3Q72A

Crystal structure of rad g-domain-gtp analog complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
138
Chain Sequence
b'SVYKVLLLGAPGVGKSALARIFGGVHTYDRSIVVDGEEASLMVYDIWGDAYVIVYSVTDKGSFEKASELRVQLRRARDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein RAD
publication title RGK Family G-Domain:GTP Analog Complex Structures and Nucleotide-Binding Properties.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 49
structure length 138
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q72A00
1DAKA 3A1WA 1IQPA 2FWRA 1EG7A 1ZC4A 3NWJA 1MABA 4LBVA 4LHXA 2AXNA 5G40A 1IHUA 2QAGC 3KUDA 2WOOA 3I5YA 3T1OA 4L15A 4Q00A 5ANRB 1OH8A 5CK5A 3AKCA 5SZHB 1DS6A 4HAUA 4JLJA 3TSWA 4DDTA 1XXHB 3K9HA 3FOZA 4AYXA 3H0KA 1FMJA 4KVGA 3RC8A 5CIWA 1XJCA 3NBXX 4R2IA 2OBLA 5EXTA 3TUIC 3BK7A 2ORIA 1YQTA 3Q5EA 4Q48A 2YHSA 3UWOA 2YVUA 3BH6A 2QAGB 2QGZA 3FMPB 3IKJA 3K0AB 5EE1A 2OLKA 2GWHA 3KJGA 5TB5A 4TL7A 4AC9A 4DLXA 2NO9A 2PT5A 1II8A 3A1SA 2C04A 3NBYC 1K8RA 4YC7A 4Q7JB 1GG2A 4DUGA 1Z22A 4LYHA 1NJGA 4C0AC 1NG1A 1RYHA 4GT1A 3DM5A 2QAGA 2PCLA 3DOFA 3TVTA 3MD0A 2EU8A 5E7IA 3W6NA 5DH9A 3WNCA 1GTVA 3GLHB 5JCPA 2AWOA 5JRJA 4B76A 4B73A 5KSYA 3TNFA 1OPXA 1L7VC 2WJYA 4RCZA 3IO5A 4TTRA 1E1QA 4FXPA 4IDPA 4OK6A 3QXHA 3A8TA 1G20E 3A4MA 4GI7A 2NIPA 1XJ0A 4UXIA 3P4YA 2ZREA 3KKQA 2CNWA 3NDPA 3OFNA 3PUWA 4IDQA 4IXNA 1TTTA 3K0CC 1G6HA 2JJ2D 3TVDA 3CONA 2W2TA 3VR3A 1E32A 2BBOA 2WWWA 1GKUB 1XBTA 1Q1BA 3OIYA 4Q1FA 5JWOA 1DELA 2VF7A 3OEHA 1EK0A 1E2KA 1EX7A 1D9ZA 1E2GA 1FNNA 3PVSA 3ZZ0A 4KODA 4C0BA 2RH5A 4DLVA 1XRJA 2Z4SA 4P33A 2QORA 1E3MA 4XTRA 2RAPA 5JHHB 4PSVA 3NTUA 3SYKA 1Q20A 4CT4B 5JS7A 2JLXA 4XSGA 2GK6A 2Q3HA 4W5WA 4S2EA 1KO7A 2EFHB 3BRWD 4PO8A 4Q1EA 3FKSA 4JVMA 1KSGA 1K5GA 3QKSB 2N42A 5FTJA 3Q8XB 4TN1A 3A4NA 1J70A 4M1OA 2X19A 4AIIA 2ODNA 3MCAA 1DO0A 3GEHA 1F2UA 4WAUA 3FHTA 4PZZA 1W4AA 3R9WA 5TXGA 3AVVA 2IEYA 3K0CA 3EZ9A 1KYIA 3BOSA 1MO5A 4AD8A 4XVQA 1G19A 2ANCA 2GNOA 3QKSA 1NVWQ 2V1XA 2OBMA 1AS2A 3SS8A 3MJHA 2G1KA 2ZI3A 4TYQA 5C1BA 1XD2B 4EPWA 2NQ2C 2YWHA 2D74A 2A5YB 3BBPA 3LO5A 5CM8B 1XPUA 4C7OA 2YJTD 3WNDA 1GVNB 4BE7B 3NG1A 1P2SA 4PX9A 1IN8A 2GF0A 2I4IA 2OO7A 3RRYA 2V54A 4CW7A 4TLEA 5JRZA 1T4GA 1XXHE 3I72A 3KFXA 4M9ZA 4PHGA 4PR0A 3SE0A 2Z0MA 4ZIRB 2FU5C 3GFPA 4LRWA 4NU0A 2J45A 2O8EA 1F2TA 3CH5A 4E03A 3TIFA 4OK5A 1G7SA 4OI0A 5EP4A 2GEDA 2OFXA 1EX6A 2ZRNA 4TSFD 4EJSC 1AS3A 3RYTC 4IEIA 1N6RA 4MGIR 1TUEA 3ZD6A 4K81B 4OKSA 1E2FA 1N6OA 4AYWA 1UBGA 2RKOA 3RDPA 1E69A 4BEBA 4QJ4A 2D7CA 4M0LA 3MG9A 1XFAA 4GOKA 3MWLA 3RABA 2KBFA 3ZDQA 2FGKA 2QN6A 4POAA 5JHGB 4KBGA 1IM2A 1UADA 3HU2A 1DPFA 1Q57A 4HDQB 1CKEA 1E0AA 5EP3A 5LBIA 4IKEA 1X8LA 1OFIA 4FMDF 4TQAA 5BQ5A 2YOHA 1SXJC 4XD7A 3X1WA 3FFAA 4JMPA 1X86B 2A30A 2ZXUA 2FH5B 4DDWA 2NMVA 3BJIC 5J4LA 2IC5A 1ESMA 3SJCA 4S35A 2F3TA 1VG8A 2BCGY 3CNNA 5BN3A 4D0GA 4FWIB 3FB4A 4AI6A 4CF7A 4NYJR 2VP9A 2EVWX 2IXGA 1MKYA 3CO5A 4DEYA 4EFNA 4Q19A 4EJSA 4EQ6A 3CF0A 4A4DA 4CEIA 1XEFA 2C95A 2QGNA 5E3HA 5KNCA 1NBMA 3Q85A 1PZNA 5FI0B 4A8JC 4HSEA 4IOKA 2XTNA 4HDCA 1E2QA 1R8QA 1KGDA 1U2RA 1E9AA 1NSFA 1VG1A 4CGZA 4D2IA 2JLRA 2NO6A 2RGDA 3IBYA 5KPDA 2JLSA 4DC9A 2RGEA 4NHOA 2G3YA 4NTZA 2WKQA 3HDTA 5FOUA 2W6JA 4P32A 4G5QA 4TMVA 1J8MF 4QOSA 1DE0A 2B8WA 3ZQ6A 1KKMA 4BFSA 4D0LB 1E0JA 3EW9A 3W34A 3GJ4A 1UEJA 4KYIB 3ADCA 1SXJA 3P1JA 3KKMA 1TADA 3LBHA 4DZZA 4BFVA 4B71A 4LJ6A 1FPMA 3TAUA 5JWHA 4C9BA 1RRCA 1BKDR 3QKUA 1P72A 3RSOA 5AUOB 3AVTA 4G5RA 2IYTA 1G4UR 4Q1CA 2P6NA 2O8BA 3IEUA 3HP1A 3GEEA 3SOPA 3K70D 4A8JA 4JSTA 4DCNA 2J7PD 5J5CA 1DOAA 2FMXA 1HUQA 2ZRIA 3AF1A 4Q4AA 2V1UA 1C1YA 1YR7A 4C0LA 3L2OB 4HLUC 1OXSC 3I61A 2IX3A 2BIFA 5B57C 1BIFA 1NMYA 1AQUA 3ASZA 4PFSA 5KPJA 1OB2A 1JR3A 1ZNZA 3D31A 1Q1EA 2I1QA 2KSQA 1TMKA 3QE0A 3LX8A 3X1XA 2W6ID 2ZI4A 1QVAA 2R65A 3O8BA 2OE2A 4Z54A 1KAOA 2REBA 1N6PA 1XTSA 4QNRA 2JJ1A 3RSLA 3HR8A 1N6LA 1KK1A 2DBYA 3QI2A 3V4RA 1T8UA 4OJQA 1XD8A 1XU4A 2RCNA 2QE7D 2QT0A 1YJ5A 3NVAA 3WMGA 1NP6A 1CJTC 4XTCS 4ZDIA 2GVDC 3DM9B 3ZIAA 4G5OA 4LY6A 5FUWA 1XP8A 5E4FA 1OYWA 2WTUA 1KDOA 3HU1A 4PHFA 5DLQC 2WSMA 4KFUA 3KZ1E 5C18A 1KZGB 2WJHA 2IS6A 3RVBA 5FBLB 5KSOA 3FDIA 2QEQA 1E2MA 4HI0E 4HLUA 1EXMA 3WBJA 5HZKA 2DY1A 4NP6A 4D81A 1Q1QA 4LHVA 5BYJA 3ND8A 4ACAA 2HDNB 4URVR 3CH4B 1RYFA 4HAVA 1G5RA 2GILA 2OZEA 4I1UA 2BC9A 1WBDA 3VQTA 2B8TA 4XWOA 1N5LA 4AKHA 2VP4A 1CR1A 2CBZA 2PLRA 2QROA 4ZKEA 4DIEA 5HCNA 4E22A 4I4LA 4Q9KA 4PAOA 4Q4LA 1JEEA 2P5TB 1E2HA 1XMVA 2J0SA 1KY3A 5IRCD 4F7WA 3REGA 1LS1A 5DN6A 4B32A 3THWB 4PANA 3QNUA 2ZRKA 5J4YA 5FH9A 1NVUQ 3K1JA 5JSZB 1CTQA 4YDHB 4DWJA 1SXJE 4DB4A 4JKIA 1EFUA 3QPUA 4DSNA 2GCPA 4IFBA 5IHPA 2J7KA 1OT3A 1P73A 2ATXA 2DFLA 1Z0IA 2IUUA 3WY9A 3CKLA 1JBKA 2BWJA 4RFVA 2J3EA 3GJ3A 1E1RA 2V6JA 2V9PA 3C4JA 3PQCA 4QRHA 5EUQB 1SVIA 4DLSA 1E0KA 1W0JA 4BPBA 5LB4A 2ZRGA 3KB1A 1JQJC 3EZFA 3QJYA 2V3CC 4II7A 2D06A 4AK9A 3SFZA 4M9XA 3FFBA 1U98A 3Q7QA 1Y3AA 4URXR 4LCBA 3DKPA 1ZRHA 3OF5A 2VPPA 2IEZA 2ZUCA 4LDJA 2CVHA 1P6XA 5FBWB 1RIFA 1VMAA 1JR3E 2KJQA 2ZYUX 4V0OA 4D0NA 2XNDD 1KNQA 1OXVA 1E9SA 4PC1A 2CHQA 2AD1A 3FWYA 2C9YA 4PSAA 2EFDB 4JT2A 4L4UA 3NC1C 2QPOA 2V7QA 1A1VA 2Q9BA 2IK8A 4TYWA 3U61B 3CZPA 2FFQA 3AM1A 4KBFA 2JLZA 3VFDA 3T5DA 1ZJ6A 2ZJOA 1G4AE 1L4YA 2R8RA 1X6VA 2LKDA 4KHZA 5TDHA 3FMOB 5J4KA 3QXJA 3U3JA 1VG9B 4B3CA 2ZM5A 4C3ZA 2HJVA 4KYUA 2WJIA 4MDEA 5SZIA 1CIPA 3UPUA 2GEVA 5BXQC 4HZIA 4B2PA 3EPHA 4NYIR 1QHXA 2W2VA 1IXSB 1XTQA 4R7ZA 3REFA 1F3OA 4ZDJA 1NLYA 2QU8A 3VAAA 5K8LA 1W0KA 1LS6A 4ARZA 2E87A 2NOAA 5GVRA 4LSGA 1A82A 4IFEA 1Z8FA 1AK2A 2OV2A 2J41A 4CYMA 1LW7A 1N6NA 2GCNA 4I1OA 5DI3A 4P0TA 1OHHD 1X8JA 2ONKA 3UG7A 1VKJA 2MSEB 1CJVC 421PA 3EA0A 4MKGA 3B1VA 2FE4A 3BB3A 3U6BA 1Z29A 1XJQA 2DHRA 1KAGA 2XSZA 1J8YF 3CWQA 4B2LA 4L9WA 2XZOA 3QF4A 2R62A 5JJIA 2IYXA 3T35A 4LJ5A 1TEXA 1ZW6A 3VKWA 3GJXC 1NNEA 2IXFA 2RGCA 4JL6A 2C03A 3PV0A 1QHSA 3SJAA 621PA 1T0HB 1GITA 4CDGA 2VA8A 3KL4A 1Z0AA 1U99A 1T5LA 2QZ4A 2QBYA 1MV5A 2FG5A 1Z6AA 1HEIA 5DI9A 4B3DA 3N2EA 3WP0A 3THYA 5DNYB 2ZROA 1TEVA 2XB4A 2BM0A 3KKOA 2Q9AA 1OF1A 2A5FA 4M21A 5EZ6B 1UFQA 3N5CA 2YOGA 1WF3A 2QI9C 2ZR9A 1BMFD 3H2YA 4I1SA 4ILEA 5EP2A 5C4MA 4M1SA 4DSTA 1JEDA 2F9LA 3Q72A 3VTKA 4US2R 4D25A 2GHIA 5CB8A 2WMNB 3W8NA 4JS0A 1O3YA 2O8CB 4PHHA 2XTMA 1CR0A 4DJTA 5HKKA 3RS7A 4PZLA 3RS5A 1Q0UA 4UJ3A 3TBKA 4AKGA 1GL7A 1SHZA 4A2PA 1Q21A 3BD9A 4JLVA 2RGAA 2IF2A 3AEZA 2GRJA 1R4AA 1TU3A 1NJFA 3GFTA 821PA 1TNDA 4RSGA 3F8TA 4M53A 1QRAA 4ABYA 1WMSA 2WPDD 1I4TD 2NGRA 5K8UA 4TYNA 1IJEA 1R0ZA 1H8HD 3H4MA 3OAAA 1KO1A 3NHBA 3EG5A 1XCGB 1H8ED 1E79A 1YE8A 3CPEA 2B92A 4BASA 4ZDKA 1G3IA 1KMHB 5D3MA 4FD2A 4NCNA 4Q03A 5EE3A 2HLDD 4BFTA 3DOEA 5CM9C 2A9KA 4KSBA 1T91A 4M1MA 1NN1A 4CZ2A 1FQJA 5TVKA 2IYSA 1JXMA 3LNCA 1NN3A 1M8PA 1QHYA 3W3ZB 1KI3A 3SU8A 1D9XA 3CX7A 2QRZA 2UZ3A 3T1VA 5F3WB 1P60A 2WWXA 1L8QA 2V8OA 3QBTA 4O2RA 5KUTA 4A15A 4WIAA 5HZHA 2K5UA 2AXPA 2ZIAA 3R7WB 3ZH9B 3PEVA 3NH9A 1E4YA 2FEMA 4D26A 3GJ7A 3IPYA 3EPLA 4HB2A 4PO9A 3W5JA 2O8FA 3A1UA 5L3SA 3PEWA 3OEEA 3KQLA 3QUSA 2BMEA 3GPLA 3P4XA 1XZQA 1E9FA 4A6XA 2BEKA 2WWFA 2Z4RA 2FFAA 5TARA 2VP6A 2HXSA 2XOKD 3CRW1 1GKIA 5AJVB 5TMPA 3X2SA 3QG1A 1G7RA 2H92A 3AF0A 1ZM2A 4F91B 1OKKD 3S1AA 3TW8B 3K0EA 2WAXA 1OH7A 1S9HA 1H65A 4EPTA 1ESNA 4Z51A 1ZU4A 3B8HA 3AGPA 1R10A 4O2LA 4JLPA 3A6PC 2WJVA 1FFHA 5FUVA 1VG0B 3U44B 3K9NA 2VQSA 2GF9A 2CL6X 2O8DB 3PEYA 3DEFA 3EWAA 4BQSA 2R6FA 3KQHA 3R9IA 3I32A 4M8NE 4Q4JB 5SZJA 4FCVA 4TMWA 3SN6A 3HJNA 2X1VA 3I92A 4MUBA 4NCJA 5FPHA 3C8UA 4P4SB 2YNMA 2O8DA 4K46A 4AKIA 4B3GA 2DR3A 2WAYA 5ELXA 2J59A 2Q21A 1DAHA 3CM0A 2DYKA 1Q3HA 3ZS8A 4B3BA 3E70C 4IOMA 4YMUA 4H1VA 4A82A 2GK7A 3LA6A 5DE3A 4DKXA 3QOFA 3CNLA 2NPIA 2FJUA 2OBNA 4XOIA 3KXLA 3NC0C 4OQNA 4PPGA 3T15A 1E2JA 3KTAB 4IHQA 4LC0A 4GL2A 2CK3A 4TL8A 1XPRA 3HYTA 2N46A 3AQ4A 2BKUA 3PCRB 3WRYC 2HF9A 4O3MA 3AVYA 1HA3A 1YVDA 2WIBA 2ZRAA 1HYQA 5CJ2A 2WWIA 2EQBA 2CCGA 1KI9A 4RCYA 3TSOA 1U90A 2QRNA 3ONWA 1YRBA 1U8AA 1UEIA 2ZJZA 2J0UB 3EZ2A 1AGRA 1E9EA 4RFSB 1W36C 3HR7A 3NIBA 4HB3A 1U0HC 3ZVRA 1YHNA 4MKFA 4FCTA 1NIJA 1DAIA 5J4VA 2XNSA 4UXHA 2AKAB 1XEXB 1IY1A 1XXHA 3AVUA 2I3BA 2V4ZA 4IOJA 4LZZA 5G3YA 4MGKR 4GBMA 4EDHA 4BZPA 2JJ2A 2F1IA 1L2TA 3B60A 2GAAA 2QPAA 1NKTA 5L3QB 3IBGA 1UKVY 1Z6GA 1Z08A 4JVNA 4A9AA 3M4YA 2GZDA 1NMZA 2NTYC 2IYVA 1W36B 4FW9A 3SFVA 3K0AA 2VH5R 4ZI3A 3ZJYA 3PUVA 4YXWD 1PLLA 1ELOA 2BJVA 2DWPA 1ZM9A 5F2EA 2ZSDA 4GOXA 4ZCLA 5EE0A 5L3QA 5HE9A 1II9A 1KO5A 3NEJA 2XZLA 1E96A 4C0KA 2VSOA 1AJEA 2IS4A 3IGFA 1R0WA 3BORA 5JBQA 2O5VA 3DVLA 4GZMA 4DRZA 4TT3A 2NO0A 3GLHA 3MLEA 4OI4A 1G8PA 3AP2A 3CRQA 4TZ6A 3TR5A 1VPLA 2HCJB 1U8YA 4M22A 2VBCA 1CJKC 2OCYC 3SC3A 1F6BA 4P4UA 4DBLC 4X8MA 1E9CA 2IYYA 1OYYA 2AK2A 3CWZA 4HUTA 2C98A 2VYFA 4EFLA 4MUAA 4DXAA 4TLAA 3EA5A 1N6KA 2VSFA 3GCGA 4N3NA 4Q7LA 4MRNA 4MYHA 4UXJA 4R71A 2QTHA 4XH9B 1I2MA 1JECA 2A3RA 3QBVA 4TLBA 2DFTA 4D4KA 3QF7A 4NONA 3MJRA 1U94A 4YMTA 5HE8A 1YZNA 1SKQA 1C4OA 2VO1A 4DUGD 1CLUA 4AY2A 4AYTA 1S9DA 4NYIQ 1KDRA 3FPAA 2RHDA 3IILA 4ZPXA 1N5KA 5AR1A 4BFWA 4PXAA 2AX4A 5FPSA 4CVNA 4UNRA 2C96A 1XTIA 4NDZA 3RWOA 1J7KA 2FPMA 4OHYA 5KDOA 1TU4A 2HT1A 3BB1A 4QNMA 1E1QD 4PC2A 2I1VB 1DAEA 2QM7A 4RKEA 3PG5A 4DSUA 3QKTA 4JBXA 4TMXA 1IAQA 2FSIA 3A1VA 4LV5B 1QBKC 2TMKA 2IA5A 3U60B 2F1HA 1KSHA 2CNWD 3OFND 5IK2A 3W6OA 5BN4A 3GLFB 3U7EB 2Z43A 2EYUA 2WHXA 121PA 3QXSA 3QXCA 2A7QA 5H68A 5HCIA 4UNPA 1JAIA 1SVOA 2QQEA 3I3SR 4LUCA 5C4GB 1FW6A 1EFRA 1XD2A 3FVQA 3ICQB 1SVSA 1ZNWA 3OEHD 4LJ4A 1DBSA 4KO8A 1KHTA 1RW4A 2YYZA 2Z83A 1RRPA 1MRNA 2IF0A 1TF5A 2H16A 4FWTA 1QZXA 1G5TA 4XIGS 5IT5A 1FP7A 3K8YA 3OIUA 4HLCA 2ZI7A 4ZIRA 1ZM4A 3FKSD 3W9YA 3CF2A 1XTJA 3QSYA 1TF7A 4BLTA 2GBLC 4M1TA 5KSZA 4PPNA 1E94E 2WSSA 2FOLA 2RHMA 3ETLA 721PA 3MWKA 1CR2A 2BMDA 2F7SA 5TY0A 4XJXA 4NKRA 2ATVA 4US0R 4EPRA 2H1LA 5G41A 5FR1A 2PLFA 2O0KA 3K0FB 3VR1A 3D3QA 3GLHE 2GVZC 3O47A 1G3QA 2LKCA 1PJRA 2FV8A 1XTKA 2B7CA 5AK0A 4NBSA 4RVCA 3CUEF 5JWRA 4AG6A 2FX3A 4LGMA 4TYPA 1GRQA 1T3LA 4FMCB 1KO4A 4H1UA 4EIWA 3RNLA 1G21E 1VCIA 2FSHA 2RGGA 2JATA 1XD9A 3T12A 4EPYA 1MT0A 3CIOA 1Q44A 3LVRE 2YV5A 4LHZA 4M1KA 4LJ7A 4PC3A 3ZZUA 2XXAB 1QF9A 1UBEA 2MMCA 3G5UA 4TQUS 3SJBA 4DCUA 1G6OA 4HEJA 4A0RA 1QHGA 2XZPA 5FBVB 4WOPA 4R2HA 3VHLB 2GBLA 4CEJB 3MSXA 521PA 1G8YA 2CCJA 2XJ9A 4HATA 1A2KC 3QENA 4PQYA 1YR9A 2GEUA 2ZRFA 1UBCA 4KSCA 1ZP6A 1P2UA 3ND9A 1M7BA 1TQ4A 2XXAA 1IN5A 4URYR 2GXQA 2Q3FA 2A5JA 1M6NA 3H1TA 4ASUA 2C5LA 3BAFA 4NYMR 4JBYA 4CEJA 3LBNA 2UZIR 5DO9A 3CRMA 1OV4A 2P67A 2ZUBA 1AS0A 1CBUA 4BLQA 3RC3A 3QXXA 2FPLA 2JIZA 3CLVA 4XD7D 1GDDA 2ZPTX 1WDTA 3PUZA 2AN9A 2ZR7A 4FN5A 1NL3A 2FZLA 3U7FB 3IHWA 5B30A 4LYFA 5L8VA 3R8FA 1T8TA 1UF9A 1KTVA 1D8TA 3KXKA 3MWJA 5KDLA 1VTKA 3W8RA 1JPJA 4G1UC 5LPNA 1S3SA 4NE2A 3A58B 1MO6A 1PUJA 3ADDA 2IHBA 2VHCA 1A7JA 1NRJB 3FYHA 1NBMD 2IYWA 2Z6VA 4RD3A 2ZRMA 4V0NA 1KJWA 4LHYA 4V0LA 3GLIB 1BYUA 1VIAA 3B1WA 4P3YA 4QHYA 3U3RA 1PLJA 2JCSA 2CLDX 4JVLA 5FL7A 1P2VA 2GXUA 4G5GA 4ZV4A 4PC7A 1OH6A 3AVPA 2NO7A 2QENA 4ITRC 1TX4B 3SJZA 3KFVA 2CDNA 1GP2A 1JPNA 2W6JD 2KBEA 2ZRLA 2R6DA 1AM4D 2GESA 3K09C 5FPKA 4BLPA 3AB3A 1ZM7A 2B6HA 1M7HA 5A5GA 1KSFX 3GLIA 4PPQA 2JLQA 1SXJD 3CX8A 4KFRA 3BE4A 3ZVNA 2WKRA 1P75A 3AUXA 4JLOA 4CEHB 1K6MA 1COWA 1T0JB 3UG6A 3NBZC 4LHWA 3QEOA 3EIQA 3A1TA 4URWR 1I4DD 1EFHA 4XVRA 1G64A 2AR7A 4DLUA 3QPWA 3PFIA 4GPTA 4LWZA 3K0SA 4DSOA 1ODFA 2HF8A 5JCZA 4LJYA 5JECA 4JLAA 1EFCA 4C4PA 3SEAA 2ONJA 5B64A 1CF4A 4JLKA 4OHXA 2WVJA 3A37A 1RVDA 1SQ5A 1IN4A 1QHIA 2ZRHA 4QHSA 2WBLC 4TMZA 5EZ5A 4D4MA 2P3SA 1FOEB 2C78A 2REOA 4JZKA 4YMVA 1KK3A 4M2LA 1KZ7B 5HPYB 4HUQB 2KB0A 1GFIA 2FSGA 3LW7A 3Q7PA 5GJWC 4QG7A 4KCGA 4QBGB 1VHLA 5F98A 4WXPA 2ZI9A 5L3RA 4TQ9A 3K09A 1GL9B 1JR3D 3UMRA 4FMDB 2Q3MA 1IN7A 1KIMA 5C46F 1G8FA 2ZSFA 2QSZA 1AQYA 4U7DA 2AFIE 1X8KA 4HUQA 2Y8EA 1C9KA 4QM6A 4IW3B 5FUXA 2JJ1D 5JEEA 2HEIA 1WCV1 3I4LA 5K8IA 2BJWA 5DIFA 4BRUA 2AL7A 1G8HA 1VIYA 3TLXA 2XX3A 5DHFA 1N0UA 3THWA 3KKNA 5J4HA 5J47A 4OQFA 3ZIAD 5CITA 5EXPA 5JSZA 1SKYB 4KFSA 5KDDA 2ZSEA 3F5FA 2ODWA 4AURA 3B13B 4DLYA 3K9GA 3T06B 1NF3A 4TMTA 3PUYA 1SVWA 3AGQA 3LFUA 4TLDA 2OAP1 4B43A 3EWSA 3IQWA 1UM8A 1ZVQA 2D2EA 4F93B 3LVQE 4Q66C 3UXMA 2IW3A 3U3OA 3KQUA 2JASA 3W6PA 5JMTA 4M9QA 3B1XA 4TYYA 1NN0A 2WWGA 4IEEA 4Q1BA 3BC1A 5GJBA 2N1BA 4L9SA 1G8GA 5FTLA 4LJ9A 2IT1A 3NH6A 4YMSA 4BLSA 2ZVQX 4NPHA 3AF2A 2C99A 3DL0A 4LYAA 1P61B 2D7DA 4EPVA 5AJXA 3SBDA 2AKYA 2ZRPA 4OQXA 2PBRA 1A2BA 2O0JA 4F4IA 2J0VA 3HPQA 5G53C 1MO4A 3MUFA 2FNAA 5FOVA 3I8XA 1KI1A 1NI3A 5DN6D 4RD1A 1YZGA 4F38A 2YWGA 4BUJA 1NLFA 2EFGA 4L8GA 3GLIE 1XTRA 1IOZA 3UWKA 3LV8A 3OIVA 5LB2A 3OE7A 3AVOA 2JDIA 4GNKA 1E9BA 1FMLA 1UJ2A 2EFEB 3GEIA 4Q1AA 1XX6A 1XCPA 2W00A 2W2XA 2YC2C 4H9GA 1IXZA 1E1RD 4B33A 5FPTA 1T3HA 3KQNA 1DO2A 3D7MA 1XF9A 3TKLA 4D4JA 3TE6A 1DG3A 5AJYA 3SHWA 2JLUA 1E0SA 1W0JD 4NZYA 3D8BA 3KJEA 1T6NA 2EFCB 1Z6XA 3H84A 2OT3B 3X1DA 3VR5A 1W4RA 5GVSA 3WMEA 1GNQA 4NH0A 4QHTA 5JZVA 3CW2A 2QT1A 4ZDWA 1P9NA 1VHTA 5H1YA 3THXB 2FZ4A 5IDVA 1Z0KA 2ZSBA 2VP5A 1OJLA 1R0XA 1G18A 2FGJA 2ORVA 3Q9LA 3DHWC 2QMEA 3U4QB 4B6EA 1W4BA 4M9SA 5F9HA 4P4TA 1OE0A 2AWNA 1W5TA 2CL7X 2ZU6A 4PQRA 1AKYA 5FL3A 5FBRB 2IUSA 5JEDA 4BECA 4O0MA 1P5ZB 4DLWA 1E9RA 2IYZA 1LFDB 4IVPA 4JBWA 4L16A 3T1QA 3UMSA 2V7QD 5H70A 4KV9A 4C0HA 4NCIA 3U4QA 3GMTA 4K8OA 1M34E 4OYHA 4BZQA 1KI4A 4HDOB 5FTKA 4W9MC 2HUPA 3ZS9A 5JJKA 2C9CA 1BYIA 2BDTA 4RY2A 4X8LA 3IQXA 3NKVA 4QM7A 2ZANA 4F92B 3EZ7A 1LB1B 1SVKA 4KLZA 1TAGA 5FTNA 2C2HA 4HAZA 1E2LA 2D3WA 3BGWA 4LOAA 3VR2A 3SYNA 4BEJA 4CRWB 2RB4A 4JYCA 3EXAA 2ZITA 1MO3A 2CXXA 1SKYE 2G9NA 1WB9A 2OSBA 4W5JA 1TF2A 2GZAA 3B82A 2G0TA 3KJIA 4LPKA 2QP3A 2YOFA 1N0VC 2ZRJA 4Q01A 1W0KD 1N0WA 4PPFA 1UKEA 1W4CA 5JJLA 1PUIA 2V55B 1Z63A 4MKIA 4DCSA 2BEJA 4OQLA 2DWQA 4QBIA 2R6CA 1WE2A 4B35A 1M1YE 1KSJA 3Q5DA 2HYIC 3I62A 1G291 4Z1MA 3HYRA 2W83A 1CRQA 1HV8A 2P65A 4TL6A 4DT1B 2L0XA 2XSZD 3EAQA 2OESA 1HQCA 5AJWA 1KI7A 2EW1A 1Z6TA 4NYJQ 2XJ4A 4ESVA 1D2MA 3IPXA 4GP6A 2GZHA 3IIMA 4Z8YA 5EUMA 2WWYA 2O8CA 3U7GA 1QDEA 3AVXA 3B1ZA 3L0IB 1AGPA 1GWNA 2BKEA 2NZJA 2VHUA 2H57A 2BMFA 4DT1A 1FNMA 1TPZA 3C16C 3LLMA 1XMIA 3FHCB 2W58A 3U5ZB 2G77B 1CEEA 5DHAA 1ZYUA 3LDAA 4GMXA 4IJMA 3N70A 4B44A 4P31A 1G41A 1ZIOA 2MSCB 1S96A 3ZLJA 4DHEA 1NKSA 2J1LA 2JLWA 4OHZA 2ANBA 4MYCA 3KUCA 4Q21A 5FOTA 4NYMQ 1KMHA 1XPOA 1S1MA 1KJYA 3DMDA 1JI0A 3EARA 2JGNA 1QG2A 3GJ0A 4MRRA 2Z5FA 4V0KA 2P0EA 3LRPA 1CRPA 3WNBA 1NSTA 3KX2A 2AHOA 1IONA 2ZRDA 1JALA 4RD0A 1Z28A 3DZ8A 5HKKD 3UANA 1EWQA 2ZRCA 2H7VA 5DYIA 3R7WA 4A0FA 3AVQA 1JNYA 1XEWY 2P2LA 4PTLA 2P6UA 5GJCA 4FMBB 1YZQA 3WYGA 4RZUA 4UNSA 5CYOA 3DDCA 2F9MA 2IS2A 3H86A 2ZETA 2GXAA 2GJKA 4BFUA 1SVLA 1ETUA 1Q12A 3RRMA 1GL6A 2IYLD 4LV6A 1Z47A 5CDFA 2ZJAA 1TUIA 2IHYA 2PJZA 3CR7A 1Z83A 1U0LA 2BHRA 3OAAD 1JJ7A 3A36A 1E79D 1GIAA 2A78A 3C7KA 4A2QA 3O8RA 2ZAMA 3N2IA 2IWHA 3LLUA 3HPRA 2CLCX 4GOJA 1XWIA 2QMHA 4JSYA 1FUKA 1PVOA 1GNRA 5DYGA 1SULA 3HU3A 1ANKA 1ZD9A 1JJVA 3DMNA 1U81A 2OILA 1RPZA 3GLGB 4B3FX 3U6KA 1CJUC 1N5JA 3NBFA 3U44A 2PZEA 5KU1A 1U0JA 1W47A 2GETA 1Z06A 2ZS9A 2G0NA 1QG4A 1LV7A 1PLKA 5LD2C 4OK3A 1NY6A 5EP1A 4Q5IA 1RRGA 4IDNA 3W5IA 4BWYA 1FX0B 1FZQA 3J81k 4C0JA 3BH0A 4IXMA 4X8OA 2P5SA 1P4SA 2BBTA 1G3UA 3OEED 4Q4JA 5CIQA 5B58C 3GLGA 2MSDB 4KJZA 3AKDA 2ZE8A 4MGZR 3B9PA 4DDVA 4LJ8A 1HT2E 1G7TA 1RJ9B 4JL5A 2AFHE 4P4SA 1KDPA 4W5HA 5DISB 2NO1A 1YRAA 4ON9A 1MABB 4KVAA 1GKYA 3WRXC 1Z2AA 5KNDA 3ICEA 2E1RA 2OXCA 4Q7MB 3M1IA 5LD2B 5F9FA 4LV8B 4ZKDA 1GRRA 4YDSA 3KTAA 5B2ZA 2NPFA 2NG1A 2AD5A 1KDTA 2ZU0C 2ASEA 1E98A 1XB2A 2A2ZA 2WKPA 1M74A 1W1WA 1BO6A 3EIEA 3TMKA 1OIVA 2WJJA 3FMIA 5FR2A 2QTVB 3LH5A 2ZJ8A 4DEXA 1XNJA 2BCJQ 4LBZA 1P2TA 1X1SA 3VX3A 2HJGA 4XWAA 2JAQA 2VP2A 3AV0B 4QGAA 2PMKA 4QXAA 5HR5A 5A0FA 2GAOA 2J0UA 1VCNA 2KWIA 4RFSA 2OFWA 2OCPA 2BV3A 5EE9A 1E6CA 2ZR0A 3EX7C 2R9VA 2X2EA 4XVUA 2H18A 1YZLA 2PZGA 1E2PA 1E2EA 1Y63A 1XEXA 1W48A 2VSXA 4QL3A 4ZCIA 4BFYA 1II8B 1ZM3A 2YZ2A 1Z07A 2J46A 3W90A 2PX3A 1P3JA 2IBMA 1M7GA 5FPYA 2QM8A 3MRSA 4QGFA 2VP0A 1GM5A 1ZUIA 2FDCA 3JZMA 4WZBE 5JS8A 1UKZA 4OHWA 3LQRA 2UKDA 4GRAA 1VYVA 5C2JB 1PV4A 1KK0A 2BM1A 3V4FA 3WMFA 1YZTA 2CK3D 3V9PA 1VYUA 1GILA 2QAJA 3RRZA 5CDFE 2J0QA 3P26A 1R5BA 4FMCF 3VMFA 4OJKA 2ZS7A 5JFGA 4PAMA 4Q7KA 2JLYA 2ZTSA 1DTSA 4UQOA 1N25A 3R9XA 3E5HA 1DARA 3DO6A 3TRFA 3QG5A 1E2NA 3CB4A 5E7MA 3X1YA 4TZ0A 4YQFA 3SYLA 2VHTA 1D6JA 4TTPA 3IUYA 3KDSE 2LWIA 2QA5A 2J9RA 3AP3A 1NMXA 3CNOA 2A5GA 3LW8A 4GZLA 3GJ8A 2DPXA 1XMSA 1BS1A 3KXIA 3PENA 2CE7A 4RD2A 4EUNA 3B9QA 1FQKA 4XSHA 3NDBB 5BN5A 2VLIA 2XEXA 1NVVR 4GDFA 2DB3A 4URZR 4JKYA 3NHAA 3ZZTA 1B0UA 1OFUX 2IWRA 3GLGE 2OHFA 1E9DA 4MRPA 1YKSA 2XB2A 4IOLA 3QQ5A 4BLRA 3EPKA 2ZE6A 2V6IA 2VEDA 1OXTA 5KHOC 4DCVA 4RKFA 1UBFA 1RRFA 1B23P 1T9HA 4TSFA 3BFKA 3MMPA 5UKDA 4AWXA 1F2UB 2JA1A 4BGDA 3CF6R 4PHTA 4R98A 3ZQJA 4C30A 3LWNA 1KI6B 3JZAA 4L5BA 4E5UA 3SQXA 2ZJBA 2X2FA 1TL7C 2OAQ1 3CR8A 1W36D 3VKGA 4Z8XA 3SZRA 4TT3D 4ACBA 1DVRA 1KKLA 4TTQA 3BFXA 2FEOA 3KKPA 2G83A 3QKRB 3IEVA 3JVUA 1LY1A 1W2GA 3OESA 4OBEA 3RHFA 4C7OB 3ZD7A 5JLJA 2F3RA 4Q9HA 2WJGA 1O87A 2DCUA 3C15C 3T5GA 2C9OA 2YINC 1KI6A 2C77A 3C5CA 3BWDD 3DPUA 3AP1A 2FFBA 2ZRBA 4MYTA 1RFLA 2RGBA 3R20A 3RS2A 1WBBA 1JR6A 1ZD8A 1GAJA 4FI3C 2J5XA 3GLFA 5EJEA 3FKQA 3QKRA 2O8EB 2OG2A 1AN0A 4JL8A 2OLJA 2WV9A 4HB4A 1F2TB 4DDUA 3TGPA 2XTZA 2QMOA 4N0EA 1MRSA 1UDXA 1ZUNB 4D82A 1OFTA 3U3KA 3K70C 2G88A 4LX0A 2ERYA 2QP9X 3VR4A 1G3RA 5CB6A 1W49A 1ZNYA 3QVUA 4MH0R 3AF4A 4Q18A 1ONBA 5G3ZA 4GP7A 1UDWA 1LVGA 1BH2A 5KTYA 5GJVC 3EIHA 4UNNA 4D6PA 3C5HA 2F55A 2BMJA 2H8KA 3WHLA 2WWHA 1Z0DA 3P32A 2VHJA 4MQBA 2QMUA 2DFKB 1Z3IX 2Q9CA 4DLTA 1NG9A 3K70B 1P62B 1N2CE 2IYQA 1YR6A 4IVQA 5IK2D 1CS4C 2QSYA 3K0FA 5CLLA 1HH4A 4UJ5A 2O52A 3WXMA 3CRVA 3RS3A 1KO8A 4JYBA 1Q22A 1HE8B 3WYFA 1GNPA 2JJ8A 4LBWA 3T61A 4RZ2A 3TUJC 1Z6YA 1EFRD 4EJSB 4EQ6B 4HAXA 3VR6A 4CEIB 1HURA 1SHKA 1ZINA 2J7PA 3TSZA 1GZSA 3TH5A 5KYKA 1LNZA 3MGCA 1AZTA 3CX6A 4QBFA 2IYUA 3PUXA 3ZGXA 1HT1E 2ZJ5A 1ZAKA 2F43B 3LD9A 4G5SA 3UATA 3UK6A 1X3SA 2GXSA 3AH8A 1WRBA 2ZE5A 2FF7A 3F0TA 3UKDA 3VKHA 3EC2A 1FTNA 3B78A 1J99A 5K8TA 2OXRA 2W6IA 3PXGA 4QGHA 1I2DA 1T3SA 2QUZA 4WXRA 1SXJB 2XITA 2ODEA 1DADA 3CRRA 2WSSD 4JLMA 4TWZA 3V00A 2F43A 1S4QA 1ZMXA 1RE0A 2IUTA 2W0SA 3I1FA 4AKEA 4R9UC 3BS4A 3FHOA 1A5TA 3L82B 1U9IC 3TUZC 2QE7A 2D4HA 4U00A 2O8BB 1HTWA 4Q02A 1CXZA 2PJRA 1GOTA 4YMWA 4EKDA 2PH1A 4I99A 1EESA 3CPJB 3SNHA 4A8JB 1N5IA 2KE5A 4Q4AB 2OM2A 3R8CA 2QY9A 2ZUDA 3G0HA 2GA8A 2GKSA 4B2IA 4A2WA 4Q4HB 4A92A 3B85A 3L0PA 3GLFE 1ZNXA 3WP1B 1R8SA 1WQ1R 2DWOA 3LBIA 2GJSA 3SR0A 4Y0AA 4DLZA 4IRUB 4B75A 5P21A 1IXRC 2EWVA 2H17A 2HXYA 3TR0A 1OB5A 5CJPA 1FL9A 1N6IA 2IXEA 4V0MA 2ZYVX 4Q4HA 3IO3A 1E4VA 2VL7A 1J2JA 2CLSA 2ZEJA 5BYKA 5IF9A 4B47A 3CBQA 4C0QC 3JVVA 4ASUD 4DIDA 1U9IA 4CIDA 4QJ5A 1I4LD 5BW8A 4LI0A 3PEUA 3ADKA 5FOSA 1D5CA 4GMDA 4M1WA 2GJAA 3C14C 3VNVA 1G1MA 4PSKA 2FPKA 1EGAA 4G01B 4B34A 4Q1DA 3TAHA 2P6RA 1ZUHA 3ZVMA 2GJ9A 4PO1A 3U7HB 2R44A 2WICA 2F6RA 2JIZD 1TQ2A 2ZI5A 5SZKB 4PQFA 3L8ZA 4MRVA 1VCMA 4ZI2A 2ECKA 1KNXA 2W0MA 3HWSA 4CEHA 2O0HA 4KXFB 2J87A 2RGNC 4NCKA 4HYYA 1GRNA 1FUUA 1IN6A 3QIAA 4JLNA 3RANA 3MAAC 5KO2A 2YWFA 3GJ6A 3A4LA 3BXZA 3M0EA 3VU9B 5CLQA 3SQWA 4NCHA 1MH1A 1OXXK 5KSPA 2A5DA 2ZYWX 4PC6A 4RD4A 4A36A 3B1YA 4JLDA 1G3MA 4RJLA 1IY2A 3SBEA 3PIRA 3SI7A 4Q9LA 4C2TA 1NLZA 5FL7D 3BH7A 3GFOA 2IL1A 3ZVLA 1NBME 3VU9A 3F3YA 1IBRA 3L0OA 4KU4A 2XNDA 2QQ0A 4GSYA 1R5OA 3DKVA 5EXXA 4EFMA 1NIPA 3EC1A 4KFTA 2IYRA 3E2IA 2CCKA 1P9WA 2RMKA 1M2OB 5BWMA 3T1TA 4LJAA 1LF0A 4IDHA 2PL3A 3ZYCA 1VDZA 1LF5A 3TQFA 5FI1B 3OZXA 1COWD 2OEPA 2RGNA 2X8AA 3O8DA 2JLVA 1N3BA 1P7CA 3PITA 1KK2A 2ZE7A 5DSZA 2PEZA 3RRNA 1NY5A 4WW0A 1HQYE 1KY2A 2WIAA 3TK1A 2Q6TA 2QNRA 4KAXA 1L4UA 221PA 3LX5A 4US1R 4B6FA 1YR8A 1KI8A 2OCAA 4EPXA 1R6BX 1CR4A 1GSIA 3W3AA 4GFDA 4QGGA 2PZFA 1YU9A 4DCTA 3THOA 4G0NA 5FOWA 5JI3E 5FUYA 4B74A 1Z0FA 2CHVA 2B7BA 4V0ME 2GTPA 5FOXA 3EPJA 3DZDA 1F60A 3FE2A 2G1JA 1CJMA 4ESHA 4UNQA 2VF8A 1OHHA 3MFYA 3FTQA 2PX0A 3B7GA 5AUPB 3ECCA 1YZKA 3AVWA 1QHHB 4YONB 4Q9IA 2EYQA 4I81A 1WA5A 2PT7A 3QEJA 1R5NA 3UMFA 2F1JA 3GQBA 4PAQA 3L8YA 2ZJYA 4LC1A 1NVXQ 1OSNA 1DAMA 3RLFA 1NVVQ 4MGYR 2C8VA 1QHHA 1ZC3A 1ZIPA 2PMDA 1N6HA 2IS1A 4QC2A 3RWMB 4LYJA 3QPVA 1ZCAA 3Q3JB 2OCBA 3BFVA 2MMGA 4HZUB 4N0DA 1BOFA 5EE5B 3RS0A 3T34A 3QY0A 3I5XA 1G17A 2EWWA 4J0QA 2GDJA 1CU1A 1OW3B 1XMJA 2QP4A 3L43A 1Q3TA 3LXXA 4HLDA 4ARZB 1AZSC 3GP8A 1AKEA 1EFTA 4WBSA 4Q9JA 1DAFA 4LPSA 3K53A 2G6BA 4Y0VA 4DVGA 2ZS8A 5DI3B 4BRWA 2FSFA 5J40A 4HZUA 1FP6A 2CE2X 2WZQA 1G9XA 2PEYA 4TMKA 4JLBA 5L3VA 1BMFA 1DAGA 4Q47A 4URUR 3THXA 4A0GA 1OFHA 2XAUA 4MDFA 5KNBA 1TQ6A 5AUNB 5EQTA 4OI2A 4RZ3A 1U8ZA 5TV2A 1DG1G 2HV8A 2ODBA 3RS4A 4FCWA 2OUKA 2ZYTX 3QF4B 4E07A 1F5NA 4WA7A 1JB1A 3OE7D 4MITA 1JAHA 1OIXA 2ZJ2A 3WHKA 2JDID 2B21A 2CJWB 1RC8A 2Q0HA 4N1AA 1OXUA 2WM9B 1WXQA 4DLRA 3KQKA 2DFNA 3VNUA 1Z0JA 4YLGA 4ERNA 1XCMA 3TW4A 3M6AA 1W5SA 2QBYB 1QVRA 1CP2A 4NMMA 4OHVA 2HCBA 2WPDA 2VHQA 5FFMA 1W46A 2E9SA 2BOVA 3WYAA 4EAQA 4F4JA 4ZO4A 3THYB 3ASYA 1H8HA 1G5PA 1LTQA 2CJWA 1OH5A 4RD6A 1T5IA 1H8EA 2GCOB 3TQCA 1E2IA 4G3XA 1NN5A 1Z5ZA 3LXRA 3LY5A 1Q1ZA 1UKYA 2HLDA 3TJZA 2LCFA 1KJZA 3VHXA 2H5EA 2OFOA 5AUQA 1JXOA 1K5DA 1A4RA 4CT5A 4WZ6A 4DB2A 4O25A 2HT6A 2QPTA 4WVFA 3O8CA 1S0UA 4A6PA 1R0YA 2GCOA 1KMQA 1W2HA 3BIFA 3C41J 1XEWX 1XDBA 4I1VA 3LAWA 2NZ8A 3BERA 4FINA 4JVSB 3PR1A 2ZI6A 5EXSA 1D2EA 4HB0A 2WOJA 4LK2A 2D2FA 5D3QA 3SHFA 2YWEA 1SZPA 3AF3A 5KOYA 2CMKA 3AUYA 1WP9A 3IIJA 1JQLB 2SHKA 3U3MA 3I73A 4M1YA 4W7SA 4QKQA 2AK3A 1QHNA 3BB4A 2BBWA 4BFZA 5CK4A 1VCOA 2YC4C 3KJHA 4HAYA 4U02A 5CYPA 2HYDA 3UIEA 4KLNA 2XOKA 1FTSA 1E2DA 1II0A 1MR3F 2CEAA 5D3MB 2RGXA 5AWFC 1OKKA 2UVQA 3D6TB 3P20A 4MRSA 4RZXA 4D80A 1OLOA 3IDQA 1AA9A 2ERXA 3ADBA 1S3GA 2CVFA 4E09A 4C2UA 1UAAA 1Z2CA 3AKYA 3NEYA 1HY3A 2QTFA 4MKHA 1ZBDA 4X8HA 1W7AA 6Q21A 1D2NA 5JI2E 2VRWA 4XWKA 4WZAE 1G16A 5DGXA 2ZVPX 1J90A 2VTKA 4A1FA 2O8FB 5M04A 3EZ6A 5FTMA 4Z1MD 5L3SB 5LDDC 4A0HA 1E99A 8OHMA 3MWYW 2XGJA 4IVRA 4ZCMA 3U2QA 2GJ8A 4M4SA 4KITB 4IDOA 1W44A 5H8WA 4HAWA 1IY0A 2ZSAA 3SDZA 4OI1A 1IJFA 2FA9A 1S2MA 1V43A 2F1RA 3FGNA 4HLQB 4KI0A 3KB2A 2REXB 4TLCA 2CL0X 5AJZA 4U5XA 4BLOA 3PJRA 1P9RA 1S1CA 4F4CA 4TL9A 2YKGA 2X77A 4QBHA 4V03A 3NXSA 4PZYA 1AIPA 4MYUA 2PCJA 3IIKA 3S1AB 4V02A 1R7RA 1VECA 4LBYA 1HE1C 3IHLA 4B3XA 3EASA 1UPTA 5FBQB 5E7JA 2ORWA 2ZAOA 3WBKA 3B5JA 2BBSA 2FFHA 3GD7A 2D62A 1S8FA 1R2QA 3B6EA 2CHGA 4JT4A 3P27A 5E95A 4JJKA 3RAPR 1RZ3A 2WMOB 1SGWA 4QJ3A 3G82C 3E1SA 4FIDA 4C0SA 2R6GA 1ZU5A 4QFMA 5GADl 4D4LA 2FN4A 2QG6A 4OL0A 4NL4H 1F48A 5HTKA 1OIWA 1YZUA 4OQMA 3VX4A 1V5WA 3CPHA 4BFXA 3X1ZA 1US8B 2VIIA 3OHMA 4AG5A 1RKBA 2ZQ5A 3I8SA 3LQQA 1TQDA 4MA4A 2QL6A 2JEOA 1FX0A 4BZXA 1KI2A 1XZPA 3QVVA 1G7CA 5A4JA 3FMFA 2BVNA 1MOZA 1SVMA 1GUAA 3B2EA 3OIWA 4B48A 1ZCBA 1DEKA 4JIMA 1X1RA 4UKDA 1KOFA 4YXWA 1VYTA 2R2AA 3AKEA 1US8A 1RJ9A 1ZD1A 3K9LA 4JJZA 1CULC 2KI5A 3CZQA 3L0SA 1EWRA 3GJ5A 2R6AA
chains in the Genus database with same CATH superfamily
1IQPA 1R0SA 1ZC4A 2I8LA 1TZMA 3NGXA 3TNYA 3TQRA 3GAAA 2VQ6A 4RY8A 4MYRA 1SOAA 3DQPA 4QXMA 2WOOA 3I5YA 4J0CA 2VVTA 2ZCVA 5C8VA 4GUDA 1K7YA 4LCEA 3QMPA 4MR7A 4FDMA 3GLQA 2JFQA 2Z58A 4YJFA 1XLWA 2NADA 2G6TA 4F2HA 4HAUA 4ICIA 3R7LA 4E4YA 1XGKA 1VP9A 1NW4A 4KWEA 1J0CA 3UMVA 3D02A 5IBQA 1P9LA 5A9TA 3TGLA 3HXOA 2VF5X 3OT1A 2XHZA 4QOHA 3ZK9A 3RC8A 3OMLA 5CIWA 1XJCA 1OTYA 3NBXX 1M5RA 4R2IA 4TMYA 3JQAD 4MR8A 5F5NA 4F5EA 3SXUB 5CFPA 3WLTA 4CCSA 4UC0A 5L51A 3Q5EA 4JJEA 3FZGA 2YHSA 2C84A 5IXSA 2JFUA 2RKBA 3KFLA 1G5HA 2MJLA 3IKJA 3BSWA 2GNAA 3WLRA 4CM8B 5J5VA 3M2TA 3TXAA 1NJ8A 4PNPA 1T9AA 2H59A 3AR2A 4P80A 2CJFA 3PGA1 5JSUA 3SGLA 5JJ5A 2I7VA 3LFHA 4G0MA 2BAGA 1KOJA 1GG2A 1J1ZA 4RKQA 1Z22A 3KHSA 4QOFA 1X1AA 3O5AA 4P3KA 5JBIA 1NG1A 3ZQUA 1CUVA 3TCNA 1CWUA 1Z4MA 2HA7A 2QAGA 3H9EO 1LPOA 3GQVA 1O58A 5C53B 3TVTA 2P8SA 1GZHB 4J9UE 5LN1A 3IAEA 4MPJA 3TZCA 2CEKA 5JRJA 3AIOA 1T36B 1UMBA 3ZWCA 4B73A 5KYGA 3CO0S 2I1WA 2H7CA 4NFYA 4ENSA 1L7VC 2QVCA 2B4KA 2GBFA 4IDGA 3R76A 3IERA 4F5WA 3P9ZA 4U3JB 3ZN2A 4DRXB 4TKVA 4IDPA 4OK6A 2G63A 3OZAA 5ILOA 4NZ9A 2GCEA 4YRLA 5L7TA 3ZLTA 3HKBB 4GI7A 1KPHA 1XJ0A 2XCTB 4G1EB 4HH1A 1SKAA 4AXBA 2DE0X 5COAA 1QTNA 3NDPA 1TTTA 1CQPA 4ND1A 3RUDA 1L5GB 2JJ2D 2LUOA 4TXHA 2OWDA 2PJDA 3ISVA 3HB9A 3B6ZA 3ODGA 4JAVC 5EXEA 3EGXA 3OM1A 2AE1A 2VDQB 1Q1BA 1WXHA 2RHGB 3OIYA 1I33A 3K05A 3Q3CA 4W1QA 4DJ5X 3UMYA 2AI1A 1AKTA 5AM5A 2VF7A 1MJGM 4AIIA 3OPYB 3OEHA 1DRUA 1SBTA 1EX7A 1FMFA 4CN8A 3R77A 1PL8A 3KTDA 3V4FA 2X40A 4DLVA 3BTUA 3VVCA 3UGJA 1NUTA 4Z5XA 2IH5A 3FHJA 4NH4A 3SYKA 3P2IA 4L07A 4MJLA 3L84A 3RSSA 3OE5A 2OD7A 1M2EA 4G0UA 8LDHA 5JS7A 4XSGA 2Q3HA 2BEVA 3EEBA 1BEEA 1KO7A 3BXPA 1EE9A 2EFHB 3BRWD 1GQRA 3DL2A 2C1ZA 4QXQA 3ICOA 3TX2A 4DLPA 4IH4A 2BFFA 4RSMA 4YJ3B 4HX2A 4E6EA 4W5QA 5A4IS 3ONEA 5EJFA 2R85A 1QH8A 3NRJA 3PQEA 3H11A 1MB9A 4TN1A 5LYJB 4BJ1A 3W5CA 4M1OA 2X19A 1IM5A 1UOQA 1UMCA 1BRMA 1B6SA 3MCAA 3GEHA 3R4CA 4B85A 5C7IO 3OM8A 4KXNA 4MKZA 3U13A 1CETA 3OD5A 4JENA 3AVVA 1HDOA 3SJUA 1JLMA 1HMPA 3K0CA 1M9NA 2QXUA 3EZ9A 4FPXA 4NBVA 2XODA 3TQTA 2GVNA 1GKKA 1PTJC 1QFMA 2Q1WA 3GCWA 1POWA 2R47A 4QDXA 4XVQA 3OLXA 5CVDA 5ILGA 4EG5A 3QKSA 4XGQA 2V1XA 4YCCA 1WB4A 4TYQA 3QLJA 3LXMA 4K9OA 3TNJA 1S4MA 4FLEA 4ZK6A 2NQ2C 1YR2A 2YWHA 3AK4A 3GUYA 5C8ZA 1IULA 3AY6A 3AY0A 3LPNA 1YB1A 2CHEA 3BWCA 4C7OA 2LVBA 3FRJA 2XUGA 1MRZA 4GPEA 5ECWA 1P2SA 2F67A 4FFWA 1NC1A 1QO0D 5JRZA 2J3JA 5GM2A 1XLUA 2YH2A 4X66B 1PZFA 3AB7A 1XHEA 3KFXA 1LI4A 3H5IA 4M9ZA 1Q84A 2W2LD 3SF0A 1B8VA 3SE0A 3TLCA 1JLHA 3OQNA 3NTLA 2O7VA 3MJTA 1Z7BA 3CH5A 2VDMB 2P2NA 1AV7A 1UP7A 1XWFA 3D6NB 4HAOA 2JARA 5E2BA 4LGYA 3R8XA 4AS3A 3BAZA 3M8KA 4UBIA 3RT7A 13PKA 3UCXA 3FTPA 5A0VA 1NQ5A 4H0CA 1GFZA 3ZD6A 2D00A 1N6OA 1V1RA 1F6DA 4AYWA 2XA2A 3CE6A 3KYCB 5IM5A 3SBXA 2F8TA 3NTQA 1E69A 3EFOA 4NEHB 4M0LA 1ECLA 3F96A 4H6VA 3MG9A 2E85A 5F76A 3MWLA 1T8WA 2DMRA 3L5OA 2KBFA 3ZDQA 4B31A 3TTVA 2QN6A 3GLSA 1IM2A 2JD2A 3UOGA 2Q7XA 1JKJB 4FEYA 4HDQB 4MQFA 2QW0X 5LBIA 5DLPA 3N8IA 1X8LA 1OFIA 2XUQA 4TQAA 1RMTA 4YRGA 2P4SA 1GA4A 2YRFA 1X86B 3G59A 3EEQA 4RH0A 1BRTA 2L17A 4WADA 4UHDA 5KQMA 2YN2A 3H13A 4X1IA 1WXFA 2F4VB 4ADSG 3TSCA 2IC5A 2WIJA 3INNA 2QD1A 1Z2DA 1MIOA 1OVMA 4S35A 1I6WA 2J4DA 2Y67A 3BWYA 3INRA 2IXBA 4MUKA 4D0GA 4F6RA 5BN3A 2JKZA 3AFIA 3QOYA 2B4YA 3AUTA 2I3ZA 3U0BA 5BY2A 3IP8A 3RJ9A 4EFNA 4AJNA 6NULA 1S6YA 4RZQA 4BHTA 4EJSA 1XKLA 3EMVA 3L7YA 2C95A 1LU9A 4R0NA 2QGNA 4RF5A 4ZAZA 4TTTS 2ZYAA 2ADMA 1GPH1 1GQOA 4NECA 3VR4D 4LOKA 1ZMOA 4R84A 4XIFA 3OQVA 1Y5LA 3U80A 4CCYA 4DY6A 3A4TA 3M3HA 1R8QA 3NBMA 1RTTA 1GJRA 3WWDA 4HWSA 2JLRA 1GARA 2NO6A 3IBYA 3UOAB 3NGMA 1KYZA 1H3NA 2JLSA 2RGEA 4XIYA 4EF6A 3DEJA 3HDTA 5I8ZA 2W6JA 2EARA 3E3AA 1T29A 3KG2A 2F3SA 3ZE0B 2Q7OE 4BFSA 1W2WB 5A04A 2KYRA 1TT5A 2N47A 2SCUA 1UEJA 2QW8A 4KYIB 3ADCA 2CXNA 2B98A 3BICA 3LBHA 3BWMA 3SQMA 1AUXA 4DZZA 4BFVA 4ZA2A 2CT8A 2HCRA 4LJ6A 2H1RA 1OZFA 1FPMA 2M2IA 3JQBC 5ENVA 1AMNA 3S2FA 1KFKB 4A03A 3I6QA 1QG6A 1GU7A 5JNTA 1P72A 4UTPA 2FWPA 1O9GA 1Z34A 3AVTA 2B4QA 3TEFA 3O75A 3ODPA 1Q7EA 5TS2A 3E5RA 4M98A 4H7PA 3PGKA 4NQRA 4Q1CA 2P6NA 3BF8A 1TZ2A 3L6CA 4OX9B 2O8BA 1YKFA 4F96A 1KFCB 1V3TA 3HLKA 3IHKA 1CUAA 1U8XX 3MWFA 3I6MA 3GEEA 3OKCA 5AQ1A 4J0JA 4A8JA 3FPEA 2PZAA 3HYLA 1SQ6A 1WD7A 3LCMA 1EAMA 2ESRA 3KYDB 5J3JA 1DLJA 1HUQA 3LQKA 3ZD8A 4Q4AA 1ISHA 4E33A 2V1UA 4PGMA 4S12A 2UYYA 2ZT7A 3GWGA 4AJEA 1PT7A 3K6JA 4C0LA 1XF1A 3L2OB 4JCOA 3VUFA 4DA7A 4E6PA 2IX3A 2HSWA 4NFSA 2D5BA 2HEGA 3I05A 4TGLA 1GO2A 3GA0A 1A8IA 5CA0F 2VC2B 3AW8A 3DPSA 3R5HA 5TQ2A 1XTZA 1EFLA 1EXNA 4OGGA 3U3DA 1B6TA 1M10A 1T4DA 5KYUA 3NTXA 5CVUA 4GIBA 2X22A 4MW1A 4REQB 3WNVA 4YJ2A 1WDWB 4JU9A 2PUDA 4EK9A 1B14A 2AEMA 3OTGA 2Q5OA 4J7AA 2QIOA 4QDUA 4AZ3A 5CMLA 1GSAA 1DG9A 3GGJA 1WQ3A 3P0FA 4PBRA 3VJMA 5AOAA 1M2VA 1ODJA 1XTSA 1QYRA 3KAJA 3C6YA 3MTQA 1FDIA 4MJXA 4QNRA 1EWTA 5E6RB 3RUIA 3ZE6A 3L07A 1A7KA 1RAFA 4KE6A 3BMNA 3V4RA 1T8UA 3IT2A 4O4JF 3DOOA 3DB2A 2A1UA 4UPDA 3TEJA 3RTGA 3ZIAA 4LY6A 4BQOA 3AEKB 2BGUA 4MPDA 3PF9A 2WTUA 3ITNA 4XPZA 2WSMA 1IVYA 4BJ6A 4EKEA 5CCEA 4YMLA 4DV3B 2Q4EA 1KZGB 2W2KA 4PV7A 3ROMA 2IS6A 2UUAB 5KSOA 1JDBB 1U7PA 3FDIA 5KHLB 2R0QC 1QGED 2DY1A 1D4ZA 4N3AA 1U9CA 4LHVA 5BYJA 4DLKA 4P22A 2ZQZA 4BC0A 3SR3A 1I9CA 2I2BA 1SCNE 2C5BA 3AHCA 4IO1A 4P7JA 2CFOA 2W8BA 4IR7A 2PKYX 2GILA 2C1XA 1E3EA 2YHUA 3E8SA 1XQXA 3RI3A 4CLDA 4DJEC 1SUIA 1RQLA 4WMLA 1WBDA 1QOQB 3VQTA 4XWOA 4KR7A 3PC3A 4OQQA 2AA3A 1YQEA 3OQJA 2GPYA 4X3CA 1EGQA 1RAIA 2CBZA 3OF3A 4GOLD 4AKHA 1SBCA 1KQPA 4MCHA 4ZKEA 4CM1A 4E22A 4F3KA 4FJ0A 2CKDA 5F7OA 1P8JA 3R6WA 4JJ7A 4LA4A 1JEEA 2P5TB 1QVWA 1QG0A 2J5BA 1XMVA 3QUTA 2Y1GA 3BIXA 4TSKA 3DVRX 4CYMA 1FU4A 4FOPA 3C3KA 3DEZA 4MS4B 3THWB 2PUEA 2BN4A 1NVUQ 2QVXX 3C3PA 3PE6A 1N4DA 3R5JA 4G23A 1XDUA 1P77A 1ZI6A 2OLEA 4BVJA 3IEMA 3W9SA 1DKNA 1EFUA 3WWOA 1Y8QB 2ZP1A 3ZWKA 4HLNA 2CVQA 3DUFA 5IHPA 3HA3A 4XM1A 1OT3A 2IHVA 1CUXA 4YFVA 3WY9A 1YU6A 4ZZIA 5DHSA 1I30A 4RH3A 2J3EA 4P5DA 1Q14A 3ORHA 2CD7A 2JKVA 1UT6A 2I6QA 2PU5A 3UKOA 4BGEA 5CIYA 1HDZA 2J30A 2V9PA 3DYIA 2Z9DA 4D9KA 4M1EA 1H2FA 3PBKA 1RWPA 4QRHA 5FXMA 3CY6A 5H4GA 3O8OA 3G02A 1W0JA 4L85A 4I4IA 2UVPB 5LB4A 2HTFA 3AI1A 3KB1A 1FUIA 3EZFA 4Q6WA 1T5TA 4XXHA 5K20A 1WM1A 3INGA 4X93A 5DTMA 4FSHA 5JXWA 2PANA 4B9AA 4S24A 4CLRB 3IB6A 4URXR 1J49A 2C82A 3DKPA 1ZRHA 4D3DA 5ESXA 3EDYA 6LDHA 2IEZA 2VYCA 3V7WA 1Y1QA 1UZNA 4AXXA 2W93A 1T2DA 3I12A 1RIFA 4J49A 4X1YA 3PFNA 2RE8A 1DV2A 1XYVA 4V0OA 2HZBA 4P3PA 2PO7A 1KNQA 1PE0A 3C43A 1ENZA 1ZOLA 2CHQA 2YVQA 4D8XA 3WXBA 2VDNB 4D1YA 1CNMA 5DM60 2C7GA 3FWYA 1NMSA 1WABA 3H5TA 3AU8A 4JT2A 4OHOA 2UYGA 3I09A 4EUFA 1THMA 4GBED 3G1UA 3A3YA 3NDIA 3QEMA 2V7QA 1EFKA 1U3CA 2ZUFA 2B5WA 2VT7A 4XCXA 4JXJA 2Q9BA 5AHWA 4EABA 1EFPB 1FNCA 5TE9A 3ZY6A 3IV9A 4YYZA 3CZPA 2FFQA 2B2XA 1KVRA 1NRWA 3PXBA 3LTNC 2JLZA 1Y3IA 1T5OA 1DKRA 2ZAYA 3T5DA 5LZ7A 2G9UA 2XUHA 4N48A 4O4LB 1SXIA 4QO8A 5FD8A 5HKLA 1FTGA 1WUIS 1X1EA 4MGEA 3U3JA 3ZV7A 2NUPA 4WY2A 3G88A 1T6ZA 2ZM5A 1YQWA 2RARA 1DX6A 2FTKE 4EUHA 4N6OA 3L7LA 4UU0A 1MU0A 2HKIA 2AG0A 5SZIA 1QQAA 1ENPA 2GEVA 4TUYA 1A76A 4J3JA 4RYLA 1QHXA 1KF0A 4FYKA 3QWHA 1PD1A 4G4SO 3GFBA 1RM4A 1AXEA 1FK8A 4D79A 5F2NA 1LS6A 4ARZA 4I6EA 1RI1A 3NDJA 4ZU1X 3BT7A 3ACDA 5BVGA 2V0NA 2IVZA 2PWZA 1Z8FA 3AO0B 4R68A 2GCNA 3SQDA 2WVGA 1DHRA 1OHHD 2OK7A 3BWVA 1X8JA 3OUZA 3RT1A 1QPBA 2EQ5A 1ZGGA 4C6TA 1PTKA 4IFTA 2J4CA 4KEAA 1N75A 2WT4A 3GDFA 3D2AA 3H75A 4LZAA 4PG6A 3TL6A 3VR4H 4B4DA 5AK6A 1H2BA 5IBRA 2FE4A 1SUSA 1YIDA 4I55F 2NU9A 1EUCA 3JASB 1XJQA 3K72B 4FR2A 4EG1A 5GGYA 1J8YF 3NHWA 2P9YA 5L4NA 3LPDA 4OXXA 4AF8A 1H5NA 4KZKA 5JJIA 4IGFA 3LDHA 1CYEA 2I6FA 3OZVA 1UBOS 4LJ5A 3T35A 2VZ0A 1ZW6A 2BZ0A 2EBFX 2QN8A 3CT6A 4ZWNA 3VKWA 3VSEA 3B48A 1QAMA 2ZT5A 3PZRA 2NVUA 5B3LA 4DIFA 4HQ6A 4L8VA 4PRZA 2FYTA 2QR5A 3REOA 1CJBA 1W9HA 4X63A 2ILVA 4D9HA 1Z0AA 1RWKA 4E46A 4R6WA 3RBXA 4UNIA 4ZJPA 2QBYA 1L7DA 1NUAA 5DI9A 3WWZA 1YIOA 1CB0A 4K1XA 4UU7A 3HWRA 1BQ3A 3L6BA 4G9BA 1ZJJA 4KXLA 3ZKWA 2ZROA 1TEVA 3GBSA 2XB4A 4R31A 2BM0A 1BVYF 1P1HA 3QVLA 2JLAA 2A5FA 4UHKA 1YDMA 2VWGA 4LE1A 5F7JA 5JSKA 5CTAA 3QYFA 4B4OA 3N5CA 2Q62A 1F0PA 4NJMA 5KNBD 5ALRA 3HVUA 2CYBA 2J9FA 1R0BA 3N3AC 2F9LA 1H1DA 2OB2A 1A7AA 3A1EA 4NC9A 2P30A 1WXWA 4JI6B 2JA2A 3TO5A 1NT4A 3UJBA 1GNLA 1R3UA 2WZDA 3UM9A 2VYQA 4OVKA 1NW9B 4XJSA 1WVIA 3BL6A 2O8CB 1MB3A 4EG7A 5BV0A 3FUWA 1AO0A 2MYUA 3AR3A 5HUHA 2PQMA 2YXDA 5TC4A 1KVTA 1R8JA 4QXOA 1B15A 3Q15C 1P8AA 2I3GA 4BTLA 3H2KA 5F4ZA 1BGWA 1NJFA 1SPBS 2V45A 2VJLA 1GXSA 2O2YA 1QRAA 3EVZA 4DR5B 5K0LA 1CIJA 4UBMA 5K8UA 2GX6A 2RIRA 4TYNA 1TK3A 3JXEA 1SU4A 3IDFA 3OAAA 1QTIA 2J9ZB 1D2RA 1KO1A 5AW3A 1EWKA 1R5JA 3TQSA 5FIUA 3T99A 1AQNA 5CNMA 3RFXA 2B92A 4NWIA 1XZEA 1I36A 1GZ3A 1KMHB 1LQ2A 1MORA 1T0PA 5K3FB 4Q03A 4H27A 4JT8A 4RV5A 1TU0A 4KQWA 3D3EA 2V7XA 3GZNA 4JI5B 2Q3JA 1BGXT 1FZTA 3DC2A 1F9AA 1JXMA 2IYSA 1XG5A 2VJMB 3OWXA 1M8PA 3ZR4B 1U8FO 1YNSA 4HWKA 3W3ZB 3HJUA 4LDRA 5A4AA 1A9QA 1D9XA 2B2CA 2UZ3A 2I80A 3T1VA 1ZD4A 1KXJA 1L8QA 2BTQA 2V8OA 4GGOA 2Y1EA 3KZOA 2YZNA 3LWBA 5KUTA 4A15A 3ZH9B 3R7WB 2DFPA 3W2EA 1G8SA 1YQ9A 2H4ZA 3N8GA 3CR3C 3IPYA 3ZQKA 4R69A 1THGA 3NHFA 3PGJA 4MGHA 4MX8A 2J6BA 1FJ2A 1U5BB 2NTVA 3N2LA 3OEEA 4WNCA 5LDGA 4LOIA 1IHPA 4GX5A 3QUSA 3OCXA 4FS3A 3U49A 4NK5A 4MVJF 4F86A 1E9FA 1B3RA 3S99A 3SHQA 2JAOA 1R15A 2WWFA 2Z4RA 3MTAA 1KYQA 1GCUA 1TGYA 2VP6A 2XOKD 2BEUA 2W43A 1QV6A 1L5HB 5IJAA 4TN5A 2VKQA 1OZGA 1ZM2A 5NULA 4Z3DA 5L95A 1NBAA 1HMYA 5ALXA 1IUOA 1V96A 3S1AA 3LIIA 3P2OA 1HFKA 3L6DA 1G60A 3K0EA 4RACA 4TKUA 4IH1A 4UHJA 4HRAA 1AB5A 4YJDA 4B7UA 1ESNA 3BIJA 1RTKA 4AQYB 3B8HA 2YVAA 3A6PC 4X1KB 4WI1A 5HP4A 4ALNA 5FUVA 5E3JA 5U9CA 4QFDA 1TD9A 2NZUG 4AURA 2WE8A 3JQAB 4H4DA 3H5NA 3QFSA 3PEYA 1ZMTA 3JATA 4BQSA 1GT6A 3HUEA 2BTEA 4ZVSA 3R9IA 4NF2A 2PKCA 3T41A 4M8NE 1XAHA 3IXQA 5SZJA 4FCVA 5THQA 4OV6B 4NCJA 3EXHC 5DNWA 1EH5A 1GCOA 3UWSA 2PT9A 4C7VA 5HJ2A 1U80A 3DNMA 1QLHA 2JIPA 4AKIA 4BN5A 2PX5A 3WTBA 2DR3A 3L40A 2J59A 1DAHA 1MEJA 2DHQA 2FLWA 3NWBA 4PYNA 4OX9Y 5B3AA 1KRHA 4YMUA 4QLAA 3PHJA 1P31A 3WGLA 3T4EA 3LA6A 3MS4A 1KQ3A 4DKXA 4F3NA 1E7RA 4Z99A 2EG9A 4TTSA 1GCAA 4R4JA 2FJUA 1ULTA 5AP9A 3PUJA 2Z95A 5BRJA 4OQNA 5KQLA 4LDAA 4IHQA 4LC0A 3CH7A 2CK3A 3P0IA 4TL8A 2O0LA 2VZEA 3A6FA 4QQ8A 5B4VA 4G0WA 4KREA 2I78A 4N41A 1Q17A 1T2AA 3HYTA 1RQXA 1UKAA 3DXYA 3JR3A 4WK4B 3ZOZA 4EVIA 2Y1FA 3M4XA 1Q91A 4XWYA 2DTDA 4O3MA 4V2IA 3AVYA 4J43A 2ZRAA 5CJ2A 5T7BA 3SXPA 3ORFA 3CA8A 1KI9A 4I0WB 4B6OA 1KOLA 3IQHX 4PVDA 3ONWA 1YRBA 3U62A 1U8AA 2ZJZA 1LC3A 1L0BA 1TFUA 4MNTA 1W36C 2KLHA 2YCLA 4HNAB 3A0UA 4HB3A 5AKEA 5FYQA 2R1ZA 3ZY3A 3ZVRA 4MWDA 1DKPA 2HCFA 1TA9A 2OV8A 4FOOA 3CB2A 4LXHA 1XEXB 1UZLA 4TT8A 1W1UA 4LF8B 4JJ6A 4XR4A 2JI7A 5C1IA 3KRTA 2QPAA 4NR0A 4BPRA 5FKJA 3N9IA 4FDLA 5AVJA 5JMOA 1GA6A 4HVAA 5L3QB 1UKVY 1DBQA 1QFXA 1K08A 4GZ6A 2QR2A 2VPWA 4N82A 4JVNA 4PGGA 3PGVA 1UWKA 5F3RA 2X0FA 1C0IA 5E2IA 4FW9A 4FHEA 5D6OA 3EWNA 2ZB7A 1H1TA 3FNQA 5CW2A 4ZI3A 1AVTA 3F7OA 3WRYA 2IPXA 4BRZA 2BJVA 3N7AA 4FZ5A 3WS7A 1VHWA 2PSSA 4D97A 3R9XB 3O4FA 1ECCA 4WN9A 5FAKA 1Q2UA 1RI4A 5HE9A 1KO5A 1R18A 1AQ6A 4UE3S 1AJEA 3ZJ5A 2O3TA 1G21B 5BSWA 4BKPA 5E9JA 1MAHA 3CLSC 3DVLA 3G8AA 3O0DA 4NBNA 3OOSA 4KH1A 3PWZA 1EDZA 1A9ZA 1VM6A 3MLEA 4TZ6A 1FDVA 2P9ZA 1D4FA 2B6NA 4YECA 1RQNA 2BR4A 2WZBA 4OFBA 2OCYC 3SC3A 1Z7GA 3C4QA 3BDAA 5AXDA 4BO3A 3SQOA 4EM6A 4M8LA 1IHDA 3G17A 4ND8B 4H1WA 3WVNA 2WIDA 2Y0BA 5J59A 1IZ0A 2D5LA 4LDQA 5AI5A 4MRNA 1BVUA 1F6WA 3PJEA 4MYHA 4R71A 2QTHA 1I2MA 4GI3A 4G5YA 1O9HA 4MZDA 2DFTA 1AG9A 2WE7A 3QF7A 4FZRA 4NONA 1N92A 2D2XA 4Q9AA 1QYCA 1ZK2A 3GJRA 3YASA 4OSOA 5CHYA 1UM9B 4KQIA 4D42A 1IVNA 4AY2A 2QSUA 1S9DA 4FHGA 5B5SA 3FUVA 2RHDA 2W4MA 3ZW8A 5AR1A 1QO9A 1X42A 1HL3A 5EZYB 4FVTA 1MGOA 3CX4A 4CVNA 1IRXA 3DBRA 3OI7A 1MCZA 1XTIA 3WB0A 3LSTA 2FPMA 1JHYA 2YDYA 1BQ4A 1TMGE 3DOJA 1IJKA 1P44A 4QNMA 4HDRB 3NONA 1E89A 4P4GA 1WEKA 3L0DA 1DAEA 1V1MA 4PC2A 3RC1A 4JT9A 4EUSA 5CD1A 4RTNA 3R09A 3PG5A 3VI3B 4UUQA 4JBXA 4DJDC 1T3TA 2QE6A 3A1VA 4OMFG 4Q3CA 2IZ6A 2WRZA 5M7EA 4EO4A 1KSHA 4G81A 1MOSA 4PE5B 1OJ7A 4G89A 3M6IA 5BN4A 3LUGA 1CZNA 3KAKA 3H7AA 4FC7A 5GZ3A 5FFNA 4CF6A 2TMYA 1JAIA 3LPLA 1ECJA 3ND6A 3RCBA 3ROKA 2BFAA 1DT5A 2QQEA 4IDCA 5C4GB 3ICQB 2I7XA 3DLAA 1XEAA 4IICA 2J09A 1N36B 3OEHD 4R8VA 3DEYX 3GJTA 4IDAA 3GV0A 4C7JA 4IIEA 1OBCA 2Q45A 1C30A 1RW4A 2C54A 4ZYVA 1RRPA 1JAYA 5ICFA 2X6RA 2VDVE 5DP1A 3KCQA 4HH4A 2CMHA 4GMHA 2H16A 1G5TA 5AVKA 4B84A 3HO6A 4D8TA 1I3CA 2ZI7A 1ZM4A 2FUKA 2PU7A 1DX4A 2Q5HA 3HB1A 1NRIA 2KPOA 1XTJA 3W9YA 5KYTA 3QSYA 4BLTA 1W73A 5SYMA 4FE4A 2VRNA 4M1TA 2YCBA 1BJKA 4HH0A 2ISSD 1DJOA 2FOLA 2MU1A 4UU1A 3SZOA 2IP4A 3LUBA 4QNNA 4R8SA 1CR2A 2ISCA 5TY0A 4F12A 5B4TA 4AZWA 3I58A 1OXKB 4NKRA 1K27A 1HL7A 3L1HA 1AXRA 4UM7A 2O0KA 5EINA 2OGZA 1GD1O 1X9GA 1AUQA 4JC8A 1U3UA 4DFDA 3GLHE 3E03A 1H2YA 1PJRA 5FT9A 1WD5A 4XYMA 5MDHA 1C9MA 2RJNA 1I1QB 2ZIXA 1C1DB 5EJ7A 2ZBGA 3EDRA 3CUEF 4AY3A 5FWXB 4MVJE 3W05A 4MZXA 1T3LA 4TYPA 4EIWA 1KO4A 1L6RA 4OIFA 1OAKA 4MICA 1C7IA 1ZBQA 3UUWA 1MT0A 3CIOA 4M1KA 4HDMA 1TTHA 4LYGA 5E6SA 1QF9A 1UBEA 1ZLYA 1G6OA 2HL6A 4WESB 3S8MA 2BFMA 2XZPA 4HN9A 1CE8B 4RK4A 4WOPA 1XTTA 5B3KA 4R2HA 1T9GR 5LP6A 5HRCA 4CEJB 3JYQA 3MSXA 4XD2A 1Z25A 4EG3A 4HATA 2VK8A 1A2KC 4LYEA 3SC2B 5TEVA 3IIIA 3OM9A 1LK7A 1BDJA 2GEUA 1JR2A 4RMJA 1ISRA 1M7BA 1Y1KE 1IN5A 4M0CA 4MS3B 2ZJ0A 3OUTA 1BN7A 3P5BA 4URYR 2VDRB 1PR1A 4G1BA 1ADCA 2A5JA 4RVFA 4XJVA 5FPQA 2YZMA 4ASUA 4H08A 4DLNA 1M2WA 3LIPA 4PX5A 5BT8A 3MB5A 3QELA 1V8FA 4NYMR 4JCCA 5EQFA 2HMSA 2PMCA 4ER7A 2MYNA 4PAGA 1GHTA 4OP3A 4ZC1A 5B7GA 2HWYA 1ZHFA 4HRYA 4RSRA 3EDMA 4BLQA 5EJ4A 3EGEA 3QXXA 4GICA 5BOSA 1LUAA 1XVVA 3CLVA 2WYUA 2ZJ4A 1JF8A 1GDDA 2ZPTX 4CUJA 2FZLA 3OQBA 3IHWA 2IYOA 1U2PA 4A8HA 2X76A 1BW9B 1SUPA 4LYFA 4MPTA 1VOTA 1D8TA 5KDLA 3EXEB 3MWJA 3W8RA 5LPNA 4U1RA 1N2IA 3TOSA 1MO6A 3K5PA 2HF7A 1LLFA 1E5VA 2FK8A 2H2IA 1PUJA 1WJGA 10MHA 1QQ7A 4BU0A 1NPTO 3ADDA 5BQXA 1A7JA 3FYHA 4RTMA 2JGDA 5EIBD 2Z6VA 2R25B 5K3CA 1OWLA 3HP4A 2NU8A 2JJMA 5U4QA 3B1WA 3DULA 1T1IA 4P3YA 1GPMA 1PLJA 2JCSA 3MLAA 3EXG2 4CXMA 1OMOA 2CLDX 5FL7A 2JI4A 4G5GA 1OASA 3ZCQA 4Z2AA 4ZV4A 5LOVF 1D2GA 5ISMA 1I7LA 2X5KO 4TUYF 1F20A 1SFRA 1WLSA 3SJZA 3HGMA 2F3QA 2PWPA 3PWTA 5GV7A 2W6JD 1SXHA 4ARAA 3OJFA 3NKLA 3IP5A 3K09C 4ZYTA 1ENYA 1QQBA 3QFHA 3VISA 4N6NA 3FZEA 1UK7A 4RESA 4CMAA 2P9EA 5A5GA 3HJHA 1F0YA 2FZ5A 3EOZA 1LSSA 3CX8A 3EF0A 3E7WA 5EJ2A 4DQDA 3GWZA 3ZVNA 3GEPA 1R0RE 4OGFA 1LVHA 4D8YA 4MW7A 4O02B 1YI1A 2GLTA 5J1SB 1T0JB 1S2IA 4ZQCB 2FPSA 4L7VA 2POQX 4P08A 2CY0A 3TZLA 1JG6A 4D9MA 1XO1A 1G6Q1 1KFJB 3MCVA 1BWRA 4XVRA 2WHPA 3D0OA 3GUZA 2HWWA 3QPWA 4DLUA 1XTPA 5FX2A 4LWZA 5DKFA 4DSOA 4S0XA 1H4VB 1RQRA 1RWOA 5JCZA 4TS3A 5LDHA 1XVAA 1M1ZA 3DAOA 2ONJA 3HLTA 5DHPA 3NLLA 5B64A 2WT8A 1E6EA 2HB6A 2WVJA 2I5PO 3A37A 1SQ5A 4WDRA 4Z7NB 4GVLA 4RVDA 4AZTA 2Y68A 1U4OA 4RF4A 1KK3A 1FLVA 1FFYA 3IT0A 3AW9A 4HUQB 2AOUA 4AKTA 3LW7A 3Q7PA 5I7HA 5CFQA 3F1KA 3ZCXA 5HFAA 4OQEA 2Q4OA 1ODTC 1D09A 3MBOA 2ZI9A 3PGLA 4PRKA 4XPIA 2BJHA 4L4SA 4ZZ2A 3U7IA 1E5TA 3X0DA 2Q3MA 4ZVPA 4RZIA 3GMDA 1UOPA 2YFQA 3NIGB 1ODIA 1G8FA 3NTRA 4DY4A 1I32A 1VJGA 2BFPA 2DC1A 2GFQA 2ZSFA 1Y7TA 3AIKA 5C80A 2CLKB 3JR7A 1EXWA 5FDFA 5KVQA 4QYIB 5EKSA 4QM6A 4RL4A 4LZLA 1IJBA 3ESRA 1AKVA 2WG0A 5IARA 3U9SA 3T1HB 3W0LB 4IS2A 2XX3A 4HWTA 3ZCPA 2QQFA 3EZNA 3WLSA 1DV1A 5H83A 3ZIAD 2GS9A 5EXPA 1SKYB 5CITA 2PSJA 1QGYA 5CT9A 4G0PA 2PS9A 2Z6UA 2YASA 4L0QA 2GTIA 3EWSA 2QL5A 1ZVQA 2D2EA 1L8XA 1PZEA 2CXQA 3IQWA 5H3CA 4C87A 4J8PA 1MX9A 1XNQB 4Q66C 1XTUA 5LFAA 2HUNA 3I2JA 1SB9A 1GTSA 3IUJA 4RJIA 3U3OA 3KQUA 2HHHB 4NCXA 3FVTA 1XZDA 4I4TA 5KYXA 3EW7A 4D96A 1YRWA 3A70A 3G2MA 3SVLA 5GJBA 1QKJA 3TZBA 2A8YA 2VDUE 5LKRA 3I2HA 4MQEB 4YI3A 5HDQA 1JUDA 2PSHA 2QPLA 3W8EA 5FTLA 1XZBA 2PYIA 4H3KB 4LJ9A 4PLTA 2Z5GA 1M6VB 4YMSA 4NPHA 4DREA 4QUIA 3VOAA 3TD2A 2HLHA 5FUMA 4PX2A 1GPAA 4II3A 5DXJA 2D7DA 1U1CA 4EPVA 2W8ZA 3BDVA 4P8RA 5DT9A 2PBRA 1A2BA 1QMGA 4XUCA 5IAGA 3WKEA 2R3SA 1DQSA 5MN5A 3DVQX 2XGSA 1MO4A 2YZGA 5FOVA 4Q3DA 3DEKA 3LPMA 4CDNA 2B69A 1KI1A 3TI9A 4ZEMA 5J43A 4MKXA 4RH1A 4WNAA 1I80A 5SV2A 1NDUA 3IODA 4BUJA 5C8YF 1SU8A 3IVRA 3LT2A 3CZRA 3GAFA 4L8GA 3GLIE 2MT9A 3LV8A 5C7LO 5LU9A 1IHOA 2HPHA 3H0CA 3PX3A 4MHTA 4CU2A 4INJA 3OE7A 2FRXA 3AXSA 4E14A 4N3GA 5CDHA 2MIIA 1E9BA 1ZCJA 1UBKS 3C8HA 3FVWA 1A96A 3GEIA 2QMZA 2P0AA 4Q1AA 4JVOA 1S2GA 3AFHA 3DZHA 3LDFA 3HKEA 3VPXA 1IN1A 3JQ7B 1IXZA 4H9GA 4K6MA 2JKYA 5FPTA 3A9TA 3LRXA 4MI1A 3VGPA 4HNVA 4UTNA 3T5CA 1RAGA 5ENDA 4D4JA 2VCYA 1DG3A 3B36A 3W78A 2JLUA 1JEAA 2YMMA 1E0SA 1W0JD 2WEKA 4MWSA 1R8YA 3OOEA 4EI8A 1JWBB 1W0CA 1Z6XA 2EJTA 2QN2A 2Y27A 4R2MA 3UQYS 3AY3A 3VR5A 3NZEA 3X1DA 4RTJA 4QHTA 2HLNA 3Q3HA 3OQ6A 1NQVA 3O83A 1O6GA 4K2AA 1LXCA 4E08A 3NV7A 3MXOA 2FZ4A 1RT9A 4J16A 1EUDB 4RPLA 2XYVA 2VP5A 1OJLA 1FTWA 1G18A 5HKBA 1TPYA 3FGPA 4P34A 5CDSA 4LG1A 6PFKA 2OZKA 2F2TA 4HNTA 5F78A 2OCKA 1U7OA 1BXKA 1WR8A 4FS8A 1O6FA 1P0MA 2AWNA 3EHDA 4OH1A 4EUEA 1AKYA 1IG3A 2GN0A 4EY7A 3S4YA 3PXCX 2PR2A 3ZHSA 2OM6A 2IUSA 2VUSA 4G56A 4NULA 4XUGB 5T41A 1XN4A 3PUHA 5TEWA 2ZKIA 3N8HA 4BECA 2NXEA 1APBA 2QWXA 4L16A 3T1QA 4RIHA 3I5MA 5DNAA 3RQSA 2VDKB 1GZ6A 2B4RO 2V7QD 4V3CA 1YGPA 1RKVA 2Z57A 4TV8B 3WFZA 4KV9A 5IJXA 5AI0A 4NCIA 2IPMA 3GP5A 1JVBA 1SG6A 3FYTA 4C5BA 2C5EA 3GMTA 1M34E 2YDXA 4LECA 4E5YA 1KI4A 2I7DA 2HNAA 2IDKA 1IMJA 1L1EA 3ZS9A 1XR3A 5JJKA 5B3JA 1JLSA 1PX2A 4B8WA 3WSWA 2WQ6A 3NKVA 4YT2A 3MEQA 5JROA 2FHPA 1RHJA 2Z3ZA 1WUHS 4HAZA 4O63O 2P7IA 3AF5A 2ZWPA 4ZHQB 3WWYA 4H6WA 1PWHA 4OL9A 2C7VA 1M6WA 2HV9A 1XN1A 4YUAA 3U9LA 4W5JA 5A4MS 6REQB 3FCSB 3TBFA 4XLLA 5AW4A 3VC2A 4HNRA 1UMKA 2EP5A 4LDNA 2YOFA 3ZNQA 3KQOA 1YT5A 3CISA 4U2KA 1W4CA 3LUFA 1PUIA 5F1PA 5BOVA 2WU8A 2I2CA 1DCFA 2PVCA 1LV8A 3RVNA 4TKZA 2MTBA 1O2DA 1ECBA 1YMQA 1WE2A 2BH9A 3IXMA 5ULLA 1I5OA 3Q7IA 1EKXA 2EBUA 3HG7A 1RM0A 4MVWA 4OBBA 3UC9A 2EGHA 2P9TA