3Q6ZA

Human parp14 (artd8)-macro domain 1 in complex with adenosine-5-diphosphoribose
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
187
structure length
185
Chain Sequence
CFSRTVLAPGVVLIVQQGDLARLPVDVVVNASNEDLKHYGGLAAALSKAAGPELQADCDQIVKREGRLLPGNATISKAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRAVQLSLCLAEKYKYRSIAIPAISSGVFGFPLGRCVETIVSAIKENFQFKKHCLKEIYLVDVSEKTVEAFAEAVKTVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of Mono-ADP-Ribosylated ARTD10 Substrates by ARTD8 Macrodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Poly [ADP-ribose] polymerase 14
total genus 65
structure length 185
sequence length 187
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3q6zA00
1VHUA 2BFRA 3PEIA 2EEEA 3GPGA 4UMLA 3T8WA 2BFQA 2FG1A 3EW5A 4GVVA 3V2BA 1GYTA 3ETIA 3GQOA 1NJRA 1LANA 3Q71A 1HJZA 5FSXA 1BPNA 1LAMA 2J9AA 3Q6ZA 1TXZA 4GUAA 4R76A 3H8EA 1LCPA 3EJGA 3H8GA 2FAVA 1TY8A 3GQEA 3KR4A 3GPOA 4ZI6A 3EKEA 4ZX8A 2L8RA 3EJFA 4KYBA 3IJ3A 5DUSA 3KQZA 5FSZA 3EWQA 4R7MA 3EWOA 5FSUA 5E3BA 3H8FA 4R6TA 5HOLA 4ABKA 3SIIA 2AFCA 4D86A 4ETKA 1ZR3A 2DX6A 2XD7A 3JRUA 4ABLA 2EWBA 4ZY2A 2LGRA 5FSYA 1ZR5A 3GPQA 5D8NA 3SIGA 3V45A 4J5SA 4JLLA 3VFQA 2FXKA 4KSIA 3KZWA 4JVVA 3KQXA 2ACFA 4ZY1A 4K0CA 4TU0A 4IQYA 4ZX9A 1YD9A 4ETJA 4X2TA 4J5QA 2VRIA 2X47A 3EWRA 3IIFA 3SIJA 1SPVA 4GVWA 5CMSA 4ESSA 3EWPA 5FSVA 1BLLE 4ZY0A 5CB5A 3SIHA 4J4ZA 1LAPA 5CB3A 4JGKA 4JCAA 3IIDA 4J5RA 4K3NA 5CBMA 3JZTA 5HIHA 3KR5A 4ZYQA 5AILA 1BPMA
chains in the Genus database with same CATH superfamily
1VHUA 2BFRA 3PEIA 2EEEA 3GPGA 4UMLA 3T8WA 2BFQA 2FG1A 3EW5A 4GVVA 3V2BA 1GYTA 3ETIA 3GQOA 1NJRA 1LANA 3Q71A 1HJZA 5FSXA 1BPNA 1LAMA 2J9AA 3Q6ZA 1TXZA 4GUAA 4R76A 3H8EA 1LCPA 3EJGA 3H8GA 2FAVA 1TY8A 3GQEA 3KR4A 3GPOA 4ZI6A 3EKEA 2JZDA 4ZX8A 2L8RA 3EJFA 4KYBA 3IJ3A 5DUSA 3KQZA 5FSZA 3EWQA 4R7MA 3EWOA 5FSUA 5E3BA 3H8FA 4R6TA 2JZEA 5HOLA 4ABKA 2RNKA 3SIIA 2AFCA 4D86A 4ETKA 1ZR3A 2DX6A 2XD7A 3JRUA 4ABLA 2EWBA 4ZY2A 2LGRA 5FSYA 1ZR5A 2WCTA 5D8NA 3GPQA 2JZFA 3SIGA 3V45A 4J5SA 4JLLA 3VFQA 2FXKA 4KSIA 3KZWA 4JVVA 3KQXA 2ACFA 4ZY1A 4K0CA 4TU0A 4IQYA 4ZX9A 1YD9A 4ETJA 4X2TA 4J5QA 2VRIA 2X47A 3EWRA 3IIFA 3SIJA 1SPVA 4GVWA 5CMSA 4ESSA 3EWPA 5FSVA 1BLLE 4ZY0A 5CB5A 3SIHA 4J4ZA 1LAPA 2KQVA 5CB3A 4JGKA 4JCAA 3IIDA 4J5RA 4K3NA 5CBMA 3JZTA 5HIHA 3KR5A 4ZYQA 5AILA 1BPMA 2W2GA
chains in the Genus database with same CATH topology
1VHUA 2BFRA 3PEIA 2EEEA 3GPGA 4UMLA 3T8WA 2BFQA 2FG1A 3EW5A 4GVVA 3V2BA 1GYTA 3ETIA 3GQOA 1NJRA 1LANA 3Q71A 1HJZA 5FSXA 1BPNA 1LAMA 2J9AA 3Q6ZA 1TXZA 4GUAA 4R76A 3H8EA 1LCPA 3EJGA 3H8GA 2FAVA 1TY8A 3GQEA 3KR4A 3GPOA 4ZI6A 3EKEA 4ZX8A 2L8RA 3EJFA 4KYBA 3IJ3A 5DUSA 3KQZA 5FSZA 3EWQA 4R7MA 3EWOA 5FSUA 5E3BA 3H8FA 4R6TA 5HOLA 4ABKA 3SIIA 2AFCA 4D86A 4ETKA 1ZR3A 2DX6A 2XD7A 3JRUA 4ABLA 2EWBA 4ZY2A 2LGRA 5FSYA 1ZR5A 3GPQA 5D8NA 3SIGA 3V45A 4J5SA 4JLLA 3VFQA 2FXKA 4KSIA 3KZWA 4JVVA 3KQXA 2ACFA 4ZY1A 4K0CA 4TU0A 4IQYA 4ZX9A 1YD9A 4ETJA 4X2TA 4J5QA 2VRIA 2X47A 3EWRA 3IIFA 3SIJA 1SPVA 4GVWA 5CMSA 4ESSA 3EWPA 5FSVA 1BLLE 4ZY0A 5CB5A 3SIHA 4J4ZA 1LAPA 5CB3A 4JGKA 4JCAA 3IIDA 4J5RA 4K3NA 5CBMA 3JZTA 5HIHA 3KR5A 4ZYQA 5AILA 1BPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VHU A;  2BFR A;  3PEI A;  2EEE A;  3GPG A;  4UML A;  3T8W A;  2BFQ A;  2FG1 A;  3EW5 A;  4GVV A;  3V2B A;  1GYT A;  3ETI A;  3GQO A;  1NJR A;  1LAN A;  3Q71 A;  1HJZ A;  5FSX A;  1BPN A;  1LAM A;  2J9A A;  3Q6Z A;  1TXZ A;  4GUA A;  4R76 A;  3H8E A;  1LCP A;  3EJG A;  3H8G A;  2FAV A;  1TY8 A;  3GQE A;  3KR4 A;  3GPO A;  4ZI6 A;  3EKE A;  4ZX8 A;  2L8R A;  3EJF A;  4KYB A;  3IJ3 A;  5DUS A;  3KQZ A;  5FSZ A;  3EWQ A;  4R7M A;  3EWO A;  5FSU A;  5E3B A;  3H8F A;  4R6T A;  5HOL A;  4ABK A;  3SII A;  2AFC A;  4D86 A;  4ETK A;  1ZR3 A;  2DX6 A;  2XD7 A;  3JRU A;  4ABL A;  2EWB A;  4ZY2 A;  2LGR A;  5FSY A;  1ZR5 A;  3GPQ A;  5D8N A;  3SIG A;  3V45 A;  4J5S A;  4JLL A;  3VFQ A;  2FXK A;  4KSI A;  3KZW A;  4JVV A;  3KQX A;  2ACF A;  4ZY1 A;  4K0C A;  4TU0 A;  4IQY A;  4ZX9 A;  1YD9 A;  4ETJ A;  4X2T A;  4J5Q A;  2VRI A;  2X47 A;  3EWR A;  3IIF A;  3SIJ A;  1SPV A;  4GVW A;  5CMS A;  4ESS A;  3EWP A;  5FSV A;  1BLL E;  4ZY0 A;  5CB5 A;  3SIH A;  4J4Z A;  1LAP A;  5CB3 A;  4JGK A;  4JCA A;  3IID A;  4J5R A;  4K3N A;  5CBM A;  3JZT A;  5HIH A;  3KR5 A;  4ZYQ A;  5AIL A;  1BPM A; 
#chains in the Genus database with same CATH topology
 1VHU A;  2BFR A;  3PEI A;  2EEE A;  3GPG A;  4UML A;  3T8W A;  2BFQ A;  2FG1 A;  3EW5 A;  4GVV A;  3V2B A;  1GYT A;  3ETI A;  3GQO A;  1NJR A;  1LAN A;  3Q71 A;  1HJZ A;  5FSX A;  1BPN A;  1LAM A;  2J9A A;  3Q6Z A;  1TXZ A;  4GUA A;  4R76 A;  3H8E A;  1LCP A;  3EJG A;  3H8G A;  2FAV A;  1TY8 A;  3GQE A;  3KR4 A;  3GPO A;  4ZI6 A;  3EKE A;  2JZD A;  4ZX8 A;  2L8R A;  3EJF A;  4KYB A;  3IJ3 A;  5DUS A;  3KQZ A;  5FSZ A;  3EWQ A;  4R7M A;  3EWO A;  5FSU A;  5E3B A;  3H8F A;  4R6T A;  2JZE A;  5HOL A;  4ABK A;  2RNK A;  3SII A;  2AFC A;  4D86 A;  4ETK A;  1ZR3 A;  2DX6 A;  2XD7 A;  3JRU A;  4ABL A;  2EWB A;  4ZY2 A;  2LGR A;  5FSY A;  1ZR5 A;  2WCT A;  5D8N A;  3GPQ A;  2JZF A;  3SIG A;  3V45 A;  4J5S A;  4JLL A;  3VFQ A;  2FXK A;  4KSI A;  3KZW A;  4JVV A;  3KQX A;  2ACF A;  4ZY1 A;  4K0C A;  4TU0 A;  4IQY A;  4ZX9 A;  1YD9 A;  4ETJ A;  4X2T A;  4J5Q A;  2VRI A;  2X47 A;  3EWR A;  3IIF A;  3SIJ A;  1SPV A;  4GVW A;  5CMS A;  4ESS A;  3EWP A;  5FSV A;  1BLL E;  4ZY0 A;  5CB5 A;  3SIH A;  4J4Z A;  1LAP A;  2KQV A;  5CB3 A;  4JGK A;  4JCA A;  3IID A;  4J5R A;  4K3N A;  5CBM A;  3JZT A;  5HIH A;  3KR5 A;  4ZYQ A;  5AIL A;  1BPM A;  2W2G A; 
#chains in the Genus database with same CATH homology
 1VHU A;  2BFR A;  3PEI A;  2EEE A;  3GPG A;  4UML A;  3T8W A;  2BFQ A;  2FG1 A;  3EW5 A;  4GVV A;  3V2B A;  1GYT A;  3ETI A;  3GQO A;  1NJR A;  1LAN A;  3Q71 A;  1HJZ A;  5FSX A;  1BPN A;  1LAM A;  2J9A A;  3Q6Z A;  1TXZ A;  4GUA A;  4R76 A;  3H8E A;  1LCP A;  3EJG A;  3H8G A;  2FAV A;  1TY8 A;  3GQE A;  3KR4 A;  3GPO A;  4ZI6 A;  3EKE A;  4ZX8 A;  2L8R A;  3EJF A;  4KYB A;  3IJ3 A;  5DUS A;  3KQZ A;  5FSZ A;  3EWQ A;  4R7M A;  3EWO A;  5FSU A;  5E3B A;  3H8F A;  4R6T A;  5HOL A;  4ABK A;  3SII A;  2AFC A;  4D86 A;  4ETK A;  1ZR3 A;  2DX6 A;  2XD7 A;  3JRU A;  4ABL A;  2EWB A;  4ZY2 A;  2LGR A;  5FSY A;  1ZR5 A;  3GPQ A;  5D8N A;  3SIG A;  3V45 A;  4J5S A;  4JLL A;  3VFQ A;  2FXK A;  4KSI A;  3KZW A;  4JVV A;  3KQX A;  2ACF A;  4ZY1 A;  4K0C A;  4TU0 A;  4IQY A;  4ZX9 A;  1YD9 A;  4ETJ A;  4X2T A;  4J5Q A;  2VRI A;  2X47 A;  3EWR A;  3IIF A;  3SIJ A;  1SPV A;  4GVW A;  5CMS A;  4ESS A;  3EWP A;  5FSV A;  1BLL E;  4ZY0 A;  5CB5 A;  3SIH A;  4J4Z A;  1LAP A;  5CB3 A;  4JGK A;  4JCA A;  3IID A;  4J5R A;  4K3N A;  5CBM A;  3JZT A;  5HIH A;  3KR5 A;  4ZYQ A;  5AIL A;  1BPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...