3Q6ZA

Human parp14 (artd8)-macro domain 1 in complex with adenosine-5-diphosphoribose
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
187
structure length
185
Chain Sequence
CFSRTVLAPGVVLIVQQGDLARLPVDVVVNASNEDLKHYGGLAAALSKAAGPELQADCDQIVKREGRLLPGNATISKAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRAVQLSLCLAEKYKYRSIAIPAISSGVFGFPLGRCVETIVSAIKENFQFKKHCLKEIYLVDVSEKTVEAFAEAVKTVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of Mono-ADP-Ribosylated ARTD10 Substrates by ARTD8 Macrodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Poly [ADP-ribose] polymerase 14
total genus 65
structure length 185
sequence length 187
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3q6zA00
4ABKA 2ACFA 5CB5A 5FSUA 3T8WA 4ETKA 3EWQA 3GPOA 5HOLA 1HJZA 2BFRA 1SPVA 1YD9A 5D8NA 1LCPA 1GYTA 4JCAA 5FSXA 3SIJA 5CBMA 5FSZA 5E3BA 5DUSA 4ETJA 3GQOA 3GQEA 4JLLA 4JGKA 5AILA 3GPGA 3H8FA 5CMSA 4ABLA 4ZI6A 2X47A 4X2TA 2XD7A 1BLLE 4ZY1A 3EJFA 4UMLA 2FXKA 4R7MA 4ZY0A 3H8GA 4J4ZA 1TXZA 3KQZA 3H8EA 4IQYA 4ESSA 1LANA 3IIFA 3ETIA 4R6TA 3EWRA 3KR5A 4GVVA 3IIDA 4GVWA 3KZWA 4J5RA 1LAMA 2EWBA 4K3NA 1ZR3A 3JRUA 4ZX8A 3SIIA 3Q6ZA 1TY8A 4JVVA 3V2BA 3EWPA 1LAPA 4ZY2A 2J9AA 2BFQA 4K0CA 2VRIA 5HIHA 2FAVA 3VFQA 3EKEA 3JZTA 3GPQA 2FG1A 1BPNA 3IJ3A 1VHUA 3KR4A 1BPMA 5FSYA 4TU0A 4KSIA 2DX6A 4ZYQA 4J5QA 3EWOA 4D86A 2L8RA 3PEIA 4GUAA 5FSVA 2LGRA 3KQXA 2EEEA 3SIHA 4R76A 5CB3A 1ZR5A 3V45A 3Q71A 3SIGA 2AFCA 3EW5A 1NJRA 4J5SA 4ZX9A 3EJGA 4KYBA
chains in the Genus database with same CATH superfamily
4ABKA 2ACFA 5CB5A 5FSUA 3T8WA 4ETKA 3EWQA 3GPOA 5HOLA 2KQVA 1HJZA 2BFRA 1SPVA 1YD9A 5D8NA 1LCPA 1GYTA 4JCAA 5FSXA 3SIJA 5CBMA 5FSZA 5E3BA 5DUSA 4ETJA 3GQOA 3GQEA 4JLLA 4JGKA 5AILA 3GPGA 3H8FA 5CMSA 4ABLA 4ZI6A 2X47A 4X2TA 2XD7A 1BLLE 4ZY1A 3EJFA 4UMLA 2JZFA 2FXKA 4R7MA 4ZY0A 3H8GA 4J4ZA 1TXZA 2JZDA 3KQZA 3H8EA 4IQYA 4ESSA 1LANA 3IIFA 3ETIA 4R6TA 3EWRA 3KR5A 4GVVA 3IIDA 4GVWA 3KZWA 4J5RA 1LAMA 2EWBA 4K3NA 1ZR3A 3JRUA 4ZX8A 3SIIA 3Q6ZA 1TY8A 4JVVA 3V2BA 2WCTA 3EWPA 2W2GA 1LAPA 4ZY2A 2J9AA 2BFQA 4K0CA 2VRIA 5HIHA 2FAVA 2RNKA 3VFQA 3EKEA 3JZTA 3GPQA 2JZEA 2FG1A 1BPNA 3IJ3A 1VHUA 3KR4A 1BPMA 5FSYA 4TU0A 4KSIA 2DX6A 4ZYQA 4J5QA 3EWOA 4D86A 2L8RA 3PEIA 4GUAA 5FSVA 2LGRA 3KQXA 2EEEA 3SIHA 4R76A 5CB3A 1ZR5A 3V45A 3Q71A 3SIGA 2AFCA 3EW5A 1NJRA 4J5SA 4ZX9A 3EJGA 4KYBA
chains in the Genus database with same CATH topology
4ABKA 2ACFA 5CB5A 5FSUA 3T8WA 4ETKA 3EWQA 3GPOA 5HOLA 1HJZA 2BFRA 1SPVA 1YD9A 5D8NA 1LCPA 1GYTA 4JCAA 5FSXA 3SIJA 5CBMA 5FSZA 5E3BA 5DUSA 4ETJA 3GQOA 3GQEA 4JLLA 4JGKA 5AILA 3GPGA 3H8FA 5CMSA 4ABLA 4ZI6A 2X47A 4X2TA 2XD7A 1BLLE 4ZY1A 3EJFA 4UMLA 2FXKA 4R7MA 4ZY0A 3H8GA 4J4ZA 1TXZA 3KQZA 3H8EA 4IQYA 4ESSA 1LANA 3IIFA 3ETIA 4R6TA 3EWRA 3KR5A 4GVVA 3IIDA 4GVWA 3KZWA 4J5RA 1LAMA 2EWBA 4K3NA 1ZR3A 3JRUA 4ZX8A 3SIIA 3Q6ZA 1TY8A 4JVVA 3V2BA 3EWPA 1LAPA 4ZY2A 2J9AA 2BFQA 4K0CA 2VRIA 5HIHA 2FAVA 3VFQA 3EKEA 3JZTA 3GPQA 2FG1A 1BPNA 3IJ3A 1VHUA 3KR4A 1BPMA 5FSYA 4TU0A 4KSIA 2DX6A 4ZYQA 4J5QA 3EWOA 4D86A 2L8RA 3PEIA 4GUAA 5FSVA 2LGRA 3KQXA 2EEEA 3SIHA 4R76A 5CB3A 1ZR5A 3V45A 3Q71A 3SIGA 2AFCA 3EW5A 1NJRA 4J5SA 4ZX9A 3EJGA 4KYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ABK A;  2ACF A;  5CB5 A;  5FSU A;  3T8W A;  4ETK A;  3EWQ A;  3GPO A;  5HOL A;  1HJZ A;  2BFR A;  1SPV A;  1YD9 A;  5D8N A;  1LCP A;  1GYT A;  4JCA A;  5FSX A;  3SIJ A;  5CBM A;  5FSZ A;  5E3B A;  5DUS A;  4ETJ A;  3GQO A;  3GQE A;  4JLL A;  4JGK A;  5AIL A;  3GPG A;  3H8F A;  5CMS A;  4ABL A;  4ZI6 A;  2X47 A;  4X2T A;  2XD7 A;  1BLL E;  4ZY1 A;  3EJF A;  4UML A;  2FXK A;  4R7M A;  4ZY0 A;  3H8G A;  4J4Z A;  1TXZ A;  3KQZ A;  3H8E A;  4IQY A;  4ESS A;  1LAN A;  3IIF A;  3ETI A;  4R6T A;  3EWR A;  3KR5 A;  4GVV A;  3IID A;  4GVW A;  3KZW A;  4J5R A;  1LAM A;  2EWB A;  4K3N A;  1ZR3 A;  3JRU A;  4ZX8 A;  3SII A;  3Q6Z A;  1TY8 A;  4JVV A;  3V2B A;  3EWP A;  1LAP A;  4ZY2 A;  2J9A A;  2BFQ A;  4K0C A;  2VRI A;  5HIH A;  2FAV A;  3VFQ A;  3EKE A;  3JZT A;  3GPQ A;  2FG1 A;  1BPN A;  3IJ3 A;  1VHU A;  3KR4 A;  1BPM A;  5FSY A;  4TU0 A;  4KSI A;  2DX6 A;  4ZYQ A;  4J5Q A;  3EWO A;  4D86 A;  2L8R A;  3PEI A;  4GUA A;  5FSV A;  2LGR A;  3KQX A;  2EEE A;  3SIH A;  4R76 A;  5CB3 A;  1ZR5 A;  3V45 A;  3Q71 A;  3SIG A;  2AFC A;  3EW5 A;  1NJR A;  4J5S A;  4ZX9 A;  3EJG A;  4KYB A; 
#chains in the Genus database with same CATH topology
 4ABK A;  2ACF A;  5CB5 A;  5FSU A;  3T8W A;  4ETK A;  3EWQ A;  3GPO A;  5HOL A;  2KQV A;  1HJZ A;  2BFR A;  1SPV A;  1YD9 A;  5D8N A;  1LCP A;  1GYT A;  4JCA A;  5FSX A;  3SIJ A;  5CBM A;  5FSZ A;  5E3B A;  5DUS A;  4ETJ A;  3GQO A;  3GQE A;  4JLL A;  4JGK A;  5AIL A;  3GPG A;  3H8F A;  5CMS A;  4ABL A;  4ZI6 A;  2X47 A;  4X2T A;  2XD7 A;  1BLL E;  4ZY1 A;  3EJF A;  4UML A;  2JZF A;  2FXK A;  4R7M A;  4ZY0 A;  3H8G A;  4J4Z A;  1TXZ A;  2JZD A;  3KQZ A;  3H8E A;  4IQY A;  4ESS A;  1LAN A;  3IIF A;  3ETI A;  4R6T A;  3EWR A;  3KR5 A;  4GVV A;  3IID A;  4GVW A;  3KZW A;  4J5R A;  1LAM A;  2EWB A;  4K3N A;  1ZR3 A;  3JRU A;  4ZX8 A;  3SII A;  3Q6Z A;  1TY8 A;  4JVV A;  3V2B A;  2WCT A;  3EWP A;  2W2G A;  1LAP A;  4ZY2 A;  2J9A A;  2BFQ A;  4K0C A;  2VRI A;  5HIH A;  2FAV A;  2RNK A;  3VFQ A;  3EKE A;  3JZT A;  3GPQ A;  2JZE A;  2FG1 A;  1BPN A;  3IJ3 A;  1VHU A;  3KR4 A;  1BPM A;  5FSY A;  4TU0 A;  4KSI A;  2DX6 A;  4ZYQ A;  4J5Q A;  3EWO A;  4D86 A;  2L8R A;  3PEI A;  4GUA A;  5FSV A;  2LGR A;  3KQX A;  2EEE A;  3SIH A;  4R76 A;  5CB3 A;  1ZR5 A;  3V45 A;  3Q71 A;  3SIG A;  2AFC A;  3EW5 A;  1NJR A;  4J5S A;  4ZX9 A;  3EJG A;  4KYB A; 
#chains in the Genus database with same CATH homology
 4ABK A;  2ACF A;  5CB5 A;  5FSU A;  3T8W A;  4ETK A;  3EWQ A;  3GPO A;  5HOL A;  1HJZ A;  2BFR A;  1SPV A;  1YD9 A;  5D8N A;  1LCP A;  1GYT A;  4JCA A;  5FSX A;  3SIJ A;  5CBM A;  5FSZ A;  5E3B A;  5DUS A;  4ETJ A;  3GQO A;  3GQE A;  4JLL A;  4JGK A;  5AIL A;  3GPG A;  3H8F A;  5CMS A;  4ABL A;  4ZI6 A;  2X47 A;  4X2T A;  2XD7 A;  1BLL E;  4ZY1 A;  3EJF A;  4UML A;  2FXK A;  4R7M A;  4ZY0 A;  3H8G A;  4J4Z A;  1TXZ A;  3KQZ A;  3H8E A;  4IQY A;  4ESS A;  1LAN A;  3IIF A;  3ETI A;  4R6T A;  3EWR A;  3KR5 A;  4GVV A;  3IID A;  4GVW A;  3KZW A;  4J5R A;  1LAM A;  2EWB A;  4K3N A;  1ZR3 A;  3JRU A;  4ZX8 A;  3SII A;  3Q6Z A;  1TY8 A;  4JVV A;  3V2B A;  3EWP A;  1LAP A;  4ZY2 A;  2J9A A;  2BFQ A;  4K0C A;  2VRI A;  5HIH A;  2FAV A;  3VFQ A;  3EKE A;  3JZT A;  3GPQ A;  2FG1 A;  1BPN A;  3IJ3 A;  1VHU A;  3KR4 A;  1BPM A;  5FSY A;  4TU0 A;  4KSI A;  2DX6 A;  4ZYQ A;  4J5Q A;  3EWO A;  4D86 A;  2L8R A;  3PEI A;  4GUA A;  5FSV A;  2LGR A;  3KQX A;  2EEE A;  3SIH A;  4R76 A;  5CB3 A;  1ZR5 A;  3V45 A;  3Q71 A;  3SIG A;  2AFC A;  3EW5 A;  1NJR A;  4J5S A;  4ZX9 A;  3EJG A;  4KYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...