ZFGL 2W0FB 5DHVB 1FJ1B 4JRYD 2VXSH 1EVUA 4G42B 4NKMB 1DLHA 2BDNH 3QNXA 3NFPB 5FO7A 2EYRA 1GGIL 2F53B 2B4CL 4I2XE 4NQTA 4Y89A 4K7PY 4KZDL 2AK4A 4XZUB 4LAQL 3SGEI 2ZUQC 1FL3B 3TO4A 1K4DB 3HE6A 3EJYD 2FX8L 5IBLD 1HZHL 4YHYB 2I9LA 3VFNB 1XF4B 1SJXA 2YC1A 2HFEA 1LE9A 4FQ2L 1P9MA 2VZSA 4JCMA 5IR1A 4MS8C 5DJ2B 3WLWC 5F6IB 2Z93A 4UAOB 2O5XH 4R0LA 3WD5H 1EO8H 2VDQL 2R4RL 4JFHD 1Q9OB 4YFDB 3W9EB 2NZ9D 1CS6A 1IGML 1IM9B 4HXBH 3IDXL 1NC2A 1KXQE 2XI9A 2CSPA 4L9LA 4LRIA 1VEMA 1N8ZB 4J3SA 4U1MB 3K80A 1BQUA 3O2VL 3O45A 3S96A 5DURB 4OZFA 3QUXC 4JFDB 2ADFL 3NZHH 3H7BA 1W0VB 3QIBC 5DJ2A 1AR1C 1F2XK 3LKRA 4P2CG 1CGVA 3IFLL 5FIEA 3WUWB 3VFGL 5EA0L 5JDSA 4P2QD 1RD6A 4D0CA 5FYJH 4NN6B 5KOMC 1ZWIA 3NGBB 5EBMB 2AJVL 1A0QL 1LP9E 3UBXB 5D93B 1NDGB 1UC6A 3AC0A 3QEUA 2MMXA 2BVPA 5CSZA 1SJVA 4JFYA 1MFEL 5IBUB 1C5BH 2J4WL 4X6EB 4PJ9C 3UTPD 1WIPA 3WSQL 1U8QB 3ARGD 4U2YA 2C1PA 3DUUB 2Z8WC 5GZNC 2KUTA 4G7VL 1S7WB 5HD8D 5ISZA 4MB3A 4LEXH 5I19L 1CICC 5IQ7L 4MD0B 3BIKA 3VWKC 1MRFL 1FO0A 2NW2A 4MXWL 3GIVB 5GGVL 4QXWA 4DFIA 3U4EB 4BYHA 1BFVL 2VLRB 2NY2D 3VG9B 1GAFH 3JZ7A 4N9GA 4P4KA 2A9ML 1I8IB 2NW3B 2OK0H 2YPLE 4Q2ZB 2JCCB 4MB4A 5E6ID 3RIFF 4AEFA 3ILQC 3BN3B 3SGKA 3KG5A 2OBGA 3H0TA 5J3HD 5D1ZA 5IJKC 2R0WL 1DE4B 1O5DT 4YHNB 2I9LB 5K9JH 1JPSH 1DBBL 4MMZC 4C55A 1FL6A 1OOAA 2VXUL 5I8CB 3QNZB 4L4TA 3WUWG 2MWCA 5I1CL 3DI2B 3V4VL 1F11A 3CUPB 4WW1A 1UJTA 4TTGA 2AXGA 5HHQB 2Q6WB 5J11B 1T1WA 5C0JA 1BX2B 1DVFC 4G8IA 1A7PL 4K3GA 5JPNA 3JTSB 3PL6D 2BY0A 4E9LA 3MNWA 1G7PB 2X41A 3G5YA 1S7XB 3FONB 4WI9A 1ZLSL 4RRPG 3KLHC 4J1UA 3LKPA 2YRLA 1DN2A 3U9UB 1ACZA 4MHHG 1RVFL 5DT1H 3CVIL 2BERA 4A2MA 4RGMC 5D5MA 5GGVY 3VXMA 5AAWA 1T5XA 1MCOH 1HH6A 5B38G 4LVEA 1F42A 1U8LB 3F65A 2MQ0A 5E8PB 1Q9LB 3SGDI 4PGBA 5CHNA 4FQLH 1IKFH 1A9BB 3ES6A 1UCBH 3KYKL 3L95B 4EDWL 4UQ3B 1YN7B 2D7TL 2MSPA 1INQA 3U0TB 3G04B 4CDHA 1L9NA 4GKOA 1BEYL 1QVOB 1KN2L 4PJFE 2JJUA 1J8HE 4Z7QF 1CFNB 2O61A 1DFBH 3V0VB 1NFDA 2R2CA 3SO3C 4ZOBA 1X5GA 2AVGA 2IADB 3T4YB 4OGYL 5GRVL 2F54B 4KDTC 3ZT6A 1J0JA 4HKXB 4MQTB 5C08E 1OTTD 1HDMA 2W9EL 4TUJA 2ZP0T 1QFWM 2VLLA 2GSIA 4KY1L 1U2CA 3I6KB 2G75A 4MJ6B 5CILL 4IRZL 1ULVA 4Y5YB 3TBWB 2PTUA 3VRLF 2YD9A 2YD8A 3MRBA 2Z0BA 1A6PA 2V2XB 4LL9A 2AJSH 5HYQB 3C8KB 3VJ6A 2HH0H 4J3OC 2VDRL 4OFPA 5HJ3A 1YJDH 3ARDA 1ZHBB 3DVGA 4KI1A 1F4WH 1X3DA 5HDBF 1T6WA 2F74B 1Q0XH 1DQQB 2JJSA 4HFUL 1IGYA 4JFHE 3V0WL 3RWGB 5TQ0L 3HPJB 1UACL 4N5EC 1IARB 5C07D 4N8VG 2B1HL 1LNUB 3WIFB 5KW9H 1JUFA 3VWKB 3PDDA 1CD0A 4KZEH 1XFPA 1J88A 2OTWA 5J12C 5C0IA 1CICB 5I15H 4F7PA 1DTUA 5GHWL 1MPAL 4MX7B 3FHAA 4GMSH 4X9HA 4DZBA 5E2VH 2NY0C 3HAEH 4U3HA 3QUML 1IC5H 4PJ9B 4RBPK 4CU6A 4JKWA 4PJ5B 4L4VE 2JK5A 3MJ7A 3X12A 3WL9B 1R5VB 4RMUA 3RNQB 1L0YA 1WC7B 3BDXA 3RWGA 2HWZH 1WFUA 3SDXA 4LPYA 2VKXA 3LS5H 3KR3H 1BZQK 4LMQI 5IW1A 1QSEA 3C87A 4H88H 4HIIB 4Y4FB 4U1NA 1JRHH 4P2QE 4XPAL 3V4PL 3GSOA 4OZIE 2J2ZA 3F58H 5HGDA 5I0ZA 2PYEA 5D7LE 1OAKL 3B9KD 5FDWA 1MFAH 3QZWG 1FC1A 4H1LG 3SQBA 2V7NA 1MLCA 4UT7H 2I25N 1UWEH 3WFDH 1NUNB 1BVLB 1KB5A 4DGIH 2F54A 5BS0E 1IAOA 3MACH 1T03H 1KEML 4G9FB 3MGOB 3S98A 1HEZA 1K4CA 4G9DB 4P2OD 4YR6A 1D5IL 1NBQA 1T04A 2R1XA 2IQ9H 2R0LH 5JO5B 3UTTB 3W9DB 4X8JA 4LSDA 1U8PB 5F3BA 5LXGH 3O4LA 4ONOA 3SE9L 2P7TB 5I1JH 3LQMA 5F7DA 5B4MC 3FQTA 4Y8DC 1XT5A 2R8SL 5BVPH 2VJXA 3BP5B 1CBVL 1QO3B 2YPLB 1DBKL 1ZHNB 1D6VL 4NZTL 1JYNA 2UUDH 5TH2B 2EO1A 3Q1SL 1O0VA 4U6XB 4PJBE 3RDTA 3RDTD 3Q3GB 2XICA 4LSQL 1LMKA 4C4KO 3PWPA 4YHIA 2FGZA 1CGUA 3G5ZB 3BEWA 4NYLB 4GBXB 3MTRA 3WS6A 3BP5A 5EORH 3AAZA 1UZ8A 1TZGH 2PF6A 2R4SL 3RVUC 5CD5D 5CSGA 5FK9B 4RCAA 3VWKD 1QFPA 5TDOB 2LTQC 5JPMB 1OL0A 4IMKC 5CINL 2ZJSL 5CWSA 1E4KC 4LLVA 4WI2A 1RSFA 2OR9H 3GUTB 2QQNH 2X09A 2AJUL 4WEUD 4ZYKB 3RUGA 3MPCA 1DVFD 3VXRA 3T1FA 2EIEA 5SWZD 3NACH 1JWMA 1YEFH 4BFIB 4X6CA 4U4BA 5E1AA 5F88A 4XMKL 4U2ZA 3MCG1 5CHNB 4PTUA 5JIKA 4BSWB 1NCAH 4HIEA 2I9TA 4KTDH 4M7KH 4LCWE 4TQEH 3TNNA 2GJ6B 1QRNE 1A9EB 3PHSA 5DQ9B 5FK9A 4JKLA 1QSED 3VRIB 1I8MB 4MA7H 3ULUE 3DV6A 4MCYA 4LLVB 4XAKE 3REWB 1ND0B 2NY2C 2J5LC 1MQ8A 5SWSB 2BNUB 4PJ5A 5IBTL 1A5FL 1AXSA 1P7KA 4XNXH 2R9HC 4Z7WE 2EICA 3ALWA 4PRBB 4HZLA 2XA8H 3UYRL 4OI7A 5EOTA 1H15B 5IFAH 3FT3A 4XPTH 4I3RL 3HTLX 1TQCB 3QEUB 4JM4H 4KDTA 3O6ML 1ZOXA 2V7HA 3C5ZC 2PXYD 2AQ1A 4QHNB 5DS8A 1ZVSA 5K33A 1FVDB 3JXAA 4QT5A 5FYLE 3D1MC 1QPXA 3G9VA 4KK6C 4L8BB 1O7SA 2DWEB 3LN4B 1IC7L 5HBBA 1HN1A 4UDUB 1DP0A 2G9HA 5DUBB 1OQXA 3GKZA 2XPGA 4PY8J 1L9MA 4LIQL 1NJ9B 3SGJC 4G9DA 1U8JA 2AXHA 3WXWL 2DWDA 2QHRL 1FLRL 1GC1L 4DGYH 4JB9H 4PRBA 5GRUH 2J7LA 3UTSE 4EBQL 2V17H 1HKLL 4D0DA 2OL3L 1M71B 3L3OA 1JZ4A 3K0WA 5E4EB 3CDGB 2NY1C 4Q6IA 3EO1B 3HNTH 2ENSA 1YMMA 4P46B 3HC3L 1V05A 1WV7T 3RVUD 2YPVH 5JORA 4PS4L 3FO9B 1Z6JT 5F21B 2Q8AH 1YNKL 1Z9LA 1N6QL 4U1IB 5E56A 3OMZA 4LVNB 4JFFE 1BX2A 4HH8A 3IDJA 4LOUD 3CFEB 1CD9B 1ZVHA 4Q7DA 4HWBA 3QEHA 2YMXL 2BNRA 1QEWA 3TBSA 2IG2H 3NPSB 3I85A 4HCRA 2PCPB 2RCSH 3BD5A 3DXAE 3O41B 3OKKA 1RU9L 2VDKL 5HHOD 1TZIB 4W6YB 5EUOA 3MLZL 1DEEA 1HXYA 3S96B 2X10A 1QFUL 4OZIB 4KJYB 1X5IA 1CLOH 1LK3L 2ITDA 3L1OL 4KK8C 3IDUA 4P46A 4JM2A 3TBVB 1YPZF 3O8XB 4XNQB 1EJ6A 2IAMA 3MRDB 3V6FB 2AXGB 2SEBA 1OCWL 2XXCB 3IDMB 1J8HB 4HF5H 3BZ4B 4FQJL 2AEPL 4I2XB 4YXKL 2HG5A 4NM4L 1H5BA 1A1NB 3AMKA 4UU9B 4LGSB 5DFWH 5KSUA 3SE8H 5F96L 3EYVA 4WHTB 3TCLB 1IGTA 5BXFA 4MDJA 1MIMH 4P2OB 4HPYH 5I1EL 3LPWA 3C6LD 3MLSL 4YEEA 4FQHA 3RPIA 4Z0XA 4UDUA 3A6BL 4K2UH 3KNBB 3LEVH 4N8CL 4GRWE 4EDXA 2CD0A 2BMKB 4L4TD 4NOFA 3GIVA 1OP3K 5KSAA 2UZIH 2VZTA 1ACYL 1U42A 2JB6B 4AIZA 5I1GH 4XRCB 5F7MC 2ADJB 4QNPF 4M1GL 3SCMA 4AM0A 4JLRB 4H1LA 5ESVB 4G8FA 4JN1L 4J3WA 5C0GB 1SEBA 3MV7E 5GJSH 3TFKD 5L7XH 3C5JA 2RJMA 2CUIA 4H8WC 1NCDL 3SKMB 5GPRA 4JFDE 1A3RH 4PJIE 3W81A 2DJ4A 1AO7E 4OM1L 4WY7H 5SWSA 4F37F 1OAZH 1K8DA 1BVLA 4BFEA 2IBGA 1TCRA 2CRYA 3MRIA 1CF8H 3TBYB 3KLDA 3TNMA 1GGIH 3MV01 3G6JA 1BLNB 3RVVC 1CQYA 2GUOB 1LO2L 3DLQR 4S1SL 4M3KB 4OV5A 3KPPA 4LSTH 2FX8H 3DGGB 5F9OL 1J0IA 3TPKA 3I6KA 2C3WA 4K9EL 5JQ6L 1UJ3B 4AQ1B 4HUNB 5FO8B 3BQUC 1VCAA 3MLWL 2ARJB 1LO4L 4N0FB 2YPLA 1NC2D 2A6IB 3NZ8B 5E6IB 3VFRA 2DM7A 2DI9A 3WFCH 4UV7H 5DJYB 1I1FA 4GKNA 2ESVA 3KXFA 4PJ9A 4ZSOA 3CCHA 3OG6B 15C8L 5HGAB 3VGGA 3J7HA 4XT1C 1J1PH 4LU5L 4WEMB 4X9FA 4YAQA 1JYVA 3RFZC 2E9JA 5ANMB 1ZHLB 3D39D 1TZHA 4KKCC 5JR1H 1G9MC 2VL5A 1Z3GL 1YEKH 4JQIL 4O2CA 1D5BB 3HLAB 5IF0A 2WLZA 4FXGB 3CPLA 4IIQA 1RZKC 5CUSL 2ZUXA 4HG4K 3VXNA 4JFQA 1PJ9A 3L3GA 4O58L 3IFOB 4CNIA 3LRSA 4B41A 1VFMA 1WEJL 5FDWB 4EVNB 1S7VB 1PX3A 1NQBA 2OMBA 4OSUL 3T77A 4HHAA 1JPGA 1U8OA 1I3GL 1A6WH 2IGFH 4Y2OA 2J88H 3TN0D 5KS9B 5GGTL 1NMBH 4C56E 1OAUH 2ILLA 4UTBL 4PBWD 1KCUH 5E6IC 5EOQH 1KPVB 4PRHB 3VFNA 3NH7H 1MFEH 3DRQB 1NGQL 3UTZA 4F57L 3QDJD 1YQ2A 4TRPL 3IJYB 4PJ7B 3C2SA 4KQ4H 3O2DL 5H37G 3STLB 1MHPL 4HWEH 5K9QI 3RWIA 3G5YB 3EBAA 4XWOC 3Q6GH 2YN5A 5F1IA 1DQTA 1J18A 3ARSA 2MCPL 3PXJA 2UWEA 4YHKL 2FD6L 2EE6A 2ORBH 3UPCA 4QXGL 4QWWD 1A7RL 2HTLD 3FOLA 1E4XI 2NTFA 2X9XA 4KJWC 5ID1B 1NGXA 1P7HL 3L3KA 1H0DA 4I9WE 1KIQA 3S34L 3QDMB 1IAOB 2XNAA 1ONQB 1BBDL 3PWNB 3VFTA 1RIVH 1SYVA 4K3HA 2VN4A 1JNJA 3KYMA 4NZDA 3ZO0A 4EDXB 4YDVB 1LO3H 2ZOLB 3E0GA 5D7IF 5K9JL 1G9EA 5DVMA 4KTEL 1M6OA 4XP1L 3IDJB 3IJYA 1X7QA 1I7RB 1MFCL 3MSPA 5BS0B 5I30L 4IDJL 3ZL4H 4J2XA 1FYTB 5IK3A 5I1CH 1DE4A 3MMEA 3RWJB 4F3FB 3TA3C 4DUXA 2WANA 1EGJH 4NGHL 1IQWL 1NBZB 4AIXA 4XNYH 2QSCH 4FFVD 2DIJA 4P5TA 1IM3B 5CEZD 1J11A 5IFHL 4JFXA 5BMFH 4Z77A 2EE3A 2MKWA 2R29H 1EFXB 4XNUL 4UOJA 2YSSB 3HC4H 3D2UA 5B3JF 1ZT7B 2BVTA 3MJ8A 1TZHB 3FCTB 2HFFB 1TNMA 2W65B 3UC0H 1OY3B 1CWVA 3O8XA 1CFQA 4JG0L 4NFDA 4WIQA 3HAEA 3MXWH 2Z31C 4XHJD 5I18H 3CVIH 1A22B 3BJLA 5GS1B 3O6KL 5EZLB 1MI5D 1GXEA 4TSCH 5LAXA 3NBNA 1FIGL 2D7OA 2OJZL 5D7JA 3QXDA 3PUCA 2LU7A 5HGBB 5GRYA 4PJXA 2ATPA 3RWDB 4KUZH 4NO5B 2QEJA 3LPGA 1K5NB 3C60D 4DK3A 2DI8A 2G60H 4PFEA 3RBSA 3RJQB 4XC1H 3RPIB 5IIEA 5F3HA 3SO5A 4LKXA 2H9GA 3H9SA 4FQIL 4APQB 5L2KD 1JHTB 1QG3A 1YEEH 3UTZB 1IAMA 3N1QC 5MEPA 1ZT4B 4D0CB 4HGWB 4HULB 1XR8A 4XMPH 5T3ZD 2EDNA 5L8JB 5EOCH 1RUPL 2MQCA 1ZGLM 1GGCL 5EWIH 4LAQH 1QFOA 5DDHB 5ALBH 4XPFH 4NO3B 3D0VB 4PJBF 4LQFL 1CGXA 5ICXB 1I9EA 4YUEL 5MERA 5I0DA 1JF1B 4HWZA 4U1KB 4H1LH 2HJLA 4ZXBB 4KDWA 2XWJA 2YRZA 3VFMA 3V9FA 4RRPA 2FJGB 3PWNA 1DDHA 1IGCL 4IMKA 1AGEA 4PJEE 2F5AL 1LE9B 1F4YL 4I4WA 1U8QA 1DBAL 4IRZH 3VG0L 4LHJB 2LAAA 1CVSC 1W0WA 4O9HH 4HXBL 4M1DL 3BGFB 1YN6B 2ADIA 3QIWA 3CFIC 3LZFL 3BZFB 5BRZB 3MUZ1 1CFBA 2IPTL 3I9GH 4KMTH 3P73B 5DD6B 3UBXI 4KRNA 4JPVH 3P0VH 4PJ7A 1Q0YH 5MHSE 1OB1A 1KXTB 5I9QC 5EULV 4RAHA 3WE6B 5AUMA 5FM5O 4PREB 4LCYA 1PSKH 4RGOH 3O4OB 5KS9A 1UH3A 3KWWB 3RKPA 3VFMB 3EDFA 3OPZL 2HT2C 3BRDA 2VC2H 5E5UB 3PV6A 3STLA 1I4FA 3MRHA 1X6LA 2VWEE 4XCEB 5IWLA 4P5TD 4QRRB 4S1QH 5DZOA 3LDBC 5FDYA 3VA2C 4LVHB 4TPRL 4O2CB 3HFML 3SOBH 3ARUA 3P11H 1D5MB 5JPNB 1GH7A 2JELL 2VSCA 1M05A 3ILPA 4FQXC 4ZOCA 1HHGA 4R9HA 4C56D 3RNKA 2EYSA 3GGWB 4LCCB 1KN4H 4GKSA 4M5ZH 4EVNA 5GS0D 4MJIE 4NC2B 4U6HA 35C8L 2NY2B 5HDOA 1JV5B 1CTOA 1AQDA 3MV11 3UZEA 1KIUA 1RZIA 4LSRH 4ODHH 4MLIA 2DQHH 3MFFA 4K8RH 5IB1A 5KVEL 4L8CB 1U8KA 4E41B 1X4ZA 2R0WH 2CIIA 4HKBA 2YA0A 4OF8A 4UT7L 5E99H 5EOTB 1RULL 1SEQL 2VMFA 4X8JB 1JF1A 4BELD 3Q0HA 1A1MA 5DJCB 2IANA 2JJSC 4AT6A 5GS1A 2UUDK 3V4VH 2Z35A 5DVKA 4WHDA 1TTGA 5I73B 4ZPVA 3RTQA 2KH2B 5SWZB 3B43A 1JI1A 2HFFA 2W65A 4HK3J 5CLTA 2AEIT 3EJJX 3N0PB 3Q6FB 1RI8A 4GG6F 4XBEH 3KDMA 1S7TA 1X5YA 4EOWH 1P4BH 3BVNB 4UBDD 4WVRA 1A6TA 3P3YA 1JTTA 5D93C 1D6VH 3PHOB 3ULUC 2BVPB 1AE6H 1T1ZB 1RVFH 2R1YA 5DT1L 3OJDB 3WE6A 3P4LA 2ZSVB 2JIXB 3SGJA 3GMRA 1I7RA 2HKFL 3S8WA 1CIDA 1Q72H 4WUKL 3WO4C 3TO4B 4PJHE 1IM9D 4LSQH 3QXTA 5HYJD 3DX7A 3L5HA 1ZKAA 3NA9H 4RDQF 4Z7QE 4DN4L 5C6PB 1JP5A 1LDPH 4PJFF 5FYKL 4QHUB 4XPGL 4MAYC 4NO0B 1YEJH 3KPRE 4JFOA 3SKUD 5ETUB 4ONHB 2H2PD 3CZFA 4XWOD 1QP1A 2D7TH 3BHBB 1PQZB 4N0UB 1PW3A 2R4SH 3KS0H 4I9WD 5MEOA 4FQXA 2GITA 1FDLH 1KOAA 5FYKE 2CK0H 4R4BB 5JZ7D 1JF5A 4M03A 3SBWC 4U6VH 4XRCA 3RWHA 1ORSA 1JWUB 4HZLB 2YPLD 3P9MB 1J86A 2BCKB 1KJVB 4X7SL 3OKOA 4B0MM 4FFVC 4X80L 4B5EA 5IHZB 4XXDA 4WTXA 3A6CL 8FABA 3F7YA 1HILA 5I1LA 4HQQL 4DCQB 3HUJA 4J8RA 3JWNC 2H1PH 2NY4C 5TFSH 2NY3D 3MRFA 1H3PL 4XH2A 1OTSC 3BSZL 4NZUH 3QG7H 1KCSL 2XT1B 1ES0A 3UJTH 1F4HA 1H8NA 3SHSA 1MNUH 4R3SB 2E5EA 4OLVH 2P5WD 3F12A 5H8DA 4DKFH 5SWSD 1IAKB 5HY9B 1FG9C 1U8HB 4V1DA 2A6KA 4RFEB 3GIZL 4PRAB 4OGXH 4I48B 4KUCF 1MIEH 3QFJB 2NX5D 1JGVL 5EU6D 3V5HB 4ELMB 2B0SL 4R90L 5BJTA 4HV8B 1J8HD 3K2UL 1OAXH 1A02N 3VFUA 2I27N 3MQIA 5DSCA 4P2OC 5DJYA 5MENA 1X5AA 5J56B 3DV4B 1JZ3A 25C8L 3KPRD 3CXHK 4ZD3L 1I9JH 3O6MH 4U1SB 3B9EA 3L5XH 3F7QA 1YYML 3ZKQD 4NPYB 3F7VA 4UQ2A 1T7XA 2P5WA 4FMKA 4AK1A 4M62H 3ARZA 1V3KA 4IRSB 4MHHI 3IT8D 2YD2A 4Z76B 5IEHB 3K1KC 4LAJH 1LEGA 2NR6D 2C4XA 4YBLB 1BPVA 4LLMA 2JIXD 3CK0H 4AG4H 5CIPH 2VNCA 3QULA 4W4OA 5DTFA 2Q20A 3LHPL 1RZFH 2EKSB 2PR4H 1D6EA 4POZD 1QSFA 3FQRB 2PW2A 1XCQB 1QKZL 1JZ7A 4FFZH 4L8BA 2WINB 4W70A 4OFKA 1BZ7B 4Y2DB 2X40A 3MRPA 1OGTB 5HGGS 2EXWC 3NAAH 5DJDB 4H88L 3TBYA 2OR7A 5E8EA 4F9PC 1RZGB 4P46D 5I8KH 4QHLB 4YHPA 4EJ1C 1FZMB 2NX5E 2E6JA 2IH3B 1KV3A 4F33A 2QHLA 1YEIL 3PGCA 5F1NB 2YA1A 1A21A 2XWBB 5D6CA 1R3IH 5DZNA 4CVWA 1ZANL 5IV2B 3BEWB 2ED8A 1KSRA 1KEMH 5CZVH 3TVMA 1J5OL 4RGNE 3BESR 1YNKH 4P46C 4PRHE 2V5YA 2CQVA 5HYJA 1UZ8B 3AREA 3ME0A 4K23L 4CMHC 4JR9H 4X4YB 4K3JL 4G8GA 5E2WH 3BXNB 4M43H 3UJIH 2V7NB 4NRXA 1BQHB 1UWXH 4QRUA 1L7IL 1UWGL 4PRPD 2VLJB 4K3EL 3GMLB 1JE6A 3NCEB 2Y5EA 1AC6A 4CMMB 5L0QB 3LPFA 3CX5K 4MNQD 5CZXD 3MYJA 1EBPA 3KPNA 2F8XC 1MCPL 4JFQB 2AABL 4OD2B 2D7PA 2ITCA 5T33H 2VE6B 1WWBX 4NKOA 4X7TA 4M1CC 4N5ED 2FCBA 3DSFH 3ARFC 3N9GL 3MUY1 5K9QG 4GAYA 1F3RB 2GJ6A 3KPMA 3Q3GA 3TBVA 1EBAA 2EZ0C 3LEYL 4QF1A 3ISWA 3BGMB 3KAAA 3MV9E 2FIKA 2AEQH 3HI1A 4CU7A 4S0SD 2E7BA 3KNBA 5J57B 3IFNL 2VXSL 3QIUB 4DVBA 5J8OA 2ZJSH 3PNWA 4RX4D 5GS2D 3BDBA 1JL8A 2BSRB 3CFCH 3MOAH 2L0DA 5E7FA 4HMDA 4HPOH 1NMCC 3MO1B 2Y6SC 4OLWH 4ONFH 1QACA 2C7UB 3NACL 1BD2B 1PG7W 3LH2L 3ROLA 5TDNA 4JREC 5JPMA 3O45B 4M48H 3ZTNL 1LP9B 1HXMB 5KVDH 1SVZA 1G7HB 3T08A 3PF2A 3TZVB 3U30C 3AY4C 3CFJB 1FC2D 3RVXD 4TQEL 3X12B 4HEME 5AYUH 3K4ZA 3RA7H 1L4IA 2O5XL 3WD5L 5ITBH 4OM1H 2IBZY 4WY7L 1I7UA 1DJSA 4Z9KB 4JO4H 5JHLH 3TVMB 4ELMA 1ETZB 1OAZL 1OP3H 4BZ1H 1SVCP 1QHPA 4WEBH 4YHMH 4WW2A 2I5YL 4U1NB 4XP9L 3GHBL 3THML 5EPMA 4HK0A 1FN4A 5TH2A 1GGUA 1MUJB 5CBAB 4YDIH 4LBEA 4Y5VB 5GGSA 3L9RB 4Y0GA 2GFBA 4NWTL 1D6EB 1UB6B 3ZHDA 2GW5A 4X7DC 2DQCL 5IGXL 3DNKA 2ZOKB 3DROB 5D72L 3UYOD 1OGTA 1AGFB 2HJKB 3SQOL 5EA0H 1S9XB 6FABH 3QIWD 1ZLUH 1MOEA 3C5ZD 1NSNH 4TNVF 3BWUC 3ROOB 1KG0B 3W9DA 2AJVH 1AXSB 3ABZA 1WJ3A 4HD9A 1I8IA 4FMFA 5SWQB 4DEPC 1FLTX 2VE6A 1KUMA 4ZFZB 3RI5F 2HAZA 1H15A 1F3DJ 2D0HA 3MCLL 4OF7A 2GAZB 4TULL 2X70A 1UB6A 4M7JL 1MHCB 5HSFA 2X44D 1GRWA 4JQIH 5GGSY 1TPXC 3CMOL 1INEH 2X2YA 2WW8A 1KJ3L 4L5FH 3O4LB 4KKAC 1AHWA 5KSBA 4OCXH 4WHYG 4ZFGH 3GSQB 5HVGB 1JYXA 2Q76B 1RIHH 3L5WB 4R4NC 4Z8FL 3IDYC 4F7EA 3LIZL 2AERT 1N26A 4LRNH 1WUNT 5ALCL 2C3HA 1I7TA 4NZJA 1R5IA 3ARBA 3WUZA 3MLVH 4OCNC 1X5ZA 1C08A 4ZDHB 2HRPH 4MNGB 5AG8A 3B5GA 2X1OA 4OBSA 1OHQA 2Q8AL 2VZUA 1T0PB 4OT1H 1DBBH 1CE1L 4JJ5B 3LY6A 4TRPH 2EKSA 1BOGB 3HUJB 2GHWB 1X6NA 1ZHKB 1FSKB 2FSEB 4Z7VB 3QPXH 2QSTA 4Z7OE 1Y6NR 1NCBL 3VXOA 3MBEC 4JDZB 5JNYA 4GRLC 4HUVB 1ITBB 1T21B 2Q86A 4Y4FC 4XMLH 1PYWA 3T2PA 1VGKA 2X4QA 3BZDA 5A2IH 4QXGH 3KPNB 1PKQB 4KMQA 2F53E 4X0KB 3RWFB 3D2UD 1QR4A 3RVWC 5TE6L 3SKNB 4GUPB 3SY0A 3R4DA 2CIKB 3GBMH 5DJCA 4NBZB 5C07B 1T1XA 1OPGL 4FHBD 1CLYL 4RA3A 4JJ5A 3OQ3B 1MRCH 3S35L 1CICA 1OCWH 3I75A 3VFPB 1PG7L 4JVWA 3MNZA 4JZJA 3QCTL 4XVTL 3FT4B 3BKMH 1MFCH 4N5UA 3CZFB 1T5XB 3EFFB 3H3KA 4R7NB 3I3DA 3QQ3A 3VXSD 32C2B 2CO7B 2QKIA 4YX2L 1T1YB 3B8SA 3X13B 3QUXD 4WJ5B 1A7QH 4K71B 1BAFH 2W60A 1R3HA 5EBWB 2XACC 1MIML 2P5ED 5T5FL 3GMLA 5IFHH 4ZO8A 1T3FA 3ARGB 1INDL 4ZAKB 2XKUA 1T5WB 3KYNA 3LB6D 3O8XC 1UKTA 5AG9A 3OAZK 5F7EH 2ZCHL 2ADGA 4RAUB 4P5KA 4WUUD 1R3KA 1UB5A 3MRBB 1CU4L 1UH2A 3MFGB 3STBA 4P2RD 1W8NA 4MAYA 5CEZL 5FUOH 4JHBA 2VYRE 3SDAC 1QLRB 1NCWH 3AS1A 4LCWA 3MREB 4YDLC 1CT8A 5GJSL 1NANH 4RIRA 3ZE2E 3F12B 5JLZA 4NDMA 1IC4L 4P3CH 5CJOL 4KHTL 1KBGH 1WQVT 5DMIH 3O0RL 3CSGA 5I1IL 5TDPB 4NBYB 2DL2A 1P7QD 4XB7A 1GAFL 2XN9B 1XR8B 3D18A 4J3VA 5MI0C 5TE4L 3U7WL 1X9QA 2OK0L 3VGDA 1LO0H 1VPOL 1KG0A 4XC1L 4HXAL 1JK8B 3ZDXF 2H45A 1VSCA 3BN9C 4MA3B 4ACPA 3L9RA 1WSST 1CFVL 4F7TB 3B9DA 4TUOA 4EI6A 1C5DB 2ZOKA 5AD0A 5FUZL 2MQ3A 4XWGH 5DD1H 1V7ML 5ALBL 2W1NA 5DMGC 3PP4L 1XGTB 1UH4A 5AWNH 3FOMA 5D5MF 1BD2E 3VXPA 4F15B 3QUKB 2BSSA 1KT2A 2DLFL 3R0MA 4NN7C 3SDCB 4I4WB 1KCVL 3IXAB 4IOIB 1U8NA 1AHWB 5KSBB 2NZIA 2HLAB 3B8YA 3I02B 1UACH 4Q97A 4OD3L 2DIAA 5C0AB 1ZLWH 1FJ1A 5DVOA 4BQCA 3HAEG 1C12B 1KCLA 5F89A 3MZGB 1A6AB 1SJEA 1MPAH 3LZFH 4AENB 2A38A 3ZE0E 2P4AB 4Y4HC 3L7FA 3IJSB 1JGLH 4FG6D 4NJAL 3T65A 3VW3H 4N0YH 4GJTB 4G3YH 3S6CA 2EH8L 1CLCA 2NY6B 3HE6B 3UJJH 3HG1E 1VFAA 3WL9A 1KIRA 4LPCA 5JIHA 3VXMD 4AH2B 2Q6WA 1JHLH 4O58H 2C3GA 2VZ1A 4QRPE 5DD6A 4TSBL 1G7MA 3BQUB 3A67L 3TH4T 5DUPH 2NW2B 4C57C 4MAUH 4NCDA 3X17A 3PWJB 2HRLA 4NOBA 3GO1L 2VL4A 4NC1C 3DX8B 5GGTH 2X4NB 1KCUL 4N9OB 4YZFF 4XBPB 2Y23A 2ZCLH 4JFFA 3TYGL 3NH7L 4NQSA 5I1HL 3UPRB 3EO0A 1XF2B 1JGEB 4YXLL 4HWZB 3IXTA 4U1KA 1BVZA 4TPRH 3FO0L 3HFMH 3Q6FA 2BXYA 1EFQA 1HINH 4WHYH 1A8JH 1GVIA 3IAQA 4UNUA 1D5IH 4MXVF 5D7LB 2FD6H 2WWMC 3ES6B 2FH8A 2NY3C 3KLAA 2VR4A 4RAVA 4UI2A 3BO8A 2VH5L 4C58B 5E8OA 4GT7A 5E6ZA 4LSPH 5D8JH 3U0TA 1A6VL 1WCBA 3HC0B 5D1QB 4QHMA 4G9FE 3MGTB 3MV9B 2VQTA 3MV9D 4QGYA 5JIIA 3LN5B 5CCKL 2HKHH 5HI4C 4AQOA 2YOCA 3CMGA 4YBQC 4F8TA 1YECL 1J1XH 3UTTE 3G6AB 3BZEA 2E7LC 4OB5H 3IETA 1OGAA 4WUUB 4WTWA 5E94A 5D2LF 3WLBB 2J3SA 5D1ZC 5IJKA 3VRJA 3HUJE 3B2VH 4D2NA 1F00I 3FQXA 1XGYH 2K3TA 2V2WB 3NGBC 2ICEA 4XTRD 4E0RB 3LKQA 5H35B 1IQWH 4P4KC 3ZTJH 4JM2D 3HRZB 4MD4B 1F4XL 3V0WH 3L3DB 4JANA 3FONA 1OWRM 3CFDA 5JHDA 4D0BB 3SJVE 1RMFH 2RQ8A 2ITCB 1L0XA 1DDHB 3JBG7 2XKSA 3OHXB 3L7EA 5HHOA 3OKYA 1J1OL 4JPKL 2D7MA