3Q6OA

Oxidoreductase fragment of human qsox1
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
233
structure length
228
Chain Sequence
ALYSPSDPLTLLQADTVRGAVLGSRSAWAVEFFASWCGHCIAFAPTWALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFAFTNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPALEEIDGFFARNNEEYLALIFEGGSYLAREVALDLSQHKGVAVRRVLNTEANVVRKFGVTDFPSCYLLFRNGSVSRVPVLMESRSFYTAYLQRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfhydryl oxidase 1
publication title The dynamic disulphide relay of quiescin sulphydryl oxidase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 65
structure length 228
sequence length 233
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2011-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
A PF18108 QSOX_Trx1 QSOX Trx-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3q6oA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3q6oA02
2YP6A 1GL8A 3F6DA 2CVBA 3GTUB 2DIYA 2CAQA 4K6XA 1LU4A 4LL4B 1QMVA 1K3OA 1N8JA 2VCQA 2MBSA 17GSA 2VD1A 4J2FA 4WKWA 3GHAA 1U6TA 2PMTA 1K0MA 1J0FA 4Z7XA 2EC4A 3F3RA 1JZOA 3NZNA 1YKCA 3C8EA 3GX8A 3CBUA 1V40A 3J7Yk 4ZL8A 3M9KA 1GTAA 4MJEA 1SYRA 3PR8A 2C0FA 1OC9A 1VF3A 2AYTA 3LJRA 4ID0A 3KEBA 1EGOA 3F4SA 4X43A 3VFIA 2NBSA 1SD9A 1XWCA 2M80A 5ECMB 1M99A 4K0GA 1Q4JA 5A5KA 1WMJA 3IK9A 1TRSA 1B4QA 2JU5A 1GSEA 4KW6A 3KJYA 2DSAA 18GSA 4L5LA 1E6BA 2LSTA 4EL1A 3HKRA 3UBLA 2L4QA 3M3MA 1SJIA 3QFBC 5CAXA 2H1DA 3VURA 2DJKA 4FYCA 1TKDB 4MH3A 2MYGA 1JHBA 1OKTA 1XXUA 4EE0A 4J56E 4Q5RA 3ZITA 1WP0A 3QD9A 1TP9A 1GSFA 3D22A 3ZREA 2FWHA 2E7PA 3MNGA 3HY2A 1FOVA 1MDIA 3ZL5A 3TJGA 4G2EA 4MPGA 2I81A 2H71A 2R5GA 3QDNA 2DIZA 5GAPD 2H75A 1S3AA 3VWXA 3CSHA 2GQKA 4OCEA 1AXDA 1E2YA 1GSYA 1SJ6A 1YZXA 2HRNA 3KD0A 2GLRA 1ZOFA 1BG5A 4QL7A 2WS2A 3EC3A 19GSA 1U3IA 2C3NA 2IMKA 2HLSA 3EU3A 2B5YA 1T00A 3TCOA 5EY6A 5F8BA 4IN0A 5CRGA 2XHFA 1X5DA 2B1KA 3P90A 2F8AA 4ECBA 2J9HA 2GT5A 3WT1A 1ZL9A 3HDCA 2H73A 1XOBA 2X8CA 1MDKA 4ZB6A 2AJQB 5IM9A 2K18A 2L59A 4IELA 3GMFA 3FZ5A 2H72A 3F3QA 2HSYA 4NV5A 3UVTA 1OE8A 3ZMKA 4L0UA 4OO5A 3U6VA 5GSSA 2R4VA 1UN2A 4NXIA 3QMXA 5J9CA 1T7PB 3UBKA 1VF4A 2DJ2A 1XPVA 4POMA 4XRAA 4F82A 3LSZA 5HQPA 2RUEA 4IJ3A 1HD2A 4HU7A 4YH2A 4HEA2 2PU9C 2L5OA 5A4UA 1J08A 5EL8A 1PSQA 5D9WA 2H19A 2C8UA 3FZAA 2H76A 1A2MA 1O8XA 2RIIA 4ECIA 2FLSA 1SKSB 2HYXA 3ZYWA 3UAPA 4EVMA 2FCHA 1EV9A 3H1NA 4P3YB 4ILFA 1AQWA 5ECKB 2IFQA 4N30A 2R37A 3UOMA 2F51A 2ON5A 4X1UA 2CVDA 5G1LA 4ULXA 4MK3A 2HT9A 5ABRA 2R6KA 2IMDA 2JZTA 1M2DA 1EEMA 2F8FA 1AAZA 5J4UA 3C73A 2IWTA 1G7EA 1EOGA 2HZFA 4ZB8A 1G6WA 2H1BA 4POKA 5DALB 4Q5QA 1GTIA 4BVYA 3RHCA 2YCDA 3IAM2 4CDOA 2H0HA 5DQYA 3ERGA 3KIJA 2YPMA 1A8LA 2H01A 2LNTA 3HXSA 3MSZA 2J23A 2RUFA 1SJZA 14GSA 3PINA 3A3TA 3R2QA 4F0BA 5DJLA 2FA4A 2RM5A 3A2XA 5DQSA 3GKMA 2MMAA 1A2LA 4ZL9A 3LGCA 2O85A 1S3CA 1GSSA 4MZWA 1WPIA 2YJHA 4HDEA 2RM6A 2V32A 5INYA 3ISOA 4E8EA 3I9V2 5E4WA 4XS1A 4XS4A 4Q5FA 4EDYA 4PX1A 4NMUA 2DJJA 1AC1A 2VOCA 3D0ZA 2G2QA 1N2AA 1K0DA 1YJ6A 4O92A 3EWLA 4HQSA 2YV9A 1UVZA 1I5GA 3FYGA 5DVBA 4KDUA 3BCIA 3RAZA 4I6XA 3UMAA 1TRUA 3DWVA 1SYXA 3LYKA 3IDVA 3LEFA 5CO3A 3KZQA 1XWGA 2QGVA 4D73A 3C1SA 4G9HA 3RPNA 4GQCA 1X5EA 22GSA 4N10A 2FWEA 2PWJA 1QUWA 3W8JA 1BQ7A 1JZWA 4WBRD 13GSA 5H5RA 3BOAA 1ZCPA 4YAVA 4KSMA 2HSHA 1DSBA 2GDRA 3LYPA 3Q18A 2YJ7A 4FH8A 2NDOA 3HD5A 2KOKA 5CNWA 4ZIJA 3W6GA 2P5RA 5KN0A 5HFIA 3EINA 2BJXA 1ST9A 2YWNA 5DJMA 5COHA 1SKRB 4WR4A 1EGRA 5IOXA 2PVQA 1F9MA 4I97A 2FWFA 4DSRA 4HQZA 1K0BA 1TRWA 1QFNA 5JWQB 1V9WA 4IP1A 1GUKA 2O7KA 1KTEA 4K9ZA 2MMZA 1YEPA 1B8XA 3GFKA 2H0GA 5D93A 3G7YA 4I5QA 1GUHA 2XBIA 3FEUA 5DBQA 3ME7A 5DAKA 6GSXA 2OE1A 5IO2A 3ZIVA 1EWXA 2V2GA 4F0CA 1O81A 1X9SB 1TK5B 2IJYA 6GSTA 1RK4A 1EP7A 5LD0A 1TOFA 4FYUA 2E2GA 4RUVA 3ED3A 6GSWA 2OE0A 1O6JA 2AUVA 2ZUPA 4TR1B 2HI7A 1QQ2A 2REMA 4MMMA 1VF1A 4PUFC 1YF0A 1CQHA 3SWLA 2YN1A 2IMIA 4K0NA 3KM6A 2C1YA 2EIRA 20GSA 2LUSA 5ECSA 2VD0A 2O8VB 1GTUA 3D5JA 4AJ8A 1EP8A 4JR4A 2XBQA 1Z3EA 2HXKA 1O7UA 1BJXA 2TRCP 3TOTA 2DJ1A 2MZCA 2JL4A 5J9BA 4KB3A 4TXOB 1XBSA 3M0FA 2OADA 1TXXA 2WB9A 5D9VA 4RI7A 3IR4A 1USBA 2LRTA 1PMTA 4N0VA 4IBPA 2LNSA 1OC9B 2CX3A 2CAIA 5IMVA 4QL9A 4KDYA 1H4OA 3NOFA 3TJKA 5IOWA 1PRXA 3UVHA 1GH2A 5CRHA 3CSJA 4G10A 3GN3A 3BBYA 3TKPA 4V2LA 5EPFA 2YV7A 2H0IA 3TUEA 3ZVJA 4IKHA 3ZFLA 2GZZA 5KN2A 3RBTA 4ZILA 3NIVA 4I8BA 2RLIA 3M9JA 4F9ZA 2JSZA 4BWSA 2WULA 2B7JA 2O89A 3GRXA 3VPTA 4K7IA 3IHQA 2B1LA 1OKDA 1PN9A 2VCTA 4OFNA 3L4NA 1M0UA 4MF5A 4YQMA 3VPQA 4H86A 3M1GA 3IA1A 3KH7A 3UEMA 3H8QA 1Y25A 3RPPA 5A4WA 3KP8A 3LQ7A 1VGLA 2GT6A 1MTCA 2CVKA 4K2DA 2B5XA 3FRCA 5JCUA 4X0XA 2V6OA 5IMFA 1FHEA 5DCGA 2YNXA 4DSQA 4MF7A 4FYBA 4ZBBA 4LLRA 3U5RE 3KTBA 5ECHB 1BAYA 1FVKA 5IPGA 1K0CA 1ON4A 3APQA 4PNFA 3VI7A 3P8WA 4E8HA 3E3EA 5GSTA 1X9WB 2GS3A 3TRXA 5L71A 2IN3A 3PH9A 2NPBA 2YOIA 5ECOB 1GTBA 1K0OA 4JR6A 5H5QA 4GWRA 2QC7A 2C4JA 1MEKA 1GLQA 4PQHA 4HI7A 1V58A 3KCMA 3FR6A 4WF4A 3AY8A 1TRVA 2IPAA 3IE3A 3LXTA 1M7TA 11GSA 2MMOA 4KH7A 4XIHA 2VCWA 3MAKA 2B5EA 2WCIA 3EYTA 2LQQA 1VF2A 4TXVA 2CQ9A 4HJ2A 2YZUA 3TOUA 3W8SA 2HZEA 1TJDA 1HYUA 4GTUA 4YQVA 4BPYA 5B8BA 1SU9A 2HNLA 6GSSA 3US3A 1Z7PA 2L6CA 3I6AA 3G7JA 4PQ1A 3MWHA 2I3YA 1GULA 3IBHA 3WGDA 4OD7A 2IFQB 1ERUA 2DJ0A 1TU7A 4TKYA 3VWUA 3I43A 3HCZA 1X5CA 3VK9A 2FY6A 3F4TA 3K8NA 3IXRA 1XOAA 1ZYQB 1PL2A 3IAS2 3S9FA 3ZVJD 3OR5A 1QGVA 1XW9A 2CA8A 5J5NA 2AHEA 4GXZA 4MZCA 1AUCA 3C71A 1BX9A 2IMFA 2A2RA 2WFCA 2LV3A 2VCVA 2IIYA 2WRTA 3F63A 3WYWA 1KBNA 2PN8A 1KEBA 3TKQA 3P7XA 1OC8A 3TB2A 4HJMA 1Q98A 2QKEA 4POLA 5JCGA 2ZCTA 2GZPA 2IL3A 4AF2A 5FWGA 4HZ4A 1U87A 4OMVA 3ZTLA 5B6MA 1XWKA 4EXJA 1ABAA 2CT6A 4IW9A 3IK7A 1ERTA 2H6XA 3DGQA 1F3BA 2M46A 1M9AA 1PL1A 2KP1A 4JRRA 3RHBA 2C0EA 2VL9A 2DMLA 3QPMA 2K8VA 4ML6A 3KP9A 2FNOA 5IMZA 1SK0A 1SENA 2LJRA 3BJ5A 3EVIA 1RQMA 2X8GA 1BYEA 2R3XA 3HHVA 1Z7RA 2X99A 2K9FA 3QCPA 3KH9A 4MH2A 4GF0A 3CYNA 1NHYA 1NSWA 5CYYA 1JZDA 7GSSA 1XVWA 4ACSA 4KUNA 2OACA 1PKZA 9GSSA 2FD3A 2I9HA 3TJJA 4JZQA 5ECRB 4ECCA 3D21A 1B48A 2H30A 2KLXA 4K7NA 1HNCA 6GSYA 5GZZB 2H1AA 2VM2A 5ID2B 5LNKe 2D2ZA 2VUPA 4PNGA 5AISA 3GX0A 1X0RA 1YKAA 1SK1A 3GIXA 4D73B 4I2UA 4HZ2A 1R26A 2HRFA 5D96A 3CTGA 1NW2A 2FA8A 5HR3A 2H1GA 4AJ6A 2H66A 3GYKA 4BA7A 1S3DA 1XCCA 2FWGA 3QAVA 4GCIA 1Z9HA 5D9TA 3L9UA 1ZGNA 2V41A 3ZFBA 1Z6NA 4GSSA 4LA1A 4PXOA 4EUYA 3O6TA 1FB0A 4IS0A 1XW5A 2XC2A 4FO5A 1OAZA 3L9VA 4OFTA 4MDCA 5HFGA 1SL0B 4WEYA 2JZRA 3GV1A 2CZ2A 1GLPA 1SD8A 2JSYA 1PGTA 2BTOT 4I2TA 4HS1A 1MD3A 1PD21 1JLVA 2ON7A 1T1VA 1XZOA 5CRWA 4AJ7A 3KMNA 3ZZXA 5H5SA 3C1RA 2MMNA 2GTUA 4WBJA 2VCXA 1ML6A 4LL1B 3HVSA 5HR2A 2C0DA 4ZBAA 4NHWA 5G31A 1F37A 4MABA 2EIOA 4TR0A 3M8NA 5C04A 2B6MA 5G30A 3BCKA 1TI3A 3BD2A 1T3BA 3FKFA 3HYPA 4ZB9A 2V1MA 3PGTA 5ECPB 2DC5A 3HVXA 3TJFA 1VRSD 2KUCA 3A5WA 1R4WA 3EMPA 3UIWA 2VM1A 1FG4A 2K8SA 4XS6A 1O73A 2DBCA 3VWWA 4L8EA 4XRDA 1TW9A 2N5BA 2PUKC 5FHIA 1A0RP 5KN1A 2KP2A 2BMXA 5ENUA 2G0FA 1U3AA 4YQUA 4MZBA 1MD4A 2V6KA 3FW2A 2WJUA 1WRYA 1X9MB 4V1Ag 1CQGA 3TKSC 4XTSA 1GWCA 4BWQA 2OKAA 1ZZYA 2Z9SA 2HFDA 4J57E 1QXHA 4ZBDA 5F0GA 3GUSA 2LRNA 2N5FA 4CW9A 1A23A 8GSSA 4KAEA 1O85A 1PX7A 4RQXA 4JEDA 3DMLA 5KEJA 3GL5A 2OE3A 2PPTA 4WETA 2YWIA 4K7OA 2L5LA 4KCEA 4ECJA 3TRQA 4PURA 2PERA 1GUMA 3EE2A 3H4KA 2CZ3A 3Q19A 1OE7A 4HUAA 4IGJA 3EMXA 4TR4A 1YY7A 4KE3A 1T8EB 4N0ZA 6GSUA 1UC7A 2OBKA 1B4PA 3ERFA 4L0WA 5G2ZA 4POBA 1AQVA 1RW1A 5ECLB 4DSSA 1ZMAA 3F8UA 1V57A 2TRXA 2C3QA 2YWOA 3H93A 2DMMA 3SBCA 1T4ZA 3CXGA 3E0UA 4XCSA 3APOA 4LMVA 3IOSA 2A4VA 3D6IA 3KXOA 3QAWA 2K6VA 3FZ9A 3UJ1A 4TXOA 5IMAA 3Q74A 3IV4A 4TW5A 1XVQA 5CP1A 1M2BA 1A0FA 5JCWA 5HFKA 3DYRA 4GLTA 4WR5A 4RI6A 2GSQA 1G7OA 1R7HA 3GKNA 2YZHA 1R5PA 3KMOA 1MDJA 2B7KA 3GTUA 4G19A 3HJOA 1SKWB 1K3LA 2PBJA 5CRDA 4IQ1A 3DVXA 2MBTA 5E59A 3LWAA 3FZ4A 1DBYA 3D4MA 3VLNA 2H74A 2FHEA 3GA4A 4MJCA 1FO5A 2LKUA 3F0IA 2LQOA 4KGIA 5ELGA 4GQFA 1K3YA 1THOA 4EO3A 4V1Ap 2NVLA 1URMA 2L4CA 3LFLA 1GNEA 3P2AA 4ZXGA 2LJAA 1WE0A 2M72A 2XPEA 3VWVA 3EURA 4MF6A 4EKZA 4WXTA 3GKKA 16GSA 1HQOA 4NV2A 1V2AA 1GNWA 4RQRA 4TOPA 3GSTA 5AGYA 2AB6A 5ELAA 4IQAA 3DRNA 5JWRB 1DE2A 5D73A 5B7CA 3LORA 1G6YA 2P5QA 3MDKA 3JCML 4GSTA 5F05A 3I69A 3KTLA 2EIQA 3O3TA 4IJIA 3KGKA 12GSA 3IPZA 3TJBA 1V98A 3GSSA 3A2WA 2HZEB 1GP1A 1TTZA 1QK8A 2AAWA 1TK8B 5IQYA 2GQMA 2B3SA 2VCZA 1IYHA 5G5EA 5HR1A 1DUGA 5D9XA 1IYIA 3TRPA 1K0NA 4QQ7A 3QR6A 2YWMA 4KSOA 1NHOA 3DEXA 2OA7A 4OO4A 1ILOA 1EV4A 4KNDA 3GURA 4PGTA 3HA9A 3TKSA 1SL1B 5AN1A 10GSA 4KCAA 3IRAA 4JE1A 5G1KA 2LRCA 3WGEA 4MLYA 5DCHA 4KX4A 3N5OA 4MP4A 1YDKA 1H75A 3J7Yb 1YF1A 4F2IA 1TU8A 2VAFA 3A2VA 3ZRDA 1W89A 4O5RA 4O7HA 4EDZA 1SK2A 2AV4A 4OCFA 4NHZA 1F2EA 1R5AA 4YAPA 4MJAA 1AW9A 2E2MA 5LCZA 4JBBA 3TKRA 5CREA 1OC3A 2VL2C 1ERWA 3UL3A 3UARA 2VIMA 3HJMA 1W4VA 1ERVA 1T4YA 2L6DA 2I1UA 4N11A 3TDGA 4F03A 4MPFA 4TRXA 4Q5NA 4GSNA 1THXA 3G9BA 4DVCA 2O87A 2JACA 2LS5A 3DIEA 1FVJA 5F07A 2FUG2 5IMDA 3QAGA 4OFMA 5F06A 5IIZA 2VO4A 1JZRA 1TK0B 4BVXA 4DEJA 4XHMA 3CSIA 4CHSA 1GSDA 2FGXA 1HNBA 3G7IA 1XWAA 1EEJA 3D4TA 4HOJA 4BL7A 3FY7A 2LTKA 2H8LA 3HZ4A 2PGTA 1AIUA 3TKSE 1O8WA 2GGTA 3APSA 5AIXA 4XS4B 2JADA 3DKSA 2WZ9A 1EZKA 5IPHA 3HJPA 3QFAC 3GKXA 5DALA 1UA5A 3FR9A 5C00A 1PX6A 3C7MA 4NWYA 5FT3A 2OJLA 1JLWA 2ALBA 1NM3A 2H6YA 5ECNB 1C72A 4TR3A 1SL2B 3O76A 1WJKA 3ERWA 1BEDA 4PUAA 1ACVA 3HZ8A 1LBKA 2QSIA 3H79A 3V1WA 3QOUA 2E0QA 1TI1A 4PQIA 4K1FA 1XW6A 1LJRA 2LEGA 5B8AA 1PQNA 3FHKA 3DVWA 4HU9A 2IMEA 1TDIA 1Z5YE 5IMCA 1WOUA 2VLUA 4TN8A 1GRXA 5ID2A 2DLXA 1WWJA 5J3RA 2ZNMA 3WT2A 3LXZA 2R2JA 1GSUA 2X8HA 4L5OA 2GSRA 3CTFA 2GQLA 1F6MC 2KHPA 1FAAA 5DDLA 2GSSA 3E9JB 1XIYA 2GVPA 3GNJA 3CRTA 3GH9A 4V2NA 3L78A 3F4RA 5DAKB 2DJ3A 4EC0A 1B9XC 1GSQA 1M2AA 4ZL7A 5AIVA 3VI5A 5EVOA 3DD3A 2NTOA 4JU5A 5ECIB 2C3TA 3DXBA 4WF5A 2P31A 5IO0A 1WIKA 4NPBA 4O32A 5J41A 1YEXA 3FR3A 4KDXA 4K8MA 2TIRA 5ECQB 2H70A 4GRFA 1J9BA 2GZYA 1A2JA 4IHUA 3Q6OA 3ZMLA 1OYJA 2C0GA 4MCUA 1FB6A 2P0GA 4AGSA 1XFLA 4ISDA 3F6FA 5A4VA 1I9DA 3N9JA 3L0HA 1G0TA 3WGXA 2I4AA 3RDWA 2X64A 2LJKA 2WDUA 4ML1A 3IC4A 3L9SA 1A24A 4TVEA 5HR0A 2GSTA 2VLTA 2VL2A 2YANA 4IP6A 5JWOB 1U88A 2F3MA 2JZSA 3GH6A 1Y6EA 3ZLPA 4MJBA 3EU4A 2WGRA 5KN3A 1DE1A 1FW1A 3F9UA 1KNGA 1M9BA 1ZYEA 2H6ZA 5G5FA 2VL3A 3LG6A 1F3AA 2L57A 2F9SA 1YQ1A 1HNAA 1K0AA 4IVFA 4LMWA 3TGZA 6GSVA 1PKWA 4FIWA 2C80A 4DSSB 2OBIA 1AQXA 4NAXA 1Z6MA 2XPDA 4MA9A 1EOHA 4V2MA 3ZIJA 1A8YA 1OVNA 3WD6A 2A2SA 3CMIA 5B6NA 2VLVA 4TR1A 5GAND 2CX4A 2PVOC 1JFUA 2ES7A 3ME8A 5D8IA 3HVVA 3FK8A 3GL3A 4EF0A 1B9YC 4OWYA 2HE3A 2CV4A 3CRUA 2N5AA 1PA3A 4KA0A 1XWBA
chains in the Genus database with same CATH superfamily
2YP6A 1GL8A 3F6DA 2CVBA 3GTUB 2DIYA 2CAQA 4K6XA 1LU4A 4LL4B 1QMVA 1K3OA 1N8JA 2VCQA 2MBSA 17GSA 2VD1A 4J2FA 4WKWA 3GHAA 1U6TA 2PMTA 1K0MA 1J0FA 4Z7XA 2EC4A 3F3RA 1JZOA 3NZNA 1YKCA 3C8EA 3GX8A 3CBUA 1V40A 3J7Yk 4ZL8A 3M9KA 1GTAA 4MJEA 1SYRA 3PR8A 2C0FA 1OC9A 5KOXA 1VF3A 2AYTA 3LJRA 4ID0A 3KEBA 1EGOA 3F4SA 4X43A 3VFIA 2NBSA 1SD9A 1XWCA 2M80A 5ECMB 1M99A 4K0GA 1Q4JA 5A5KA 1WMJA 3IK9A 1TRSA 1B4QA 2JU5A 4EIQA 1GSEA 4KW6A 3KJYA 2DSAA 18GSA 4L5LA 1E6BA 2LSTA 4EL1A 3HKRA 3UBLA 2L4QA 3M3MA 1SJIA 3QFBC 5CAXA 2H1DA 3VURA 2DJKA 4FYCA 1TKDB 4MH3A 2MYGA 1JHBA 1OKTA 1XXUA 4EE0A 4J56E 4Q5RA 3ZITA 1WP0A 3QD9A 1TP9A 1GSFA 3D22A 3ZREA 2FWHA 2E7PA 3MNGA 3HY2A 1FOVA 1MDIA 3ZL5A 3TJGA 4G2EA 4MPGA 2I81A 2H71A 2R5GA 3QDNA 2DIZA 5GAPD 2H75A 1S3AA 3VWXA 3CSHA 2GQKA 4OCEA 1AXDA 1E2YA 1GSYA 1SJ6A 1YZXA 2HRNA 3KD0A 2GLRA 1ZOFA 1BG5A 4QL7A 2WS2A 3EC3A 19GSA 1U3IA 2C3NA 2IMKA 2HLSA 3EU3A 2B5YA 1T00A 3TCOA 5EY6A 2X4AA 5F8BA 4IN0A 5CRGA 2XHFA 1X5DA 2B1KA 3P90A 2F8AA 4ECBA 2J9HA 2GT5A 3WT1A 1ZL9A 3HDCA 2H73A 1XOBA 2X8CA 1MDKA 3R3EA 4ZB6A 2AJQB 5IM9A 2K18A 2L59A 4IELA 3GMFA 3FZ5A 2H72A 3F3QA 2HSYA 4NV5A 3UVTA 1OE8A 3ZMKA 4L0UA 4OO5A 3U6VA 5GSSA 2R4VA 1UN2A 4NXIA 3QMXA 5J9CA 1T7PB 3UBKA 1VF4A 2DJ2A 1XPVA 4POMA 4XRAA 4F82A 3LSZA 5HQPA 2RUEA 4IJ3A 1HD2A 4HU7A 4YH2A 4HEA2 2PU9C 2L5OA 5A4UA 1J08A 5EL8A 1PSQA 5D9WA 2H19A 2C8UA 3FZAA 2H76A 1A2MA 1O8XA 2RIIA 4ECIA 2FLSA 1SKSB 2HYXA 3ZYWA 3UAPA 4BVXB 4EVMA 2FCHA 1EV9A 3H1NA 4P3YB 4ILFA 1AQWA 5ECKB 2IFQA 4N30A 2R37A 3UOMA 2F51A 2ON5A 4BL7B 4X1UA 2CVDA 5G1LA 4ULXA 4MK3A 2HT9A 5ABRA 2R6KA 2IMDA 2JZTA 1M2DA 1EEMA 2F8FA 1AAZA 5J4UA 3C73A 2IWTA 1G7EA 1EOGA 2HZFA 4ZB8A 1G6WA 2H1BA 4POKA 5DALB 4Q5QA 1GTIA 4PTSA 4BIKA 4BVYA 3RHCA 2YCDA 4CY6A 3IAM2 4CDOA 2H0HA 5DQYA 3ERGA 3KIJA 2YPMA 1A8LA 2H01A 2LNTA 3HXSA 3MSZA 2J23A 2RUFA 1SJZA 14GSA 3PINA 3A3TA 3R2QA 4F0BA 5DJLA 2FA4A 2RM5A 3A2XA 5DQSA 3GKMA 2MMAA 1A2LA 4ZL9A 3LGCA 2HRAA 2O85A 1S3CA 1GSSA 4MZWA 1WPIA 2YJHA 4HDEA 2RM6A 2X49A 2V32A 5INYA 3ISOA 4E8EA 3I9V2 5E4WA 4XS1A 4XS4A 4Q5FA 4EDYA 5BRTA 4PX1A 4NMUA 2DJJA 1AC1A 2VOCA 3D0ZA 2G2QA 1N2AA 3EPTA 1K0DA 1YJ6A 4O92A 3EWLA 4HQSA 2YV9A 1UVZA 1I5GA 3FYGA 5DVBA 4KDUA 3BCIA 3RAZA 4I6XA 3UMAA 1TRUA 3DWVA 1SYXA 3LYKA 3IDVA 3LEFA 5CO3A 3KZQA 1XWGA 2QGVA 4CY8A 4D73A 3C1SA 4G9HA 3RPNA 4GQCA 1X5EA 22GSA 4N10A 2FWEA 2PWJA 1QUWA 3W8JA 1BQ7A 1JZWA 4WBRD 13GSA 5H5RA 3BOAA 1ZCPA 4YAVA 4KSMA 2HSHA 1DSBA 2GDRA 3LYPA 3Q18A 2YJ7A 4FH8A 2NDOA 3HD5A 2KOKA 5CNWA 4ZIJA 3W6GA 2P5RA 5KN0A 5HFIA 3EINA 2BJXA 1ST9A 2YWNA 5DJMA 5COHA 1SKRB 4WR4A 1EGRA 5IOXA 2PVQA 1F9MA 4I97A 2FWFA 4DSRA 4HQZA 1K0BA 1TRWA 1QFNA 3IC8A 4O5QA 5JWQB 1PN0A 1V9WA 4IP1A 1GUKA 2O7KA 1KTEA 4K9ZA 2MMZA 1YEPA 1B8XA 3GFKA 2R0CA 2H0GA 5D93A 3G7YA 4I5QA 1GUHA 2XBIA 3FEUA 5DBQA 3ME7A 5DAKA 6GSXA 2OE1A 5IO2A 3ZIVA 1EWXA 2V2GA 4F0CA 3CQFA 4X4JA 1O81A 1X9SB 1TK5B 2IJYA 6GSTA 1RK4A 1EP7A 5LD0A 1TOFA 4FYUA 2A4HA 2E2GA 4RUVA 3ED3A 6GSWA 2OE0A 1O6JA 2AUVA 2ZUPA 4TR1B 2HI7A 1QQ2A 2REMA 4MMMA 1VF1A 4PUFC 1YF0A 1CQHA 3SWLA 2YN1A 2IMIA 4K0NA 3KM6A 2C1YA 2EIRA 20GSA 2LUSA 5ECSA 1M3JA 2VD0A 2O8VB 1GTUA 3D5JA 4AJ8A 1EP8A 4JR4A 2XBQA 1Z3EA 2HXKA 1O7UA 1BJXA 2TRCP 3TOTA 2DJ1A 2MZCA 2JL4A 5J9BA 4KB3A 4TXOB 1XBSA 3M0FA 2OADA 1TXXA 2WB9A 5D9VA 4RI7A 3IR4A 1USBA 2LRTA 1PMTA 4N0VA 4IBPA 2LNSA 1OC9B 2CX3A 2CAIA 5IMVA 4QL9A 4KDYA 1H4OA 3NOFA 3TJKA 5IOWA 1PRXA 3UVHA 1GH2A 5CRHA 3CSJA 4G10A 3GN3A 3BBYA 3TKPA 4V2LA 4YKFA 5EPFA 2YV7A 2H0IA 3TUEA 3ZVJA 4IKHA 3ZFLA 2GZZA 2DKHA 5KN2A 3RBTA 4ZILA 3NIVA 4I8BA 2RLIA 3M9JA 4F9ZA 2JSZA 4BWSA 2WULA 2B7JA 2O89A 3GRXA 3VPTA 4K7IA 4G0LA 3IHQA 2B1LA 1OKDA 1PN9A 2VCTA 4OFNA 3L4NA 1M0UA 4MF5A 4YQMA 3VPQA 4H86A 3M1GA 3IA1A 3KH7A 3UEMA 3H8QA 1Y25A 3RPPA 5A4WA 5KOWA 3KP8A 3LQ7A 1VGLA 2GT6A 1MTCA 2CVKA 4K2DA 2B5XA 3FRCA 5JCUA 4X0XA 2V6OA 5IMFA 1FHEA 1ZYPA 5DCGA 2YNXA 4DSQA 4MF7A 4FYBA 4ZBBA 4KF9A 4LLRA 3U5RE 3KTBA 5ECHB 1BAYA 1FVKA 5IPGA 1K0CA 1ON4A 3APQA 4PNFA 3VI7A 3P8WA 4E8HA 3E3EA 5GSTA 1X9WB 2GS3A 3TRXA 5L71A 3A5IA 2IN3A 3PH9A 2NPBA 2YOIA 5ECOB 1GTBA 1K0OA 4JR6A 5H5QA 4GWRA 2QC7A 2C4JA 1MEKA 1GLQA 4PQHA 4HI7A 1V58A 3KCMA 3FR6A 4WF4A 3AY8A 1TRVA 2IPAA 3IE3A 3LXTA 1M7TA 11GSA 2MMOA 4KH7A 4XIHA 2VCWA 3MAKA 2B5EA 2WCIA 3EYTA 2LQQA 1VF2A 4TXVA 2CQ9A 4HJ2A 2YZUA 3TOUA 3W8SA 2HZEA 1TJDA 1HYUA 4GTUA 4YQVA 4BPYA 5B8BA 1SU9A 2HNLA 6GSSA 4K5SA 3US3A 1Z7PA 2L6CA 3I6AA 3G7JA 4PQ1A 3MWHA 2I3YA 1GULA 3IBHA 3WGDA 4OD7A 2IFQB 1ERUA 2DJ0A 1TU7A 4TKYA 3VWUA 3I43A 3HCZA 1ZYNA 1X5CA 3VK9A 2FY6A 3F4TA 3K8NA 3IXRA 1XOAA 1ZYQB 1PL2A 3IAS2 3S9FA 3ZVJD 3OR5A 1QGVA 1XW9A 2CA8A 5J5NA 2AHEA 4GXZA 4MZCA 1AUCA 3C71A 1BX9A 3IHGA 2IMFA 2A2RA 2WFCA 2LV3A 2VCVA 2IIYA 2WRTA 3F63A 3WYWA 4BVYB 1KBNA 2PN8A 1KEBA 3TKQA 3P7XA 1OC8A 3TB2A 4HJMA 1Q98A 2QKEA 4EIPA 4POLA 5JCGA 4K5RA 2ZCTA 2GZPA 2IL3A 4AF2A 5FWGA 4HZ4A 1U87A 4OMVA 3ZTLA 5B6MA 1XWKA 4EXJA 1ABAA 2CT6A 4IW9A 3IK7A 1ERTA 2H6XA 3DGQA 1F3BA 2M46A 1M9AA 1PL1A 2KP1A 4JRRA 3RHBA 2C0EA 2VL9A 2DMLA 3QPMA 2K8VA 4ML6A 3KP9A 2FNOA 5IMZA 1SK0A 1SENA 2DKIA 2LJRA 3BJ5A 3EVIA 1RQMA 2X8GA 1BYEA 2R3XA 3HHVA 1Z7RA 2X99A 2K9FA 3QCPA 3KH9A 4MH2A 4GF0A 3CYNA 1NHYA 1NSWA 1M3IA 5CYYA 1JZDA 7GSSA 1XVWA 4ACSA 4KUNA 2OACA 1PKZA 9GSSA 2FD3A 2I9HA 3TJJA 4JZQA 5ECRB 4ECCA 3D21A 1B48A 2H30A 2KLXA 4K7NA 1HNCA 6GSYA 5GZZB 2UZ8A 2H1AA 2VM2A 5ID2B 5LNKe 2D2ZA 2VUPA 4PNGA 5AISA 3GX0A 1X0RA 1YKAA 1SK1A 3GIXA 4D73B 4I2UA 4HZ2A 1R26A 2HRFA 5D96A 3CTGA 1NW2A 2FA8A 5HR3A 2H1GA 4AJ6A 2H66A 3GYKA 4BA7A 1S3DA 1XCCA 2FWGA 3QAVA 4GCIA 1Z9HA 5D9TA 3L9UA 1ZGNA 2V41A 3ZFBA 1Z6NA 4GSSA 4LA1A 4PXOA 4EUYA 3O6TA 1FB0A 4IS0A 1XW5A 2XC2A 4FO5A 1OAZA 3L9VA 4OFTA 4MDCA 5HFGA 1SL0B 4WEYA 2JZRA 3GV1A 2CZ2A 1GLPA 1SD8A 2QA2A 2JSYA 1PGTA 2BTOT 4I2TA 4HS1A 1MD3A 1PD21 1JLVA 2ON7A 1T1VA 1XZOA 5CRWA 4AJ7A 3KMNA 3ZZXA 5H5SA 3C1RA 2MMNA 2GTUA 3HVNA 4WBJA 2VCXA 1ML6A 4LL1B 4A5PA 4HSCX 3HVSA 5HR2A 2C0DA 4ZBAA 4NHWA 5G31A 1F37A 4MABA 2EIOA 4ICYA 4TR0A 3M8NA 5C04A 2B6MA 5G30A 3BCKA 1TI3A 3BD2A 1T3BA 3FKFA 3HYPA 4ZB9A 2V1MA 3PGTA 5ECPB 2DC5A 3HVXA 3TJFA 1VRSD 4YKGA 2KUCA 3A5WA 1R4WA 3PPUA 3EMPA 3UIWA 2VM1A 1FG4A 2K8SA 4XS6A 1O73A 2DBCA 4G0IA 3VWWA 4L8EA 4XRDA 1TW9A 2N5BA 2PUKC 5FHIA 1A0RP 5KN1A 2KP2A 2BMXA 5ENUA 2G0FA 1U3AA 4YQUA 4MZBA 1MD4A 2V6KA 3FW2A 2WJUA 1WRYA 1X9MB 4V1Ag 4O5UA 1CQGA 3TKSC 4XTSA 1GWCA 4BWQA 2OKAA 1ZZYA 2Z9SA 2HFDA 4J57E 1QXHA 4ZBDA 5F0GA 3GUSA 2LRNA 2N5FA 4CW9A 1A23A 2HSMA 8GSSA 4KAEA 1O85A 1PX7A 4RQXA 4JEDA 3DMLA 5KEJA 3GL5A 2OE3A 2PPTA 4WETA 2YWIA 4K7OA 2L5LA 4KCEA 1S3RA 4ECJA 3TRQA 4PURA 2PERA 1GUMA 3EE2A 3H4KA 2CZ3A 3Q19A 1OE7A 4HUAA 4IGJA 3EMXA 4TR4A 1YY7A 4KE3A 1T8EB 4N0ZA 6GSUA 1UC7A 2OBKA 1B4PA 3ERFA 4L0WA 5G2ZA 4POBA 1AQVA 3MIXA 1RW1A 5ECLB 4DSSA 1ZMAA 3F8UA 1V57A 2TRXA 2C3QA 2YWOA 3H93A 2DMMA 3SBCA 1T4ZA 3CXGA 3E0UA 4XCSA 3APOA 4LMVA 3IOSA 2A4VA 3D6IA 3KXOA 3QAWA 2K6VA 3FZ9A 3UJ1A 4TXOA 5IMAA 3Q74A 3IV4A 4TW5A 1XVQA 5CP1A 1M2BA 1A0FA 5JCWA 5HFKA 3DYRA 4GLTA 4WR5A 4RI6A 2GSQA 1G7OA 1R7HA 3GKNA 2YZHA 5BMUA 1R5PA 3KMOA 1MDJA 2B7KA 3GTUA 4G19A 3HJOA 1SKWB 1K3LA 2PBJA 5CRDA 4IQ1A 3DVXA 2MBTA 5E59A 3LWAA 3FZ4A 1DBYA 3D4MA 3VLNA 2H74A 2FHEA 3GA4A 4MJCA 1FO5A 2LKUA 3F0IA 2LQOA 4KGIA 5ELGA 1FOHA 4GQFA 1K3YA 1THOA 4EO3A 4V1Ap 2NVLA 1URMA 2L4CA 3LFLA 1GNEA 3P2AA 4ZXGA 2LJAA 1WE0A 2M72A 2XPEA 3VWVA 3EURA 4MF6A 4EKZA 4WXTA 3GKKA 16GSA 1HQOA 4NV2A 1V2AA 1GNWA 4RQRA 4TOPA 4Z2TA 3GSTA 5AGYA 2AB6A 5ELAA 4IQAA 3DRNA 5JWRB 1DE2A 5D73A 5B7CA 3LORA 1G6YA 2P5QA 3MDKA 3JCML 4GSTA 5F05A 3I69A 3KTLA 2EIQA 3O3TA 4IJIA 3KGKA 12GSA 3IPZA 3TJBA 1V98A 3GSSA 3A2WA 2HZEB 1GP1A 1TTZA 1QK8A 2AAWA 1TK8B 5IQYA 2GQMA 2B3SA 2VCZA 1IYHA 5G5EA 5HR1A 1DUGA 5D9XA 1IYIA 3TRPA 1K0NA 4QQ7A 3QR6A 2YWMA 4KSOA 1NHOA 3DEXA 2OA7A 4OO4A 1ILOA 1EV4A 4KNDA 3GURA 4PGTA 3HA9A 3TKSA 1SL1B 5AN1A 10GSA 4KCAA 3IRAA 4JE1A 5G1KA 2LRCA 3WGEA 2R0PA 4MLYA 1PFOA 5DCHA 4KX4A 3N5OA 4MP4A 1YDKA 1H75A 3J7Yb 1YF1A 4F2IA 1TU8A 2VAFA 3A2VA 3ZRDA 1W89A 4O5RA 4O7HA 4EDZA 1SK2A 2A2PA 2AV4A 4OCFA 4NHZA 1F2EA 1R5AA 4YAPA 2HRKA 4MJAA 1AW9A 2E2MA 5LCZA 4JBBA 3TKRA 5CREA 3FMWA 1OC3A 2VL2C 1ERWA 3UL3A 3UARA 2VIMA 3HJMA 1W4VA 1ERVA 3LW9A 1T4YA 2L6DA 2I1UA 4N11A 3TDGA 4F03A 4MPFA 4TRXA 4Q5NA 4GSNA 1THXA 3G9BA 4DVCA 2O87A 2JACA 2LS5A 3DIEA 1FVJA 5F07A 2FUG2 5IMDA 3QAGA 4OFMA 5F06A 5IIZA 2VO4A 1XG8A 1JZRA 1TK0B 4BVXA 4DEJA 4XHMA 3CSIA 4CHSA 1GSDA 2FGXA 4MNNA 1HNBA 3MYDA 3G7IA 1XWAA 1EEJA 3D4TA 4HOJA 4BL7A 4FQUA 3FY7A 2LTKA 2H8LA 3HZ4A 2PGTA 1AIUA 3TKSE 1O8WA 2GGTA 3APSA 5AIXA 4XS4B 2JADA 3DKSA 2WZ9A 1EZKA 5IPHA 3HJPA 3QFAC 3GKXA 5DALA 1UA5A 3FR9A 5C00A 1PX6A 3C7MA 4NWYA 5FT3A 2OJLA 1JLWA 2ALBA 1NM3A 2H6YA 5ECNB 1C72A 4TR3A 1SL2B 3O76A 1WJKA 3ERWA 1BEDA 4PUAA 1ACVA 3HZ8A 1LBKA 2QSIA 3H79A 3V1WA 3QOUA 2E0QA 1TI1A 4PQIA 4K1FA 1XW6A 1LJRA 2LEGA 5B8AA 1PQNA 3FHKA 3DVWA 4HU9A 2IMEA 1TDIA 1Z5YE 5IMCA 1WOUA 2VLUA 4TN8A 1GRXA 5ID2A 2DLXA 1WWJA 5J3RA 2ZNMA 3WT2A 3LXZA 2R2JA 1GSUA 2X8HA 4L5OA 2GSRA 3CTFA 2GQLA 1F6MC 4K2XA 4G0KA 2KHPA 4USSA 1FAAA 5DDLA 2GSSA 3E9JB 1XIYA 2GVPA 3GNJA 3CRTA 3GH9A 4V2NA 3L78A 3F4RA 5DAKB 2DJ3A 4EC0A 1B9XC 1GSQA 1M2AA 4ZL7A 5AIVA 3VI5A 5EVOA 3DD3A 2NTOA 4JU5A 5ECIB 2C3TA 3DXBA 4WF5A 4Z2UA 2P31A 5IO0A 1WIKA 4NPBA 4O32A 5J41A 1YEXA 3FR3A 4KDXA 4K8MA 2TIRA 5ECQB 2H70A 4GRFA 1J9BA 2GZYA 1A2JA 4IHUA 3Q6OA 2R0GA 3ZMLA 1OYJA 2C0GA 4MCUA 1FB6A 2P0GA 4AGSA 1XFLA 4ISDA 3F6FA 5A4VA 1I9DA 3N9JA 3L0HA 1G0TA 3WGXA 2I4AA 3RDWA 2X64A 2LJKA 2WDUA 4ML1A 3IC4A 3L9SA 1A24A 4TVEA 5HR0A 2GSTA 2VLTA 2VL2A 2YANA 4IP6A 5JWOB 1U88A 2F3MA 2JZSA 3GH6A 1Y6EA 3ZLPA 4MJBA 3EU4A 2WGRA 5KN3A 1DE1A 1FW1A 3F9UA 1KNGA 1M9BA 1ZYEA 2H6ZA 5G5FA 2VL3A 3LG6A 1F3AA 2L57A 2F9SA 1YQ1A 1HNAA 1K0AA 4IVFA 4LMWA 3TGZA 6GSVA 1PKWA 4FIWA 2C80A 4DSSB 2OBIA 1AQXA 4NAXA 2QA1A 1Z6MA 2XPDA 4MA9A 1EOHA 4V2MA 3ZIJA 1A8YA 1OVNA 3WD6A 2A2SA 3CMIA 5B6NA 2VLVA 4TR1A 5GAND 2CX4A 2PVOC 1JFUA 2ES7A 3ME8A 5D8IA 4Z2RA 3HVVA 3FK8A 3GL3A 4EF0A 1B9YC 4OWYA 2HE3A 2CV4A 3CRUA 2N5AA 1PA3A 4KA0A 1XWBA
chains in the Genus database with same CATH topology
2YP6A 1GL8A 3F6DA 2CVBA 3GTUB 2DIYA 2CAQA 4K6XA 1LU4A 4LL4B 1QMVA 1K3OA 1N8JA 2VCQA 2MBSA 17GSA 2VD1A 4J2FA 4WKWA 3GHAA 1U6TA 2PMTA 1K0MA 1J0FA 4Z7XA 2EC4A 3F3RA 1JZOA 3NZNA 1YKCA 3C8EA 3GX8A 3CBUA 1V40A 3J7Yk 4ZL8A 3M9KA 1GTAA 4MJEA 1SYRA 3PR8A 2C0FA 1OC9A 5KOXA 1VF3A 2AYTA 3LJRA 4ID0A 3KEBA 1EGOA 3F4SA 4X43A 3VFIA 2NBSA 1SD9A 1XWCA 2M80A 5ECMB 1M99A 4K0GA 1Q4JA 5A5KA 1WMJA 3IK9A 1TRSA 1B4QA 2JU5A 4EIQA 1GSEA 4KW6A 3KJYA 2DSAA 18GSA 4L5LA 1E6BA 2LSTA 4EL1A 3HKRA 3UBLA 2L4QA 3M3MA 1SJIA 3QFBC 5CAXA 2H1DA 3VURA 2DJKA 4FYCA 1TKDB 4MH3A 2MYGA 1JHBA 1OKTA 1XXUA 4EE0A 4J56E 4Q5RA 3ZITA 1WP0A 3QD9A 1TP9A 1GSFA 3D22A 3ZREA 2FWHA 2E7PA 3MNGA 3HY2A 1FOVA 1MDIA 3ZL5A 3TJGA 4G2EA 4MPGA 2I81A 2H71A 2R5GA 3QDNA 2DIZA 5GAPD 2H75A 1S3AA 3VWXA 3CSHA 2GQKA 4OCEA 1AXDA 1E2YA 1GSYA 1SJ6A 1YZXA 2HRNA 3KD0A 2GLRA 1ZOFA 1BG5A 4QL7A 2WS2A 3EC3A 19GSA 1U3IA 2C3NA 2IMKA 2HLSA 3EU3A 2B5YA 1T00A 3TCOA 5EY6A 2X4AA 5F8BA 4IN0A 5CRGA 2XHFA 1X5DA 2B1KA 3P90A 2F8AA 4ECBA 2J9HA 2GT5A 3WT1A 1ZL9A 3HDCA 2H73A 1XOBA 2X8CA 1MDKA 3R3EA 4ZB6A 2AJQB 5IM9A 2K18A 2L59A 4IELA 3GMFA 3FZ5A 2H72A 3F3QA 2HSYA 4NV5A 3UVTA 1OE8A 3ZMKA 4L0UA 4OO5A 3U6VA 5GSSA 2R4VA 1UN2A 4NXIA 3QMXA 5J9CA 1T7PB 3UBKA 1VF4A 2DJ2A 1XPVA 4POMA 4XRAA 4F82A 3LSZA 5HQPA 2RUEA 4IJ3A 1HD2A 4HU7A 4YH2A 4HEA2 2PU9C 2L5OA 5A4UA 1J08A 5EL8A 1PSQA 5D9WA 2H19A 2C8UA 3FZAA 2H76A 1A2MA 1O8XA 2RIIA 4ECIA 2FLSA 1SKSB 2HYXA 3ZYWA 3UAPA 4BVXB 4EVMA 2FCHA 1EV9A 3H1NA 4P3YB 4ILFA 1AQWA 5ECKB 2IFQA 4N30A 2R37A 3UOMA 2F51A 2ON5A 4BL7B 4X1UA 2CVDA 5G1LA 4ULXA 4MK3A 2HT9A 5ABRA 2R6KA 2IMDA 2JZTA 1M2DA 1EEMA 2F8FA 1AAZA 5J4UA 3C73A 2IWTA 1G7EA 1EOGA 2HZFA 4ZB8A 1G6WA 2H1BA 4POKA 5DALB 4Q5QA 1GTIA 4PTSA 4BVYA 3RHCA 2YCDA 4CY6A 3IAM2 4CDOA 2H0HA 5DQYA 3ERGA 3KIJA 2YPMA 1A8LA 2H01A 2LNTA 3HXSA 3MSZA 2J23A 2RUFA 1SJZA 14GSA 3PINA 3A3TA 3R2QA 4F0BA 5DJLA 2FA4A 2RM5A 3A2XA 5DQSA 3GKMA 2MMAA 1A2LA 4ZL9A 3LGCA 2HRAA 2O85A 1S3CA 1GSSA 4MZWA 1WPIA 2YJHA 4HDEA 2RM6A 2X49A 2V32A 5INYA 3ISOA 4E8EA 3I9V2 5E4WA 4XS1A 4XS4A 4Q5FA 4EDYA 5BRTA 4PX1A 4NMUA 2DJJA 1AC1A 2VOCA 3D0ZA 2G2QA 1N2AA 3EPTA 1K0DA 1YJ6A 4O92A 3EWLA 4HQSA 2YV9A 1UVZA 1I5GA 3FYGA 5DVBA 4KDUA 3BCIA 3RAZA 4I6XA 3UMAA 1TRUA 3DWVA 1SYXA 3LYKA 3IDVA 3LEFA 5CO3A 3KZQA 1XWGA 2QGVA 4CY8A 4D73A 3C1SA 4G9HA 3RPNA 4GQCA 1X5EA 22GSA 4N10A 2FWEA 2PWJA 1QUWA 3W8JA 1BQ7A 1JZWA 4WBRD 13GSA 5H5RA 3BOAA 1ZCPA 4YAVA 4KSMA 2HSHA 1DSBA 2GDRA 3LYPA 3Q18A 2YJ7A 4FH8A 2NDOA 3HD5A 2KOKA 5CNWA 4ZIJA 3W6GA 2P5RA 5KN0A 5HFIA 3EINA 2BJXA 1ST9A 2YWNA 5DJMA 5COHA 1SKRB 4WR4A 1EGRA 5IOXA 2PVQA 1F9MA 4I97A 2FWFA 4DSRA 4HQZA 1K0BA 1TRWA 1QFNA 3IC8A 4O5QA 5JWQB 1PN0A 1V9WA 4IP1A 1GUKA 2O7KA 1KTEA 4K9ZA 2MMZA 1YEPA 1B8XA 3GFKA 2R0CA 2H0GA 5D93A 3G7YA 4I5QA 1GUHA 2XBIA 3FEUA 5DBQA 3ME7A 5DAKA 6GSXA 2OE1A 5IO2A 3ZIVA 1EWXA 2V2GA 4F0CA 4X4JA 1O81A 1X9SB 1TK5B 2IJYA 6GSTA 1RK4A 1EP7A 5LD0A 1TOFA 4FYUA 2A4HA 2E2GA 4RUVA 3ED3A 6GSWA 2OE0A 1O6JA 2AUVA 2ZUPA 4TR1B 2HI7A 1QQ2A 2REMA 4MMMA 1VF1A 4PUFC 1YF0A 1CQHA 3SWLA 2YN1A 2IMIA 4K0NA 3KM6A 2C1YA 2EIRA 20GSA 2LUSA 5ECSA 2VD0A 2O8VB 1GTUA 3D5JA 4AJ8A 1EP8A 4JR4A 2XBQA 1Z3EA 2HXKA 1O7UA 1BJXA 2TRCP 3TOTA 2DJ1A 2MZCA 2JL4A 5J9BA 4KB3A 4TXOB 1XBSA 3M0FA 2OADA 1TXXA 2WB9A 5D9VA 4RI7A 3IR4A 1USBA 2LRTA 1PMTA 4N0VA 4IBPA 2LNSA 1OC9B 2CX3A 2CAIA 5IMVA 4QL9A 4KDYA 1H4OA 3NOFA 3TJKA 5IOWA 1PRXA 3UVHA 1GH2A 5CRHA 3CSJA 4G10A 3GN3A 3BBYA 3TKPA 4V2LA 4YKFA 5EPFA 2YV7A 2H0IA 3TUEA 3ZVJA 4IKHA 3ZFLA 2GZZA 2DKHA 5KN2A 3RBTA 4ZILA 3NIVA 4I8BA 2RLIA 3M9JA 4F9ZA 2JSZA 4BWSA 2WULA 2B7JA 2O89A 3GRXA 3VPTA 4K7IA 4G0LA 3IHQA 2B1LA 1OKDA 1PN9A 2VCTA 4OFNA 3L4NA 1M0UA 4MF5A 4YQMA 3VPQA 4H86A 3M1GA 3IA1A 3KH7A 3UEMA 3H8QA 1Y25A 3RPPA 5A4WA 5KOWA 3KP8A 3LQ7A 1VGLA 2GT6A 1MTCA 2CVKA 4K2DA 2B5XA 3FRCA 5JCUA 4X0XA 2V6OA 5IMFA 1FHEA 1ZYPA 5DCGA 2YNXA 4DSQA 4MF7A 4FYBA 4ZBBA 4KF9A 4LLRA 3U5RE 3KTBA 5ECHB 1BAYA 1FVKA 5IPGA 1K0CA 1ON4A 3APQA 4PNFA 3VI7A 3P8WA 4E8HA 3E3EA 5GSTA 1X9WB 2GS3A 3TRXA 5L71A 3A5IA 2IN3A 3PH9A 2NPBA 2YOIA 5ECOB 1GTBA 1K0OA 4JR6A 5H5QA 4GWRA 2QC7A 2C4JA 1MEKA 1GLQA 4PQHA 4HI7A 1V58A 3KCMA 3FR6A 4WF4A 3AY8A 1TRVA 2IPAA 3IE3A 3LXTA 1M7TA 11GSA 2MMOA 4KH7A 4XIHA 2VCWA 3MAKA 2B5EA 2WCIA 3EYTA 2LQQA 1VF2A 4TXVA 2CQ9A 4HJ2A 2YZUA 3TOUA 3W8SA 2HZEA 1TJDA 1HYUA 4GTUA 4YQVA 4BPYA 5B8BA 1SU9A 2HNLA 6GSSA 4K5SA 3US3A 1Z7PA 2L6CA 3I6AA 3G7JA 4PQ1A 3MWHA 2I3YA 1GULA 3IBHA 3WGDA 4OD7A 2IFQB 1ERUA 2DJ0A 1TU7A 4TKYA 3VWUA 3I43A 3HCZA 1ZYNA 1X5CA 3VK9A 2FY6A 3F4TA 3K8NA 3IXRA 1XOAA 1ZYQB 1PL2A 3IAS2 3S9FA 3ZVJD 3OR5A 1QGVA 1XW9A 2CA8A 5J5NA 2AHEA 4GXZA 4MZCA 1AUCA 3C71A 1BX9A 3IHGA 2IMFA 2A2RA 2WFCA 2LV3A 2VCVA 2IIYA 2WRTA 3F63A 3WYWA 4BVYB 1KBNA 2PN8A 1KEBA 3TKQA 3P7XA 1OC8A 3TB2A 4HJMA 1Q98A 2QKEA 4EIPA 4POLA 5JCGA 4K5RA 2ZCTA 2GZPA 2IL3A 4AF2A 5FWGA 4HZ4A 1U87A 4OMVA 3ZTLA 5B6MA 1XWKA 4EXJA 1ABAA 2CT6A 4IW9A 3IK7A 1ERTA 2H6XA 3DGQA 1F3BA 2M46A 1M9AA 1PL1A 2KP1A 4JRRA 3RHBA 2C0EA 2VL9A 2DMLA 3QPMA 2K8VA 4ML6A 3KP9A 2FNOA 5IMZA 1SK0A 1SENA 2DKIA 2LJRA 3BJ5A 3EVIA 1RQMA 2X8GA 1BYEA 2R3XA 3HHVA 1Z7RA 2X99A 2K9FA 3QCPA 3KH9A 4MH2A 4GF0A 3CYNA 1NHYA 1NSWA 5CYYA 1JZDA 7GSSA 1XVWA 4ACSA 4KUNA 2OACA 1PKZA 9GSSA 2FD3A 2I9HA 3TJJA 4JZQA 5ECRB 4ECCA 3D21A 1B48A 2H30A 2KLXA 4K7NA 1HNCA 6GSYA 5GZZB 2UZ8A 2H1AA 2VM2A 5ID2B 5LNKe 2D2ZA 2VUPA 4PNGA 5AISA 3GX0A 1X0RA 1YKAA 1SK1A 3GIXA 4D73B 4I2UA 4HZ2A 1R26A 2HRFA 5D96A 3CTGA 1NW2A 2FA8A 5HR3A 2H1GA 4AJ6A 2H66A 3GYKA 4BA7A 1S3DA 1XCCA 2FWGA 3QAVA 4GCIA 1Z9HA 5D9TA 3L9UA 1ZGNA 2V41A 3ZFBA 1Z6NA 4GSSA 4LA1A 4PXOA 4EUYA 3O6TA 1FB0A 4IS0A 1XW5A 2XC2A 4FO5A 1OAZA 3L9VA 4OFTA 4MDCA 5HFGA 1SL0B 4WEYA 2JZRA 3GV1A 2CZ2A 1GLPA 1SD8A 2QA2A 2JSYA 1PGTA 2BTOT 4I2TA 4HS1A 1MD3A 1PD21 1JLVA 2ON7A 1T1VA 1XZOA 5CRWA 4AJ7A 3KMNA 3ZZXA 5H5SA 3C1RA 2MMNA 2GTUA 4WBJA 2VCXA 1ML6A 4LL1B 4A5PA 3HVSA 5HR2A 2C0DA 4ZBAA 4NHWA 5G31A 1F37A 4MABA 2EIOA 4ICYA 4TR0A 3M8NA 5C04A 2B6MA 5G30A 3BCKA 1TI3A 3BD2A 1T3BA 3FKFA 3HYPA 4ZB9A 2V1MA 3PGTA 5ECPB 2DC5A 3HVXA 3TJFA 1VRSD 4YKGA 2KUCA 3A5WA 1R4WA 3PPUA 3EMPA 3UIWA 2VM1A 1FG4A 2K8SA 4XS6A 1O73A 2DBCA 4G0IA 3VWWA 4L8EA 4XRDA 1TW9A 2N5BA 2PUKC 5FHIA 1A0RP 5KN1A 2KP2A 2BMXA 5ENUA 2G0FA 1U3AA 4YQUA 4MZBA 1MD4A 2V6KA 3FW2A 2WJUA 1WRYA 1X9MB 4V1Ag 4O5UA 1CQGA 3TKSC 4XTSA 1GWCA 4BWQA 2OKAA 1ZZYA 2Z9SA 2HFDA 4J57E 1QXHA 4ZBDA 5F0GA 3GUSA 2LRNA 2N5FA 4CW9A 1A23A 2HSMA 8GSSA 4KAEA 1O85A 1PX7A 4RQXA 4JEDA 3DMLA 5KEJA 3GL5A 2OE3A 2PPTA 4WETA 2YWIA 4K7OA 2L5LA 4KCEA 4ECJA 3TRQA 4PURA 2PERA 1GUMA 3EE2A 3H4KA 2CZ3A 3Q19A 1OE7A 4HUAA 4IGJA 3EMXA 4TR4A 1YY7A 4KE3A 1T8EB 4N0ZA 6GSUA 1UC7A 2OBKA 1B4PA 3ERFA 4L0WA 5G2ZA 4POBA 1AQVA 3MIXA 1RW1A 5ECLB 4DSSA 1ZMAA 3F8UA 1V57A 2TRXA 2C3QA 2YWOA 3H93A 2DMMA 3SBCA 1T4ZA 3CXGA 3E0UA 4XCSA 3APOA 4LMVA 3IOSA 2A4VA 3D6IA 3KXOA 3QAWA 2K6VA 3FZ9A 3UJ1A 4TXOA 5IMAA 3Q74A 3IV4A 4TW5A 1XVQA 5CP1A 1M2BA 1A0FA 5JCWA 5HFKA 3DYRA 4GLTA 4WR5A 4RI6A 2GSQA 1G7OA 1R7HA 3GKNA 2YZHA 5BMUA 1R5PA 3KMOA 1MDJA 2B7KA 3GTUA 4G19A 3HJOA 1SKWB 1K3LA 2PBJA 5CRDA 4IQ1A 3DVXA 2MBTA 5E59A 3LWAA 3FZ4A 1DBYA 3D4MA 3VLNA 2H74A 2FHEA 3GA4A 4MJCA 1FO5A 2LKUA 3F0IA 2LQOA 4KGIA 5ELGA 1FOHA 4GQFA 1K3YA 1THOA 4EO3A 4V1Ap 2NVLA 1URMA 2L4CA 3LFLA 1GNEA 3P2AA 4ZXGA 2LJAA 1WE0A 2M72A 2XPEA 3VWVA 3EURA 4MF6A 4EKZA 4WXTA 3GKKA 16GSA 1HQOA 4NV2A 1V2AA 1GNWA 4RQRA 4TOPA 4Z2TA 3GSTA 5AGYA 2AB6A 5ELAA 4IQAA 3DRNA 5JWRB 1DE2A 5D73A 5B7CA 3LORA 1G6YA 2P5QA 3MDKA 3JCML 4GSTA 5F05A 3I69A 3KTLA 2EIQA 3O3TA 4IJIA 3KGKA 12GSA 3IPZA 3TJBA 1V98A 3GSSA 3A2WA 2HZEB 1GP1A 1TTZA 1QK8A 2AAWA 1TK8B 5IQYA 2GQMA 2B3SA 2VCZA 1IYHA 5G5EA 5HR1A 1DUGA 5D9XA 1IYIA 3TRPA 1K0NA 4QQ7A 3QR6A 2YWMA 4KSOA 1NHOA 3DEXA 2OA7A 4OO4A 1ILOA 1EV4A 4KNDA 3GURA 4PGTA 3HA9A 3TKSA 1SL1B 5AN1A 10GSA 4KCAA 3IRAA 4JE1A 5G1KA 2LRCA 3WGEA 2R0PA 4MLYA 5DCHA 4KX4A 3N5OA 4MP4A 1YDKA 1H75A 3J7Yb 1YF1A 4F2IA 1TU8A 2VAFA 3A2VA 3ZRDA 1W89A 4O5RA 4O7HA 4EDZA 1SK2A 2A2PA 2AV4A 4OCFA 4NHZA 1F2EA 1R5AA 4YAPA 2HRKA 4MJAA 1AW9A 2E2MA 5LCZA 4JBBA 3TKRA 5CREA 3FMWA 1OC3A 2VL2C 1ERWA 3UL3A 3UARA 2VIMA 3HJMA 1W4VA 1ERVA 3LW9A 1T4YA 2L6DA 2I1UA 4N11A 3TDGA 4F03A 4MPFA 4TRXA 4Q5NA 4GSNA 1THXA 3G9BA 4DVCA 2O87A 2JACA 2LS5A 3DIEA 1FVJA 5F07A 2FUG2 5IMDA 3QAGA 4OFMA 5F06A 5IIZA 2VO4A 1JZRA 1TK0B 4BVXA 4DEJA 4XHMA 3CSIA 4CHSA 1GSDA 2FGXA 4MNNA 1HNBA 3MYDA 3G7IA 1XWAA 1EEJA 3D4TA 4HOJA 4BL7A 4FQUA 3FY7A 2LTKA 2H8LA 3HZ4A 2PGTA 1AIUA 3TKSE 1O8WA 2GGTA 3APSA 5AIXA 4XS4B 2JADA 3DKSA 2WZ9A 1EZKA 5IPHA 3HJPA 3QFAC 3GKXA 5DALA 1UA5A 3FR9A 5C00A 1PX6A 3C7MA 4NWYA 5FT3A 2OJLA 1JLWA 2ALBA 1NM3A 2H6YA 5ECNB 1C72A 4TR3A 1SL2B 3O76A 1WJKA 3ERWA 1BEDA 4PUAA 1ACVA 3HZ8A 1LBKA 2QSIA 3H79A 3V1WA 3QOUA 2E0QA 1TI1A 4PQIA 4K1FA 1XW6A 1LJRA 2LEGA 5B8AA 1PQNA 3FHKA 3DVWA 4HU9A 2IMEA 1TDIA 1Z5YE 5IMCA 1WOUA 2VLUA 4TN8A 1GRXA 5ID2A 2DLXA 1WWJA 5J3RA 2ZNMA 3WT2A 3LXZA 2R2JA 1GSUA 2X8HA 4L5OA 2GSRA 3CTFA 2GQLA 1F6MC 4K2XA 4G0KA 2KHPA 4USSA 1FAAA 5DDLA 2GSSA 3E9JB 1XIYA 2GVPA 3GNJA 3CRTA 3GH9A 4V2NA 3L78A 3F4RA 5DAKB 2DJ3A 4EC0A 1B9XC 1GSQA 1M2AA 4ZL7A 5AIVA 3VI5A 5EVOA 3DD3A 2NTOA 4JU5A 5ECIB 2C3TA 3DXBA 4WF5A 4Z2UA 2P31A 5IO0A 1WIKA 4NPBA 4O32A 5J41A 1YEXA 3FR3A 4KDXA 4K8MA 2TIRA 5ECQB 2H70A 4GRFA 1J9BA 2GZYA 1A2JA 4IHUA 3Q6OA 2R0GA 3ZMLA 1OYJA 2C0GA 4MCUA 1FB6A 2P0GA 4AGSA 1XFLA 4ISDA 3F6FA 5A4VA 1I9DA 3N9JA 3L0HA 1G0TA 3WGXA 2I4AA 3RDWA 2X64A 2LJKA 2WDUA 4ML1A 3IC4A 3L9SA 1A24A 4TVEA 5HR0A 2GSTA 2VLTA 2VL2A 2YANA 4IP6A 5JWOB 1U88A 2F3MA 2JZSA 3GH6A 1Y6EA 3ZLPA 4MJBA 3EU4A 2WGRA 5KN3A 1DE1A 1FW1A 3F9UA 1KNGA 1M9BA 1ZYEA 2H6ZA 5G5FA 2VL3A 3LG6A 1F3AA 2L57A 2F9SA 1YQ1A 1HNAA 1K0AA 4IVFA 4LMWA 3TGZA 6GSVA 1PKWA 4FIWA 2C80A 4DSSB 2OBIA 1AQXA 4NAXA 2QA1A 1Z6MA 2XPDA 4MA9A 1EOHA 4V2MA 3ZIJA 1A8YA 1OVNA 3WD6A 2A2SA 3CMIA 5B6NA 2VLVA 4TR1A 5GAND 2CX4A 2PVOC 1JFUA 2ES7A 3ME8A 5D8IA 4Z2RA 3HVVA 3FK8A 3GL3A 4EF0A 1B9YC 4OWYA 2HE3A 2CV4A 3CRUA 2N5AA 1PA3A 4KA0A 1XWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YP6 A;  1GL8 A;  3F6D A;  2CVB A;  3GTU B;  2DIY A;  2CAQ A;  4K6X A;  1LU4 A;  4LL4 B;  1QMV A;  1K3O A;  1N8J A;  2VCQ A;  2MBS A;  17GS A;  2VD1 A;  4J2F A;  4WKW A;  3GHA A;  1U6T A;  2PMT A;  1K0M A;  1J0F A;  4Z7X A;  2EC4 A;  3F3R A;  1JZO A;  3NZN A;  1YKC A;  3C8E A;  3GX8 A;  3CBU A;  1V40 A;  3J7Y k;  4ZL8 A;  3M9K A;  1GTA A;  4MJE A;  1SYR A;  3PR8 A;  2C0F A;  1OC9 A;  1VF3 A;  2AYT A;  3LJR A;  4ID0 A;  3KEB A;  1EGO A;  3F4S A;  4X43 A;  3VFI A;  2NBS A;  1SD9 A;  1XWC A;  2M80 A;  5ECM B;  1M99 A;  4K0G A;  1Q4J A;  5A5K A;  1WMJ A;  3IK9 A;  1TRS A;  1B4Q A;  2JU5 A;  1GSE A;  4KW6 A;  3KJY A;  2DSA A;  18GS A;  4L5L A;  1E6B A;  2LST A;  4EL1 A;  3HKR A;  3UBL A;  2L4Q A;  3M3M A;  1SJI A;  3QFB C;  5CAX A;  2H1D A;  3VUR A;  2DJK A;  4FYC A;  1TKD B;  4MH3 A;  2MYG A;  1JHB A;  1OKT A;  1XXU A;  4EE0 A;  4J56 E;  4Q5R A;  3ZIT A;  1WP0 A;  3QD9 A;  1TP9 A;  1GSF A;  3D22 A;  3ZRE A;  2FWH A;  2E7P A;  3MNG A;  3HY2 A;  1FOV A;  1MDI A;  3ZL5 A;  3TJG A;  4G2E A;  4MPG A;  2I81 A;  2H71 A;  2R5G A;  3QDN A;  2DIZ A;  5GAP D;  2H75 A;  1S3A A;  3VWX A;  3CSH A;  2GQK A;  4OCE A;  1AXD A;  1E2Y A;  1GSY A;  1SJ6 A;  1YZX A;  2HRN A;  3KD0 A;  2GLR A;  1ZOF A;  1BG5 A;  4QL7 A;  2WS2 A;  3EC3 A;  19GS A;  1U3I A;  2C3N A;  2IMK A;  2HLS A;  3EU3 A;  2B5Y A;  1T00 A;  3TCO A;  5EY6 A;  5F8B A;  4IN0 A;  5CRG A;  2XHF A;  1X5D A;  2B1K A;  3P90 A;  2F8A A;  4ECB A;  2J9H A;  2GT5 A;  3WT1 A;  1ZL9 A;  3HDC A;  2H73 A;  1XOB A;  2X8C A;  1MDK A;  4ZB6 A;  2AJQ B;  5IM9 A;  2K18 A;  2L59 A;  4IEL A;  3GMF A;  3FZ5 A;  2H72 A;  3F3Q A;  2HSY A;  4NV5 A;  3UVT A;  1OE8 A;  3ZMK A;  4L0U A;  4OO5 A;  3U6V A;  5GSS A;  2R4V A;  1UN2 A;  4NXI A;  3QMX A;  5J9C A;  1T7P B;  3UBK A;  1VF4 A;  2DJ2 A;  1XPV A;  4POM A;  4XRA A;  4F82 A;  3LSZ A;  5HQP A;  2RUE A;  4IJ3 A;  1HD2 A;  4HU7 A;  4YH2 A;  4HEA 2;  2PU9 C;  2L5O A;  5A4U A;  1J08 A;  5EL8 A;  1PSQ A;  5D9W A;  2H19 A;  2C8U A;  3FZA A;  2H76 A;  1A2M A;  1O8X A;  2RII A;  4ECI A;  2FLS A;  1SKS B;  2HYX A;  3ZYW A;  3UAP A;  4EVM A;  2FCH A;  1EV9 A;  3H1N A;  4P3Y B;  4ILF A;  1AQW A;  5ECK B;  2IFQ A;  4N30 A;  2R37 A;  3UOM A;  2F51 A;  2ON5 A;  4X1U A;  2CVD A;  5G1L A;  4ULX A;  4MK3 A;  2HT9 A;  5ABR A;  2R6K A;  2IMD A;  2JZT A;  1M2D A;  1EEM A;  2F8F A;  1AAZ A;  5J4U A;  3C73 A;  2IWT A;  1G7E A;  1EOG A;  2HZF A;  4ZB8 A;  1G6W A;  2H1B A;  4POK A;  5DAL B;  4Q5Q A;  1GTI A;  4BVY A;  3RHC A;  2YCD A;  3IAM 2;  4CDO A;  2H0H A;  5DQY A;  3ERG A;  3KIJ A;  2YPM A;  1A8L A;  2H01 A;  2LNT A;  3HXS A;  3MSZ A;  2J23 A;  2RUF A;  1SJZ A;  14GS A;  3PIN A;  3A3T A;  3R2Q A;  4F0B A;  5DJL A;  2FA4 A;  2RM5 A;  3A2X A;  5DQS A;  3GKM A;  2MMA A;  1A2L A;  4ZL9 A;  3LGC A;  2O85 A;  1S3C A;  1GSS A;  4MZW A;  1WPI A;  2YJH A;  4HDE A;  2RM6 A;  2V32 A;  5INY A;  3ISO A;  4E8E A;  3I9V 2;  5E4W A;  4XS1 A;  4XS4 A;  4Q5F A;  4EDY A;  4PX1 A;  4NMU A;  2DJJ A;  1AC1 A;  2VOC A;  3D0Z A;  2G2Q A;  1N2A A;  1K0D A;  1YJ6 A;  4O92 A;  3EWL A;  4HQS A;  2YV9 A;  1UVZ A;  1I5G A;  3FYG A;  5DVB A;  4KDU A;  3BCI A;  3RAZ A;  4I6X A;  3UMA A;  1TRU A;  3DWV A;  1SYX A;  3LYK A;  3IDV A;  3LEF A;  5CO3 A;  3KZQ A;  1XWG A;  2QGV A;  4D73 A;  3C1S A;  4G9H A;  3RPN A;  4GQC A;  1X5E A;  22GS A;  4N10 A;  2FWE A;  2PWJ A;  1QUW A;  3W8J A;  1BQ7 A;  1JZW A;  4WBR D;  13GS A;  5H5R A;  3BOA A;  1ZCP A;  4YAV A;  4KSM A;  2HSH A;  1DSB A;  2GDR A;  3LYP A;  3Q18 A;  2YJ7 A;  4FH8 A;  2NDO A;  3HD5 A;  2KOK A;  5CNW A;  4ZIJ A;  3W6G A;  2P5R A;  5KN0 A;  5HFI A;  3EIN A;  2BJX A;  1ST9 A;  2YWN A;  5DJM A;  5COH A;  1SKR B;  4WR4 A;  1EGR A;  5IOX A;  2PVQ A;  1F9M A;  4I97 A;  2FWF A;  4DSR A;  4HQZ A;  1K0B A;  1TRW A;  1QFN A;  5JWQ B;  1V9W A;  4IP1 A;  1GUK A;  2O7K A;  1KTE A;  4K9Z A;  2MMZ A;  1YEP A;  1B8X A;  3GFK A;  2H0G A;  5D93 A;  3G7Y A;  4I5Q A;  1GUH A;  2XBI A;  3FEU A;  5DBQ A;  3ME7 A;  5DAK A;  6GSX A;  2OE1 A;  5IO2 A;  3ZIV A;  1EWX A;  2V2G A;  4F0C A;  1O81 A;  1X9S B;  1TK5 B;  2IJY A;  6GST A;  1RK4 A;  1EP7 A;  5LD0 A;  1TOF A;  4FYU A;  2E2G A;  4RUV A;  3ED3 A;  6GSW A;  2OE0 A;  1O6J A;  2AUV A;  2ZUP A;  4TR1 B;  2HI7 A;  1QQ2 A;  2REM A;  4MMM A;  1VF1 A;  4PUF C;  1YF0 A;  1CQH A;  3SWL A;  2YN1 A;  2IMI A;  4K0N A;  3KM6 A;  2C1Y A;  2EIR A;  20GS A;  2LUS A;  5ECS A;  2VD0 A;  2O8V B;  1GTU A;  3D5J A;  4AJ8 A;  1EP8 A;  4JR4 A;  2XBQ A;  1Z3E A;  2HXK A;  1O7U A;  1BJX A;  2TRC P;  3TOT A;  2DJ1 A;  2MZC A;  2JL4 A;  5J9B A;  4KB3 A;  4TXO B;  1XBS A;  3M0F A;  2OAD A;  1TXX A;  2WB9 A;  5D9V A;  4RI7 A;  3IR4 A;  1USB A;  2LRT A;  1PMT A;  4N0V A;  4IBP A;  2LNS A;  1OC9 B;  2CX3 A;  2CAI A;  5IMV A;  4QL9 A;  4KDY A;  1H4O A;  3NOF A;  3TJK A;  5IOW A;  1PRX A;  3UVH A;  1GH2 A;  5CRH A;  3CSJ A;  4G10 A;  3GN3 A;  3BBY A;  3TKP A;  4V2L A;  5EPF A;  2YV7 A;  2H0I A;  3TUE A;  3ZVJ A;  4IKH A;  3ZFL A;  2GZZ A;  5KN2 A;  3RBT A;  4ZIL A;  3NIV A;  4I8B A;  2RLI A;  3M9J A;  4F9Z A;  2JSZ A;  4BWS A;  2WUL A;  2B7J A;  2O89 A;  3GRX A;  3VPT A;  4K7I A;  3IHQ A;  2B1L A;  1OKD A;  1PN9 A;  2VCT A;  4OFN A;  3L4N A;  1M0U A;  4MF5 A;  4YQM A;  3VPQ A;  4H86 A;  3M1G A;  3IA1 A;  3KH7 A;  3UEM A;  3H8Q A;  1Y25 A;  3RPP A;  5A4W A;  3KP8 A;  3LQ7 A;  1VGL A;  2GT6 A;  1MTC A;  2CVK A;  4K2D A;  2B5X A;  3FRC A;  5JCU A;  4X0X A;  2V6O A;  5IMF A;  1FHE A;  5DCG A;  2YNX A;  4DSQ A;  4MF7 A;  4FYB A;  4ZBB A;  4LLR A;  3U5R E;  3KTB A;  5ECH B;  1BAY A;  1FVK A;  5IPG A;  1K0C A;  1ON4 A;  3APQ A;  4PNF A;  3VI7 A;  3P8W A;  4E8H A;  3E3E A;  5GST A;  1X9W B;  2GS3 A;  3TRX A;  5L71 A;  2IN3 A;  3PH9 A;  2NPB A;  2YOI A;  5ECO B;  1GTB A;  1K0O A;  4JR6 A;  5H5Q A;  4GWR A;  2QC7 A;  2C4J A;  1MEK A;  1GLQ A;  4PQH A;  4HI7 A;  1V58 A;  3KCM A;  3FR6 A;  4WF4 A;  3AY8 A;  1TRV A;  2IPA A;  3IE3 A;  3LXT A;  1M7T A;  11GS A;  2MMO A;  4KH7 A;  4XIH A;  2VCW A;  3MAK A;  2B5E A;  2WCI A;  3EYT A;  2LQQ A;  1VF2 A;  4TXV A;  2CQ9 A;  4HJ2 A;  2YZU A;  3TOU A;  3W8S A;  2HZE A;  1TJD A;  1HYU A;  4GTU A;  4YQV A;  4BPY A;  5B8B A;  1SU9 A;  2HNL A;  6GSS A;  3US3 A;  1Z7P A;  2L6C A;  3I6A A;  3G7J A;  4PQ1 A;  3MWH A;  2I3Y A;  1GUL A;  3IBH A;  3WGD A;  4OD7 A;  2IFQ B;  1ERU A;  2DJ0 A;  1TU7 A;  4TKY A;  3VWU A;  3I43 A;  3HCZ A;  1X5C A;  3VK9 A;  2FY6 A;  3F4T A;  3K8N A;  3IXR A;  1XOA A;  1ZYQ B;  1PL2 A;  3IAS 2;  3S9F A;  3ZVJ D;  3OR5 A;  1QGV A;  1XW9 A;  2CA8 A;  5J5N A;  2AHE A;  4GXZ A;  4MZC A;  1AUC A;  3C71 A;  1BX9 A;  2IMF A;  2A2R A;  2WFC A;  2LV3 A;  2VCV A;  2IIY A;  2WRT A;  3F63 A;  3WYW A;  1KBN A;  2PN8 A;  1KEB A;  3TKQ A;  3P7X A;  1OC8 A;  3TB2 A;  4HJM A;  1Q98 A;  2QKE A;  4POL A;  5JCG A;  2ZCT A;  2GZP A;  2IL3 A;  4AF2 A;  5FWG A;  4HZ4 A;  1U87 A;  4OMV A;  3ZTL A;  5B6M A;  1XWK A;  4EXJ A;  1ABA A;  2CT6 A;  4IW9 A;  3IK7 A;  1ERT A;  2H6X A;  3DGQ A;  1F3B A;  2M46 A;  1M9A A;  1PL1 A;  2KP1 A;  4JRR A;  3RHB A;  2C0E A;  2VL9 A;  2DML A;  3QPM A;  2K8V A;  4ML6 A;  3KP9 A;  2FNO A;  5IMZ A;  1SK0 A;  1SEN A;  2LJR A;  3BJ5 A;  3EVI A;  1RQM A;  2X8G A;  1BYE A;  2R3X A;  3HHV A;  1Z7R A;  2X99 A;  2K9F A;  3QCP A;  3KH9 A;  4MH2 A;  4GF0 A;  3CYN A;  1NHY A;  1NSW A;  5CYY A;  1JZD A;  7GSS A;  1XVW A;  4ACS A;  4KUN A;  2OAC A;  1PKZ A;  9GSS A;  2FD3 A;  2I9H A;  3TJJ A;  4JZQ A;  5ECR B;  4ECC A;  3D21 A;  1B48 A;  2H30 A;  2KLX A;  4K7N A;  1HNC A;  6GSY A;  5GZZ B;  2H1A A;  2VM2 A;  5ID2 B;  5LNK e;  2D2Z A;  2VUP A;  4PNG A;  5AIS A;  3GX0 A;  1X0R A;  1YKA A;  1SK1 A;  3GIX A;  4D73 B;  4I2U A;  4HZ2 A;  1R26 A;  2HRF A;  5D96 A;  3CTG A;  1NW2 A;  2FA8 A;  5HR3 A;  2H1G A;  4AJ6 A;  2H66 A;  3GYK A;  4BA7 A;  1S3D A;  1XCC A;  2FWG A;  3QAV A;  4GCI A;  1Z9H A;  5D9T A;  3L9U A;  1ZGN A;  2V41 A;  3ZFB A;  1Z6N A;  4GSS A;  4LA1 A;  4PXO A;  4EUY A;  3O6T A;  1FB0 A;  4IS0 A;  1XW5 A;  2XC2 A;  4FO5 A;  1OAZ A;  3L9V A;  4OFT A;  4MDC A;  5HFG A;  1SL0 B;  4WEY A;  2JZR A;  3GV1 A;  2CZ2 A;  1GLP A;  1SD8 A;  2JSY A;  1PGT A;  2BTO T;  4I2T A;  4HS1 A;  1MD3 A;  1PD2 1;  1JLV A;  2ON7 A;  1T1V A;  1XZO A;  5CRW A;  4AJ7 A;  3KMN A;  3ZZX A;  5H5S A;  3C1R A;  2MMN A;  2GTU A;  4WBJ A;  2VCX A;  1ML6 A;  4LL1 B;  3HVS A;  5HR2 A;  2C0D A;  4ZBA A;  4NHW A;  5G31 A;  1F37 A;  4MAB A;  2EIO A;  4TR0 A;  3M8N A;  5C04 A;  2B6M A;  5G30 A;  3BCK A;  1TI3 A;  3BD2 A;  1T3B A;  3FKF A;  3HYP A;  4ZB9 A;  2V1M A;  3PGT A;  5ECP B;  2DC5 A;  3HVX A;  3TJF A;  1VRS D;  2KUC A;  3A5W A;  1R4W A;  3EMP A;  3UIW A;  2VM1 A;  1FG4 A;  2K8S A;  4XS6 A;  1O73 A;  2DBC A;  3VWW A;  4L8E A;  4XRD A;  1TW9 A;  2N5B A;  2PUK C;  5FHI A;  1A0R P;  5KN1 A;  2KP2 A;  2BMX A;  5ENU A;  2G0F A;  1U3A A;  4YQU A;  4MZB A;  1MD4 A;  2V6K A;  3FW2 A;  2WJU A;  1WRY A;  1X9M B;  4V1A g;  1CQG A;  3TKS C;  4XTS A;  1GWC A;  4BWQ A;  2OKA A;  1ZZY A;  2Z9S A;  2HFD A;  4J57 E;  1QXH A;  4ZBD A;  5F0G A;  3GUS A;  2LRN A;  2N5F A;  4CW9 A;  1A23 A;  8GSS A;  4KAE A;  1O85 A;  1PX7 A;  4RQX A;  4JED A;  3DML A;  5KEJ A;  3GL5 A;  2OE3 A;  2PPT A;  4WET A;  2YWI A;  4K7O A;  2L5L A;  4KCE A;  4ECJ A;  3TRQ A;  4PUR A;  2PER A;  1GUM A;  3EE2 A;  3H4K A;  2CZ3 A;  3Q19 A;  1OE7 A;  4HUA A;  4IGJ A;  3EMX A;  4TR4 A;  1YY7 A;  4KE3 A;  1T8E B;  4N0Z A;  6GSU A;  1UC7 A;  2OBK A;  1B4P A;  3ERF A;  4L0W A;  5G2Z A;  4POB A;  1AQV A;  1RW1 A;  5ECL B;  4DSS A;  1ZMA A;  3F8U A;  1V57 A;  2TRX A;  2C3Q A;  2YWO A;  3H93 A;  2DMM A;  3SBC A;  1T4Z A;  3CXG A;  3E0U A;  4XCS A;  3APO A;  4LMV A;  3IOS A;  2A4V A;  3D6I A;  3KXO A;  3QAW A;  2K6V A;  3FZ9 A;  3UJ1 A;  4TXO A;  5IMA A;  3Q74 A;  3IV4 A;  4TW5 A;  1XVQ A;  5CP1 A;  1M2B A;  1A0F A;  5JCW A;  5HFK A;  3DYR A;  4GLT A;  4WR5 A;  4RI6 A;  2GSQ A;  1G7O A;  1R7H A;  3GKN A;  2YZH A;  1R5P A;  3KMO A;  1MDJ A;  2B7K A;  3GTU A;  4G19 A;  3HJO A;  1SKW B;  1K3L A;  2PBJ A;  5CRD A;  4IQ1 A;  3DVX A;  2MBT A;  5E59 A;  3LWA A;  3FZ4 A;  1DBY A;  3D4M A;  3VLN A;  2H74 A;  2FHE A;  3GA4 A;  4MJC A;  1FO5 A;  2LKU A;  3F0I A;  2LQO A;  4KGI A;  5ELG A;  4GQF A;  1K3Y A;  1THO A;  4EO3 A;  4V1A p;  2NVL A;  1URM A;  2L4C A;  3LFL A;  1GNE A;  3P2A A;  4ZXG A;  2LJA A;  1WE0 A;  2M72 A;  2XPE A;  3VWV A;  3EUR A;  4MF6 A;  4EKZ A;  4WXT A;  3GKK A;  16GS A;  1HQO A;  4NV2 A;  1V2A A;  1GNW A;  4RQR A;  4TOP A;  3GST A;  5AGY A;  2AB6 A;  5ELA A;  4IQA A;  3DRN A;  5JWR B;  1DE2 A;  5D73 A;  5B7C A;  3LOR A;  1G6Y A;  2P5Q A;  3MDK A;  3JCM L;  4GST A;  5F05 A;  3I69 A;  3KTL A;  2EIQ A;  3O3T A;  4IJI A;  3KGK A;  12GS A;  3IPZ A;  3TJB A;  1V98 A;  3GSS A;  3A2W A;  2HZE B;  1GP1 A;  1TTZ A;  1QK8 A;  2AAW A;  1TK8 B;  5IQY A;  2GQM A;  2B3S A;  2VCZ A;  1IYH A;  5G5E A;  5HR1 A;  1DUG A;  5D9X A;  1IYI A;  3TRP A;  1K0N A;  4QQ7 A;  3QR6 A;  2YWM A;  4KSO A;  1NHO A;  3DEX A;  2OA7 A;  4OO4 A;  1ILO A;  1EV4 A;  4KND A;  3GUR A;  4PGT A;  3HA9 A;  3TKS A;  1SL1 B;  5AN1 A;  10GS A;  4KCA A;  3IRA A;  4JE1 A;  5G1K A;  2LRC A;  3WGE A;  4MLY A;  5DCH A;  4KX4 A;  3N5O A;  4MP4 A;  1YDK A;  1H75 A;  3J7Y b;  1YF1 A;  4F2I A;  1TU8 A;  2VAF A;  3A2V A;  3ZRD A;  1W89 A;  4O5R A;  4O7H A;  4EDZ A;  1SK2 A;  2AV4 A;  4OCF A;  4NHZ A;  1F2E A;  1R5A A;  4YAP A;  4MJA A;  1AW9 A;  2E2M A;  5LCZ A;  4JBB A;  3TKR A;  5CRE A;  1OC3 A;  2VL2 C;  1ERW A;  3UL3 A;  3UAR A;  2VIM A;  3HJM A;  1W4V A;  1ERV A;  1T4Y A;  2L6D A;  2I1U A;  4N11 A;  3TDG A;  4F03 A;  4MPF A;  4TRX A;  4Q5N A;  4GSN A;  1THX A;  3G9B A;  4DVC A;  2O87 A;  2JAC A;  2LS5 A;  3DIE A;  1FVJ A;  5F07 A;  2FUG 2;  5IMD A;  3QAG A;  4OFM A;  5F06 A;  5IIZ A;  2VO4 A;  1JZR A;  1TK0 B;  4BVX A;  4DEJ A;  4XHM A;  3CSI A;  4CHS A;  1GSD A;  2FGX A;  1HNB A;  3G7I A;  1XWA A;  1EEJ A;  3D4T A;  4HOJ A;  4BL7 A;  3FY7 A;  2LTK A;  2H8L A;  3HZ4 A;  2PGT A;  1AIU A;  3TKS E;  1O8W A;  2GGT A;  3APS A;  5AIX A;  4XS4 B;  2JAD A;  3DKS A;  2WZ9 A;  1EZK A;  5IPH A;  3HJP A;  3QFA C;  3GKX A;  5DAL A;  1UA5 A;  3FR9 A;  5C00 A;  1PX6 A;  3C7M A;  4NWY A;  5FT3 A;  2OJL A;  1JLW A;  2ALB A;  1NM3 A;  2H6Y A;  5ECN B;  1C72 A;  4TR3 A;  1SL2 B;  3O76 A;  1WJK A;  3ERW A;  1BED A;  4PUA A;  1ACV A;  3HZ8 A;  1LBK A;  2QSI A;  3H79 A;  3V1W A;  3QOU A;  2E0Q A;  1TI1 A;  4PQI A;  4K1F A;  1XW6 A;  1LJR A;  2LEG A;  5B8A A;  1PQN A;  3FHK A;  3DVW A;  4HU9 A;  2IME A;  1TDI A;  1Z5Y E;  5IMC A;  1WOU A;  2VLU A;  4TN8 A;  1GRX A;  5ID2 A;  2DLX A;  1WWJ A;  5J3R A;  2ZNM A;  3WT2 A;  3LXZ A;  2R2J A;  1GSU A;  2X8H A;  4L5O A;  2GSR A;  3CTF A;  2GQL A;  1F6M C;  2KHP A;  1FAA A;  5DDL A;  2GSS A;  3E9J B;  1XIY A;  2GVP A;  3GNJ A;  3CRT A;  3GH9 A;  4V2N A;  3L78 A;  3F4R A;  5DAK B;  2DJ3 A;  4EC0 A;  1B9X C;  1GSQ A;  1M2A A;  4ZL7 A;  5AIV A;  3VI5 A;  5EVO A;  3DD3 A;  2NTO A;  4JU5 A;  5ECI B;  2C3T A;  3DXB A;  4WF5 A;  2P31 A;  5IO0 A;  1WIK A;  4NPB A;  4O32 A;  5J41 A;  1YEX A;  3FR3 A;  4KDX A;  4K8M A;  2TIR A;  5ECQ B;  2H70 A;  4GRF A;  1J9B A;  2GZY A;  1A2J A;  4IHU A;  3Q6O A;  3ZML A;  1OYJ A;  2C0G A;  4MCU A;  1FB6 A;  2P0G A;  4AGS A;  1XFL A;  4ISD A;  3F6F A;  5A4V A;  1I9D A;  3N9J A;  3L0H A;  1G0T A;  3WGX A;  2I4A A;  3RDW A;  2X64 A;  2LJK A;  2WDU A;  4ML1 A;  3IC4 A;  3L9S A;  1A24 A;  4TVE A;  5HR0 A;  2GST A;  2VLT A;  2VL2 A;  2YAN A;  4IP6 A;  5JWO B;  1U88 A;  2F3M A;  2JZS A;  3GH6 A;  1Y6E A;  3ZLP A;  4MJB A;  3EU4 A;  2WGR A;  5KN3 A;  1DE1 A;  1FW1 A;  3F9U A;  1KNG A;  1M9B A;  1ZYE A;  2H6Z A;  5G5F A;  2VL3 A;  3LG6 A;  1F3A A;  2L57 A;  2F9S A;  1YQ1 A;  1HNA A;  1K0A A;  4IVF A;  4LMW A;  3TGZ A;  6GSV A;  1PKW A;  4FIW A;  2C80 A;  4DSS B;  2OBI A;  1AQX A;  4NAX A;  1Z6M A;  2XPD A;  4MA9 A;  1EOH A;  4V2M A;  3ZIJ A;  1A8Y A;  1OVN A;  3WD6 A;  2A2S A;  3CMI A;  5B6N A;  2VLV A;  4TR1 A;  5GAN D;  2CX4 A;  2PVO C;  1JFU A;  2ES7 A;  3ME8 A;  5D8I A;  3HVV A;  3FK8 A;  3GL3 A;  4EF0 A;  1B9Y C;  4OWY A;  2HE3 A;  2CV4 A;  3CRU A;  2N5A A;  1PA3 A;  4KA0 A;  1XWB A; 
#chains in the Genus database with same CATH topology
 2YP6 A;  1GL8 A;  3F6D A;  2CVB A;  3GTU B;  2DIY A;  2CAQ A;  4K6X A;  1LU4 A;  4LL4 B;  1QMV A;  1K3O A;  1N8J A;  2VCQ A;  2MBS A;  17GS A;  2VD1 A;  4J2F A;  4WKW A;  3GHA A;  1U6T A;  2PMT A;  1K0M A;  1J0F A;  4Z7X A;  2EC4 A;  3F3R A;  1JZO A;  3NZN A;  1YKC A;  3C8E A;  3GX8 A;  3CBU A;  1V40 A;  3J7Y k;  4ZL8 A;  3M9K A;  1GTA A;  4MJE A;  1SYR A;  3PR8 A;  2C0F A;  1OC9 A;  5KOX A;  1VF3 A;  2AYT A;  3LJR A;  4ID0 A;  3KEB A;  1EGO A;  3F4S A;  4X43 A;  3VFI A;  2NBS A;  1SD9 A;  1XWC A;  2M80 A;  5ECM B;  1M99 A;  4K0G A;  1Q4J A;  5A5K A;  1WMJ A;  3IK9 A;  1TRS A;  1B4Q A;  2JU5 A;  4EIQ A;  1GSE A;  4KW6 A;  3KJY A;  2DSA A;  18GS A;  4L5L A;  1E6B A;  2LST A;  4EL1 A;  3HKR A;  3UBL A;  2L4Q A;  3M3M A;  1SJI A;  3QFB C;  5CAX A;  2H1D A;  3VUR A;  2DJK A;  4FYC A;  1TKD B;  4MH3 A;  2MYG A;  1JHB A;  1OKT A;  1XXU A;  4EE0 A;  4J56 E;  4Q5R A;  3ZIT A;  1WP0 A;  3QD9 A;  1TP9 A;  1GSF A;  3D22 A;  3ZRE A;  2FWH A;  2E7P A;  3MNG A;  3HY2 A;  1FOV A;  1MDI A;  3ZL5 A;  3TJG A;  4G2E A;  4MPG A;  2I81 A;  2H71 A;  2R5G A;  3QDN A;  2DIZ A;  5GAP D;  2H75 A;  1S3A A;  3VWX A;  3CSH A;  2GQK A;  4OCE A;  1AXD A;  1E2Y A;  1GSY A;  1SJ6 A;  1YZX A;  2HRN A;  3KD0 A;  2GLR A;  1ZOF A;  1BG5 A;  4QL7 A;  2WS2 A;  3EC3 A;  19GS A;  1U3I A;  2C3N A;  2IMK A;  2HLS A;  3EU3 A;  2B5Y A;  1T00 A;  3TCO A;  5EY6 A;  2X4A A;  5F8B A;  4IN0 A;  5CRG A;  2XHF A;  1X5D A;  2B1K A;  3P90 A;  2F8A A;  4ECB A;  2J9H A;  2GT5 A;  3WT1 A;  1ZL9 A;  3HDC A;  2H73 A;  1XOB A;  2X8C A;  1MDK A;  3R3E A;  4ZB6 A;  2AJQ B;  5IM9 A;  2K18 A;  2L59 A;  4IEL A;  3GMF A;  3FZ5 A;  2H72 A;  3F3Q A;  2HSY A;  4NV5 A;  3UVT A;  1OE8 A;  3ZMK A;  4L0U A;  4OO5 A;  3U6V A;  5GSS A;  2R4V A;  1UN2 A;  4NXI A;  3QMX A;  5J9C A;  1T7P B;  3UBK A;  1VF4 A;  2DJ2 A;  1XPV A;  4POM A;  4XRA A;  4F82 A;  3LSZ A;  5HQP A;  2RUE A;  4IJ3 A;  1HD2 A;  4HU7 A;  4YH2 A;  4HEA 2;  2PU9 C;  2L5O A;  5A4U A;  1J08 A;  5EL8 A;  1PSQ A;  5D9W A;  2H19 A;  2C8U A;  3FZA A;  2H76 A;  1A2M A;  1O8X A;  2RII A;  4ECI A;  2FLS A;  1SKS B;  2HYX A;  3ZYW A;  3UAP A;  4BVX B;  4EVM A;  2FCH A;  1EV9 A;  3H1N A;  4P3Y B;  4ILF A;  1AQW A;  5ECK B;  2IFQ A;  4N30 A;  2R37 A;  3UOM A;  2F51 A;  2ON5 A;  4BL7 B;  4X1U A;  2CVD A;  5G1L A;  4ULX A;  4MK3 A;  2HT9 A;  5ABR A;  2R6K A;  2IMD A;  2JZT A;  1M2D A;  1EEM A;  2F8F A;  1AAZ A;  5J4U A;  3C73 A;  2IWT A;  1G7E A;  1EOG A;  2HZF A;  4ZB8 A;  1G6W A;  2H1B A;  4POK A;  5DAL B;  4Q5Q A;  1GTI A;  4PTS A;  4BIK A;  4BVY A;  3RHC A;  2YCD A;  4CY6 A;  3IAM 2;  4CDO A;  2H0H A;  5DQY A;  3ERG A;  3KIJ A;  2YPM A;  1A8L A;  2H01 A;  2LNT A;  3HXS A;  3MSZ A;  2J23 A;  2RUF A;  1SJZ A;  14GS A;  3PIN A;  3A3T A;  3R2Q A;  4F0B A;  5DJL A;  2FA4 A;  2RM5 A;  3A2X A;  5DQS A;  3GKM A;  2MMA A;  1A2L A;  4ZL9 A;  3LGC A;  2HRA A;  2O85 A;  1S3C A;  1GSS A;  4MZW A;  1WPI A;  2YJH A;  4HDE A;  2RM6 A;  2X49 A;  2V32 A;  5INY A;  3ISO A;  4E8E A;  3I9V 2;  5E4W A;  4XS1 A;  4XS4 A;  4Q5F A;  4EDY A;  5BRT A;  4PX1 A;  4NMU A;  2DJJ A;  1AC1 A;  2VOC A;  3D0Z A;  2G2Q A;  1N2A A;  3EPT A;  1K0D A;  1YJ6 A;  4O92 A;  3EWL A;  4HQS A;  2YV9 A;  1UVZ A;  1I5G A;  3FYG A;  5DVB A;  4KDU A;  3BCI A;  3RAZ A;  4I6X A;  3UMA A;  1TRU A;  3DWV A;  1SYX A;  3LYK A;  3IDV A;  3LEF A;  5CO3 A;  3KZQ A;  1XWG A;  2QGV A;  4CY8 A;  4D73 A;  3C1S A;  4G9H A;  3RPN A;  4GQC A;  1X5E A;  22GS A;  4N10 A;  2FWE A;  2PWJ A;  1QUW A;  3W8J A;  1BQ7 A;  1JZW A;  4WBR D;  13GS A;  5H5R A;  3BOA A;  1ZCP A;  4YAV A;  4KSM A;  2HSH A;  1DSB A;  2GDR A;  3LYP A;  3Q18 A;  2YJ7 A;  4FH8 A;  2NDO A;  3HD5 A;  2KOK A;  5CNW A;  4ZIJ A;  3W6G A;  2P5R A;  5KN0 A;  5HFI A;  3EIN A;  2BJX A;  1ST9 A;  2YWN A;  5DJM A;  5COH A;  1SKR B;  4WR4 A;  1EGR A;  5IOX A;  2PVQ A;  1F9M A;  4I97 A;  2FWF A;  4DSR A;  4HQZ A;  1K0B A;  1TRW A;  1QFN A;  3IC8 A;  4O5Q A;  5JWQ B;  1PN0 A;  1V9W A;  4IP1 A;  1GUK A;  2O7K A;  1KTE A;  4K9Z A;  2MMZ A;  1YEP A;  1B8X A;  3GFK A;  2R0C A;  2H0G A;  5D93 A;  3G7Y A;  4I5Q A;  1GUH A;  2XBI A;  3FEU A;  5DBQ A;  3ME7 A;  5DAK A;  6GSX A;  2OE1 A;  5IO2 A;  3ZIV A;  1EWX A;  2V2G A;  4F0C A;  3CQF A;  4X4J A;  1O81 A;  1X9S B;  1TK5 B;  2IJY A;  6GST A;  1RK4 A;  1EP7 A;  5LD0 A;  1TOF A;  4FYU A;  2A4H A;  2E2G A;  4RUV A;  3ED3 A;  6GSW A;  2OE0 A;  1O6J A;  2AUV A;  2ZUP A;  4TR1 B;  2HI7 A;  1QQ2 A;  2REM A;  4MMM A;  1VF1 A;  4PUF C;  1YF0 A;  1CQH A;  3SWL A;  2YN1 A;  2IMI A;  4K0N A;  3KM6 A;  2C1Y A;  2EIR A;  20GS A;  2LUS A;  5ECS A;  1M3J A;  2VD0 A;  2O8V B;  1GTU A;  3D5J A;  4AJ8 A;  1EP8 A;  4JR4 A;  2XBQ A;  1Z3E A;  2HXK A;  1O7U A;  1BJX A;  2TRC P;  3TOT A;  2DJ1 A;  2MZC A;  2JL4 A;  5J9B A;  4KB3 A;  4TXO B;  1XBS A;  3M0F A;  2OAD A;  1TXX A;  2WB9 A;  5D9V A;  4RI7 A;  3IR4 A;  1USB A;  2LRT A;  1PMT A;  4N0V A;  4IBP A;  2LNS A;  1OC9 B;  2CX3 A;  2CAI A;  5IMV A;  4QL9 A;  4KDY A;  1H4O A;  3NOF A;  3TJK A;  5IOW A;  1PRX A;  3UVH A;  1GH2 A;  5CRH A;  3CSJ A;  4G10 A;  3GN3 A;  3BBY A;  3TKP A;  4V2L A;  4YKF A;  5EPF A;  2YV7 A;  2H0I A;  3TUE A;  3ZVJ A;  4IKH A;  3ZFL A;  2GZZ A;  2DKH A;  5KN2 A;  3RBT A;  4ZIL A;  3NIV A;  4I8B A;  2RLI A;  3M9J A;  4F9Z A;  2JSZ A;  4BWS A;  2WUL A;  2B7J A;  2O89 A;  3GRX A;  3VPT A;  4K7I A;  4G0L A;  3IHQ A;  2B1L A;  1OKD A;  1PN9 A;  2VCT A;  4OFN A;  3L4N A;  1M0U A;  4MF5 A;  4YQM A;  3VPQ A;  4H86 A;  3M1G A;  3IA1 A;  3KH7 A;  3UEM A;  3H8Q A;  1Y25 A;  3RPP A;  5A4W A;  5KOW A;  3KP8 A;  3LQ7 A;  1VGL A;  2GT6 A;  1MTC A;  2CVK A;  4K2D A;  2B5X A;  3FRC A;  5JCU A;  4X0X A;  2V6O A;  5IMF A;  1FHE A;  1ZYP A;  5DCG A;  2YNX A;  4DSQ A;  4MF7 A;  4FYB A;  4ZBB A;  4KF9 A;  4LLR A;  3U5R E;  3KTB A;  5ECH B;  1BAY A;  1FVK A;  5IPG A;  1K0C A;  1ON4 A;  3APQ A;  4PNF A;  3VI7 A;  3P8W A;  4E8H A;  3E3E A;  5GST A;  1X9W B;  2GS3 A;  3TRX A;  5L71 A;  3A5I A;  2IN3 A;  3PH9 A;  2NPB A;  2YOI A;  5ECO B;  1GTB A;  1K0O A;  4JR6 A;  5H5Q A;  4GWR A;  2QC7 A;  2C4J A;  1MEK A;  1GLQ A;  4PQH A;  4HI7 A;  1V58 A;  3KCM A;  3FR6 A;  4WF4 A;  3AY8 A;  1TRV A;  2IPA A;  3IE3 A;  3LXT A;  1M7T A;  11GS A;  2MMO A;  4KH7 A;  4XIH A;  2VCW A;  3MAK A;  2B5E A;  2WCI A;  3EYT A;  2LQQ A;  1VF2 A;  4TXV A;  2CQ9 A;  4HJ2 A;  2YZU A;  3TOU A;  3W8S A;  2HZE A;  1TJD A;  1HYU A;  4GTU A;  4YQV A;  4BPY A;  5B8B A;  1SU9 A;  2HNL A;  6GSS A;  4K5S A;  3US3 A;  1Z7P A;  2L6C A;  3I6A A;  3G7J A;  4PQ1 A;  3MWH A;  2I3Y A;  1GUL A;  3IBH A;  3WGD A;  4OD7 A;  2IFQ B;  1ERU A;  2DJ0 A;  1TU7 A;  4TKY A;  3VWU A;  3I43 A;  3HCZ A;  1ZYN A;  1X5C A;  3VK9 A;  2FY6 A;  3F4T A;  3K8N A;  3IXR A;  1XOA A;  1ZYQ B;  1PL2 A;  3IAS 2;  3S9F A;  3ZVJ D;  3OR5 A;  1QGV A;  1XW9 A;  2CA8 A;  5J5N A;  2AHE A;  4GXZ A;  4MZC A;  1AUC A;  3C71 A;  1BX9 A;  3IHG A;  2IMF A;  2A2R A;  2WFC A;  2LV3 A;  2VCV A;  2IIY A;  2WRT A;  3F63 A;  3WYW A;  4BVY B;  1KBN A;  2PN8 A;  1KEB A;  3TKQ A;  3P7X A;  1OC8 A;  3TB2 A;  4HJM A;  1Q98 A;  2QKE A;  4EIP A;  4POL A;  5JCG A;  4K5R A;  2ZCT A;  2GZP A;  2IL3 A;  4AF2 A;  5FWG A;  4HZ4 A;  1U87 A;  4OMV A;  3ZTL A;  5B6M A;  1XWK A;  4EXJ A;  1ABA A;  2CT6 A;  4IW9 A;  3IK7 A;  1ERT A;  2H6X A;  3DGQ A;  1F3B A;  2M46 A;  1M9A A;  1PL1 A;  2KP1 A;  4JRR A;  3RHB A;  2C0E A;  2VL9 A;  2DML A;  3QPM A;  2K8V A;  4ML6 A;  3KP9 A;  2FNO A;  5IMZ A;  1SK0 A;  1SEN A;  2DKI A;  2LJR A;  3BJ5 A;  3EVI A;  1RQM A;  2X8G A;  1BYE A;  2R3X A;  3HHV A;  1Z7R A;  2X99 A;  2K9F A;  3QCP A;  3KH9 A;  4MH2 A;  4GF0 A;  3CYN A;  1NHY A;  1NSW A;  1M3I A;  5CYY A;  1JZD A;  7GSS A;  1XVW A;  4ACS A;  4KUN A;  2OAC A;  1PKZ A;  9GSS A;  2FD3 A;  2I9H A;  3TJJ A;  4JZQ A;  5ECR B;  4ECC A;  3D21 A;  1B48 A;  2H30 A;  2KLX A;  4K7N A;  1HNC A;  6GSY A;  5GZZ B;  2UZ8 A;  2H1A A;  2VM2 A;  5ID2 B;  5LNK e;  2D2Z A;  2VUP A;  4PNG A;  5AIS A;  3GX0 A;  1X0R A;  1YKA A;  1SK1 A;  3GIX A;  4D73 B;  4I2U A;  4HZ2 A;  1R26 A;  2HRF A;  5D96 A;  3CTG A;  1NW2 A;  2FA8 A;  5HR3 A;  2H1G A;  4AJ6 A;  2H66 A;  3GYK A;  4BA7 A;  1S3D A;  1XCC A;  2FWG A;  3QAV A;  4GCI A;  1Z9H A;  5D9T A;  3L9U A;  1ZGN A;  2V41 A;  3ZFB A;  1Z6N A;  4GSS A;  4LA1 A;  4PXO A;  4EUY A;  3O6T A;  1FB0 A;  4IS0 A;  1XW5 A;  2XC2 A;  4FO5 A;  1OAZ A;  3L9V A;  4OFT A;  4MDC A;  5HFG A;  1SL0 B;  4WEY A;  2JZR A;  3GV1 A;  2CZ2 A;  1GLP A;  1SD8 A;  2QA2 A;  2JSY A;  1PGT A;  2BTO T;  4I2T A;  4HS1 A;  1MD3 A;  1PD2 1;  1JLV A;  2ON7 A;  1T1V A;  1XZO A;  5CRW A;  4AJ7 A;  3KMN A;  3ZZX A;  5H5S A;  3C1R A;  2MMN A;  2GTU A;  3HVN A;  4WBJ A;  2VCX A;  1ML6 A;  4LL1 B;  4A5P A;  4HSC X;  3HVS A;  5HR2 A;  2C0D A;  4ZBA A;  4NHW A;  5G31 A;  1F37 A;  4MAB A;  2EIO A;  4ICY A;  4TR0 A;  3M8N A;  5C04 A;  2B6M A;  5G30 A;  3BCK A;  1TI3 A;  3BD2 A;  1T3B A;  3FKF A;  3HYP A;  4ZB9 A;  2V1M A;  3PGT A;  5ECP B;  2DC5 A;  3HVX A;  3TJF A;  1VRS D;  4YKG A;  2KUC A;  3A5W A;  1R4W A;  3PPU A;  3EMP A;  3UIW A;  2VM1 A;  1FG4 A;  2K8S A;  4XS6 A;  1O73 A;  2DBC A;  4G0I A;  3VWW A;  4L8E A;  4XRD A;  1TW9 A;  2N5B A;  2PUK C;  5FHI A;  1A0R P;  5KN1 A;  2KP2 A;  2BMX A;  5ENU A;  2G0F A;  1U3A A;  4YQU A;  4MZB A;  1MD4 A;  2V6K A;  3FW2 A;  2WJU A;  1WRY A;  1X9M B;  4V1A g;  4O5U A;  1CQG A;  3TKS C;  4XTS A;  1GWC A;  4BWQ A;  2OKA A;  1ZZY A;  2Z9S A;  2HFD A;  4J57 E;  1QXH A;  4ZBD A;  5F0G A;  3GUS A;  2LRN A;  2N5F A;  4CW9 A;  1A23 A;  2HSM A;  8GSS A;  4KAE A;  1O85 A;  1PX7 A;  4RQX A;  4JED A;  3DML A;  5KEJ A;  3GL5 A;  2OE3 A;  2PPT A;  4WET A;  2YWI A;  4K7O A;  2L5L A;  4KCE A;  1S3R A;  4ECJ A;  3TRQ A;  4PUR A;  2PER A;  1GUM A;  3EE2 A;  3H4K A;  2CZ3 A;  3Q19 A;  1OE7 A;  4HUA A;  4IGJ A;  3EMX A;  4TR4 A;  1YY7 A;  4KE3 A;  1T8E B;  4N0Z A;  6GSU A;  1UC7 A;  2OBK A;  1B4P A;  3ERF A;  4L0W A;  5G2Z A;  4POB A;  1AQV A;  3MIX A;  1RW1 A;  5ECL B;  4DSS A;  1ZMA A;  3F8U A;  1V57 A;  2TRX A;  2C3Q A;  2YWO A;  3H93 A;  2DMM A;  3SBC A;  1T4Z A;  3CXG A;  3E0U A;  4XCS A;  3APO A;  4LMV A;  3IOS A;  2A4V A;  3D6I A;  3KXO A;  3QAW A;  2K6V A;  3FZ9 A;  3UJ1 A;  4TXO A;  5IMA A;  3Q74 A;  3IV4 A;  4TW5 A;  1XVQ A;  5CP1 A;  1M2B A;  1A0F A;  5JCW A;  5HFK A;  3DYR A;  4GLT A;  4WR5 A;  4RI6 A;  2GSQ A;  1G7O A;  1R7H A;  3GKN A;  2YZH A;  5BMU A;  1R5P A;  3KMO A;  1MDJ A;  2B7K A;  3GTU A;  4G19 A;  3HJO A;  1SKW B;  1K3L A;  2PBJ A;  5CRD A;  4IQ1 A;  3DVX A;  2MBT A;  5E59 A;  3LWA A;  3FZ4 A;  1DBY A;  3D4M A;  3VLN A;  2H74 A;  2FHE A;  3GA4 A;  4MJC A;  1FO5 A;  2LKU A;  3F0I A;  2LQO A;  4KGI A;  5ELG A;  1FOH A;  4GQF A;  1K3Y A;  1THO A;  4EO3 A;  4V1A p;  2NVL A;  1URM A;  2L4C A;  3LFL A;  1GNE A;  3P2A A;  4ZXG A;  2LJA A;  1WE0 A;  2M72 A;  2XPE A;  3VWV A;  3EUR A;  4MF6 A;  4EKZ A;  4WXT A;  3GKK A;  16GS A;  1HQO A;  4NV2 A;  1V2A A;  1GNW A;  4RQR A;  4TOP A;  4Z2T A;  3GST A;  5AGY A;  2AB6 A;  5ELA A;  4IQA A;  3DRN A;  5JWR B;  1DE2 A;  5D73 A;  5B7C A;  3LOR A;  1G6Y A;  2P5Q A;  3MDK A;  3JCM L;  4GST A;  5F05 A;  3I69 A;  3KTL A;  2EIQ A;  3O3T A;  4IJI A;  3KGK A;  12GS A;  3IPZ A;  3TJB A;  1V98 A;  3GSS A;  3A2W A;  2HZE B;  1GP1 A;  1TTZ A;  1QK8 A;  2AAW A;  1TK8 B;  5IQY A;  2GQM A;  2B3S A;  2VCZ A;  1IYH A;  5G5E A;  5HR1 A;  1DUG A;  5D9X A;  1IYI A;  3TRP A;  1K0N A;  4QQ7 A;  3QR6 A;  2YWM A;  4KSO A;  1NHO A;  3DEX A;  2OA7 A;  4OO4 A;  1ILO A;  1EV4 A;  4KND A;  3GUR A;  4PGT A;  3HA9 A;  3TKS A;  1SL1 B;  5AN1 A;  10GS A;  4KCA A;  3IRA A;  4JE1 A;  5G1K A;  2LRC A;  3WGE A;  2R0P A;  4MLY A;  1PFO A;  5DCH A;  4KX4 A;  3N5O A;  4MP4 A;  1YDK A;  1H75 A;  3J7Y b;  1YF1 A;  4F2I A;  1TU8 A;  2VAF A;  3A2V A;  3ZRD A;  1W89 A;  4O5R A;  4O7H A;  4EDZ A;  1SK2 A;  2A2P A;  2AV4 A;  4OCF A;  4NHZ A;  1F2E A;  1R5A A;  4YAP A;  2HRK A;  4MJA A;  1AW9 A;  2E2M A;  5LCZ A;  4JBB A;  3TKR A;  5CRE A;  3FMW A;  1OC3 A;  2VL2 C;  1ERW A;  3UL3 A;  3UAR A;  2VIM A;  3HJM A;  1W4V A;  1ERV A;  3LW9 A;  1T4Y A;  2L6D A;  2I1U A;  4N11 A;  3TDG A;  4F03 A;  4MPF A;  4TRX A;  4Q5N A;  4GSN A;  1THX A;  3G9B A;  4DVC A;  2O87 A;  2JAC A;  2LS5 A;  3DIE A;  1FVJ A;  5F07 A;  2FUG 2;  5IMD A;  3QAG A;  4OFM A;  5F06 A;  5IIZ A;  2VO4 A;  1XG8 A;  1JZR A;  1TK0 B;  4BVX A;  4DEJ A;  4XHM A;  3CSI A;  4CHS A;  1GSD A;  2FGX A;  4MNN A;  1HNB A;  3MYD A;  3G7I A;  1XWA A;  1EEJ A;  3D4T A;  4HOJ A;  4BL7 A;  4FQU A;  3FY7 A;  2LTK A;  2H8L A;  3HZ4 A;  2PGT A;  1AIU A;  3TKS E;  1O8W A;  2GGT A;  3APS A;  5AIX A;  4XS4 B;  2JAD A;  3DKS A;  2WZ9 A;  1EZK A;  5IPH A;  3HJP A;  3QFA C;  3GKX A;  5DAL A;  1UA5 A;  3FR9 A;  5C00 A;  1PX6 A;  3C7M A;  4NWY A;  5FT3 A;  2OJL A;  1JLW A;  2ALB A;  1NM3 A;  2H6Y A;  5ECN B;  1C72 A;  4TR3 A;  1SL2 B;  3O76 A;  1WJK A;  3ERW A;  1BED A;  4PUA A;  1ACV A;  3HZ8 A;  1LBK A;  2QSI A;  3H79 A;  3V1W A;  3QOU A;  2E0Q A;  1TI1 A;  4PQI A;  4K1F A;  1XW6 A;  1LJR A;  2LEG A;  5B8A A;  1PQN A;  3FHK A;  3DVW A;  4HU9 A;  2IME A;  1TDI A;  1Z5Y E;  5IMC A;  1WOU A;  2VLU A;  4TN8 A;  1GRX A;  5ID2 A;  2DLX A;  1WWJ A;  5J3R A;  2ZNM A;  3WT2 A;  3LXZ A;  2R2J A;  1GSU A;  2X8H A;  4L5O A;  2GSR A;  3CTF A;  2GQL A;  1F6M C;  4K2X A;  4G0K A;  2KHP A;  4USS A;  1FAA A;  5DDL A;  2GSS A;  3E9J B;  1XIY A;  2GVP A;  3GNJ A;  3CRT A;  3GH9 A;  4V2N A;  3L78 A;  3F4R A;  5DAK B;  2DJ3 A;  4EC0 A;  1B9X C;  1GSQ A;  1M2A A;  4ZL7 A;  5AIV A;  3VI5 A;  5EVO A;  3DD3 A;  2NTO A;  4JU5 A;  5ECI B;  2C3T A;  3DXB A;  4WF5 A;  4Z2U A;  2P31 A;  5IO0 A;  1WIK A;  4NPB A;  4O32 A;  5J41 A;  1YEX A;  3FR3 A;  4KDX A;  4K8M A;  2TIR A;  5ECQ B;  2H70 A;  4GRF A;  1J9B A;  2GZY A;  1A2J A;  4IHU A;  3Q6O A;  2R0G A;  3ZML A;  1OYJ A;  2C0G A;  4MCU A;  1FB6 A;  2P0G A;  4AGS A;  1XFL A;  4ISD A;  3F6F A;  5A4V A;  1I9D A;  3N9J A;  3L0H A;  1G0T A;  3WGX A;  2I4A A;  3RDW A;  2X64 A;  2LJK A;  2WDU A;  4ML1 A;  3IC4 A;  3L9S A;  1A24 A;  4TVE A;  5HR0 A;  2GST A;  2VLT A;  2VL2 A;  2YAN A;  4IP6 A;  5JWO B;  1U88 A;  2F3M A;  2JZS A;  3GH6 A;  1Y6E A;  3ZLP A;  4MJB A;  3EU4 A;  2WGR A;  5KN3 A;  1DE1 A;  1FW1 A;  3F9U A;  1KNG A;  1M9B A;  1ZYE A;  2H6Z A;  5G5F A;  2VL3 A;  3LG6 A;  1F3A A;  2L57 A;  2F9S A;  1YQ1 A;  1HNA A;  1K0A A;  4IVF A;  4LMW A;  3TGZ A;  6GSV A;  1PKW A;  4FIW A;  2C80 A;  4DSS B;  2OBI A;  1AQX A;  4NAX A;  2QA1 A;  1Z6M A;  2XPD A;  4MA9 A;  1EOH A;  4V2M A;  3ZIJ A;  1A8Y A;  1OVN A;  3WD6 A;  2A2S A;  3CMI A;  5B6N A;  2VLV A;  4TR1 A;  5GAN D;  2CX4 A;  2PVO C;  1JFU A;  2ES7 A;  3ME8 A;  5D8I A;  4Z2R A;  3HVV A;  3FK8 A;  3GL3 A;  4EF0 A;  1B9Y C;  4OWY A;  2HE3 A;  2CV4 A;  3CRU A;  2N5A A;  1PA3 A;  4KA0 A;  1XWB A; 
#chains in the Genus database with same CATH homology
 2YP6 A;  1GL8 A;  3F6D A;  2CVB A;  3GTU B;  2DIY A;  2CAQ A;  4K6X A;  1LU4 A;  4LL4 B;  1QMV A;  1K3O A;  1N8J A;  2VCQ A;  2MBS A;  17GS A;  2VD1 A;  4J2F A;  4WKW A;  3GHA A;  1U6T A;  2PMT A;  1K0M A;  1J0F A;  4Z7X A;  2EC4 A;  3F3R A;  1JZO A;  3NZN A;  1YKC A;  3C8E A;  3GX8 A;  3CBU A;  1V40 A;  3J7Y k;  4ZL8 A;  3M9K A;  1GTA A;  4MJE A;  1SYR A;  3PR8 A;  2C0F A;  1OC9 A;  5KOX A;  1VF3 A;  2AYT A;  3LJR A;  4ID0 A;  3KEB A;  1EGO A;  3F4S A;  4X43 A;  3VFI A;  2NBS A;  1SD9 A;  1XWC A;  2M80 A;  5ECM B;  1M99 A;  4K0G A;  1Q4J A;  5A5K A;  1WMJ A;  3IK9 A;  1TRS A;  1B4Q A;  2JU5 A;  4EIQ A;  1GSE A;  4KW6 A;  3KJY A;  2DSA A;  18GS A;  4L5L A;  1E6B A;  2LST A;  4EL1 A;  3HKR A;  3UBL A;  2L4Q A;  3M3M A;  1SJI A;  3QFB C;  5CAX A;  2H1D A;  3VUR A;  2DJK A;  4FYC A;  1TKD B;  4MH3 A;  2MYG A;  1JHB A;  1OKT A;  1XXU A;  4EE0 A;  4J56 E;  4Q5R A;  3ZIT A;  1WP0 A;  3QD9 A;  1TP9 A;  1GSF A;  3D22 A;  3ZRE A;  2FWH A;  2E7P A;  3MNG A;  3HY2 A;  1FOV A;  1MDI A;  3ZL5 A;  3TJG A;  4G2E A;  4MPG A;  2I81 A;  2H71 A;  2R5G A;  3QDN A;  2DIZ A;  5GAP D;  2H75 A;  1S3A A;  3VWX A;  3CSH A;  2GQK A;  4OCE A;  1AXD A;  1E2Y A;  1GSY A;  1SJ6 A;  1YZX A;  2HRN A;  3KD0 A;  2GLR A;  1ZOF A;  1BG5 A;  4QL7 A;  2WS2 A;  3EC3 A;  19GS A;  1U3I A;  2C3N A;  2IMK A;  2HLS A;  3EU3 A;  2B5Y A;  1T00 A;  3TCO A;  5EY6 A;  2X4A A;  5F8B A;  4IN0 A;  5CRG A;  2XHF A;  1X5D A;  2B1K A;  3P90 A;  2F8A A;  4ECB A;  2J9H A;  2GT5 A;  3WT1 A;  1ZL9 A;  3HDC A;  2H73 A;  1XOB A;  2X8C A;  1MDK A;  3R3E A;  4ZB6 A;  2AJQ B;  5IM9 A;  2K18 A;  2L59 A;  4IEL A;  3GMF A;  3FZ5 A;  2H72 A;  3F3Q A;  2HSY A;  4NV5 A;  3UVT A;  1OE8 A;  3ZMK A;  4L0U A;  4OO5 A;  3U6V A;  5GSS A;  2R4V A;  1UN2 A;  4NXI A;  3QMX A;  5J9C A;  1T7P B;  3UBK A;  1VF4 A;  2DJ2 A;  1XPV A;  4POM A;  4XRA A;  4F82 A;  3LSZ A;  5HQP A;  2RUE A;  4IJ3 A;  1HD2 A;  4HU7 A;  4YH2 A;  4HEA 2;  2PU9 C;  2L5O A;  5A4U A;  1J08 A;  5EL8 A;  1PSQ A;  5D9W A;  2H19 A;  2C8U A;  3FZA A;  2H76 A;  1A2M A;  1O8X A;  2RII A;  4ECI A;  2FLS A;  1SKS B;  2HYX A;  3ZYW A;  3UAP A;  4BVX B;  4EVM A;  2FCH A;  1EV9 A;  3H1N A;  4P3Y B;  4ILF A;  1AQW A;  5ECK B;  2IFQ A;  4N30 A;  2R37 A;  3UOM A;  2F51 A;  2ON5 A;  4BL7 B;  4X1U A;  2CVD A;  5G1L A;  4ULX A;  4MK3 A;  2HT9 A;  5ABR A;  2R6K A;  2IMD A;  2JZT A;  1M2D A;  1EEM A;  2F8F A;  1AAZ A;  5J4U A;  3C73 A;  2IWT A;  1G7E A;  1EOG A;  2HZF A;  4ZB8 A;  1G6W A;  2H1B A;  4POK A;  5DAL B;  4Q5Q A;  1GTI A;  4PTS A;  4BVY A;  3RHC A;  2YCD A;  4CY6 A;  3IAM 2;  4CDO A;  2H0H A;  5DQY A;  3ERG A;  3KIJ A;  2YPM A;  1A8L A;  2H01 A;  2LNT A;  3HXS A;  3MSZ A;  2J23 A;  2RUF A;  1SJZ A;  14GS A;  3PIN A;  3A3T A;  3R2Q A;  4F0B A;  5DJL A;  2FA4 A;  2RM5 A;  3A2X A;  5DQS A;  3GKM A;  2MMA A;  1A2L A;  4ZL9 A;  3LGC A;  2HRA A;  2O85 A;  1S3C A;  1GSS A;  4MZW A;  1WPI A;  2YJH A;  4HDE A;  2RM6 A;  2X49 A;  2V32 A;  5INY A;  3ISO A;  4E8E A;  3I9V 2;  5E4W A;  4XS1 A;  4XS4 A;  4Q5F A;  4EDY A;  5BRT A;  4PX1 A;  4NMU A;  2DJJ A;  1AC1 A;  2VOC A;  3D0Z A;  2G2Q A;  1N2A A;  3EPT A;  1K0D A;  1YJ6 A;  4O92 A;  3EWL A;  4HQS A;  2YV9 A;  1UVZ A;  1I5G A;  3FYG A;  5DVB A;  4KDU A;  3BCI A;  3RAZ A;  4I6X A;  3UMA A;  1TRU A;  3DWV A;  1SYX A;  3LYK A;  3IDV A;  3LEF A;  5CO3 A;  3KZQ A;  1XWG A;  2QGV A;  4CY8 A;  4D73 A;  3C1S A;  4G9H A;  3RPN A;  4GQC A;  1X5E A;  22GS A;  4N10 A;  2FWE A;  2PWJ A;  1QUW A;  3W8J A;  1BQ7 A;  1JZW A;  4WBR D;  13GS A;  5H5R A;  3BOA A;  1ZCP A;  4YAV A;  4KSM A;  2HSH A;  1DSB A;  2GDR A;  3LYP A;  3Q18 A;  2YJ7 A;  4FH8 A;  2NDO A;  3HD5 A;  2KOK A;  5CNW A;  4ZIJ A;  3W6G A;  2P5R A;  5KN0 A;  5HFI A;  3EIN A;  2BJX A;  1ST9 A;  2YWN A;  5DJM A;  5COH A;  1SKR B;  4WR4 A;  1EGR A;  5IOX A;  2PVQ A;  1F9M A;  4I97 A;  2FWF A;  4DSR A;  4HQZ A;  1K0B A;  1TRW A;  1QFN A;  3IC8 A;  4O5Q A;  5JWQ B;  1PN0 A;  1V9W A;  4IP1 A;  1GUK A;  2O7K A;  1KTE A;  4K9Z A;  2MMZ A;  1YEP A;  1B8X A;  3GFK A;  2R0C A;  2H0G A;  5D93 A;  3G7Y A;  4I5Q A;  1GUH A;  2XBI A;  3FEU A;  5DBQ A;  3ME7 A;  5DAK A;  6GSX A;  2OE1 A;  5IO2 A;  3ZIV A;  1EWX A;  2V2G A;  4F0C A;  4X4J A;  1O81 A;  1X9S B;  1TK5 B;  2IJY A;  6GST A;  1RK4 A;  1EP7 A;  5LD0 A;  1TOF A;  4FYU A;  2A4H A;  2E2G A;  4RUV A;  3ED3 A;  6GSW A;  2OE0 A;  1O6J A;  2AUV A;  2ZUP A;  4TR1 B;  2HI7 A;  1QQ2 A;  2REM A;  4MMM A;  1VF1 A;  4PUF C;  1YF0 A;  1CQH A;  3SWL A;  2YN1 A;  2IMI A;  4K0N A;  3KM6 A;  2C1Y A;  2EIR A;  20GS A;  2LUS A;  5ECS A;  2VD0 A;  2O8V B;  1GTU A;  3D5J A;  4AJ8 A;  1EP8 A;  4JR4 A;  2XBQ A;  1Z3E A;  2HXK A;  1O7U A;  1BJX A;  2TRC P;  3TOT A;  2DJ1 A;  2MZC A;  2JL4 A;  5J9B A;  4KB3 A;  4TXO B;  1XBS A;  3M0F A;  2OAD A;  1TXX A;  2WB9 A;  5D9V A;  4RI7 A;  3IR4 A;  1USB A;  2LRT A;  1PMT A;  4N0V A;  4IBP A;  2LNS A;  1OC9 B;  2CX3 A;  2CAI A;  5IMV A;  4QL9 A;  4KDY A;  1H4O A;  3NOF A;  3TJK A;  5IOW A;  1PRX A;  3UVH A;  1GH2 A;  5CRH A;  3CSJ A;  4G10 A;  3GN3 A;  3BBY A;  3TKP A;  4V2L A;  4YKF A;  5EPF A;  2YV7 A;  2H0I A;  3TUE A;  3ZVJ A;  4IKH A;  3ZFL A;  2GZZ A;  2DKH A;  5KN2 A;  3RBT A;  4ZIL A;  3NIV A;  4I8B A;  2RLI A;  3M9J A;  4F9Z A;  2JSZ A;  4BWS A;  2WUL A;  2B7J A;  2O89 A;  3GRX A;  3VPT A;  4K7I A;  4G0L A;  3IHQ A;  2B1L A;  1OKD A;  1PN9 A;  2VCT A;  4OFN A;  3L4N A;  1M0U A;  4MF5 A;  4YQM A;  3VPQ A;  4H86 A;  3M1G A;  3IA1 A;  3KH7 A;  3UEM A;  3H8Q A;  1Y25 A;  3RPP A;  5A4W A;  5KOW A;  3KP8 A;  3LQ7 A;  1VGL A;  2GT6 A;  1MTC A;  2CVK A;  4K2D A;  2B5X A;  3FRC A;  5JCU A;  4X0X A;  2V6O A;  5IMF A;  1FHE A;  1ZYP A;  5DCG A;  2YNX A;  4DSQ A;  4MF7 A;  4FYB A;  4ZBB A;  4KF9 A;  4LLR A;  3U5R E;  3KTB A;  5ECH B;  1BAY A;  1FVK A;  5IPG A;  1K0C A;  1ON4 A;  3APQ A;  4PNF A;  3VI7 A;  3P8W A;  4E8H A;  3E3E A;  5GST A;  1X9W B;  2GS3 A;  3TRX A;  5L71 A;  3A5I A;  2IN3 A;  3PH9 A;  2NPB A;  2YOI A;  5ECO B;  1GTB A;  1K0O A;  4JR6 A;  5H5Q A;  4GWR A;  2QC7 A;  2C4J A;  1MEK A;  1GLQ A;  4PQH A;  4HI7 A;  1V58 A;  3KCM A;  3FR6 A;  4WF4 A;  3AY8 A;  1TRV A;  2IPA A;  3IE3 A;  3LXT A;  1M7T A;  11GS A;  2MMO A;  4KH7 A;  4XIH A;  2VCW A;  3MAK A;  2B5E A;  2WCI A;  3EYT A;  2LQQ A;  1VF2 A;  4TXV A;  2CQ9 A;  4HJ2 A;  2YZU A;  3TOU A;  3W8S A;  2HZE A;  1TJD A;  1HYU A;  4GTU A;  4YQV A;  4BPY A;  5B8B A;  1SU9 A;  2HNL A;  6GSS A;  4K5S A;  3US3 A;  1Z7P A;  2L6C A;  3I6A A;  3G7J A;  4PQ1 A;  3MWH A;  2I3Y A;  1GUL A;  3IBH A;  3WGD A;  4OD7 A;  2IFQ B;  1ERU A;  2DJ0 A;  1TU7 A;  4TKY A;  3VWU A;  3I43 A;  3HCZ A;  1ZYN A;  1X5C A;  3VK9 A;  2FY6 A;  3F4T A;  3K8N A;  3IXR A;  1XOA A;  1ZYQ B;  1PL2 A;  3IAS 2;  3S9F A;  3ZVJ D;  3OR5 A;  1QGV A;  1XW9 A;  2CA8 A;  5J5N A;  2AHE A;  4GXZ A;  4MZC A;  1AUC A;  3C71 A;  1BX9 A;  3IHG A;  2IMF A;  2A2R A;  2WFC A;  2LV3 A;  2VCV A;  2IIY A;  2WRT A;  3F63 A;  3WYW A;  4BVY B;  1KBN A;  2PN8 A;  1KEB A;  3TKQ A;  3P7X A;  1OC8 A;  3TB2 A;  4HJM A;  1Q98 A;  2QKE A;  4EIP A;  4POL A;  5JCG A;  4K5R A;  2ZCT A;  2GZP A;  2IL3 A;  4AF2 A;  5FWG A;  4HZ4 A;  1U87 A;  4OMV A;  3ZTL A;  5B6M A;  1XWK A;  4EXJ A;  1ABA A;  2CT6 A;  4IW9 A;  3IK7 A;  1ERT A;  2H6X A;  3DGQ A;  1F3B A;  2M46 A;  1M9A A;  1PL1 A;  2KP1 A;  4JRR A;  3RHB A;  2C0E A;  2VL9 A;  2DML A;  3QPM A;  2K8V A;  4ML6 A;  3KP9 A;  2FNO A;  5IMZ A;  1SK0 A;  1SEN A;  2DKI A;  2LJR A;  3BJ5 A;  3EVI A;  1RQM A;  2X8G A;  1BYE A;  2R3X A;  3HHV A;  1Z7R A;  2X99 A;  2K9F A;  3QCP A;  3KH9 A;  4MH2 A;  4GF0 A;  3CYN A;  1NHY A;  1NSW A;  5CYY A;  1JZD A;  7GSS A;  1XVW A;  4ACS A;  4KUN A;  2OAC A;  1PKZ A;  9GSS A;  2FD3 A;  2I9H A;  3TJJ A;  4JZQ A;  5ECR B;  4ECC A;  3D21 A;  1B48 A;  2H30 A;  2KLX A;  4K7N A;  1HNC A;  6GSY A;  5GZZ B;  2UZ8 A;  2H1A A;  2VM2 A;  5ID2 B;  5LNK e;  2D2Z A;  2VUP A;  4PNG A;  5AIS A;  3GX0 A;  1X0R A;  1YKA A;  1SK1 A;  3GIX A;  4D73 B;  4I2U A;  4HZ2 A;  1R26 A;  2HRF A;  5D96 A;  3CTG A;  1NW2 A;  2FA8 A;  5HR3 A;  2H1G A;  4AJ6 A;  2H66 A;  3GYK A;  4BA7 A;  1S3D A;  1XCC A;  2FWG A;  3QAV A;  4GCI A;  1Z9H A;  5D9T A;  3L9U A;  1ZGN A;  2V41 A;  3ZFB A;  1Z6N A;  4GSS A;  4LA1 A;  4PXO A;  4EUY A;  3O6T A;  1FB0 A;  4IS0 A;  1XW5 A;  2XC2 A;  4FO5 A;  1OAZ A;  3L9V A;  4OFT A;  4MDC A;  5HFG A;  1SL0 B;  4WEY A;  2JZR A;  3GV1 A;  2CZ2 A;  1GLP A;  1SD8 A;  2QA2 A;  2JSY A;  1PGT A;  2BTO T;  4I2T A;  4HS1 A;  1MD3 A;  1PD2 1;  1JLV A;  2ON7 A;  1T1V A;  1XZO A;  5CRW A;  4AJ7 A;  3KMN A;  3ZZX A;  5H5S A;  3C1R A;  2MMN A;  2GTU A;  4WBJ A;  2VCX A;  1ML6 A;  4LL1 B;  4A5P A;  3HVS A;  5HR2 A;  2C0D A;  4ZBA A;  4NHW A;  5G31 A;  1F37 A;  4MAB A;  2EIO A;  4ICY A;  4TR0 A;  3M8N A;  5C04 A;  2B6M A;  5G30 A;  3BCK A;  1TI3 A;  3BD2 A;  1T3B A;  3FKF A;  3HYP A;  4ZB9 A;  2V1M A;  3PGT A;  5ECP B;  2DC5 A;  3HVX A;  3TJF A;  1VRS D;  4YKG A;  2KUC A;  3A5W A;  1R4W A;  3PPU A;  3EMP A;  3UIW A;  2VM1 A;  1FG4 A;  2K8S A;  4XS6 A;  1O73 A;  2DBC A;  4G0I A;  3VWW A;  4L8E A;  4XRD A;  1TW9 A;  2N5B A;  2PUK C;  5FHI A;  1A0R P;  5KN1 A;  2KP2 A;  2BMX A;  5ENU A;  2G0F A;  1U3A A;  4YQU A;  4MZB A;  1MD4 A;  2V6K A;  3FW2 A;  2WJU A;  1WRY A;  1X9M B;  4V1A g;  4O5U A;  1CQG A;  3TKS C;  4XTS A;  1GWC A;  4BWQ A;  2OKA A;  1ZZY A;  2Z9S A;  2HFD A;  4J57 E;  1QXH A;  4ZBD A;  5F0G A;  3GUS A;  2LRN A;  2N5F A;  4CW9 A;  1A23 A;  2HSM A;  8GSS A;  4KAE A;  1O85 A;  1PX7 A;  4RQX A;  4JED A;  3DML A;  5KEJ A;  3GL5 A;  2OE3 A;  2PPT A;  4WET A;  2YWI A;  4K7O A;  2L5L A;  4KCE A;  4ECJ A;  3TRQ A;  4PUR A;  2PER A;  1GUM A;  3EE2 A;  3H4K A;  2CZ3 A;  3Q19 A;  1OE7 A;  4HUA A;  4IGJ A;  3EMX A;  4TR4 A;  1YY7 A;  4KE3 A;  1T8E B;  4N0Z A;  6GSU A;  1UC7 A;  2OBK A;  1B4P A;  3ERF A;  4L0W A;  5G2Z A;  4POB A;  1AQV A;  3MIX A;  1RW1 A;  5ECL B;  4DSS A;  1ZMA A;  3F8U A;  1V57 A;  2TRX A;  2C3Q A;  2YWO A;  3H93 A;  2DMM A;  3SBC A;  1T4Z A;  3CXG A;  3E0U A;  4XCS A;  3APO A;  4LMV A;  3IOS A;  2A4V A;  3D6I A;  3KXO A;  3QAW A;  2K6V A;  3FZ9 A;  3UJ1 A;  4TXO A;  5IMA A;  3Q74 A;  3IV4 A;  4TW5 A;  1XVQ A;  5CP1 A;  1M2B A;  1A0F A;  5JCW A;  5HFK A;  3DYR A;  4GLT A;  4WR5 A;  4RI6 A;  2GSQ A;  1G7O A;  1R7H A;  3GKN A;  2YZH A;  5BMU A;  1R5P A;  3KMO A;  1MDJ A;  2B7K A;  3GTU A;  4G19 A;  3HJO A;  1SKW B;  1K3L A;  2PBJ A;  5CRD A;  4IQ1 A;  3DVX A;  2MBT A;  5E59 A;  3LWA A;  3FZ4 A;  1DBY A;  3D4M A;  3VLN A;  2H74 A;  2FHE A;  3GA4 A;  4MJC A;  1FO5 A;  2LKU A;  3F0I A;  2LQO A;  4KGI A;  5ELG A;  1FOH A;  4GQF A;  1K3Y A;  1THO A;  4EO3 A;  4V1A p;  2NVL A;  1URM A;  2L4C A;  3LFL A;  1GNE A;  3P2A A;  4ZXG A;  2LJA A;  1WE0 A;  2M72 A;  2XPE A;  3VWV A;  3EUR A;  4MF6 A;  4EKZ A;  4WXT A;  3GKK A;  16GS A;  1HQO A;  4NV2 A;  1V2A A;  1GNW A;  4RQR A;  4TOP A;  4Z2T A;  3GST A;  5AGY A;  2AB6 A;  5ELA A;  4IQA A;  3DRN A;  5JWR B;  1DE2 A;  5D73 A;  5B7C A;  3LOR A;  1G6Y A;  2P5Q A;  3MDK A;  3JCM L;  4GST A;  5F05 A;  3I69 A;  3KTL A;  2EIQ A;  3O3T A;  4IJI A;  3KGK A;  12GS A;  3IPZ A;  3TJB A;  1V98 A;  3GSS A;  3A2W A;  2HZE B;  1GP1 A;  1TTZ A;  1QK8 A;  2AAW A;  1TK8 B;  5IQY A;  2GQM A;  2B3S A;  2VCZ A;  1IYH A;  5G5E A;  5HR1 A;  1DUG A;  5D9X A;  1IYI A;  3TRP A;  1K0N A;  4QQ7 A;  3QR6 A;  2YWM A;  4KSO A;  1NHO A;  3DEX A;  2OA7 A;  4OO4 A;  1ILO A;  1EV4 A;  4KND A;  3GUR A;  4PGT A;  3HA9 A;  3TKS A;  1SL1 B;  5AN1 A;  10GS A;  4KCA A;  3IRA A;  4JE1 A;  5G1K A;  2LRC A;  3WGE A;  2R0P A;  4MLY A;  5DCH A;  4KX4 A;  3N5O A;  4MP4 A;  1YDK A;  1H75 A;  3J7Y b;  1YF1 A;  4F2I A;  1TU8 A;  2VAF A;  3A2V A;  3ZRD A;  1W89 A;  4O5R A;  4O7H A;  4EDZ A;  1SK2 A;  2A2P A;  2AV4 A;  4OCF A;  4NHZ A;  1F2E A;  1R5A A;  4YAP A;  2HRK A;  4MJA A;  1AW9 A;  2E2M A;  5LCZ A;  4JBB A;  3TKR A;  5CRE A;  3FMW A;  1OC3 A;  2VL2 C;  1ERW A;  3UL3 A;  3UAR A;  2VIM A;  3HJM A;  1W4V A;  1ERV A;  3LW9 A;  1T4Y A;  2L6D A;  2I1U A;  4N11 A;  3TDG A;  4F03 A;  4MPF A;  4TRX A;  4Q5N A;  4GSN A;  1THX A;  3G9B A;  4DVC A;  2O87 A;  2JAC A;  2LS5 A;  3DIE A;  1FVJ A;  5F07 A;  2FUG 2;  5IMD A;  3QAG A;  4OFM A;  5F06 A;  5IIZ A;  2VO4 A;  1JZR A;  1TK0 B;  4BVX A;  4DEJ A;  4XHM A;  3CSI A;  4CHS A;  1GSD A;  2FGX A;  4MNN A;  1HNB A;  3MYD A;  3G7I A;  1XWA A;  1EEJ A;  3D4T A;  4HOJ A;  4BL7 A;  4FQU A;  3FY7 A;  2LTK A;  2H8L A;  3HZ4 A;  2PGT A;  1AIU A;  3TKS E;  1O8W A;  2GGT A;  3APS A;  5AIX A;  4XS4 B;  2JAD A;  3DKS A;  2WZ9 A;  1EZK A;  5IPH A;  3HJP A;  3QFA C;  3GKX A;  5DAL A;  1UA5 A;  3FR9 A;  5C00 A;  1PX6 A;  3C7M A;  4NWY A;  5FT3 A;  2OJL A;  1JLW A;  2ALB A;  1NM3 A;  2H6Y A;  5ECN B;  1C72 A;  4TR3 A;  1SL2 B;  3O76 A;  1WJK A;  3ERW A;  1BED A;  4PUA A;  1ACV A;  3HZ8 A;  1LBK A;  2QSI A;  3H79 A;  3V1W A;  3QOU A;  2E0Q A;  1TI1 A;  4PQI A;  4K1F A;  1XW6 A;  1LJR A;  2LEG A;  5B8A A;  1PQN A;  3FHK A;  3DVW A;  4HU9 A;  2IME A;  1TDI A;  1Z5Y E;  5IMC A;  1WOU A;  2VLU A;  4TN8 A;  1GRX A;  5ID2 A;  2DLX A;  1WWJ A;  5J3R A;  2ZNM A;  3WT2 A;  3LXZ A;  2R2J A;  1GSU A;  2X8H A;  4L5O A;  2GSR A;  3CTF A;  2GQL A;  1F6M C;  4K2X A;  4G0K A;  2KHP A;  4USS A;  1FAA A;  5DDL A;  2GSS A;  3E9J B;  1XIY A;  2GVP A;  3GNJ A;  3CRT A;  3GH9 A;  4V2N A;  3L78 A;  3F4R A;  5DAK B;  2DJ3 A;  4EC0 A;  1B9X C;  1GSQ A;  1M2A A;  4ZL7 A;  5AIV A;  3VI5 A;  5EVO A;  3DD3 A;  2NTO A;  4JU5 A;  5ECI B;  2C3T A;  3DXB A;  4WF5 A;  4Z2U A;  2P31 A;  5IO0 A;  1WIK A;  4NPB A;  4O32 A;  5J41 A;  1YEX A;  3FR3 A;  4KDX A;  4K8M A;  2TIR A;  5ECQ B;  2H70 A;  4GRF A;  1J9B A;  2GZY A;  1A2J A;  4IHU A;  3Q6O A;  2R0G A;  3ZML A;  1OYJ A;  2C0G A;  4MCU A;  1FB6 A;  2P0G A;  4AGS A;  1XFL A;  4ISD A;  3F6F A;  5A4V A;  1I9D A;  3N9J A;  3L0H A;  1G0T A;  3WGX A;  2I4A A;  3RDW A;  2X64 A;  2LJK A;  2WDU A;  4ML1 A;  3IC4 A;  3L9S A;  1A24 A;  4TVE A;  5HR0 A;  2GST A;  2VLT A;  2VL2 A;  2YAN A;  4IP6 A;  5JWO B;  1U88 A;  2F3M A;  2JZS A;  3GH6 A;  1Y6E A;  3ZLP A;  4MJB A;  3EU4 A;  2WGR A;  5KN3 A;  1DE1 A;  1FW1 A;  3F9U A;  1KNG A;  1M9B A;  1ZYE A;  2H6Z A;  5G5F A;  2VL3 A;  3LG6 A;  1F3A A;  2L57 A;  2F9S A;  1YQ1 A;  1HNA A;  1K0A A;  4IVF A;  4LMW A;  3TGZ A;  6GSV A;  1PKW A;  4FIW A;  2C80 A;  4DSS B;  2OBI A;  1AQX A;  4NAX A;  2QA1 A;  1Z6M A;  2XPD A;  4MA9 A;  1EOH A;  4V2M A;  3ZIJ A;  1A8Y A;  1OVN A;  3WD6 A;  2A2S A;  3CMI A;  5B6N A;  2VLV A;  4TR1 A;  5GAN D;  2CX4 A;  2PVO C;  1JFU A;  2ES7 A;  3ME8 A;  5D8I A;  4Z2R A;  3HVV A;  3FK8 A;  3GL3 A;  4EF0 A;  1B9Y C;  4OWY A;  2HE3 A;  2CV4 A;  3CRU A;  2N5A A;  1PA3 A;  4KA0 A;  1XWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...