3Q72A

Crystal structure of rad g-domain-gtp analog complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
138
Chain Sequence
SVYKVLLLGAPGVGKSALARIFGGVHTYDRSIVVDGEEASLMVYDIWGDAYVIVYSVTDKGSFEKASELRVQLRRARDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein RAD
publication title RGK Family G-Domain:GTP Analog Complex Structures and Nucleotide-Binding Properties.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 49
structure length 138
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q72A00
4JJKA 2G0TA 1W2HA 1T5IA 4QHTA 3MAAC 4Q9IA 1ZCBA 1OYWA 2R65A 4AK9A 2Q3MA 4D4JA 3T61A 2Z5FA 4JYCA 1GZSA 2YHSA 1VG8A 3GD7A 4G01B 1SXJE 1MH1A 2HT6A 4JZKA 3DL0A 5EP1A 3RRZA 3E5HA 1SQ5A 2ZANA 1N5JA 4JVSB 4AIIA 4TLAA 1R5OA 4ITRC 1K6MA 2H18A 2FJUA 5JRJA 4LHZA 4ON9A 3TQFA 3PFIA 1J8MF 1E2PA 1P3JA 3B2EA 4RZ3A 2VYFA 2CE7A 3BERA 4Q1FA 5AJZA 2B21A 4M1OA 2QPTA 5GADl 1TNDA 1QG4A 2QMOA 4HEJA 4HLCA 5JJIA 1OXSC 3GCGA 5FOTA 2J45A 3TUIC 4MH0R 1W49A 1LS1A 4NE2A 4Z54A 1YR6A 2AXPA 4HI0E 3TKLA 1OHHD 1W48A 1Z07A 4G5GA 4IDNA 3NBFA 2HUPA 4FW9A 5FOXA 1Z8FA 1KMHB 1N5KA 1JEDA 2ERXA 3K53A 4ILEA 3ZGXA 4PXAA 4JSYA 2C9YA 1Z22A 1ZC4A 2ORIA 4M9XA 1UBFA 3ZDQA 1XCPA 3GLHE 3FVQA 2OILA 3NBZC 3AP1A 1KMHA 5FTKA 3V00A 3QY0A 1JAHA 4LZZA 2OFOA 4IVPA 1KAGA 1CS4C 2AR7A 2E9SA 3KUDA 4E22A 3VR2A 3CLVA 3TAUA 1UDWA 2DR3A 2P65A 3IHLA 1NMZA 2HEIA 5FTLA 5DI3B 5CDFA 4PO8A 5AUQA 3K09A 1KSGA 2NO1A 2VO1A 1UM8A 3NBXX 2J0QA 3LH5A 5G40A 1OLOA 1QHNA 4YQFA 2FEMA 3CF2A 4X8MA 3R20A 5DI3A 5EJEA 1TU4A 3B5JA 1ZM7A 5LB2A 1YR9A 2D3WA 4LJ8A 4DSNA 4KYIB 1RFLA 3MWYW 2WPDA 1WF3A 1KKMA 5GJBA 1UKYA 1U8YA 2P6UA 1M8PA 2QRNA 4WOPA 2VF7A 1GNQA 3EXAA 3OAAD 4IEEA 3CNOA 4Y0VA 5HE8A 3EIHA 5J40A 5CK5A 2BM0A 2EFDB 1E94E 4KI0A 4V02A 4KXFB 3Q3JB 5EUQB 4EJSB 2CL6X 2ZU0C 3C7KA 2GZDA 5FUXA 2ZYUX 3W8RA 1DARA 2CNWD 5CIQA 1VMAA 1G5RA 3O8CA 1Q21A 2WVJA 2OCAA 3SFZA 2AX4A 3B1VA 4EJSA 4CF7A 2XEXA 5K8UA 2CJWB 4FCTA 3MG9A 1P9WA 5C2JB 1HT1E 4U7DA 1G5PA 1SKYE 2XZLA 4GOXA 4XSHA 1JPJA 5M04A 1P2TA 1E32A 2IYUA 1S1MA 2CJWA 4ZI2A 2R6CA 3I8SA 3QF4B 1U9IC 3K70D 1YZUA 4AYWA 1ESMA 1R10A 1ZU5A 1CULC 4RFVA 5F2EA 1EESA 1XJCA 2ZRNA 3DO6A 2AHOA 3I8XA 4TYNA 2J5XA 3W5IA 3NH6A 2A7QA 3QF4A 2QTHA 2V6IA 4ACBA 2BMFA 3M6AA 4KLZA 1XEWY 4B3FX 3QJYA 4TYPA 5EZ5A 5C46F 3SJAA 1TMKA 1MABB 2R6DA 3B78A 4B2LA 2WWYA 4JLAA 2QGNA 4JBWA 1DO0A 1ELOA 1G17A 1EFTA 1Z47A 1V43A 1KZ7B 1MABA 1ZIOA 4W7SA 1J99A 2RHMA 3QXXA 2H16A 1A1VA 2ATVA 4DLYA 1TADA 1XDBA 2F1HA 4DLSA 2D2FA 4P33A 3TLXA 1US8B 3HWSA 4YLGA 1SVWA 2QORA 2Q0HA 3ZQJA 2JLWA 3DKPA 5F9FA 1W44A 1VG0B 1IY1A 1IY0A 1JI0A 2W2XA 1US8A 3MMPA 4KO8A 1MO4A 5FH9A 4QJ5A 2ERYA 1NVWQ 4Q7LA 1H8ED 2CK3A 4C0SA 4IXMA 1Z2AA 2WHXA 5J4LA 2P0EA 1SVLA 2WM9B 4HSEA 4TMXA 5JSZA 2CCKA 2F7SA 3H86A 2ZI7A 4JJZA 2OT3B 4NTZA 3X1XA 4F4IA 1E2JA 3AF0A 1GIAA 2V9PA 3FTQA 5EXXA 3A1UA 1ZD1A 1OFUX 2QGZA 4JVMA 3EZ2A 4D4MA 2JLXA 1RW4A 1AGRA 1N0WA 5JI2E 2OEPA 1OXTA 2PX0A 1Q3TA 3FHOA 5AJWA 1Q1BA 1X8KA 2EQBA 2IYZA 2J7PD 2VIIA 5G53C 4UXIA 4JLVA 2GJAA 3CRMA 1QZXA 5GJVC 5EXSA 4NL4H 3RYTC 1JJVA 1XTQA 2ONKA 3PEYA 4PSAA 1NG9A 4IKEA 2VBCA 4YC7A 2VPPA 4XVUA 1G19A 1Z3IX 2WIBA 4AKGA 2HF8A 5IRCD 3SU8A 2O0JA 4G5QA 3FGNA 2O8FB 2WTUA 2J7KA 1M34E 1UEJA 1KI4A 2IHYA 4O0MA 4PQFA 5KUTA 3ZD6A 4GFDA 4TZ0A 2MSEB 3AUXA 1ZM9A 5AUNB 1G6OA 3IPXA 1N6HA 4LRWA 2BEJA 3IGFA 3X1ZA 1HY3A 2WJJA 2O8FA 3GJ5A 1NSTA 5B30A 2ZYVX 4XH9B 4BLSA 3SOPA 2R6AA 1YZNA 1XTJA 2QP4A 2ZI9A 4UJ5A 2H1LA 2REOA 2PZFA 1GITA 1NKTA 3AVWA 1DOAA 5A5GA 2BJVA 1HURA 1BYIA 1U94A 5CB8A 4L4UA 1KK3A 4EDHA 2HYIC 2ZI4A 1G291 4PC7A 4URUR 1AZSC 1R8QA 4IOMA 3SHWA 3MRSA 4Q1EA 1EFUA 4CT5A 1M1YE 2J0SA 2JA1A 3EIQA 3G0HA 4CYMA 1NIJA 3KKQA 1YR8A 5FI1B 2IUUA 4KITB 4TSFD 2QSYA 2KJQA 2UVQA 3EIEA 3TSOA 3U61B 1OHHA 1E9EA 4KSBA 3BH6A 3QG5A 5BYKA 2ODBA 4PO1A 3MUFA 1XB2A 1M2OB 3K0FB 2RH5A 3GJ3A 3VR5A 2YYZA 3RAPR 4AKIA 1UKEA 2B92A 2ZI3A 1E69A 3GEEA 2ORWA 3K0FA 3SYKA 1KSJA 4C7OB 1U90A 4M1SA 3G5UA 4QHYA 1GL9B 4ZPXA 2IBMA 1NP6A 1HT2E 1RRFA 2V54A 1FX0B 5GVRA 1RRCA 4CEJB 3EPKA 4FWTA 4C7OA 2WWFA 5CJPA 2ZVQX 1CKEA 3U6BA 3P4YA 1E2DA 2ZRGA 4PAOA 1FX0A 4M0LA 4CEJA 1R5NA 1Z0FA 1BS1A 1COWD 2EWVA 3WY9A 3WBKA 5FTMA 4CIDA 3T1QA 4XJXA 1HQCA 1HUQA 3DVLA 4O2LA 4CW7A 2CLSA 2C5LA 2R2AA 2WWXA 5IDVA 1G7RA 2G77B 2I3BA 4QJ3A 2C78A 1D5CA 3OAAA 1BOFA 4JL6A 1XMSA 2D4HA 2KWIA 4BEBA 3GJ0A 1JR3E 4JLBA 4S35A 1NSFA 2CNWA 4HAUA 4IEIA 1VCMA 4B3GA 3U7GA 3GLIA 1FQJA 1XXHB 3ECCA 2WV9A 3KZ1E 4MQBA 1DS6A 2CXXA 4RVCA 3PXGA 1ZM3A 121PA 4OHVA 4IVRA 1JECA 1GUAA 1RRGA 2FPKA 1GRNA 1OFIA 3NIBA 4JVNA 1XXHA 4DEXA 3Q85A 2WAYA 3JZMA 1E1QD 2QRZA 1CJMA 5FTNA 1G7TA 3GJ6A 4B75A 4QBGB 2BKUA 3NEJA 4WXRA 1KO5A 2WWIA 3CPJB 2OFXA 2O8BB 2IT1A 2BEKA 2ZVPX 2W6JD 2CE2X 3AVVA 1W36D 2VRWA 1PVOA 3SHFA 4IHQA 1SULA 4OJKA 5KU1A 5KO2A 4TYWA 3SQWA 1K5GA 3W9YA 1YE8A 3UANA 4DDWA 2O8BA 2QAGB 4XVRA 2SHKA 3LBNA 3QBTA 3PG5A 1S1CA 4B33A 1OF1A 3AVXA 4OJQA 2ZAOA 1NLFA 1HYQA 1KJYA 2H7VA 3GQBA 2QAGA 3LFUA 4DBLC 4DLWA 1TX4B 4I99A 1R6BX 3NC1C 4RD0A 2F9MA 2GBLA 4AC9A 3K9NA 1CXZA 4EJSC 2C98A 5KDDA 1WMSA 2PL3A 1ZNXA 1P2SA 2V3CC 4ESVA 1J7KA 5AJVB 5SZJA 1OH8A 3TH5A 2QA5A 1YZGA 1VHTA 1OPXA 1XEFA 4LJ7A 2CEAA 4FWIB 2ZRJA 2WIAA 3FDIA 4BFWA 2FSFA 3GMTA 2ZITA 4GRAA 4PPGA 2BV3A 2QENA 1UDXA 3K0CA 4KVAA 4B3CA 3QXJA 3TRFA 2C77A 4Q4LA 4OQNA 3ZJYA 4YMVA 4MGIR 1QHYA 5F9HA 2D74A 4XWKA 1T9HA 3HU2A 4LBWA 3EWSA 4PO9A 3THOA 4NPHA 3V4RA 2A5FA 3DOEA 2NQ2C 5TB5A 2DFTA 4BQSA 5JS8A 2VP6A 2FZLA 3LWNA 3B8HA 5KPDA 2FU5C 2FV8A 3HJNA 4UQOA 5BW8A 1DE0A 3EASA 1KKLA 4UXJA 1G4AE 4DCSA 4QBHA 2HCBA 5FOSA 3O47A 2OAP1 2ZS7A 4C2UA 5K8TA 5TXGA 3VX3A 1PV4A 4CGZA 4B2IA 2QY9A 2MSCB 2JATA 1Z6AA 4M1TA 3N2EA 3NH9A 4MYTA 4QRHA 4F7WA 5B64A 2OG2A 1FMJA 1NMYA 4GMXA 1X6VA 4J0QA 3BD9A 2QT0A 3T1OA 3DKVA 2GJ8A 3HYTA 3TE6A 3EA0A 5BYJA 2QP9X 3I73A 5JCPA 3T1TA 2JLSA 1Q1ZA 4OQFA 1XTKA 4C0QC 3BFXA 1XFAA 3PEUA 3JZAA 2FGJA 2A2ZA 3W5JA 3LVRE 5KNBA 2J0UB 3CZQA 3EG5A 4D0LB 1AKYA 4OI4A 4F38A 2IYRA 2H17A 2JLYA 1PZNA 1QG2A 1VIYA 3A1VA 2IWRA 3MWKA 3AUYA 5BN5A 1OB5A 1EXMA 4DWJA 2J0UA 2NZ8A 3QEJA 1E0JA 1KI3A 1QHHB 1T3HA 5EP3A 3PQCA 4G5OA 3WRXC 1MV5A 1WQ1R 4C4PA 2ZYWX 4LHVA 4NCKA 4EUNA 1R5BA 1MO5A 1U99A 2AXNA 4M1MA 2GNOA 4TL8A 421PA 4OHYA 4TL6A 1QHHA 4ZV4A 2YWGA 4BLPA 4OHWA 2RHDA 5E7MA 1UPTA 5L3SB 1Z2CA 4ZDWA 2ZQ5A 2H5EA 1DG1G 4B71A 5H68A 1DAFA 3FYHA 4PSKA 2ZUDA 2TMKA 5G3YA 1E0KA 4BUJA 1GG2A 5HZHA 5L3SA 1E6CA 3BH7A 3LVQE 1UBCA 1TL7C 4JIMA 4QNMA 1TEXA 2E1RA 4U02A 3U7EB 2DPXA 3AEZA 1AQYA 1N6PA 1FP7A 3EZFA 3FHCB 4EQ6B 1MRSA 2BBSA 2OXRA 4IOLA 3RSOA 1IN6A 4BASA 5DHFA 3RWMB 1G16A 4QKQA 5L3RA 1WBBA 4FMCB 4QGAA 1COWA 3MCAA 3PEWA 1GVNB 3RS0A 1W1WA 4TYYA 1IN4A 4EQ6A 1DG3A 1HE8B 2ZE7A 3Q7QA 4BFVA 5L3VA 5ELXA 1IN8A 1HTWA 1W4CA 2RB4A 4BRUA 5BWMA 3ZD7A 4GL2A 1KI1A 5J47A 3AF1A 4FMBB 1MO3A 4B47A 5JEEA 2IF2A 1KIMA 3RRMA 1TU3A 4B2PA 2IEZA 2QMHA 3CB4A 2DFNA 1G18A 1E9DA 1TF7A 4MRVA 3MJRA 4NU0A 3THYB 2OHFA 4KFUA 3RS5A 2KI5A 4B3DA 1ZU4A 3A37A 2JLVA 1KTVA 4OK5A 4Q4HB 3EX7C 2XZPA 4Q19A 2ORVA 3THYA 1XCMA 1I4TD 4QL3A 4RSGA 2GAAA 3W8NA 4F4CA 2AKYA 2P2LA 1F3OA 3HP1A 1E3MA 1YZKA 2IYWA 2CHQA 3PV0A 1VCNA 4WZAE 3U3KA 3ADDA 4OHZA 1W36B 3TVDA 2L0XA 4X8LA 2DWPA 1L2TA 1XPUA 4TZ6A 4C30A 1E98A 2IYQA 2W6JA 4MUAA 4DDTA 3LA6A 3LLMA 2DFLA 5KSZA 1XU4A 4I1VA 2NMVA 3MSXA 3T1VA 3U6KA 4L16A 3CIOA 3I72A 4LC1A 3CKLA 3I5XA 3NVAA 3U5ZB 2D7DA 2ZE5A 3DZDA 4JT4A 3CNNA 2HDNB 3E1SA 2J0VA 3BB3A 1N2CE 1WE2A 1YU9A 1O3YA 3Q7PA 1Z63A 2W2VA 4UNNA 3EC2A 4MYCA 4P0TA 1EGAA 2ZRHA 1OFTA 1G8YA 1N0VC 3PVSA 3WNCA 5K8IA 3R8FA 4KV9A 3QKRB 1IHUA 4CEIB 3L0SA 3TSZA 4Q03A 3U44B 1S3SA 1PLLA 1KI9A 3KQHA 4HAXA 3QKRA 3HU1A 3KKMA 4CEIA 4JMPA 1IBRA 3K70C 3U44A 2ZJYA 1P2UA 1Z29A 1HA3A 3ZH9B 4LUCA 3NEYA 4DJTA 1Q20A 1U8ZA 1AIPA 3NHAA 1MOZA 1OXVA 2ODNA 1KJWA 3QPVA 4IDHA 2GVDC 2ZSAA 3UXMA 5DIFA 2XTZA 2VP0A 4I1OA 3SDZA 3MLEA 4MKIA 3TNFA 2XB2A 4D2IA 2PEZA 1Z0DA 3MFYA 3AB3A 5D3QA 5FBQB 3IIKA 2WSMA 2YWHA 4D81A 1XJQA 5DSZA 1P4SA 2QBYB 4EPTA 2XNDD 5CJ2A 1AA9A 2ZRBA 2ASEA 2ATXA 2VP9A 3CBQA 3TAHA 3TK1A 3CWQA 4FMDB 2GBLC 2J46A 3RANA 4DLTA 1J90A 2QBYA 3BAFA 4DCNA 4JLOA 4WZ6A 2VF8A 3REFA 4D80A 2ZRCA 1CBUA 3CUEF 3RS7A 2ZSEA 1R0YA 2W6IA 2BWJA 4LDJA 1J8YF 5EXPA 3KJGA 4DUGA 1AKEA 3KJIA 4Q47A 1KYIA 1KK0A 1J70A 3E2IA 3G82C 3SN6A 1JXMA 2RGGA 1K8RA 3B13B 1CJTC 5FUWA 4TMVA 4GOJA 3D8BA 2IXGA 2BBWA 3WMFA 4XSGA 1E9SA 1E9FA 2P6RA 1A2KC 4TQAA 3N2IA 3P1JA 2BIFA 1E9AA 2ZR7A 4BZXA 2NOAA 3SBDA 4M53A 1T0JB 1II0A 1C1YA 1GL7A 3BGWA 3QUSA 2FFAA 2IS6A 3VU9B 1GKUB 2O8EB 4BLTA 3BB1A 1GTVA 3VU9A 3LXXA 2O8EA 3L43A 3NWJA 4QGHA 2LWIA 1G7CA 3ZZUA 5H1YA 1RVDA 4HUQB 3UMRA 2J87A 821PA 3WNBA 3I1FA 3MD0A 3PITA 4D0GA 2GEUA 3AF2A 4HUQA 4B6FA 2WWHA 3KKOA 3PJRA 2C2HA 1WXQA 3Q72A 3OIUA 4KAXA 4LPSA 2RGAA 2VL7A 1KY2A 4GOKA 1N6OA 2A3RA 1OSNA 1R0WA 4C0LA 4P3YA 3QXCA 2QP3A 4URXR 2C99A 1IXRC 1WB9A 4Y0AA 4LYJA 4YXWA 3GLIE 2WWWA 2BJWA 4P31A 2VHTA 1M7BA 1SKQA 2BDTA 1ZAKA 3VMFA 3L0OA 2ZI6A 4BFXA 4Q01A 1D2EA 4U00A 2YWEA 2REBA 3SZRA 5JJKA 1GSIA 4C0AC 4EKDA 1QVRA 1E2IA 2QUZA 1FZQA 3EZ7A 4BE7B 4KBFA 4HAVA 4MKGA 3PUZA 3GFPA 5HCIA 4ZI3A 3U3RA 1LY1A 4PHHA 4PTLA 4URVR 5EP2A 4YMTA 4TMWA 2OFWA 3LQQA 4LGMA 2A9KA 3LLUA 4Q4AB 1NY6A 1II9A 2RGEA 4M2LA 2F9LA 3ZLJA 1NBME 1VHLA 2OBNA 4HDCA 5J4KA 4M8NE 1OYYA 1W0JA 2Z83A 1I4DD 5BXQC 2ZUBA 3B60A 2UZ3A 3KJHA 4MGZR 4Q4AA 4ERNA 1GFIA 2OCPA 3AF4A 4QG7A 2DFKB 3OIYA 4TL9A 1ZM2A 2X19A 4FI3C 3H1TA 4TMZA 3BWDD 4JLPA 3LY5A 4GNKA 1GKYA 3T15A 4FMCF 5FL3A 3ICQB 1E9CA 3ASYA 4P4TA 4RD1A 2XX3A 1E79D 1E2KA 4Z8YA 4FCWA 4TQ9A 1G8GA 5DE3A 4RFSB 1KNQA 4B74A 1BMFD 2CL0X 2RCNA 3GEIA 3IKJA 5FUYA 5L8VA 1BYUA 3GLFE 2KB0A 2WKPA 2PMKA 3CH5A 4NDZA 4LV6A 4TTQA 5KTYA 4RFSA 4IOKA 3A1TA 5KNCA 1AS2A 4AG5A 4OQLA 4OI0A 4MUBA 4DCTA 3HPRA 3LXRA 5G3ZA 4KSCA 4V0MA 1P75A 4G5RA 2Z0MA 4JKIA 4A0RA 1JR6A 4MGKR 1G20E 1RYFA 4DB4A 2FFHA 4OKSA 4KBGA 1PUJA 4QBIA 3L82B 2CHVA 4NHOA 5LPNA 4MA4A 3AKEA 3ZVNA 5DNYB 5FBWB 5FOVA 3SJCA 1Q57A 2F1JA 4HLUC 4DIDA 5C1BA 4TMKA 4DT1B 1Z0KA 3WXMA 5C18A 4UJ3A 5CLQA 2OBLA 4RKFA 1ZM4A 4PQYA 2GESA 2V4ZA 2OESA 2JASA 4EPRA 4FD2A 2ZJBA 3SR0A 1EK0A 4DT1A 2O8CB 4JL5A 3OE7D 2QAJA 4URWR 5CYOA 2ZRAA 2B7BA 4ARZB 1OH7A 1E9BA 4FINA 2PJZA 1AGPA 2GA8A 3P4XA 2O8CA 4XD7D 4QM6A 1F60A 1OV4A 3KFVA 2Z4RA 4Q00A 2CLCX 3BXZA 4OI1A 1W36C 1P5ZB 2BOVA 2YNMA 1SHZA 3ZS9A 3DM5A 3EWAA 3KQLA 3I61A 3GLGB 2GJ9A 3FMOB 1JEEA 1T8TA 2G1KA 2Q9BA 3P32A 2N46A 4A2QA 1DAGA 3K9HA 4UNRA 1DAMA 2YKGA 2PLFA 2JLUA 4TN1A 2E87A 2WWGA 3UWOA 3GLGA 2XNDA 4YMSA 2YZ2A 1UAAA 2AWOA 4HB0A 3SE0A 3T06B 1E2NA 1ZCAA 4X8OA 3VTKA 1XEXB 3F3YA 5TDHA 4EIWA 2IS2A 4ZKEA 2A5JA 2B6HA 4RCYA 1DAHA 1KK1A 3AKDA 5J4YA 4TQUS 3VQTA 1N0UA 1Z0JA 1XEXA 4LK2A 3TW4A 2OCBA 1ANKA 2AFIE 3LW7A 5JHHB 4WAUA 3GJ7A 4EPYA 3CW2A 1EFCA 1Q22A 1Q3HA 3NHBA 4Q66C 3NG1A 4A92A 1XPOA 3VKGA 2RGBA 1E0SA 2BM1A 3QVUA 1SVSA 3AGPA 1P7CA 4M1WA 5LD2B 2XJ9A 2WKRA 3X2SA 1D2MA 621PA 2W00A 3SYLA 1ZJ6A 5CITA 3IIJA 3VNVA 1SVIA 4NCJA 4R7ZA 1G21E 1A2BA 3KKNA 4FMDF 4K81B 4RD2A 4US2R 4RY2A 5CM8B 2C8VA 5FBLB 2HJVA 3Q9LA 3GJXC 2G1JA 3GP8A 1LF0A 4ZDKA 1NIPA 4HDQB 1G8FA 4MDFA 5BQ5A 4HZUB 1R7RA 1EX7A 5SZKB 3ONWA 3UG6A 2GXQA 3OESA 4Z8XA 1H8HD 3DMNA 1XMIA 2ZROA 3GJ8A 2ODEA 3FE2A 5A0FA 1I2MA 1NG1A 4HZUA 4DSUA 5HR5A 5L3QB 5JWRA 1S4QA 2PZGA 4QHSA 5HCNA 4QJ4A 4RCZA 1KDOA 2XXAB 4GSYA 2IEYA 4V0NA 5L3QA 3EPHA 3IO5A 1P60A 3ZZTA 2XXAA 2RMKA 1KNXA 4M9QA 4LJ4A 1Z28A 3MWJA 4NMMA 4D4KA 2V55B 5AUPB 3LNCA 3IDQA 4LBZA 4YDHB 4XWOA 5DGXA 2OBMA 1FTNA 1ZNWA 5KNDA 2F3TA 4CEHB 1FQKA 3WYAA 3A36A 1II8B 3FPAA 4QC2A 2ZSBA 1BIFA 3GFTA 1LS6A 3P27A 5KOYA 3S1AB 1XZQA 4CEHA 4OYHA 3I32A 1S9HA 2IHBA 1II8A 5IT5A 2FFBA 4JLMA 4LYFA 1RZ3A 1XMJA 4YONB 2VP5A 4MRSA 3S1AA 4DLRA 4DZZA 2V1XA 2NG1A 1KZGB 3NDBB 1P9NA 3U7HB 1KI8A 3MGCA 4US0R 4NCHA 2QPOA 1KDRA 2AKAB 3BC1A 4Q1AA 4G0NA 2XOKD 1TF2A 1YJ5A 4MYHA 2LCFA 4Q4JB 5CB6A 1U98A 2X1VA 2ZETA 3CPEA 1YVDA 3BFKA 3ND8A 4MRPA 2FE4A 4LJ9A 2QEQA 2GZHA 5TVKA 3CH4B 5DI9A 1FNMA 4C0BA 4Q4JA 3Q5DA 4D6PA 3SFVA 3W6NA 3LAWA 5EE1A 3BOSA 1E79A 2AK2A 3UIEA 3UMFA 5HPYB 2JIZD 3K09C 4EFMA 2A78A 2OLKA 1XCGB 1BMFA 1MRNA 4ZCLA 2C9CA 1NVVQ 3U3JA 5JLJA 2BCGY 5AWFC 4A0HA 1G3UA 2UZIR 721PA 3RRNA 1RE0A 5H8WA 2JLQA 4DB2A 4BRWA 4AG6A 3B9PA 2Z43A 2ANBA 1OIWA 3PCRB 4A2PA 5E7IA 1XJ0A 3Q5EA 4V0OA 2J3EA 3FKQA 1ZD8A 4TWZA 3NKVA 4NYJQ 2HCJB 1KAOA 2KSQA 3K1JA 3RS2A 1D9ZA 3CNLA 2R9VA 4M4SA 1CTQA 2ZRPA 3R8CA 2WJYA 1GAJA 2LKCA 3QPUA 3FMFA 3V4FA 4DXAA 2X2FA 2NZJA 2ZE6A 3J81k 2FSHA 1ZYUA 3D6TB 3WBJA 3OE7A 5JWHA 4MRRA 4ACAA 1F2TB 4Z1MD 3UPUA 2VSFA 2ZJAA 5ANRB 2ZPTX 3CF0A 1P2VA 1GRQA 1SVOA 4P32A 2IXEA 4DLZA 1CJUC 2CVHA 1JPNA 4Q9JA 4XD7A 2FDCA 3ZYCA 1JR3D 3KXIA 1Z5ZA 2FMXA 1A4RA 3C5HA 1VKJA 4MKHA 2WMOB 1X8JA 4DDUA 2QN6A 1B0UA 2NTYC 4B48A 2F1IA 1SKYB 4KCGA 4E09A 4I1SA 4CDGA 1NMXA 1SZPA 1ZC3A 1DAEA 1Q0UA 5HZKA 2VLIA 3LBHA 4OK3A 4NYMQ 4A8JB 1C9KA 2AK3A 2Q21A 2PT7A 3W6OA 2EFEB 4DKXA 4GZLA 4O2RA 1G1MA 3M4YA 1U2RA 3T34A 1XRJA 3QENA 4LWZA 4AYXA 2CCGA 3LX5A 4A8JA 3LBIA 4BECA 4TLEA 3LO5A 3RC8A 2DWOA 1U81A 1Z08A 1YZTA 4JKYA 3TMKA 5B2ZA 3P26A 3K0AB 5FUVA 1CLUA 1CU1A 2D06A 3ZVLA 1W5SA 2IYTA 2BBTA 2KBFA 2K5UA 2XNSA 2W6ID 2GETA 2I1VB 4Q9LA 3K0AA 2BMDA 3M0EA 2B8WA 2FNAA 3SBEA 3TBKA 4DUGD 3T35A 2QI9C 4LJ6A 3H0KA 3KKPA 1Z6XA 4ZIRB 3C15C 3BBPA 2ZEJA 4IDPA 4BLRA 3R9IA 4D82A 1NN5A 3CX6A 3KQNA 4KHZA 2XGJA 2DYKA 4DLVA 3BRWD 3TIFA 4ZIRA 2VHQA 1CJKC 2ZRLA 2MMGA 2ZRKA 1G3RA 4DLXA 5EE0A 2AL7A 2EW1A 3B1XA 4Q48A 5CDFE 1H65A 4IDQA 4P4SB 2ZJ5A 3OIVA 1L4YA 2G0NA 1ONBA 3IUYA 1QHXA 2JLZA 4G5SA 3QPWA 1H8HA 3HU3A 1OH6A 5E7JA 5HTKA 4P4SA 3ADCA 3NTUA 3EAQA 4LY6A 2EVWX 3VHXA 2V7QD 4A36A 1KY3A 1T91A 1W4BA 4D26A 1E9RA 4HB2A 1W7AA 5EE9A 5CM9C 2A5DA 1BKDR 2ODWA 2QTFA 1XPRA 2Z4SA 2RGNA 4TYQA 2VHCA 3MJHA 4Q5IA 5GJWC 1EWRA 1SVKA 5AJYA 4PANA 3VFDA 5IF9A 4YXWD 2DCUA 4PC6A 2JGNA 1M7GA 5LD2C 2ZS9A 3ZS8A 2XITA 2IWHA 1CR2A 4B43A 1VECA 2IW3A 4POAA 2W58A 4H9GA 4ZCMA 3KDSE 4DIEA 1AS0A 4G3XA 2P6NA 2JAQA 4ASUD 2GJSA 2GCOB 4CVNA 2GCNA 3TSWA 4AD8A 4AURA 2FA9A 1CEEA 4V0KA 1N6NA 1S2MA 3WNDA 3E70C 1KDTA 2GCOA 4V0ME 1JQLB 1JJ7A 3EW9A 4DC9A 1NVVR 4A1FA 1YZQA 5KSPA 1IAQA 3MWLA 4CZ2A 2XOKA 2NO7A 4XTCS 1W0JD 2GK7A 2OXCA 1LV7A 3RS4A 3WYFA 5SZIA 3NXSA 2QL6A 4Q7JB 5J4HA 3QXSA 1OKKD 4LPKA 5TMPA 2W0MA 2ZJ2A 1Q12A 3QKTA 2G88A 3AQ4A 3KX2A 1XTIA 4D4LA 2ZJOA 1DAKA 1U8AA 3ASZA 4NYJR 4TLBA 4KYUA 1ZBDA 2JIZA 4DHEA 4PC1A 4JLKA 1NN3A 4GI7A 4Q4HA 2OCYC 2QMUA 3WP0A 2GRJA 4NYIQ 3CX8A 4PX9A 5EE5B 2J9RA 3SJBA 3B1WA 2GWHA 3LX8A 4PHTA 5FBRB 4TL7A 3REGA 4ESHA 4OL0A 1B23P 1VCOA 2PT5A 3CZPA 3X1YA 2ZU6A 1NN0A 4GZMA 5SZHB 4C3ZA 4AI6A 3O8DA 1P6XA 1UKZA 2MSDB 1ZUHA 2X8AA 2QNRA 3I4LA 4MYUA 4Q1CA 4Q1DA 4EFLA 1R2QA 5KDOA 4H1UA 5AUOB 2B8TA 3U2QA 2WOOA 1S9DA 2FWRA 1KDPA 1W5TA 1QBKC 1XNJA 2IL1A 1ZUIA 2GEDA 2RAPA 3F8TA 2YC2C 5JI3E 2NGRA 4NYMR 4BZPA 4PQRA 1PJRA 1F2UB 2CBZA 1LW7A 4KJZA 2OM2A 3DZ8A 5FBVB 4HLDA 1MT0A 1FUUA 2GXUA 1G3IA 3TUJC 4M1YA 1OW3B 2FPLA 4Z1MA 4M21A 3HDTA 2VSOA 4FIDA 4JYBA 1F2UA 3RSLA 4DCVA 4LYAA 5F3WB 3KUCA 3BFVA 3EPJA 3EZ6A 4W5HA 4IXNA 1JR3A 4R71A 1TF5A 2ZYTX 1M6NA 1QDEA 4DEYA 3BE4A 2D7CA 3RC3A 1NF3A 5DN6D 2WJIA 1R0ZA 3FOZA 1TTTA 4IJMA 1IM2A 3BJIC 4Q1BA 2HYDA 3GPLA 5JHGB 2CCJA 3KXKA 2CLDX 4GPTA 1IN5A 1AJEA 3L0PA 2OUKA 4KODA 5TV2A 3THWB 5GVSA 2IX3A 5LB4A 3FHTA 3IO3A 5P21A 1ZRHA 5IHPA 3VR3A 2EFGA 2QAGC 4ZCIA 3I3SR 3THWA 2FN4A 2FZ4A 4II7A 2QG6A 1E99A 4X8HA 3AP3A 1DADA 4B35A 3TJZA 2P5TB 1WA5A 4JLDA 4WXPA 2BVNA 4PZZA 4TTPA 5JECA 2GZAA 3PUVA 5KDLA 1W2GA 1ZUNB 1JB1A 2FG5A 3BS4A 5FL7A 3X1DA 5F98A 1EWQA 3T12A 4R98A 3KJEA 1G5TA 1IXSB 1CJVC 3K0CC 3CR7A 4LX0A 4M1KA 4C2TA 4W5JA 1CR4A 8OHMA 1GILA 4QGFA 3ADBA 3WHKA 1NLYA 3CRRA 3OEED 1DPFA 4QM7A 3BB4A 1NVXQ 6Q21A 3AVPA 1IJEA 3SC3A 2VTKA 4KVGA 4I1UA 3NC0C 1D2NA 1KHTA 4A8JC 1GKIA 4FN5A 2ZR9A 3BIFA 1G7SA 1TQ6A 1HE1C 1M7HA 2CVFA 5A4JA 4NZYA 2VA8A 1FP6A 4HAZA 2FX3A 2BBOA 2G9NA 2OAQ1 3SJZA 1X8LA 2NO6A 1E2LA 4LOAA 4AWXA 2ZE8A 4IRUB 2YINC 3WMGA 2H92A 4E07A 3EA5A 2V7QA 4LBYA 3B9QA 4G1UC 3QXHA 5E4FA 4LV8B 5EXTA 1IJFA 1L8QA 5FR2A 1NJGA 3LD9A 2JJ8A 3B1YA 4TLDA 5EQTA 2CHGA 5IK2A 4E5UA 1F48A 4MDEA 2GEVA 3ICEA 4LCBA 4F93B 1TQ4A 4Q9KA 2JJ1A 2YC4C 3L2OB 3AH8A 2YOHA 3C14C 3AVUA 1HV8A 2P67A 1XXHE 3EC1A 4K8OA 1FFHA 1EFRA 1KSFX 5AJXA 3A6PC 5J4VA 1UEIA 2VHUA 4ASUA 1ODFA 5FI0B 2YOFA 3UG7A 4HLQB 2C9OA 1NY5A 1W0KD 3AKCA 3FFBA 1VYVA 2XB4A 3K0EA 3Q8XB 2ZREA 3IQWA 4HAYA 2CL7X 4N1AA 4L9SA 4LI0A 221PA 3LDAA 3VR6A 1SXJD 4BWYA 4EPVA 1AM4D 1EG7A 3A4MA 4NP6A 1KO7A 1N6KA 1Z83A 4Z51A 5JFGA 2HV8A 3THXB 1TUEA 3QNUA 4NYIR 2V8OA 4L9WA 4DCUA 2KE5A 1NL3A 2ZJZA 2PCJA 2O5VA 1UBGA 4ZDJA 5DHAA 1QHIA 1J2JA 4OI2A 5KYKA 1JBKA 3THXA 3AM1A 2RGNC 4QBFA 4B34A 1DBSA 1OKKA 5TY0A 2QE7D 4QGGA 1UF9A 5AK0A 3CWZA 3PUXA 2RKOA 3KB1A 1QRAA 2CDNA 2R62A 1E2QA 3JVUA 2HXYA 2D2EA 2YV5A 2NPIA 3VAAA 1QHSA 1TUIA 5H70A 3VX4A 4S2EA 3CRW1 4AYTA 2B7CA 4BEJA 2WJGA 5B58C 1KI7A 4UNSA 2IS1A 1XD8A 1DEKA 2N42A 4ZKDA 3OFND 3TQCA 2H8KA 3IEUA 4Q18A 4CT4B 2WAXA 1FNNA 1U0JA 1S96A 4RZUA 5FPHA 5DH9A 1D9XA 1VPLA 3RWOA 5HKKD 3W34A 1XMVA 4BFYA 3FWYA 1DTSA 2QT1A 4IFBA 4QXAA 1OE0A 4HB3A 2N1BA 1HEIA 5KSYA 1KSHA 3DM9B 3SS8A 3B85A 1XX6A 4YDSA 2X77A 3B82A 1VTKA 2HJGA 3SYNA 2JDID 4LHXA 3RRYA 2VSXA 4ZDIA 1XTSA 2BMJA 2JJ2D 4A9AA 2Q3FA 1NBMD 4WA7A 3DEFA 3K8YA 3KB2A 4TMTA 2FOLA 2F55A 2J1LA 2RGCA 2FSGA 1N5IA 3C16C 5EP4A 5CYPA 5DISB 2A5GA 4ARZA 2R8RA 1Z6GA 2D62A 5DN6A 2OZEA 1KI6B 2C03A 1WP9A 4B6EA 3A1WA 4GP6A 5BN4A 4U5XA 2G83A 1HH4A 4GDFA 2PBRA 1KI6A 1TPZA 3WHLA 1YQTA 3WP1B 2RGXA 2JLRA 3QKUA 2ZRFA 2GCPA 1E1RA 4Q9HA 4AY2A 1P72A 4PZYA 1ESNA 3A1SA 1A82A 5JSZB 5FOWA 3ZIAD 5JMTA 3TGPA 2GK6A 2NIPA 2HLDD 4AKEA 2ZRIA 1AZTA 1W4RA 3DMDA 1TAGA 2DHRA 2YOGA 3I92A 2BCJQ 5D3MB 2EFHB 4KLNA 3QBVA 4RD3A 3EARA 2W2TA 2X2EA 2IYSA 5FTJA 3O8RA 1W46A 5D3MA 1E0AA 4PPQA 4QNRA 1V5WA 1AK2A 3A8TA 2HXSA 3TVTA 2JCSA 3OEEA 3VNUA 1QHGA 2XZOA 4IVQA 1Y3AA 3ETLA 4ZO4A 3L0IB 1N6RA 2QTVB 3F5FA 1NI3A 4MGYR 1E2MA 1FTSA 1Q1EA 1I4LD 1LB1B 4HAWA 2IYYA 1A7JA 3W90A 4EPWA 3QF7A 1YRAA 3RLFA 2O0KA 2FH5B 3LRPA 5EZ6B 1KJZA 2QMEA 2XJ4A 4Q21A 3V9PA 3X1WA 2ZM5A 2V6JA 4TTRA 1X1RA 4JBYA 1XP8A 4QOSA 1G3MA 4OK6A 4QFMA 2OLJA 3NBYC 3ZVRA 4PPNA 1VDZA 2AD5A 3D7MA 3D31A 2OV2A 2YJTD 3KL4A 4NH0A 4URZR 2A30A 2C04A 2IA5A 5LBIA 3QOFA 5GJCA 4LSGA 3ZQ6A 3CO5A 2NO0A 2AFHE 2J41A 1T3SA 2GHIA 4PC2A 1MR3F 1C4OA 3TR5A 2WSSD 2QQ0A 3FKSD 3KXLA 1S0UA 4RZ2A 2WKQA 1P9RA 2EYUA 2HF9A 5E95A 3A4LA 4IFEA 2VHJA 2AN9A 4PZLA 1BH2A 3CM0A 1PUIA 4WW0A 3R9WA 4A82A 3AVOA 3I5YA 1ZD9A 5FPTA 4WVFA 1XD9A 1K5DA 4BZQA 2R6GA 4FXPA 2ZSDA 1SXJB 1PLJA 4JT2A 4KFTA 1F5NA 4PPFA 1D8TA 2P5SA 4BFSA 1W0KA 3T5GA 3AVYA 5CIWA 3DHWC 2IS4A 4BFTA 1SXJA 1I2DA 1VIAA 2BKEA 3W6PA 1ZW6A 4B32A 1CRPA 2ZSFA 1ZIPA 4DRZA 4R9UC 3A58B 1WBDA 1RC8A 1GP2A 1G9XA 5FPSA 3IQXA 2WOJA 3FMPB 2Z6VA 3QQ5A 4D25A 4BLOA 3GEHA 4EAQA 4MKFA 4KFSA 4MITA 5FFMA 3FB4A 2OO7A 4RD6A 3U3MA 1KO4A 2QM7A 1E2HA 2F3RA 4US1R 2WICA 3QSYA 2QE7A 2ZJ8A 3IILA 4UNPA 1OB2A 1RKBA 4A2WA 4JLNA 1OH5A 1WCV1 3KTAB 4PFSA 5CLLA 4KFRA 5JRZA 4WIAA 4WZBE 3BH0A 1X3SA 4JVLA 5EUMA 2ONJA 4E03A 3U60B 3KTAA 2XSZD 2ZRMA 3GLHB 2ZS8A 4HATA 2QU8A 2CMKA 2QM8A 2DB3A 3CONA 4AKHA 4DDVA 5JZVA 4N0DA 4DSTA 4JBXA 4UKDA 1VYUA 3OF5A 4W9MC 2ANCA 3H2YA 3GLIB 3GLHA 1S3GA 4R2IA 1CRQA 1ZNYA 5JCZA 3OFNA 3VHLB 3K0SA 1EX6A 2IYVA 1Z6TA 4OQMA 1E2GA 3IPYA 1A5TA 3VR4A 4HUTA 5DLQC 5JEDA 4V0LA 1T8UA 4B3XA 1KOFA 3K70B 2GKSA 1Q44A 2GXAA 2PZEA 2OSBA 1R4AA 1XWIA 5DYGA 5HKKA 4PAQA 3FMIA 1W47A 1KK2A 3FFAA 2G6BA 3N5CA 1SHKA 1UJ2A 1TQDA 4NCNA 5TARA 2QQEA 4Q7KA 4IDOA 2GDJA 3UMSA 2FSIA 4W5WA 4TT3D 3PENA 4XTRA 2PEYA 1NJFA 1PLKA 2EWWA 2JDIA 3C41J 4IW3B 1MKYA 4HDOB 3QE0A 2JJ2A 2ZAMA 2I4IA 1NBMA 4PHFA 3WRYC 2GF0A 1CIPA 4BLQA 1G8PA 1FUKA 1Z0IA 1E4VA 3JVVA 4N0EA 1F2TA 1RIFA 3IBGA 1Z06A 2EU8A 2P3SA 1OT3A 1ZINA 1LNZA 2FFQA 2IYXA 3CF6R 3AGQA 1IXZA 1XD2B 4F91B 3K9LA 4I4LA 4EPXA 3GLFB 2PJRA 3DPUA 1GOTA 1NVUQ 3HYRA 4NONA 3ND9A 3TR0A 2WBLC 1R8SA 4L8GA 1IONA 1DAIA 4K46A 3DDCA 1XD2A 2JEOA 4M9SA 4NCIA 1YHNA 3GLFA 2V1UA 3ZIAA 1O87A 2IK8A 3O8BA 3PUYA 4MRNA 1GNPA 1G6HA 3SQXA 1H8EA 2HLDA 3KQUA 1X1SA 2BMEA 4GMDA 4GBMA 1VG1A 3W3AA 2WMNB 4A0GA 1UBEA 4LBVA 3QEOA 4GP7A 4LJ5A 1CP2A 4B73A 4M22A 1NNEA 3IBYA 5LDDC 3ZVMA 1GRRA 4N3NA 5FL7D 5JWOA 5KHOC 4LYHA 4PC3A 4BPBA 5E3HA 1VYTA 2J7PA 2PMDA 3K9GA 2QZ4A 1T6NA 1XBTA 3RNLA 3U7FB 1T0HB 3C5CA 2BHRA 1RPZA 2FEOA 4HB4A 4CRWB 5BN3A 2IC5A 1ZNZA 3U4QB 4XVQA 4LHYA 3AKYA 1JNYA 3SNHA 1OXUA 1NN1A 1VCIA 2Y8EA 1UKVY 3H4MA 4RD4A 1FMLA 3VKWA 4I81A 1XTRA 2VQSA 1U0HC 4YMWA 4RZXA 3RDPA 5KSOA 3WMEA 4LJYA 1EFHA 3OEHD 2F6RA 1KI2A 3U4QA 2ZI5A 3B6EA 2H57A 3ZZ0A 4NKRA 1NKSA 3TW8B 3AV0B 2F43B 3NDPA 3LW8A 3UATA 1S8FA 1N25A 1T4GA 5C4GB 5G41A 1E96A 2GJKA 3SEAA 1YKSA 3I62A 4L5BA 3PEVA 4XIGS 4XOIA 2F43A 1AN0A 3P20A 1N6LA 3T5DA 5FPYA 4GT1A 3AVTA 2XAUA 3H84A 3LQRA 1ZP6A 2NPFA 3CPHA 2WZQA 2ZTSA 1LTQA 3CRVA 1QVAA 3EZ9A 4L15A 2WSSA 3FKSA 4P4UA 1FW6A 5KPJA 3OIWA 1LVGA 3W3ZB 4C0KA 3B1ZA 1N3BA 4R2HA 4YMUA 3UK6A 4OHXA 5IK2D 4TSFA 1G41A 1SVMA 1ZMXA 2C96A 5EE3A 2XTNA 4BFUA 3HPQA 1YZLA 2JJ1D 1T5LA 2PCLA 2R44A 1E2FA 4LJAA 4B76A 3OZXA 4JS0A 3D3QA 2GAOA 1EFRD 1GDDA 2Q9AA 4RKEA 2ECKA 2QSZA 1AS3A 2W0SA 2YWFA 5J5CA 2BC9A 4C0JA 4C9BA 2GTPA 3QKSB 5FR1A 1G8HA 2OE2A 1DELA 2KBEA 5B57C 4M9ZA 2ZRDA 1Q1QA 2IUSA 1OIVA 4OBEA 3VR1A 3GJ4A 4HZIA 1FL9A 1VG9B 3QKSA 2IF0A 1JXOA 2G3YA 3QG1A 1WDTA 2PX3A 2EFCB 4V03A 1L4UA 2VEDA 3M1IA 2PH1A 4PSVA 3PR1A 3VKHA 4RJLA 1ETUA 5C4MA 4TLCA 4O25A 4A6XA 5JBQA 3AVQA 2NO9A 4JLJA 1P73A 1RRPA 1CF4A 2A5YB 1E2EA 2WJVA 1CR0A 1U9IA 1KMQA 4DLUA 4NBSA 4PAMA 4D0NA 4UXHA 4DSOA 4DVGA 1UFQA 4A15A 5K8LA 2W83A 1OFHA 3ADKA 1KO1A 5DO9A 2VP2A 2XSZA 3R9XA 1IQPA 2PLRA 2AWNA 3U3OA 2WPDD 1T3LA 1G4UR 1IOZA 1LFDB 1L7VC 1Z0AA 3PUWA 3B7GA 4A4DA 1E4YA 2Q9CA 1WRBA 1KO8A 1RYHA 4UNQA 1SXJC 2Q6TA 3AP2A 4HLUA 2QROA 3IIMA 4IOJA 1XEWX 2Q3HA 3OHMA 4F4JA 2YVUA 3KQKA 4BFZA 3CR8A 1G64A 2O52A 1MO6A 1OXXK 1P62B 3C8UA 3L8ZA 3QIAA 1TQ2A 1E1QA 1GWNA 1R0XA 3RS3A 3GLGE 5UKDA 2C95A 2DWQA 4PHGA 1NLZA 3BORA 1CR1A 1DVRA 4BGDA 4WBSA 4F92B 4TT3A 1NRJB 1TEVA 1FOEB 1BO6A 1M74A 2J59A 1ZVQA 2I1QA 1KGDA 3KFXA 2GXSA 1OJLA 3LV8A 3RVBA 5FPKA 1N6IA 2VH5R 1P61B 2HT1A 2RGDA 5AR1A 3AF3A 1OIXA 3HR8A 1Y63A 2ZIAA 3A4NA 4LC0A 4LHWA 3RABA 4A0FA 4JSTA 3QI2A 2EYQA 2GVZC 4B3BA 3IEVA 3C4JA 2VP4A 3TUZC 3PIRA 521PA 3GFOA 3EPLA 3CX7A 2MMCA 2QPAA 2ZR0A 2R6FA 4OQXA 4O3MA 2IXFA 2DY1A 4FCVA 2O0HA 2AD1A 5JJLA 4C0HA 2GF9A 2FGKA 1XZPA 4LV5B 5FOUA 2ZXUA 5CK4A 1G3QA 4ABYA 3WYGA 3UKDA 2DBYA 2ZUCA 1E1RD 5JS7A 1JALA 4HYYA 5HE9A 1JAIA 1X86B 1JQJC 3CRQA 4KU4A 4Q7MB 1F6BA 1QF9A 3IHWA 2CK3D 1GL6A 1RJ9B 3R7WB 4Q02A 1FPMA 3F0TA 2FPMA 1SGWA 3RHFA 4A6PA 1DO2A 1U0LA 1UADA 1W4AA 2IYLD 1D6JA 4EFNA 1RJ9A 3R7WA 1GM5A 1Z6YA 1AQUA 2UKDA 1LF5A 2FF7A 4XWAA 4JL8A 4PR0A 4URYR 4H1VA 3SI7A 1GNRA 1IY2A 3QVVA 2LKDA 4B44A 1HQYE 3L8YA 1YR7A 2O8DB 2F1RA 1N5LA 2GILA 2IUTA 5DYIA 1YRBA 3HR7A 1IN7A 3DOFA 3N70A 2O8DA 2XTMA 3OEHA 1XF9A 2REXB 3BK7A 3UWKA 2WJHA
chains in the Genus database with same CATH superfamily
3TNLA 3ITDA 4R8RA 2CKMA 2DUMA 4Q9IA 3MAAC 1D2AA 1YQWA 1JA9A 2Q3MA 4C5BA 4D4JA 1XR3A 4AY6A 1FDOA 2YVAA 2Z5FA 2VNKA 3JD1A 4JYCA 2YHSA 3GD7A 4G01B 5DGDA 2QZPA 4M0UA 2HT6A 3ASVA 4BTVA 4YRBA 1CQIB 2XMDA 4P7FA 1Z4IA 4U7WA 4OTZA 2XD4A 5KTTA 3LWDA 4C0WA 3U19A 4JVSB 1CZKA 1Q77A 4M1EA 2VF4X 4FYHA 4TLAA 4BGEA 4UM8B 3RK1A 5BR1A 2WD7B 1PNTA 3H2GA 2A5LA 4ON9A 3TXXA 1L7NA 1EVJA 1EJ6A 2FEPA 2H5JA 3EFHA 3PFIA 1JSRA 3DYIA 3HKCB 5MGNA 3NNNA 4GEKA 3GCXA 4PCLA 4DRYA 3QMPA 2B21A 5JXIA 2UAGA 2WWVD 3AUSA 2PUCA 4LOHA 3SJ7A 2DG2A 2OPBA 5LJLA 5AHRA 1LBIA 1B8UA 1OXSC 3GCGA 3OWHA 3TUIC 4E3WA 1Y89A 5K4GA 5I9LA 4QEDA 2B2NA 1R1DA 5E6RB 1BC5A 1GUFA 2AXPA 1SMKA 2G40A 3CLSC 2VUSA 3DLHA 2AZTA 1N1GA 2VAWA 4FW9A 1L5WA 4RA6B 3QPAA 3K53A 4I08A 3SSNA 4W1QA 3ZGXA 4E4RA 2Z3VA 2EKPA 1R4NA 4RK0A 3USES 1QIKA 3TB6A 3TI7A 4A8PA 2P9GA 3X0DA 1UBFA 1Z6QA 1HL3A 2VQ3A 3DEJA 1XCPA 3DL7A 3GLKA 3I34X 3P2OA 4OM8A 3WLTA 3ZDQA 1QSGA 2CMHA 5FTKA 2FG7C 1LJUA 3QY0A 4Y7DA 4ESEA 6CHYA 1E3QA 3AX6A 3N8GA 5JQGF 1CS4C 3ABRB 3BL5A 4ZALA 3A2KA 4E22A 3TR6A 3CTMA 3U7RA 4XI9A 4A0SA 2QX6A 3NO4A 4BP1A 5KTPA 4RQTA 3K1ZA 4D9KA 4QLBA 5FTLA 4JI2B 2ZIFA 3C5EA 4AS2A 2RK4A 1DQSA 2A7XA 1GL3A 3K09A 1USGA 5TJHA 1HZZC 4UEQA 1EUYA 4JLUA 4ZQGA 4ZC1A 2BUAA 1E5QA 1QX4A 2WYIA 1BVUA 3JARB 2AQIA 4WACA 4TRNA 2JGKA 1QHNA 2D1TA 3DBRB 3FROA 3R20A 5DI3A 4EKNB 5AM3A 3IAS6 1SKAA 3C1AA 4JR2A 2CLLB 1T9CA 4JBHA 3SGLA 3INRA 1YQGA 1T0PA 3LSYA 2LUOA 4PYQA 3WV5A 1XZMA 2QLFA 1Z4NA 2P6UA 1S8AA 1RHRA 3G2PA 1GNQA 3EXAA 3OAAD 3KELA 4ZOLB 3CUTA 1E2BA 2PBFA 5EJGA 4PX3A 3WLHA 3LT4A 1THGA 3C6BA 3WBBA 3SY8A 4HY3A 1NVKA 2HLPA 1JG7A 2ZU0C 4CDNA 2GZDA 1NV9A 2BGUA 2FPOA 1DARA 2ZYUX 3JRXA 1VMAA 3JYOA 2I3ZA 3D6VA 4GBGA 4IWYA 4Y1GA 5L95A 1Q21A 2DBRA 5TE9A 5AM2A 2HA6A 1DKMA 4EJSA 3EPPA 5K8UA 2EX0A 3W3AD 2JBWA 3BGDA 1P9WA 4XLLA 1ZN2A 3V80A 4XB1A 1T6XA 1MVOA 3P0IA 1MUUA 3KPWA 5JNRA 1JPJA 4YAGA 1KS9A 4MEJA 5FBZA 1S1MA 2CJWA 2QT9A 3QTTA 1JN0A 1F1JA 3EFBA 3NHWA 2RH9B 1CULC 1UCFA 3AI7A 5F2EA 4FOLA 4CMAA 1DLIA 2Z09A 5SY9A 3EXFA 3W5IA 2PLWA 4E4TA 1EFPB 2A7QA 1K0UA 1VZ2A 2QTHA 4ACBA 4RIIA 1J0AA 3OVMA 1HDEA 4Q1VA 3OZWA 5TEVA 3S2EA 3UAYA 3X1JA 2GN8A 1YKFA 4KLZA 5JY1A 1TVKA 1K08A 1JQ5A 4TYPA 4P0PB 5EZ5A 5G0TA 4UEJA 3QVWA 5GZ6A 3ZJUA 4B2LA 1T5DX 5CH3A 4BKMA 4BO5A 1AUPA 4JLAA 4PAGA 1ZWLA 1KYVA 4RE6A 2IXTA 3ZBPA 1AURA 1R9GA 1PWYE 1UWLA 2QHXA 3MTQA 2DECA 4K40A 4NRDA 3P8ZA 4WLOA 4ARVA 4AX8A 1KZ7B 1MABA 1UMKA 4DCMA 5A4KA 1FQOA 4AP5A 2H16A 1PGNA 3OTHA 1A1VA 1JNXX 2D1SA 2ATVA 2VF2A 4OLBA 3MTIA 2JA2A 2VNSA 4DPMA 5JYDA 3HH8A 3TLXA 1SVWA 3DV0A 4GLLA 4BKPA 1AKUA 3NPAA 3IJRA 2Q0HA 4L22A 3ZQJA 4YAUA 3V7NA 1EIZA 2JLCA 4TUYA 3DKPA 3O3OB 2AJBA 2VRCA 1IY1A 1IZ9A 1JQEA 1PWHA 3PIDA 3MMPA 3ZWXA 2YJNA 3OOJA 4Z4GA 4CV3A 2AMYA 1P7WA 4GPIB 5H9WA 1JHZA 3UQYS 4RA9A 3EBOA 5KOHB 2NV6A 5JSZA 5DNDA 2FCRA 3CEMA 2ZI7A 3H86A 2OT3B 1SIWA 3X1XA 1SUFA 4JSRA 4YRZA 4Z5XA 2V9PA 3NTOA 4LJLA 5DHRA 1I1HA 4AICA 4JVMA 1JIIA 4L5AA 1WLYA 2V7PA 1JFFB 1YC2A 1PRYA 1Z2NX 5JMPA 4AZWA 3FHOA 1QP0A 5G53C 4HTFB 1C3OA 1X8KA 2J7PD 2VIIA 1A5BB 1WZUA 2XB8A 4TTVA 4DMGA 3EEOA 4LXIA 4N7RA 2GJAA 2MR5A 1QZXA 3CRMA 3GJQA 4NL4H 4UXIA 5AHOA 5AW5A 1JJVA 4NMWA 2LCQA 1SCJA 1UMBA 2ONKA 2POQX 3NHLA 3UT0A 2D7JA 1Z15A 5A3QA 4NBRA 4YC7A 2VPPA 3PUHA 2C3MA 4RY0A 3Q9NA 2BFBA 1Z3IX 1TKRA 3ONVA 5JD3A 2W4IA 3E3NA 4FYMA 3OLYA 4FE4A 4G5QA 4B8ZA 2NSLA 2IHYA 2QSUA 4FFRA 4O0MA 5JYBA 1IVSA 1UXHA 1ZM9A 4XARA 3RREA 1G6OA 4JB0A 2R1TB 4L02A 3DE7X 4Q3CA 5DT2A 3X1ZA 2QX4A 3IGFA 5KNLA 2NT4A 1VBMA 1WVIA 1NSTA 3EFOB 3HGQA 3DFUA 1ODJA 2HHCA 4LWOA 4Y2RA 4ERXA 3PDHA 3FCAA 4BMYA 1RI1A 2G1UA 4QARA 3G2OA 5T4EA 4EHFA 3T7DA 2ZI9A 3ZGLA 4LJRA 1NKTA 2C4WA 4YCBA 1XV5A 3VISA 8MHTA 1VKHA 5CB8A 5KNBD 3RK0A 3O8LA 2JZCA 2SBTA 1G291 1HE5A 3EHEA 3OMXA 3STVA 1IMOA 1E6UA 4E14A 3AHJA 1JEOA 1VJDA 1VMDA 5JC8A 5P8WA 5JV5A 3IMFA 2AOUB 1M1YE 3H2IA 2J8ZA 5K3SA 4JC4A 5JDIC 2KPOA 4CYMA 1YR8A 1KAEA 2QSYA 4G2TA 2VF5X 1BFUA 3BIOA 4KSBA 5E1MA 1NI4A 1SG9A 5F1PA 3QG5A 4MDYA 5BYKA 5FEUA 4PO1A 3GUUA 2ZYSA 1M2OB 3DB2A 4Z4HA 1Q7TA 2RH5A 4JX8A 5CPFA 3GJ3A 3PQDA 2O2CA 3MJ4A 1BDMA 3VR5A 3RAPR 5LFAA 4AKIA 3V48A 4IS2A 3PHGA 1T9GR 2FFJA 1C7JA 4LISA 4TS4A 1N77A 3ADPA 4CHTA 3JV7A 3SYKA 1U90A 4M1SA 1GXSA 1VE5A 4FOPA 3ZLJA 1QU2A 1OV6A 4OGFA 4QDJA 1H2HA 1PSWA 1D4FA 3V1MA 1E6LA 1FXUA 1RRFA 2X3UA 4Z9FA 4R7GA 1RRCA 3OLXA 5E0OA 4AJHA 4Y6GB 1VL1A 1Z45A 4YCSA 4C7OA 2NP6A 2WWFA 3L07A 3JU3A 4FZ5A 1RPNA 3F3MA 5LZ7A 3P4YA 2VJPA 3TEJA 2ZRGA 3U6BA 4Z9BA 1OX4B 4PAOA 3SZ3A 4R0NA 3A11A 4CEJA 1R5NA 3OZAA 1W0CA 2P1RA 1BOOA 2ALJA 1Q7GA 1Z6PA 2QD5A 4HBGA 5F3WB 5FTMA 1EVLA 2I99A 4ICIA 5L40A 3T1QA 2CKDA 2GPSA 5BN1A 1HUQA 9ATCA 5C5IA 3WB2A 4EGAA 4XAQA 3TLEA 2C5LA 5LDDC 1A9QA 1V8BA 1EP3B 1NPTO 2FW0A 3CLRC 3R5HA 4KVZA 2XVXA 2Z08A 1R6XA 2PA3A 2DTEA 2V7XA 4DJ5X 3WGJA 3VNSA 1TYZA 5LP6B 4EA8A 1JR3E 1IULA 3LXUX 1PE0A 1U04A 1NSFA 2CNWA 3CZMA 3IHKA 4HAUA 4K7JA 4MROA 3T9BA 2JLAA 2XRZA 1Z68A 1FQJA 1XXHB 3ECCA 4MQBA 4PNPA 4IF6A 4LGYA 1DS6A 4Y2JA 2ONYA 2J3HA 4N0QA 121PA 3IQEA 2H2GA 1GUAA 3MMXA 2XCUA 3EGXB 3QU2A 1ZHOA 4HXFB 1GRNA 3NIBA 4DIUA 3PKZA 4ARUA 2BTQB 5D8DA 5CLGA 2O2EA 3DMYA 1QRRA 3JZMA 4HSGA 2QY6A 1FFSA 3G3EA 2R8ZA 4B3HA 2E4VA 1G7TA 5TX7A 1ZCZA 3GJ6A 4G5XA 4QBGB 3NEJA 2ZBPA 2DP4E 3I1IA 4D9HA 4LMBA 2IT1A 3KNZA 2O8BB 1SBQA 4B5LA 2FPGA 1RP1A 1DT3A 3KHKA 4OJKA 5AKLA 1CUJA 4TTAA 3FDFA 4QECA 1QIIA 4ZVMA 1K5GA 5KQSA 1N2HA 3QPBA 1YE8A 1KWGA 4X1IA 1UAGA 1YDGA 1YA8A 3TOXA 1WMDA 2GZMA 2UZ1A 3ZX5A 3CNBA 4F5YA 3GNTA 4B33A 2CLMB 5BUZA 3OHSX 2ZAOA 1HYQA 1KJYA 3FWKA 4HN4B 5A7HA 4DWVA 1TX4B 5HJ7A 2BE7A 2CB0A 3D9QX 4RD0A 5EIWA 2IYAA 1HEYA 5CXSA 3UAWA 1CXZA 2ID9A 4AC9A 2Z57A 4EJSC 1V11B 2PL3A 4J1QA 3T52A 3MBKA 3F7NA 1YAJA 1J7KA 2B2XA 2YUTA 3Q0EA 5SZJA 2HPAA 5EHQA 5JT1A 3D1JA 4RF2A 1T6ZA 1W5FA 4G6ZA 5EXDA 1LDEA 5IAKA 2QTBA 1F4PA 1XEFA 1O95D 2CEAA 4LJ7A 4FWIB 5BVHA 1DV1A 2ZRJA 3WQRA 5CA1F 1GGJA 4NOLA 1XOIA 3GLQA 2AOVA 5K0GA 1R74A 2BV3A 4MQ5A 3CLUC 1ZXXA 1XO1A 3NWOA 1UDXA 3O8NA 3K0CA 2JIDA 3TD2A 3QXJA 3E3AA 2H5IA 1QHYA 2AUTA 5F9HA 2QRQA 3ZNPA 2EDCA 1T9HA 3GH3A 4LBWA 3BFJA 3EWSA 1EHYA 2GSDA 1XQ9A 2OCKA 1A97A 1JE0A 1LRJA 1ACMA 2HC9A 5TQ2B 2QD4A 3SQDA 4D5EA 2FZLA 5K0SA 1JHOA 3IP8A 3LYLA 3GLIB 2A67A 1M5UA 5AHXA 5G0VA 4AP9A 5AQEA 1CZRA 3ZS9A 1FQWA 4O63O 1T36B 3F1KA 1H1DA 4DCSA 1P1IA 2W6CX 4IFTA 2Y6VA 4Y67A 4UHCA 4CKBA 4RF3A 3K1AB 2R86A 3IA7A 3NIWA 2WC1A 2VA9A 3LJKA 4B6JA 2X3FA 3EUEA 2EC5A 3BDIA 3NJ4A 1DBVO 3N2EA 4FYWA 1CUVA 1RHJA 4J9VA 3RIHA 3PEFA 4F7WA 4Y2XA 1QYIA 4LY9A 1AGYA 1IY9A 1VL5A 3SKYA 4DSAA 3EGDA 1UJBA 1RDFA 5JD6A 3BD9A 2JFNA 1ODCA 1G8JA 5AW7A 2HLHA 2GJ8A 1SCBA 1KE1A 5MN5A 2QP9X 1QLHA 1D6SA 2QRKA 2V8BA 3ETGA 1PV2A 4MVXA 1Q1ZA 4D3ZA 2QZJA 1ZUWA 3R9KA 1T0UA 4LRUA 1NLUA 3RR2A 3LGXA 1WXWA 1XFAA 5DTRA 2JH9A 3PEUA 4BWFB 1YVEI 2GEKA 1RQRA 3HM2A 4IDFA 1PS9A 2IIQA 1VLJA 3B52X 1V5GA 5CX1A 5K3CA 4EYGA 4BB9A 3K6SA 2Q8QA 1BFKA 4D0LB 1AKYA 3I6IA 3RM3A 4F38A 4ZFNA 1Q50A 2DKOA 3KOZA 2H17A 2HL6A 1OA0A 4LNUB 1PVDA 1WD7A 5JNLA 1VIYA 3VJLA 1OB5A 2QD2A 1T3TA 2J0UA 2NZ8A 1JJFA 4OAPA 4UQPA 4ALNA 5CHYA 2DXIA 4G5OA 3WRXC 2GH1A 1SY7A 2VUUA 1AD2A 4S04A 3PHCA 4KXLA 3ZHRA 4X44A 1EDZA 3LHFA 4LHVA 1CRLA 1U99A 1MO5A 1G0OA 2AXNA 3H5OA 2GNOA 4GUDA 4TL8A 1YAHA 2YL2A 1DX9A 5TNXA 3VTZA 1XRLA 2ID8A 4BLPA 1ND5A 1YDEA 4PX2A 3ROQA 4J29A 5L3SB 4HGPA 1Z2CA 4UREA 1OX6A 1TB4A 3I9KA 3I01M 2FQQA 4QTUB 4ZDWA 3FWNA 4WCVA 1DAFA 4BMVA 3T7TA 2DHDA 5KX5A 2ZUDA 1E0KA 2BZ1A 4ZYTA 1GG2A 1Y1QA 5HZHA 3BH7A 1F6WA 3CKYA 1HO3A 5H83A 1EB9A 1UBCA 2HK6A 3OPNA 3HNPA 1CY1A 2ZB7A 2E1RA 3AY3A 3CZCA 2DPXA 1DZ3A 1Y5RA 2YN0A 2R7NA 5IKEA 1FDVA 3QOWA 4H18A 3CVYA 3EZFA 3FHCB 4CGYA 4DV7B 4TTIA 1MRSA 4HVAA 4EYSA 2XE7A 2F9FA 3A05A 5DHFA 1WBBA 5L3RA 3AFHA 3JXEA 4OFWA 3W77A 1FLNA 1MFPA 1ITZA 4GLOA 1COWA 2HWWA 3AB7A 1T8SA 3PEWA 3KSAC 5KTSA 4DUPA 1HE8B 4BFVA 3JQAA 1ZW1A 3P9XA 3ST7A 3CINA 3HN2A 4JP3A 1HTWA 1TZ2A 4GL2A 5DZSA 3ZTTA 4M8KA 1GGEA 5JSQA 3W2EA 1MA3A 1JZTA 3PNYA 2NU8A 4UE2A 1S5PA 2F90A 2XWBF 1L5ZA 4E08A 1NE7A 2IF2A 3HXPA 4HDKA 1O6ZA 3W2TA 1TU3A 1R18A 3DUFB 3S55A 1G18A 3IQDB 3OUUA 2V97A 4G0PA 3MJRA 2X8BA 5COAA 5DPMA 4YB8A 4FE7A 4MUFA 3WKAA 2JFXA 3MOIA 4LF4B 3SXUA 4ILKA 4N9WA 4WECA 4KK4A 4B3DA 2KI5A 4NNPA 1M75A 4OHKA 5HQ3A 5KYYB 3MXTA 4L2IB 3W1EA 4UM9B 3T3PB 2IOQA 2PZMA 4NQZA 4PWYA 3THYA 1XCMA 4XZ3A 3ER8A 1POXA 1JHVA 5I7SA 4ALMA 2FZKA 2I7XA 3OBIA 4RFLA 5BSVA 1RAFA 3ENQA 1F3OA 3KZNA 2R5FA 2IYWA 3QX9A 4MRMB 1K2WA 1LQUA 1ML3A 3U3KA 3IESA 4A8TA 2ATCA 4ZARA 4TV8A 4WFKA 5T6BA 5HTOA 1Q6ZA 2FRDA 3DE4X 3OIDA 4K6MA 3RRXA 5ICSA 5JTTA 2DWPA 2QRVB 4B3JA 5KC9A 2N9UA 2C94A 4AUMA 2E5FA 4TZ6A 1E98A 3RHTA 2W6JA 2R751 4DDTA 1RR6A 5K99A 5KNCD 4R0VA 3L4KA 4D96A 3LA6A 2A9OA 2R84A 3FCOA 4UMDA 4E5VA 1C1DB 3PJFA 2EOAA 3BWCA 3E6AA 2B4TO 2XW6A 1OLSB 3ECSA 3ZCTA 2NMVA 4G4SO 1NPDA 4IDDA 2OV1A 4EL0A 2C2GA 3DOJA 4MARA 3CKLA 4UE3S 4NE7A 3U5ZB 1P1JA 2D7DA 3MCWA 3A6LA 4INJA 1TIBA 2W5UA 1O3YA 4C7XA 2W2VA 4MINA 4XPIA 4WZBA 1EGAA 2J6IA 2P4SA 1G8YA 4WE3A 2UXDB 4KV9A 2O7NA 5COBA 1MTZA 3SYRA 5B12A 3B7PA 1JS1X 3GNSA 3ZCPA 3ENZA 1PU2A 3E8MA 4WJKB 4EHKA 1B43A 1CFJA 2VDWB 1PLLA 1KI9A 3H2SA 3OD5A 2X22A 3DF9A 5DBOA 3TXAA 3KKMA 4ENQA 1PR1A 3DE0X 1RT9A 3GNLA 1IBRA 4I4TB 4ZI7F 3K70C 1WMFA 1P2UA 4DARA 3HSYA 3OQJA 4PYLA 4UDYX 1ZZEA 1U8ZA 4R41A 1DTEA 3HBNA 1KJWA 4C7MA 1QGUA 2CWDA 2GVDC 3V4PB 3UXMA 4WJLA 1ESDA 3B6JA 1KH2A 2VP0A 4YRLA 3SDZA 4B6GA 6NULA 5KEIA 4MKIA 4NS4A 4D2IA 3GPIA 2YFKA 5BV2P 1V1MA 3FYTA 3N8HA 2HA0A 3AB3A 5D3QA 3JD2A 1XTVA 5ED0A 1X7DA 1KEVA 1WBJB 5GM2A 3L02A 5C8XA 4MV4A 5EZQA 2MYPA 5C51B 4FEEA 3HY3A 3U7IA 2VP9A 4X91A 3TK1A 3MIZA 3OTIA 3BCRA 5B37A 4RDCA 4IFIA 3RANA 3T5BA 4BTEA 4DLTA 2QBYA 1CFZA 3BAFA 4W1PA 3DYBA 4DCNA 4E1VA 2W2LA 5CYFA 4HEA1 3ZWAA 5DYYA 1AX9A 2ZRCA 4QYTA 3RS7A 3DXYA 3PJEA 3P9IA 1AMOA 4DN6A 2W6IA 1XP5A 2BWJA 4LDJA 1J8YF 2OB1A 4G63A 3TPCA 1QTIA 2AE1A 2OWEA 2IEGA 5BV7A 2VR1A 2FWNA 1OYVA 2C4MA 3SN6A 4D0RA 1Z56C 4DANA 5FFNA 3G2NA 1Q0TA 2RGGA 3H7AA 1CJTC 5B2FA 5EESA 4QICA 3PUIA 4IV5A 3MJVA 4TMVA 4GOJA 1C1XA 4D6XA 2PIAA 1N9GA 5KVVA 1E9FA 1NDHA 2P78A 5AM5A 1YI1A 3FVWA 1PCXA 4B4OA 3K94A 3FFXA 1NF8A 5LUAA 3Q2KA 3VNUA 5ERXA 2YZ7A 4DDKA 3HKBA 4MR7A 1RADA 3U0BA 2H52A 5LXTF 4G4SP 1ABEA 1UJ5A 3NANA 1II0A 1C1YA 1JHMA 1GL7A 1TKCA 2XUZA 4PFJA 3RQIA 3BXOA 1NP7A 1SVNA 6ADHA 2HHHB 1GKUB 4NHEA 2IS6A 3WGGA 2R79A 1JDNA 2AG1A 2WD7A 3DH0A 5JAZA 3HNRA 3GZNA 2ZBFA 3UT5B 4IXWA 5A4MS 2HU2A 3U7QA 1PFVA 2PKQO 2FRVA 3CA8A 1DWPA 2R0QC 3GFRA 3VU9A 3IYLW 3LXXA 2WZBA 3NWJA 3ZZUA 1PIWA 2LWIA 1G7CA 3N59A 3NKFA 2DULA 1RVDA 4M7WA 2X9VA 1XDUA 821PA 4TROA 5BOSB 4Z4QA 2TYSB 1M2HA 4DQVA 1A5ZA 1DDIA 3MPOA 3E7DA 3QRWA 1U8FO 3HYLA 4Z2YA 5BR4A 5BSHA 1A8QA 2OBBA 1JF8A 3LWBA 4L6CA 4HUQA 2XYGA 2XZTA 4O29A 5E6RA 3RG2A 1V47A 3RK4A 3JWIA 3UFBA 3E9CA 4KAXA 2C2MA 4JB3A 5FYDA 4KPUA 2X76A 2C4KA 1OSNA 4FSXA 1NVTA 3C85A 2FPRA 3TLBA 4DABA 1WHTB 2IZ6A 4URXR 4MTLA 5ALQA 1IXRC 5JVDB 3VZBA 3AI1A 5IH7A 5F5LA 2P6MA 2CV1A 4TWAA 1YV9A 4YXWA 2WWWA 1H5QA 3H2BA 4RORA 2OQVA 2VHTA 1NI5A 1V6CA 4DTIA 2WPNA 1SKQA 2BDTA 2O1SA 1NUSA 3O8OB 3WR5A 2I7CA 4HDMB 3RPEA 2YWRA 4XJTA 1GGFA 3L0OA 4B7CA 1Y6FA 4FCCA 2HSWA 2YWEA 4NSNA 3PGA1 3RYHB 3SZRA 3A9VA 3HFRA 3MZ0A 4WXEA 4RSRA 4EKDA 3NU1A 4LMPA 5EHZA 1LWOA 4BE7B 4HX9A 4KR9A 4HAVA 4K9SA 4ZI3A 1QPBA 2YV3A 1LY1A 2R7MA 1OVGA 2VDUE 3DTNA 4QQKA 1F51E 3BF7A 1H1LB 3FBTA 3W0LB 1AHHA 1VE9A 3G0BA 4QU9A 3MCVA 1S2OA 4R05A 2CN1A 3ROFA 1B7GO 3ZBUA 1T9AA 1X0VA 2QM0A 3HVHA 3NVDA 4KE7A 2XWQA 1TAQA 1Q7RA 1VHLA 4M2LA 3TTSA 1OYYA 1W0JA 2Z83A 2EJWA 4UHDA 5JCJA 3F8SA 2HNBA 4XKJA 3OOHA 4Q4AA 4Y6OA 3U17A 1AB6A 1GFIA 2OCPA 1WX1A 3IALA 2K7FA 1EP1B 3PC2A 1CIVA 4ME6A 1CEXA 3OTOB 2B8EA 3OA2A 3OO0A 2W2MA 4LQCA 4F7DA 4TXNA 3LPNA 2TECE 4JLPA 4GNKA 1GKYA 3T15A 4D02A 4ER5A 1CQJB 1XAIA 4FGKA 5FL3A 5L6LB 3ICQB 3IEIA 1JHUA 1RVV1 3ASYA 3L5KA 4P4TA 2XX3A 5TMBA 2FW6A 2KW5A 1XMQB 1ACJA 1G6KA 1D04A 1RLUA 1Q0LA 3AHDA 3FTDA 4UUBA 1H4QA 1PJBA 3IHTA 5F33A 1GZ3A 2VHVA 3TLZA 4JGGA 3IKJA 4B74A 3IAM1 3OC0A 1QQBA 3IV6A 3E03A 1GCOA 3DQZA 1PR4A 2CNOA 1K0FA 3DLIA 2WKPA 3CH5A 4LV6A 2P4QA 4B9AA 4RFSA 3K15A 3P96A 1L4HA 3BZWA 3FPJA 2QVBA 2BFMA 2CD9A 2UVDA 1PNOA 2AYYA 3JAWB 4I50F 3VZCA 4OI0A 1QZZA 2J3MA 2PKQP 1P75A 3G7NA 5I9MA 4A0RA 5L4NA 4MGKR 3QELA 1RYFA 3IMKA 1QVVA 4RTKA 2FFHA 4OKSA 1F2DA 4UOEA 1P18A 4OV6B 5GOTA 5IZCC 1BJKA 1PJ2A 3T4XA 3L82B 4W9NA 2CHVA 2OYSA 4GS5A 3D6HA 5DWQA 1IZ8A 3AR2A 4I14A 1H2WA 5DNYB 3C7CB 5FBWB 1P5JA 2EXXA 4MW1A 4TMKA 3S2GA 3NV7A 4JC5A 4ZZ1A 2R6JA 4RKFA 5ALZA 3PXDA 3AU9A 1K7XB 1PW5A 2V4ZA 3AUJB 1I5OA 5AI9A 4IS3A 3SR0A 1E18A 2O8CB 4UASA 4HOYA 3RGGA 1ILEA 3HHPA 1A72A 2PS1A 3LCJA 2WLSA 3RVSA 1E9BA 1KQPA 2AE2A 5TIIA 5EQDA 2FRDC 4JJ4A 4ZD6A 3JQDA 3SNKA 2RK6A 5FA8A 3WL6A 3FJOA 2QYSA 3V4VB 2X0KA 1CQPA 3GAAA 2CLCX 4RH0A 1T9BA 2BEVA 2WE7A 1UXKA 3QFTA 4OI1A 1P5ZB 2BOVA 1W36C 4GOLD 1AY0A 4OKIA 3I61A 4KXWA 3IDAA 4TXLA 4UZSA 5CCBA 4LC9A 3GLGB 1XAHA 2O07A 2Q9BA 2CLOB 3P32A 4IJ6A 2OXEA 5AOCA 4A2QA 4RE5A 4GOND 2VQ6A 4UNRA 1DAMA 3QM1A 1H66A 1WZEA 2JLUA 2Y1WA 4ENSA 4TN1A 2E87A 1N5RA 3IE0A 2VJDA 4C1NA 5FAKA 1UAAA 2BMVA 1B6TA 3PFNA 1E2NA 2BFWA 1TUBA 3LPAA 5I8ZA 3VTKA 2WAMA 4IMPA 2GM9A 3WYEA 1SWWA 2OR3A 2A5JA 4HG2A 4ZO6A 3CVXA 5CLIA 1WCWA 3VHQA 3A6FA 5CJJA 3H6HA 1KK1A 4YJ2F 1IL0A 3L4EA 2HIMA 3LZ6A 1Z0JA 3TW4A 4IJ5A 1IPEA 3EQ7A 1ANKA 3LW7A 1PWXA 5JHHB 4WAUA 3G6KA 1QORA 4EPYA 3CW2A 7ABPA 1U7WA 5K2MA 2JGDA 1U7UA 3BF8A 2RGBA 3WV4A 1XPOA 2BM1A 4I6EA 3QYFA 2YV2A 3ISTA 2ODQA 4X20A 4KMSA 2FP3A 2HMVA 5LD2B 4EBBA 2CNNA 2W00A 3MB5A 1DKNA 4X85A 3S4YA 2QB5A 2CNBA 3TG8A 3AINA 3VNVA 3A31A 3HCCA 4B3IA 4NCJA 4TXHA 2ISCA 3ZCSA 4R7ZA 1A2BA 4MGIR 2RDMA 4C4AA 4RD2A 2E0IA 1X7WA 4GRIA 4OJYA 1E6WA 3ZWYA 4C4ZA 2PUTA 2HJVA 1IU9A 2RG1A 3KT0A 4GOMD 4LKRA 4ZRNA 5FO1A 3H9BA 3AFIA 2G1JA 1IIBA 4TWIA 1NIPA 4MWBA 4MDFA 5BQ5A 3OD1A 4MQ6A 1Y9DA 1L7QA 2PKCA 3C4QA 4IJUA 4WADA 4Y2YA 1XCJA 4EUFA 4F84A 1NF2A 3PPXA 4MI3A 3DEHA 1H8HD 2GNAA 4F4HA 3T3GA 2G1AA 3T41A 3K71B 1WHSB 2ODEA 5FNVF 1I2MA 1NG1A 2PD6A 1M0SA 4N6GA 4HZUA 5HR5A 1MHTA 1NR5A 3DBLA 1C0EA 3EVNA 1VHWA 3F78A 4YR7A 5JWRA 1RWOA 3T9EA 4QJ4A 2QJTA 1JFSA 3VJRA 1AUQA 5ED4A 1PGJA 1E7MA 1TM7E 3FDXA 5EFOA 2ZG6A 5JNUA 4GOOD 1RSZA 1P60A 1XRRA 4JENA 4JELA 4UM5A 5HDBB 4YCLA 3ZY2A 3PE6A 4I2NA 4KQKA 3RO7A 1IOVA 2W2QA 4II2A 2MWMA 2LE0A 4PONA 3N8DA 2C5HA 4NMMA 3TBFA 2V55B 4WOKA 4YCDA 3COWA 2RK3A 4YDHB 1FS4A 1EM8A 2OBMA 1QK4A 1FTNA 4CEHB 3FUXA 1JDZA 5TRTA 3ZK9A 1PQPA 1DIOB 4ETIA 3VSCA 2B83A 3WMWA 5KOIA 5KQPA 1RNLA 5KOYA 3ILSA 3VPAA 1DOZA 2WM2A 5IJ9A 1FFBA 1S9HA 4P4GA 3PTZA 1AXGA 4N3AA 3NW9A 4F56A 3T5CA 4UDNA 4KV7A 1I7SB 1RAEA 1A71A 7REQB 3ILYA 2NG1A 3HUFA 2ZRQA 2JFYA 1KZGB 4ETMA 3NDBB 3KQOA 3D6JA 4ZOAA 4AMZA 2HPZA 1C7EA 1KI8A 1ZIDA 4US0R 1WPXA 2JVJA 4NCHA 4YIKA 1W8DA 2PQ0A 4Q1AA 4CCYB 4G0NA 3I9V1 2HRCA 2EZTA 4P86A 4Q4JB 5LNK1 3RYCA 1U98A 1G2OA 1ZK0A 1L7PA 1W75A 2X1VA 2XWPA 2VVTA 3DKRA 3GEGA 3HGMA 9ABPA 2JFPA 2GZHA 1ZIXA 1HDOA 3TDMA 1FNMA 3QW4B 1QV9A 3Q5DA 1DQRA 2P6PA 4J6FA 2Q7OE 1E79A 1UBJS 2AK2A 1BJTA 2C4VA 2D2XA 3CW9A 1SC3A 2G4LA 2P40A 1P0PA 2FPIB 3AG5A 1B6SA 3EXEA 3OF3A 3QGMA 4EFMA 2OLKA 2RHJA 3W2IA 1BMFA 3U3JA 3ZYZA 1D2RA 1V95A 1XYVA 3R3HA 3FRJA 4ZT7A 5AWFC 4D9FA 2VAPA 2AT1A 2Q0XA 721PA 2UZIR 3EVEA 1CZUA 1NOKA 1ORIA 1QHFA 1RE0A 1W5AA 1DFHA 1EMDA 4GPBA 1U9CA 3IP5A 4RK7A 4BRWA 4YPOA 4DB2A 3B9PA 4BV8A 1LV8A 2Z9DA 3KWLA 2II6A 2Z43A 1DIHA 4OH7A 4CBVA 3I4CA 2HSDA 4B31A 2F8LA 4EI2A 4H08A 5AVYA 5IT0A 3UFXA 2UYHA 1XJ0A 2YXPX 3WISA 5B7QA 3I30X 1FYWA 3E9MA 4MZXA 1X1BA 3FKQA 2QXTA 4BCBA 4YP1A 5DV9A 3F9RA 4MW2A 2NYAA 4NYJQ 5G1PA 1VL0A 3RS2A 4HEHA 3QTBA 4JXZA 4WESA 4NOMA 2ZRPA 2C29D 5AW3A 2X5JO 1K5PA 4H4DA 4ZQBA 3U9SA 3OLWA 4CQLB 3RVJA 2X2FA 4DIMA 4CR8A 4IUYA 1WPRA 2XUKA 2NZWA 1BW9B 3EH2A 2FW9A 2GI4A 5JWHA 5ALMA 4I9UA 4C78A 3KLMX 2WT9A 4U2CA 2I6FA 3KOXA 1FVFA 4P32A 2GHRA 1CJUC 1XA3A 4JUIA 3MMNA 1JPNA 3PLNA 4XD7A 1Z2PX 2G9ZA 3KXIA 5LYJA 3CISA 4MV9A 1A4RA 3C5HA 1VKJA 3HZRA 3KM0A 3O1IC 5EUBA 1D4ZA 1QMPA 3W05A 1IYZA 3DD5A 8LDHA 2VDOB 4HH3C 4KCGA 4F96A 1KZ9A 4I1SA 2C5SA 2DF8A 1Q0UA 3DLTA 1E20A 2V0CA 4NYMQ 2X0JA 2Q21A 2AJCA 3K9QO 2PX6A 1UXGA 4W9NC 4E5SA 4O2RA 1G1MA 1TTQB 3T34A 3H13A 1CDDA 1WF6A 3OPQA 2ZBQA 3QENA 1R0SA 4AYXA 1Q0SA 2XE4A 3LX5A 1M2VA 1WXEA 4F71A 1HR0B 3M9WA 3LBIA 2O1WA 3NJ8A 4WV3A 3RC8A 4K9NA 3ICWA 4F21A 3SQMA 1U81A 1VLLA 3TMKA 3NTXA 5FUVA 4O1MA 3R0XA 1CLUA 1IM5A 4WA8A 4KO2S 3HV2A 4HGNA 3KV3O 3D7KA 2NZVG 2VJAA 4QPPA 1P4AA 4YQYA 5LQUA 2XMQA 4Q4DA 4QXQA 3N0TA 4Q9LA 3K0AA 4HMPA 4F12A 4P6VF 3TBKA 1UBRS 4IDEA 4DS3A 1YCHA 4LJ6A 1FXSA 8ABPA 2XCIA 3SC4A 2G25A 2FMKA 5F2OA 5TC4A 1Z6XA 2YXBA 1PR6A 3C15C 1P0CA 3JZIA 2ZEJA 3SIWA 4BLRA 3R9IA 2YBDA 1DRKA 2ZJ4A 2EGHA 4QUAA 3WJ2A 3E8XA 1UT5A 2WJ3A 3EXIB 3MJCA 1ODTC 1IZ0A 3H6GA 2XGJA 5JAIA 1PL7A 1QR6A 2W42A 3A6HA 1MEOA 2QIOA 4F3TA 1OJ7A 5JANA 1CJKC 4IIJA 5E9WA 3U48A 2MMGA 4NBKA 1JMKC 1JLMA 1KGSA 2AXQA 1U0OC 3KS9A 4GGPA 1J42A 1U8EA 4Z0PA 3NAQA 2R1ZA 3IMCA 2D0IA 3QZUA 4MCHA 2VJQA 2YW9A 3HKDB 4DLXA 3F4KA 4DQUA 4CTOA 4V1CA 3S81A 5FCDA 1P17A 5LLSA 4HGQA 1T2AA 1VP3A 4TS3A 3P52A 1Z8NA 4L4SA 2G0NA 1T34A 4R16A 4WBNF 5BMOA 5JCOA 2JLZA 2HUNA 3QPWA 4NCBA 4XRGA 1LQTA 3A4YA 4KOAA 1ACLA 1LBTA 4EARA 5T4FA 1J09A 1Z16A 1MXHA 2CD7A 4OFBA 3DT9A 1Y1SA 3HO6A 3ND6A 3FRHA 1Z5VA 4RPGA 4DIOA 2C8KA 1J20A 1VKOA 4UPVA 1N3IA 2IX9A 5B6IA 2IPLA 4OLJA 3NUGA 2BKVA 2AJ8A 4D26A 1UPFA 1W7AA 2YDYA 2C97A 4QPCA 3ADOA 2P9QA 3G8AA 1QB7A 5EE9A 4BQPA 1ZVJA 4EG4A 2QTFA 2GUWA 1QDUA 1VPTA 4YH1A 3UYLA 4X7BA 3OWXA 4LG1A 4Q5IA 5GJWC 1EWRA 3STWA 1SXPA 1BCRB 1M34B 1EWTA 1NVEA 1XHFA 2Q4BA 4ZMBA 1YNOA 1T2DA 1WXXA 5B30A 5IF9A 1NYLA 1Q2UA 2HSJA 3I52A 4R9SA 1M7GA 4NC9A 1R3UA 2OSVA 2ZS9A 4R8VA 2XITA 2IWHA 3SM3A 2Q1SA 5AW2A 3L6UA 1CR2A 2B0JA 1VECA 4B43A 4E5MA 1SBZA 1T0IA 4DIEA 2G8NA 2G4VA 1NWCA 4NBNA 4EKEA 4CTMA 2BUCA 2JAQA 3LHKA 1XZGA 3TGLA 3DF7A 1GQ2A