3Q72A

Crystal structure of rad g-domain-gtp analog complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
138
Chain Sequence
SVYKVLLLGAPGVGKSALARIFGGVHTYDRSIVVDGEEASLMVYDIWGDAYVIVYSVTDKGSFEKASELRVQLRRARDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RGK Family G-Domain:GTP Analog Complex Structures and Nucleotide-Binding Properties.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTP-binding protein RAD
total genus 49
structure length 138
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q72A00
4OK6A 2YOFA 4JLJA 5D3MA 1W5SA 1ZINA 4B33A 4A82A 3A1TA 3TW4A 3ZVNA 1SVOA 3JZMA 5DSZA 1ZIOA 4ARZA 4RZ3A 1G5PA 4C7OB 4LYAA 1N0WA 1HQCA 3JZAA 3MSXA 1E2QA 2HCJB 2BKUA 2ZI9A 2O8EA 1QRAA 1W44A 4M4SA 5FBVB 3TKLA 1CR2A 4Z51A 2RGEA 1IXSB 1P9RA 3U44B 1FNMA 4GNKA 2F1IA 3QI2A 1AS0A 2YKGA 3NC1C 4P32A 3LX5A 4LJ4A 1H8HD 2W0SA 2ZRPA 3EC2A 3Q7QA 4TQUS 1KI4A 1QG4A 3SNHA 4DLYA 5FL3A 4LPSA 1OKKA 3IPYA 3RRMA 5DE3A 1KK2A 2AXNA 4IVQA 2JLVA 5GADl 1ZM3A 3MRSA 4HUQA 4E03A 2ZYTX 4GBMA 4TQ9A 3KZ1E 5E7MA 2YINC 1LY1A 3LH5A 1TU3A 4QBFA 5TVKA 1K5DA 1NI3A 2ZJAA 4M1KA 4CYMA 1V5WA 2VL7A 1U8AA 2D2EA 4JYBA 4DLRA 5IT5A 3REGA 3KJEA 3RHFA 1D6JA 1H65A 1NBMA 3ADCA 1X8KA 4DJTA 2WICA 2C5LA 2Q9BA 3CX6A 3NC0C 3ZQJA 1E9AA 3CUEF 5C46F 4I81A 3H4MA 3MD0A 5F3WB 1Z6AA 2XZPA 1OFTA 4URUR 3W8RA 2O8BB 2JA1A 1NLZA 4TL6A 5AJXA 3TAUA 5AK0A 1NVVQ 3WMGA 1E9DA 3GLHE 1XX6A 4HB2A 4OJKA 3VHLB 1CBUA 3PEYA 1FX0B 1BMFA 2E9SA 1XZQA 3D3QA 2ZVPX 4HB3A 4WXPA 1DE0A 1U98A 4X8LA 1JEEA 4I1UA 3RSOA 3TVTA 5B64A 1RRPA 1XJ0A 3VFDA 4LV8B 4B71A 1JAIA 3SYNA 4H1VA 3KQHA 3V9PA 4TMXA 1LF5A 4TTQA 1VECA 1RPZA 4JKYA 2QG6A 1AQUA 4AYTA 1YVDA 2C03A 2NZJA 1DELA 3QKSB 1FTNA 4MGIR 4LHZA 2X2EA 2ZI5A 2ATXA 2F1RA 4YXWA 2JIZA 4IDPA 2WWIA 2DCUA 4FWTA 2GBLC 2J1LA 4ACAA 3U6KA 2R6GA 1SXJC 2JIZD 5AWFC 2WJGA 1M7GA 1IXZA 2VQSA 5E3HA 1MABB 4PPQA 2QAGC 1H8HA 4ESHA 3ZS8A 3SI7A 5B58C 1Z83A 1OH8A 4PR0A 1W1WA 3UWOA 3QE0A 1S96A 4LJYA 3HWSA 3VAAA 1ZCBA 2ZUCA 3RNLA 4DLWA 5CB8A 3AVYA 2OFOA 2FH5B 3LLUA 3SBEA 4BECA 4F92B 3IO3A 4CEIA 2FGKA 4HLUC 4AYXA 4KFTA 2L0XA 4QJ3A 2JLSA 1UJ2A 4J0QA 1R0ZA 1WQ1R 1ZAKA 1G8YA 2GDJA 2IYSA 3BFKA 4LBVA 5LBIA 5HPYB 3FE2A 4OQMA 3B13B 4P4SB 1HYQA 3NBYC 4YC7A 3THXB 2W2VA 2V54A 4QHTA 5CLLA 121PA 3ND8A 3SOPA 4R7ZA 4GP7A 1HH4A 1N0UA 1G8HA 2VO1A 4I1SA 4XSHA 3UMSA 4C0SA 2LWIA 1E9SA 3ZYCA 2YWGA 2GZDA 1OXVA 4ZI2A 1RIFA 1J70A 1EFCA 5F98A 4BFTA 2QP3A 3QKSA 1IN6A 3UXMA 5JJLA 5FPSA 3CLVA 2ZSBA 2HLDD 2UVQA 4FW9A 4XWAA 1ZW6A 4Q9KA 4DIDA 3W8NA 4PAMA 5FL7D 1KI1A 3B9QA 4PO1A 1SQ5A 3RWMB 1LV7A 1CJMA 3A1UA 3B82A 1EWQA 1Q44A 2E87A 1OSNA 1W0JD 2ORWA 4L15A 5LB2A 2QP4A 1Q12A 4IDQA 1OHHD 3MUFA 3ZZ0A 2YVUA 2ZYVX 4P33A 4LBYA 1SXJA 4URYR 3BORA 4MYTA 3DKPA 2ZJZA 1JR3E 2CL7X 4PPFA 3WMFA 2VSXA 3D6TB 4MYUA 3ADKA 4RZUA 2R2AA 3AKYA 1TNDA 4JIMA 4S2EA 1L2TA 3VKGA 2ZRLA 4RD2A 4BE7B 1EESA 2FSFA 2PLRA 1GILA 1RE0A 4IKEA 1IN8A 4EQ6A 4MDEA 2GCOB 1KO1A 4C0AC 3K8YA 4JLOA 1FOEB 1MRNA 3GEHA 2FJUA 2CCKA 3FMIA 2P0EA 3NTUA 1XF9A 3PG5A 2RGGA 4DLZA 3R9WA 4L9SA 4TWZA 1WBDA 2ZJ2A 3P4XA 2W2XA 1SVKA 4GT1A 1G7SA 5B57C 1E96A 1MV5A 4H1UA 4QM7A 3U7EB 2E1RA 4KITB 2GKSA 1EFUA 1VCMA 4Q21A 4LY6A 2GF0A 3QOFA 2QRZA 5L8VA 3T12A 1ZU5A 3DHWC 2J87A 5KDOA 5IK2D 4TTPA 3T1OA 2ZS8A 4Q1BA 2Z4RA 1AZSC 1EWRA 4CIDA 5FTJA 1BOFA 4RD3A 1XPRA 3IDQA 2C98A 3KTAB 3OIVA 4KODA 4B3GA 4BFYA 3I3SR 3A58B 3MFYA 4NHOA 2PMDA 4KYIB 5L3SB 1JB1A 5CB6A 3AUXA 3T1TA 4ARZB 4Q7LA 1TPZA 4DUGA 1R7RA 1UEJA 3WP1B 2D7DA 5KSYA 2CLCX 4UNNA 3VX4A 4LBWA 3EPHA 3UANA 3RS3A 3CWQA 4DUGD 1R10A 1SKQA 2ZM5A 1KOFA 1VIAA 2ZS9A 1E2FA 1NVUQ 2QI9C 2CHVA 4DLVA 3QG5A 4EFLA 4QXAA 2GCNA 1KY2A 4MRNA 3LW8A 2ZJBA 3FPAA 1OH7A 5TY0A 1KZGB 2AK2A 1N6PA 3ASZA 3KUCA 1N6KA 4LYHA 1GL9B 1S1CA 1UKYA 4NCIA 2REBA 1AS3A 2PZGA 4G5SA 3F8TA 2PJRA 1U90A 1ESNA 1U94A 1GUAA 4YMVA 4BASA 3AF4A 1S9HA 4I1OA 3VR2A 2JLXA 4Q4JA 3V4RA 4QFMA 3GLIB 3GLFA 5EP2A 3FFAA 3UKDA 3WY9A 4NMMA 5IF9A 4YDSA 5TB5A 3I8SA 3KJHA 4GMXA 4HDOB 3AKCA 4ZCLA 2GRJA 3TGPA 2KSQA 2XX3A 2ODNA 4LYFA 1GKUB 3OIUA 2NIPA 2ZI7A 1YQTA 2FPMA 3VR5A 2ZS7A 1IBRA 4KAXA 3DDCA 1NF3A 4TQAA 4ILEA 3HU3A 2F9LA 1G16A 2J0UB 2AKYA 2R6AA 1FX0A 1XB2A 1XTJA 1YJ5A 4HATA 1T6NA 4JMPA 2F7SA 3LAWA 1PLKA 4MKIA 3DOEA 1Q21A 3X1ZA 2V7QA 2OXCA 5FOWA 3G82C 1KIMA 1SZPA 4NDZA 2GTPA 4Q9HA 4G1UC 3B5JA 3UATA 1JQLB 4FXPA 1NVVR 1OYYA 5FPYA 5KNDA 1YZKA 2PMKA 2PT5A 4F93B 4QL3A 4G5QA 2C04A 2HT6A 4IXMA 1KSHA 1OIXA 4MRRA 5HTKA 3RABA 5JSZB 3ZZUA 2IWRA 2G3YA 2J0SA 5P21A 1T8UA 4DLTA 2GVZC 3VNVA 5FOTA 4M1SA 2BDTA 4F7WA 1KI6B 4KI0A 1XD9A 1E79A 2LKDA 2XSZD 3DVLA 4IOLA 1UKEA 3P27A 5JRZA 2P67A 4OQLA 1BYUA 2N46A 3K0FA 2WJYA 3EWSA 4IOMA 4F4IA 3KQLA 5TARA 5ELXA 5E7JA 3AGPA 3K0CC 4JT4A 2IUUA 3QXHA 1WXQA 1XDBA 2ZAOA 4UQOA 2QQ0A 1YR7A 2QUZA 3MWLA 4NYJQ 3WHLA 3EA0A 5JLJA 2NPFA 2VP6A 1N6LA 4F38A 2OBNA 2GJ8A 1NNEA 1NL3A 2QTVB 1NN5A 1GSIA 2YJTD 2VPPA 4JVLA 2O5VA 3HYRA 4C3ZA 1DBSA 2EVWX 3KX2A 1HY3A 3CR8A 4UXHA 4Q1CA 2FN4A 4OK5A 2GBLA 5J40A 3FHTA 1W4CA 2FE4A 1BIFA 4NP6A 3QKRA 2YC4C 2IWHA 4PC6A 3RS2A 2V1UA 3KL4A 3QEOA 3W6NA 3VU9A 4JLBA 1XD2A 3O47A 4PO9A 2R8RA 1FZQA 4C0BA 4NTZA 4PHHA 3P32A 3W90A 4U5XA 2H5EA 3B60A 5GVSA 5D3QA 4C0KA 1GNQA 2OFXA 1RYHA 3BH6A 3NBZC 4Z1MA 3K9LA 4BFZA 2QA5A 2F3TA 3KJGA 3THWB 3THXA 2ZSAA 2WKRA 4NYJR 2OFWA 3K1JA 2QNRA 4D0LB 4RY2A 4M9SA 1II8B 3AB3A 1CF4A 1ODFA 2ZYWX 1Y63A 2LCFA 2OXRA 2IS2A 3OE7D 2OG2A 1KMHB 2IK8A 3OFNA 2ZXUA 1TF2A 4Q4LA 2JAQA 4DXAA 1GM5A 1E0JA 1PUIA 2CL0X 3VMFA 2F55A 2NG1A 1DO2A 4WBSA 2ONKA 3GMTA 3BBPA 1ELOA 3AVXA 1KK0A 1US8B 1EX6A 2QPTA 3HR7A 3OFND 3BFVA 4HZUA 4MQBA 4Q7KA 4RVCA 4U00A 2C9CA 4D2IA 4DCVA 5JHGB 3CF0A 3R7WA 3GJ7A 2CXXA 3TMKA 1K8RA 1ZUNB 3V4FA 2VHCA 4UNQA 4Q4HB 3QY0A 1KYIA 4URVR 3CH5A 3DM5A 2MSCB 3IIJA 4Y0AA 4PC1A 1IOZA 3D31A 3SHFA 1E6CA 4H9GA 4JLNA 4MRVA 5FOVA 1FFHA 3X1XA 1NY6A 2G9NA 4DCUA 3BJIC 1NG1A 4AIIA 3M4YA 4DSUA 4IVRA 1OE0A 2IEZA 5FR2A 3CNLA 4FMCF 5FR1A 2H8KA 5DN6D 3EZ7A 5HE9A 4ESVA 3THWA 1CR4A 1ZP6A 2P6RA 4JBYA 2R44A 3CKLA 2AWOA 3AVOA 2IBMA 1XTQA 3AH8A 3O8DA 1EX7A 1P75A 2JJ8A 2IYXA 4FMDB 3U4QB 4M1OA 4LJ6A 2ZE5A 1ZNYA 1SGWA 1ZD1A 4QM6A 2FV8A 3LQQA 3RVBA 3KDSE 1QZXA 2O0JA 2B92A 3AVTA 5KPDA 2AR7A 4X8OA 4IFEA 3U3MA 3EWAA 4GDFA 1DVRA 1E9FA 2PEYA 2GESA 2ZE8A 4M1YA 2QY9A 4ASUA 1IY0A 1JR3A 1Z0IA 1XNJA 3SE0A 4BLQA 4HLQB 2CLDX 5SZHB 3EC1A 4HUTA 3NBFA 3UPUA 5FL7A 3U3JA 4MYHA 2WAYA 3UG7A 1JJ7A 4HZIA 4Q01A 2OAP1 1UM8A 4GZMA 3K0AA 1P2TA 3PIRA 3QQ5A 2AD1A 1XTIA 1KZ7B 1M7BA 2YC2C 3I72A 4PXAA 3QJYA 2NGRA 1W7AA 3OAAD 4B74A 4A1FA 1IJFA 4XVQA 3BB4A 3ZD7A 1VYUA 1RZ3A 3LO5A 3EZ6A 5DI9A 2BIFA 1JALA 4KFSA 3X1YA 5LD2B 3PEVA 3AVVA 5KUTA 1OXSC 1SHKA 4F4CA 4B48A 1QHXA 4KV9A 2ZSEA 3T15A 4A8JB 1Z6YA 2FG5A 1R2QA 3U61B 5GVRA 1YR8A 1YR6A 3RC3A 2VP2A 4Z8YA 3THYA 2BKEA 1P7CA 2QP9X 3TAHA 4JKIA 4KHZA 5EP1A 2C9YA 2D4HA 1AK2A 1G7CA 1A7JA 5GJCA 3T1QA 5IRCD 1MABA 1ZM2A 1XZPA 2FZ4A 3GJXC 1T3SA 3B78A 5HE8A 1E0SA 3HJNA 4LC0A 5AJWA 1UPTA 2Q9CA 3FMFA 4US1R 4AWXA 4LHYA 3K0AB 1OF1A 4MGKR 1EFRA 1Z22A 1OB5A 2J0UA 1E2KA 2WVJA 4CEHB 3JVVA 4PC2A 2ZAMA 5H70A 2IS6A 1E3MA 3FKSA 3KQKA 2YV5A 5JWRA 1BH2A 1NBMD 4D6PA 1E0AA 3PEUA 2G77B 3FKQA 3PR1A 1DG3A 1VYTA 4OI2A 4DHEA 2A3RA 3GPLA 2C9OA 2JLUA 1MO5A 4DKXA 4HAXA 5EJEA 1RW4A 4Q19A 5GJBA 2C8VA 2K5UA 4B76A 2GILA 1JBKA 5KPJA 1E0KA 4FMDF 5IDVA 3ZDQA 1SXJD 2DFTA 2SHKA 1OV4A 4AI6A 4NZYA 3D7MA 1NSTA 4EFMA 2JLYA 1Z08A 4OJQA 4HUQB 3FMOB 4LJ8A 1MOZA 3EPJA 5M04A 3EIQA 2JGNA 2I1QA 2HYDA 3BWDD 3PUWA 1TF7A 2XB4A 1FMLA 4N0EA 3IPXA 3CF2A 4GOKA 3QEJA 4V0MA 3SHWA 1AM4D 3L0IB 2QE7D 2IXFA 2VEDA 1QHHB 1FQKA 3KFVA 1Q1ZA 2EFHB 5JS8A 1G8FA 4ZDWA 3TQCA 4DB4A 3U7GA 1IONA 4YQFA 5BQ5A 4DIEA 2VF8A 3SU8A 4AC9A 3RLFA 1NN3A 2IYRA 1TQDA 2QT1A 5F9HA 1VTKA 2ZR9A 3DZDA 1XRJA 3O8RA 4D82A 3L43A 1OXTA 2OM2A 1W36C 1E2PA 2W6JD 2ZVQX 2JJ1A 2YOHA 1P73A 1M1YE 4R71A 1ZC3A 1U2RA 3REFA 1A4RA 2J0QA 2CNWA 1G1MA 1XD2B 3K9GA 2CMKA 3BH7A 3VX3A 1U8YA 2VHUA 1J99A 3WNBA 1LFDB 4UKDA 2Z43A 4DEXA 2HCBA 4QGFA 1R4AA 1OFIA 3AV0B 1QHSA 1YZQA 4EJSA 4RD4A 5EZ6B 1T0HB 1Z29A 4U02A 4V0ME 5J5CA 4Q4AA 2GJ9A 2O8DA 3GLFE 2BMEA 1DPFA 1KDOA 5JFGA 1EFRD 2HLDA 1J7KA 1TTTA 2BEJA 4NYMR 4Q02A 4EUNA 1YKSA 2H92A 2YYZA 2FA9A 1HTWA 1SVLA 4LC1A 1I4TD 4YXWD 2OUKA 4Y0VA 1W4BA 2PCJA 2BEKA 1TU4A 4U7DA 4W5HA 5AUPB 2ZITA 3C4JA 3IILA 1D8TA 1ZYUA 2QAGA 2QGZA 4D25A 2A9KA 2P3SA 5DHFA 1KI6A 4L4UA 2F43B 4IHQA 4YONB 1ZD9A 4KFRA 2AKAB 3GCGA 4A6XA 1EGAA 1R5BA 821PA 4GP6A 4ITRC 1H8ED 1FL9A 1T5LA 4TL7A 2XZOA 4D26A 1AJEA 3T1VA 4B3DA 2P65A 4E5UA 2DY1A 5KHOC 2JDID 5LD2C 1D2MA 3F5FA 1XTRA 4W9MC 4QBGB 2Z4SA 5K8LA 2C77A 1Z06A 2EW1A 3BAFA 4M53A 4B43A 4AYWA 4BLSA 2QORA 4K46A 2IYQA 4QBHA 5KDDA 1CXZA 3VKWA 1ZU4A 2FZLA 4K8OA 4URWR 3H2YA 2ZR7A 2ZUDA 1XEXB 5JECA 2Y8EA 2ZRKA 2EU8A 3TSWA 1ETUA 2FMXA 4LSGA 3FOZA 1QHNA 2F3RA 3Q7PA 4EPTA 4II7A 3LDAA 4HAUA 4ASUD 3F3YA 4R98A 2WPDA 2OZEA 4M1MA 1P62B 3ICEA 2WWHA 2B8TA 3I62A 3KKMA 4BGDA 3ZS9A 3G5UA 4MRSA 2A5YB 2BJVA 1M2OB 2QGNA 1U8ZA 3GFPA 3JVUA 2Z6VA 4LCBA 1A5TA 2PEZA 3W6PA 3OEHD 1TMKA 2IEYA 4DDTA 1Z2CA 1OT3A 1RFLA 4KXFB 2BV3A 5DISB 3QSYA 4WW0A 4B3BA 4ZIRB 1YZUA 3B1WA 4WXRA 5FUYA 1RRGA 4Q03A 4XWOA 4JVNA 1FW6A 4LZZA 5TDHA 3WRXC 5C1BA 2XXAA 2ZU6A 3B1ZA 4B44A 5G3YA 4BFVA 1O3YA 2XJ4A 1I2DA 2RAPA 1ZIPA 4P4TA 4NYIR 1MH1A 4TLCA 2OSBA 3ZIAA 3U44A 1G3QA 5L3RA 5C18A 1XEWX 5E7IA 1EFTA 2QM8A 3EXAA 4XTCS 2PCLA 1WMSA 4AKEA 3CO5A 3HR8A 2VA8A 4NYMQ 5CM8B 4B75A 1FP7A 4IVPA 3CX7A 1KI7A 3WBKA 4CW7A 4ERNA 3VNUA 2BJWA 3CRVA 2IF0A 3EAQA 5BN4A 1Z63A 2AL7A 2EFEB 4NBSA 1II9A 3LW7A 4RKEA 2UZIR 1E9CA 1Z6TA 2WSSD 3VR6A 1ZJ6A 1U0HC 3DPUA 1OKKD 2RGNA 2ANBA 4R9UC 4HB0A 1Z2AA 3LY5A 5HKKA 3DMDA 3X1DA 2XZLA 2ONJA 2OCAA 2OT3B 3B1XA 3FDIA 4Q1EA 1J8MF 3F0TA 1F48A 4AKGA 3ZVLA 2A30A 2QMEA 4MUBA 1Q0UA 2XTNA 2QRNA 2O8BA 4I99A 421PA 2P6NA 4QGAA 2GHIA 4G3XA 2WAXA 4NH0A 1GOTA 2H17A 2IYVA 1D2EA 4HAWA 1NMYA 1ZD8A 1RJ9B 3ASYA 1HT2E 2RGNC 5CJPA 4BQSA 5AUNB 4V03A 4LJ7A 2IHYA 3OE7A 3GLIE 1G3RA 1KAOA 2Q3MA 2WJHA 1QVRA 5CIQA 1QBKC 1P2SA 3QPUA 1ZVQA 2GEDA 1JPNA 3QIAA 1VKJA 3EZFA 2GETA 3QG1A 1G6OA 1YRBA 4LK2A 1B0UA 4HAVA 1WE2A 2H16A 3KJIA 3VR3A 4B32A 3KKQA 1GL7A 1E1RD 4A0GA 1KSJA 2FSGA 3BIFA 2I3BA 5B2ZA 1XBTA 1E2GA 1ZNXA 2J0VA 3LLMA 5DHAA 5TV2A 3U60B 1YZLA 4DBLC 221PA 2LKCA 2W00A 4GPTA 4UJ5A 2IT1A 3CM0A 2EFCB 2QPOA 3HYTA 2R9VA 1JNYA 4OI4A 4TL9A 3SQXA 2GCOA 5EXTA 1KSGA 4TMKA 1NIPA 2WKPA 4QHYA 1KMHA 1MR3F 4O2LA 4POAA 4FIDA 5EQTA 1S8FA 1XMVA 3DOFA 2O8EB 3T5GA 2OCBA 1TQ6A 5DO9A 2CE2X 2J59A 2WJVA 1E2NA 2IX3A 1T9HA 5F9FA 5G40A 2PT7A 2QZ4A 4UNSA 3I1FA 1G19A 3SFZA 5EE1A 3O8BA 1Z0AA 4UJ3A 2WZQA 1T0JB 2H57A 4X8HA 3G0HA 3PUYA 4WOPA 3AKDA 3AF1A 1IN5A 2ATVA 1KI2A 2N42A 4IFBA 2VF7A 3U6BA 2ZE7A 1DAHA 3K09A 3AVWA 3K9HA 3W34A 4JJKA 1P6XA 4B34A 1VHLA 1T91A 4AKHA 1LF0A 2CNWD 4W5JA 4FCVA 4HEJA 4P4SA 4A9AA 3ADBA 2NO0A 1TEVA 2EQBA 2NOAA 2NO7A 5FUXA 1MRSA 5JJKA 4DB2A 3BB1A 2IXEA 2XNDA 4LHVA 2EFDB 1UBGA 2BHRA 5DI3B 1P3JA 5EUMA 1G8PA 1XMSA 4Z8XA 4TLEA 3J81k 2AFHE 3THOA 4XH9B 3KKPA 3MGCA 1GIAA 5CYPA 3RS7A 2ZI6A 1AN0A 1TAGA 4LPKA 4KYUA 5G3ZA 2V7QD 1G7TA 1ZUIA 2ZIAA 3IUYA 4Q00A 2J7PA 3U5ZB 4CEJB 3BD9A 3EIHA 4JBWA 4F91B 1CJVC 4MRPA 3EG5A 3FB4A 1L4YA 4B6EA 2ZETA 4NKRA 4NCHA 2AXPA 2VLIA 1E1QA 2FFHA 2GEVA 4PHGA 1KNQA 3QXJA 2GNOA 4YMTA 2RB4A 1XWIA 4L16A 2G83A 1G21E 2DBYA 4GOJA 4OQNA 2OHFA 2R6CA 2IW3A 2PBRA 1NMXA 5F2EA 1R8QA 3EA5A 4QHSA 5BYKA 1PZNA 1AKYA 3TR0A 1JAHA 1Z5ZA 3MAAC 2D62A 3QKRB 2WHXA 2QAGB 1T8TA 4C7OA 1XCPA 1XMIA 4R2IA 4IW3B 1BKDR 1CTQA 4BRWA 1SKYB 1KDPA 1W2GA 2QMUA 4LDJA 2OLJA 3NKVA 4TSFD 4A2PA 4QOSA 4PZYA 4RZ2A 3SJZA 1GKIA 5DI3A 4AY2A 3FHCB 5FTMA 1UEIA 3BS4A 3MJRA 4X8MA 2KBFA 1GP2A 5FBRB 1R8SA 4C0HA 2G88A 2CCGA 3FYHA 3QKTA 4TMWA 4JVMA 2MMGA 3NH9A 2A5JA 1F6BA 2X77A 5JEEA 2ZRFA 3LBIA 8OHMA 1L4UA 4ACBA 2BWJA 3R9XA 2AWNA 4G5OA 2O52A 1KK1A 4I4LA 4TMZA 5DYIA 4WZ6A 3B8HA 5DIFA 3KB1A 3Q72A 4Q4AB 1KKMA 4FWIB 4XIGS 3SJCA 4DDVA 3Q85A 2G1KA 2JJ2A 2O8CB 1GRRA 2B7BA 2O8FA 5GJWC 5J4KA 3A8TA 2B21A 3N70A 4HZUB 4KBFA 4EPRA 1WA5A 3EW9A 2JLRA 2HF8A 1NY5A 5L3SA 2N1BA 2HYIC 2EWVA 2VH5R 3CF6R 1E4YA 4PX9A 3SN6A 2OESA 4OHZA 4EPYA 4TLBA 2B8WA 2R62A 2O8DB 1DEKA 2FFBA 1KTVA 1X8JA 5JS7A 2BVNA 2GJSA 3T61A 4JLVA 5DLQC 4OL0A 2Q0HA 1JXMA 2CE7A 5HZHA 4GZLA 1S9DA 2ZRCA 4LHXA 3RAPR 2ODWA 1KI3A 1QDEA 1WCV1 2CHGA 3PUVA 2QQEA 2OLKA 4Q7MB 2WSMA 5FPKA 2A5FA 3RC8A 3AF3A 2W2TA 2ZUBA 4ZKEA 1Q3TA 2DWOA 2GXAA 2WMOB 3AUYA 1GFIA 2YHSA 5HCNA 3U4QA 1JEDA 1Q3HA 3VU9B 4EQ6B 2OEPA 3QKUA 3S1AB 5J47A 2IF2A 1DTSA 3C41J 4KU4A 3CZQA 5K8IA 1WB9A 1X86B 3TIFA 1G64A 2NO6A 2P5SA 2QAJA 5L3VA 2KBEA 2PX3A 4CVNA 1W0KA 4IRUB 3QUSA 1G291 2KWIA 4TZ0A 4DSTA 4EPXA 3LNCA 1E32A 2HDNB 4IEIA 3U3RA 4R2HA 1YR9A 3KXKA 5FPTA 5CIWA 1NVXQ 5KNBA 4ABYA 2Q6TA 2AX4A 4G0NA 3WYFA 2YNMA 4GI7A 1GITA 2BBWA 1DAIA 4I1VA 1OPXA 1PV4A 1OW3B 1IY2A 1FMJA 1RJ9A 1VG9B 4QJ4A 3ECCA 1OLOA 4LJAA 4M1TA 4AURA 1SHZA 1E2EA 1QF9A 3K9NA 4PQFA 1KNXA 3MG9A 2F6RA 2ZE6A 2ZJOA 3Q3JB 4EIWA 1Z47A 1VG8A 721PA 1TF5A 2REOA 4Q1AA 2J46A 4FD2A 4CEHA 3BXZA 4AKIA 3B1VA 1X1RA 2JEOA 3THYB 1ZM4A 5FOUA 2RGDA 2ZROA 3OEHA 5JSZA 4URXR 1OXXK 2FDCA 1M74A 3KTAA 3MCAA 4M9QA 3SYKA 4JL6A 3IIMA 4EPVA 1Q20A 3BC1A 4NONA 1Z6GA 3LVRE 3N2EA 2CK3A 3W5IA 2NPIA 4AG6A 2NQ2C 4BZPA 5FBWB 4US0R 4CRWB 2J3EA 4S35A 3I32A 3OZXA 5DGXA 4D4MA 1GNRA 1QHGA 4KVAA 4M8NE 4W5WA 1HT1E 1U0JA 4QGGA 1DAEA 4N3NA 3BB3A 2OILA 4XOIA 4AG5A 2QENA 1FP6A 1QG2A 1R5NA 2BBOA 2ZQ5A 3FGNA 3FHOA 1DAGA 2KB0A 4ON9A 1OB2A 5EE3A 2V1XA 1NRJB 4TT3A 2XXAB 2W83A 4Z54A 3MWYW 2JLWA 1GG2A 4JLAA 1NJGA 5KSZA 3KQUA 1VCIA 4LUCA 1W36B 2C95A 4Q9JA 1GRNA 4GRAA 4DVGA 1GNPA 4QGHA 2XGJA 5SZJA 1LVGA 5EUQB 3PITA 3AVUA 2D7CA 4D0GA 2QMHA 4P3YA 3DKVA 3TUZC 1I4DD 3L2OB 4Q1DA 2VP4A 4JT2A 1Q57A 4N0DA 4DCSA 2WIAA 2A7QA 3A4LA 4PPNA 5K8UA 4YMSA 4PZLA 4WAUA 2FOLA 4ZDKA 4XD7A 1HUQA 1MO6A 1CJUC 1BS1A 2WJIA 2A5GA 4EDHA 4RD6A 2HJVA 1U81A 1F5NA 1KDTA 1OFHA 1SVMA 3CRQA 2CDNA 3BE4A 4MKFA 1DADA 1SXJB 3ETLA 5KSOA 1TUEA 1XCGB 3X1WA 4M9ZA 4Q66C 5FTLA 3P20A 4RCYA 4HYYA 3SS8A 2GF9A 1JI0A 4E07A 4B3FX 4TYQA 2BCGY 4LJ5A 4IDHA 5SZKB 3OF5A 5CM9C 4Q1FA 1WBBA 2IHBA 3AQ4A 1DOAA 4A4DA 1R5OA 5KU1A 2UKDA 1JPJA 3ZH9B 2XITA 4YMWA 3AGQA 4B6FA 4NE2A 1KO7A 2IYYA 4L8GA 1Q1EA 4PC7A 2ERYA 1OHHA 3UG6A 1T4GA 3VR4A 5BW8A 1JQJC 4PQYA 2XTMA 5CJ2A 5TXGA 3U3KA 3ZVMA 2W6JA 4DRZA 5KNCA 4KO8A 3IEUA 3A37A 4KCGA 1NBME 1ZM7A 2MSEB 2Q3FA 4JLPA 4RZXA 4TSFA 1KK3A 1IM2A 1WF3A 1XEFA 1KAGA 2ERXA 3LXRA 4KFUA 1NMZA 1ZCAA 2VP5A 3NVAA 2J7KA 4HAYA 3GEIA 3ZVRA 4BLRA 4XWKA 2MMCA 1LW7A 3RRZA 1LNZA 3RS4A 2FPLA 4E09A 2JLZA 4IXNA 2CVFA 4KSBA 1T3LA 1E98A 1UBCA 2ZRDA 3L8YA 4XJXA 1VDZA 2JDIA 5AR1A 4QG7A 5JCPA 1KO8A 1E2HA 3K70B 4MGZR 2RKOA 4M0LA 1YZGA 3GEEA 2R6DA 4DT1A 3AP1A 2IUTA 2EWWA 5JHHB 3LXXA 4BZXA 3U7FB 2AK3A 1X8LA 1CRPA 1S2MA 1W4RA 4LI0A 1L8QA 4RFSB 1FQJA 2BCJQ 1G7RA 2JCSA 4OQFA 2FEOA 4JL8A 4JSTA 4MKHA 1WDTA 3ICQB 3DZ8A 3IGFA 1G6HA 4PZZA 1XTSA 5FTNA 5A0FA 3KXIA 3Q8XB 3PFIA 1AIPA 5FH9A 4PANA 5D3MB 4PHFA 1KDRA 2WV9A 2WWXA 1II8A 4LRWA 4UXIA 1U0LA 4QJ5A 4O0MA 4DEYA 3CW2A 1N5IA 5JI2E 4QNMA 2Q3HA 2DFLA 4N1AA 4WA7A 4RFSA 1ZM9A 4OHVA 4YMUA 4A2QA 5CITA 1W0JA 3CRW1 3CRRA 4ZV4A 5EXXA 1ZBDA 4MKGA 4TN1A 5C2JB 3P26A 5G41A 2BMJA 3HP1A 1YHNA 5JCZA 2QN6A 2OBLA 2ZI4A 5FUVA 3KFXA 2DHRA 4CEIB 3HU1A 2Q21A 1TEXA 1E9RA 3NIBA 4Q4HA 2VHQA 4V0KA 3NBXX 1XXHB 1U9IA 2QSYA 2X1VA 3QBTA 5BYJA 3C16C 3SYLA 2V3CC 1A2KC 2QTHA 2BMDA 5CYOA 5BN3A 2BBTA 1OYWA 2ASEA 2MSDB 2ODEA 5CLQA 4JLDA 4Q47A 1UKVY 2GJKA 4ZPXA 1XU4A 2QM7A 3K53A 1E2IA 4L9WA 1R0XA 2Z83A 3TLXA 3B1YA 1Z3IX 2RMKA 3IBGA 1M8PA 1F2UA 2QBYA 1F3OA 1P2UA 3LVQE 5BWMA 1F2TA 2D06A 3CONA 2HV8A 2ZRIA 2ZRJA 4LOAA 2WOOA 3TW8B 2YOGA 1G3IA 1SKYE 3OHMA 4OHWA 5HZKA 1N6OA 3A1VA 4OK3A 4HSEA 1KSFX 1TQ2A 3Q5DA 3EX7C 2ZU0C 4YDHB 4DCTA 1A1VA 2FF7A 1TL7C 2RGCA 3K0CA 4XTRA 1A82A 1MKYA 4C0QC 4KJZA 3NH6A 1P9NA 1G20E 4Q18A 2YZ2A 1B23P 1N5KA 1II0A 2GK6A 4MYCA 5FOSA 3OEED 2G6BA 2IYWA 2ZI3A 4WZBE 3SC3A 5HR5A 3M0EA 4ZO4A 3GJ6A 3UK6A 3VTKA 3TNFA 3KUDA 3Q9LA 3WNCA 4C2UA 4KLNA 3UWKA 4AK9A 5DH9A 2C99A 3H0KA 5UKDA 4BFSA 4CT4B 1YZNA 5GJVC 5KOYA 4LV6A 4CGZA 4TYYA 2CCJA 3V00A 2QBYB 1EFHA 2RGAA 1FUUA 1HE1C 2WSSA 5AJVB 2DFNA 3AP2A 1VCNA 4DLXA 1VPLA 5TMPA 5A5GA 1N6HA 1I2MA 3U7HB 1E2MA 4AD8A 4TMTA 3I8XA 1UBFA 1S3SA 2GZAA 2ZRNA 3LV8A 1Z0FA 4TYNA 3FWYA 1WRBA 2WJJA 1ZUHA 4JSYA 4C4PA 4EPWA 3CIOA 2G0TA 3I4LA 2PZFA 1T5IA 1KJZA 3HDTA 1XEWY 621PA 3P1JA 5G53C 3NHAA 1E94E 5KTYA 1W48A 1HURA 4ZKDA 4O25A 4P0TA 3EARA 4LBZA 3I5XA 3VQTA 3E5HA 4B3XA 5FI0B 4EJSB 2JJ2D 3QXXA 3PV0A 3C8UA 3QXCA 4Q9IA 1M7HA 1GTVA 4NU0A 1W36D 3HPQA 1LTQA 2A2ZA 3B6EA 2IS1A 4TTRA 4BPBA 2NZ8A 1MO4A 2GWHA 2JLQA 4L5BA 3QPVA 2OV2A 3TE6A 4BLPA 1G3MA 2NO9A 1XTKA 2QU8A 1SVWA 1UKZA 3W6OA 1E9BA 4KVGA 1GVNB 1P4SA 3GP8A 4M21A 4QC2A 1K5GA 2IYTA 1P9WA 2PL3A 3AVQA 5E95A 1HV8A 2XOKD 2V6JA 3E1SA 3K09C 4MITA 1XPOA 5AUOB 3RRYA 2NO1A 2VTKA 2FPKA 2YWFA 2AHOA 1FUKA 4C2TA 3QVVA 5KYKA 3L0SA 1XXHE 2CK3D 2ECKA 4JZKA 2ZSDA 2DB3A 4HLUA 4Q48A 3QENA 5H8WA 2GCPA 2VSOA 2IS4A 3CPHA 1GZSA 3GJ8A 5EP4A 1E2LA 1J8YF 3PQCA 3KB2A 1RRFA 2F1HA 2ZPTX 2G1JA 4FINA 1DAFA 3M1IA 1G4AE 1KJWA 1US8A 2WWWA 5L3QB 3AP3A 4NL4H 3TSZA 3CPJB 4A15A 5JMTA 2H18A 1X1SA 2RGXA 1XEXA 2ZRHA 4LX0A 3VR1A 1VYVA 4B2IA 4D4KA 1GWNA 4B2LA 4PSKA 1C1YA 1F60A 5AJZA 4DLSA 3AM1A 3ONWA 1S1MA 4C0LA 4HLCA 2GEUA 1K6MA 5IK2A 1DAMA 1LS6A 4PC3A 4K81B 3EPKA 2WBLC 1OIVA 1W0KD 2RH5A 3E70C 4QNRA 1R6BX 1S4QA 3BRWD 3CNOA 4WIAA 1SVSA 3RS5A 3SJAA 3SFVA 1G5TA 2ORVA 1KO5A 5JEDA 1TX4B 3QNUA 1DARA 1IHUA 1D2NA 2CVHA 4MH0R 3TRFA 2C96A 4Q9LA 1TADA 3K70D 4JYCA 3P4YA 2EYQA 2CLSA 5LDDC 1AZTA 1UF9A 1V43A 3OIWA 5FBLB 3SZRA 2UZ3A 1RYFA 2FU5C 3I73A 3K0FB 1CS4C 3NG1A 4ZIRA 1ZNZA 1C9KA 2IA5A 3QF7A 5JZVA 1IN4A 2FX3A 1E99A 2FWRA 2PLFA 4CZ2A 3IHWA 3Q5EA 1XFAA 4D81A 4JLMA 5ANRB 3R8CA 3A1WA 3C14C 3SBDA 3LQRA 3FMPB 1Z6XA 5JJIA 2HT1A 5JRJA 1IQPA 3ZIAD 4PSVA 2EFGA 2V9PA 4PPGA 4RD1A 2B6HA 2D3WA 3CZPA 3MJHA 2X2FA 2P5TB 5JI3E 1N2CE 2I4IA 4V0LA 3L0OA 1QVAA 1P5ZB 3WYAA 3IQWA 1PLLA 2WM9B 1NP6A 2FGJA 2VIIA 3C5CA 2F9MA 2FFAA 2XNSA 2XEXA 4TT3D 2H1LA 5EE5B 3PUZA 1EK0A 1YU9A 4DLUA 1D9ZA 1NN0A 5EP3A 1E9EA 4CT5A 5H1YA 4ZDIA 4JL5A 3C5HA 2BBSA 3GLFB 1E2DA 1F2TB 2O8FB 1COWA 2VP0A 4DT1B 1PUJA 1F2UB 2F1JA 3B7GA 3IO5A 1TUIA 4BFUA 2PX0A 1HQYE 2WOJA 1AS2A 2AN9A 3GJ5A 1VG0B 2A5DA 3BH0A 3GQBA 1GRQA 1Z28A 2O0HA 5C4GB 1KKLA 2W0MA 3BGWA 4XVRA 2XOKA 1CEEA 4HDQB 1XJQA 4ZDJA 3LWNA 1KHTA 4PSAA 2GA8A 3C15C 4PO8A 1XP8A 2ZSFA 3E2IA 1LB1B 4CF7A 4BUJA 3IIKA 2Q9AA 4EKDA 4A36A 4NCNA 1OXUA 2X8AA 3AEZA 2VP9A 4GOXA 3SR0A 1XD8A 3GFOA 1N5JA 4B3CA 3FFBA 5C4MA 2WTUA 3LBHA 1X3SA 1SVIA 1NJFA 2DR3A 2WWFA 1X6VA 1UDXA 3DM9B 4G5GA 1BMFD 2JASA 3AF0A 5K8TA 4M1WA 3KKOA 1OJLA 3EZ9A 4JS0A 3VKHA 1AQYA 2ANCA 1JJVA 1S3GA 4GFDA 4M22A 5B30A 1ZRHA 1GL6A 3R20A 1CIPA 2CJWB 1KGDA 3L82B 3ADDA 2C2HA 2VSFA 3EZ2A 2FEMA 2KE5A 6Q21A 1FNNA 5FI1B 4BZQA 2ZR0A 3NXSA 5DN6A 1W47A 3BOSA 3MWKA 3ZD6A 2PH1A 1CR0A 1I4LD 1NG9A 2V55B 4OHXA 2R6FA 4OBEA 3I5YA 4NYIQ 2RCNA 3WBJA 5J4YA 3RSLA 5J4VA 4NCJA 3WP0A 1Z8FA 2QTFA 5CK5A 3SQWA 1GAJA 3B2EA 3ZZTA 1PJRA 3I92A 5AUQA 2HXSA 2ORIA 5FOXA 1IAQA 1XMJA 5SZIA 3B9PA 1VMAA 4E22A 2ZTSA 1JXOA 4DDUA 4RCZA 1N6IA 4D0NA 3W5JA 3LX8A 1Z0KA 1G41A 4LYJA 3PUXA 4LJ9A 5J4HA 1BYIA 4BEBA 2KI5A 4LWZA 5JWHA 3T06B 2ZRMA 1M34E 4D80A 2OCYC 3AVPA 5CK4A 3IHLA 3TK1A 4DZZA 4BWYA 3MWJA 1QHHA 1KO4A 2ZEJA 1CKEA 4F4JA 4MDFA 3KQNA 1FTSA 1OIWA 2HJGA 2VHJA 3UMFA 2IUSA 2VBCA 3ZLJA 1YE8A 4JJZA 2ZYUX 3SJBA 4V02A 2FSHA 4CDGA 2DWPA 1UBEA 2P2LA 4HB4A 4FI3C 1E69A 1Q1QA 5JWOA 2VHTA 1CRQA 1VCOA 2WWYA 3GJ0A 1Q22A 5H68A 2QT0A 2GXQA 3LD9A 1CU1A 2XAUA 3TUIC 1UADA 3H86A 3SDZA 3T34A 1G17A 1RC8A 4WZAE 3O8CA 4B35A 2B7CA 4OQXA 3U3OA 4A8JC 3HPRA 1XJCA 1N25A 1FPMA 2C78A 2VYFA 1JR6A 1A2BA 4TYPA 3LRPA 1EG7A 2JATA 4G01B 2GAOA 4OKSA 1QHIA 3QBVA 3BERA 1P2VA 2PJZA 2BM1A 1U9IC 4PFSA 3TBKA 1KMQA 3EIEA 5DYGA 4A0FA 2D2FA 4FCTA 1KI9A 1CLUA 3CX8A 2ODBA 2ZJYA 4BFWA 4RD0A 2OE2A 4FN5A 2QEQA 2REXB 1IXRC 3L0PA 3UMRA 1Z0JA 4A6PA 2AFIE 4JLKA 4Q4JB 4A92A 1JR3D 1R0YA 1XXHA 1T3HA 3A4NA 2WKQA 2WIBA 2JJ1D 3NHBA 1YZTA 4ZI3A 4UNPA 2V8OA 4BLTA 2RGBA 1D9XA 3HU2A 1GDDA 2F43A 2J5XA 1NLFA 2O8CA 2ZREA 4TLAA 1DAKA 1WP9A 4PHTA 5EXSA 2W6ID 4CEJA 4GL2A 4MGYR 1G18A 3EPLA 2HUPA 4RKFA 2OAQ1 3ZQ6A 4NCKA 3BK7A 2RHMA 1CP2A 3RDPA 1ZNWA 3QF4A 1P72A 2J9RA 1TQ4A 1N5LA 1G9XA 3CH4B 3NDBB 3KKNA 1P61B 4UNRA 2RHDA 5FTKA 3TH5A 5FPHA 1J90A 4PTLA 5BN5A 1OH5A 1QHYA 3BFXA 3MMPA 3A36A 3R7WB 3CB4A 2QE7A 3I61A 2GVDC 2DPXA 3NEJA 2G0NA 1NKTA 3GD7A 3R9IA 4MUAA 3UIEA 4B2PA 1VIYA 2IC5A 4URZR 1OFUX 1Z0DA 3TJZA 5FBQB 2OCPA 4IEEA 4V0NA 1XCMA 5CDFE 2XTZA 1G3UA 4LV5B 4DSNA 3A4MA 2GK7A 3SEAA 3QPWA 2FFQA 1AGRA 1SXJE 2NTYC 2ZANA 2IYUA 3IBYA 1M6NA 4HDCA 4TMVA 5EE0A 3AKEA 3RS0A 1Y3AA 2Z0MA 3W3ZB 3QXSA 1MT0A 1YRAA 1ZMXA 4XVUA 4UXJA 3TSOA 3K0SA 5KO2A 3NEYA 3AF2A 3GJ3A 1KI8A 4BFXA 3M6AA 2D74A 3KXLA 3QVUA 4IDNA 3IQXA 4NPHA 5L3QA 2WWGA 3DO6A 1E2JA 4QRHA 3FVQA 1NIJA 2QMOA 3N5CA 4Z1MD 3K70C 1NSFA 3GLGA 1AGPA 3D8BA 521PA 5JBQA 2ZJ8A 3OEEA 3H84A 2KJQA 4XD7D 4HI0E 2YWEA 1ZC4A 3ZGXA 1J2JA 1ESMA 4JBXA 5AJYA 3PCRB 3TVDA 4IOKA 1C4OA 1G5RA 2I1VB 1D5CA 5KSPA 2W58A 1E1QD 4OYHA 1Z07A 1UAAA 4EJSC 2YWHA 4JVSB 1VG1A 4Q5IA 4TZ6A 2IYZA 1UFQA 5HCIA 3RYTC 2Z5FA 2VRWA 3LA6A 2GXUA 5DNYB 3FTQA 1PLJA 4BLOA 4TLDA 5EE9A 3WHKA 3GFTA 3WRYC 2HEIA 4LHWA 1G8GA 5BXQC 4DCNA 1RKBA 3IEVA 1MO3A 1E79D 2XSZA 3ND9A 3PENA 2P6UA 3K0EA 4BRUA 3CWZA 3GLGE 3GLHA 4QBIA 4A8JA 4DC9A 1G4UR 1P60A 1N0VC 2CJWA 4KLZA 1N3BA 2J41A 1SULA 2GJAA 1IN7A 4PQRA 4RFVA 2DFKB 2ZRBA 4Q7JB 3C7KA 3OIYA 1DG1G 2PZEA 1JECA 3MLEA 3X2SA 4PAOA 1DS6A 4DSOA 3RANA 1S0UA 1NLYA 3RWOA 1PVOA 1IJEA 4C0JA 1EXMA 1W4AA 4B47A 1UDWA 2H7VA 2V4ZA 3ZJYA 4OI1A 3EASA 4QKQA 4TYWA 5EZ5A 2BOVA 2QROA 2FNAA 2WPDD 2CBZA 4WVFA 2WMNB 2V6IA 4GMDA 5LB4A 4P31A 2CEAA 3CBQA 1CR1A 5HKKD 2FSIA 1CJTC 3W3AA 4ZCMA 1CULC 1XPUA 4OHYA 1COWD 4YLGA 2EYUA 2QSZA 4G5RA 3TQFA 2R65A 4P4UA 2J45A 3NDPA 3QF4B 4V0OA 3DL0A 3TUJC 1KY3A 3H1TA 3TR5A 2XB2A 4O2RA 3CNNA 1HA3A 2IL1A 4M2LA 4PAQA 2A78A 3U2QA 1IY1A 4LGMA 2GZHA 3GLHB 3CRMA 3DMNA 1BO6A 2GXSA 4D4JA 1HEIA 4C30A 4D4LA 1W2HA 4OI0A 3B85A 2BC9A 3CPEA 5A4JA 1KJYA 4A0HA 3T5DA 2OBMA 1E4VA 2GAAA 3NWJA 2TMKA 2X19A 5E4FA 1H8EA 3OESA 3L8ZA 2QPAA 1E1RA 4FMBB 4XSGA 1NVWQ 3A1SA 1VHTA 3LBNA 2NMVA 1NN1A 2J7PD 2ZRAA 4A0RA 1RRCA 1ANKA 1RVDA 5LPNA 3IKJA 3N2IA 4IJMA 1GKYA 4RSGA 3OAAA 3VHXA 4DDWA 2CL6X 4C9BA 1HE8B 4KSCA 2QL6A 2BMFA 1AKEA 1ONBA 3PVSA 3GJ4A 4IOJA 4DWJA 2BM0A 4FMCB 4ZCIA 4BEJA 3PXGA 5J4LA 2IXGA 4GSYA 4B73A 2XJ9A 3GLIA 3FKSD 2XNDD 4HAZA 1AA9A 4HLDA 3RRNA 2IYLD 2ZRGA 3R8FA 1CJKC 4US2R 3W9YA 2O0KA 4MA4A 5IHPA 3DEFA 4M9XA 4EFNA 5KDLA 2AD5A 2HXYA 1NKSA 2ZJ5A 4IDOA 1O87A 1W49A 1N6RA 3WYGA 1Q1BA 1L7VC 2CHQA 2DWQA 3CR7A 4W7SA 4KBGA 2HF9A 2OO7A 4EAQA 1R0WA 3GLGB 3PEWA 3T35A 3PJRA 1W5TA 2DYKA 1U99A 3WMEA 1LS1A 4TL8A 5CDFA 5EXPA 3S1AA 4A2WA 1OH6A 1DO0A 5FUWA 3WXMA 3A6PC 3LFUA 5FFMA 4O3MA 1W46A 1N6NA 3WNDA 4RJLA 4FCWA 2W6IA
chains in the Genus database with same CATH superfamily
4BYGA 5D3MA 4JLJA 1DHRA 5BUZA 4B33A 4CKWA 3AY0A 1P2GA 4HDKA 2JFPA 5DSZA 5DFAA 4WJLA 4ZMSA 4MVJF 3U9LA 3ZKAA 4FB4A 3TEFA 3QOYA 3ZK7A 4HSGA 3H42B 1G5PA 1B41A 1RHMA 4LYAA 3ZXIA 2GPBA 3OP4A 5A2GA 3HCNA 4LNAA 3FPCA 4H7IA 2WP8J 4CQMA 3TKLA 1G0NA 4ZP1A 3KE9A 2A0WA 2YZ7A 5D5PA 5ER6A 1P9RA 4UM7A 5EPUA 4DBLE 3VO8A 2XVAA 1NW4A 3BSFA 2ZUVA 3M6UA 1FRQA 4KMOA 4XJSA 5LDHA 3OCWA 3VKFA 4X1YA 5LR6A 4WQMA 1H8HD 1E1LA 2ZRPA 2B3DA 1KI4A 1QG4A 2C5AA 5IAGA 1XNQB 1N7JA 1D6NA 1YC5A 4CR8A 1ICIA 3RRMA 4ZYWA 3EIWA 3SLGA 5C5IA 4DPLA 4E7OA 4FYMA 4N8SA 1CNEA 1BFKA 2VNSA 2GEFA 2YDXA 3R0VA 4HUQA 4J0FA 4PNEA 1EVEA 3GELA 2J85A 2O06A 4E03A 2I8CA 1JHQA 3E84A 3FRJA 1LY1A 1NI5A 2ZJFA 4QBFA 2PMEA 2ZJAA 4M1KA 3WAGA 2WEKA 1OTXA 2FG6C 4JC5A 1F06A 1T5SA 2D2EA 2G8LA 5AI9A 4JYBA 4DLRA 2P5YA 3RHFA 1D6JA 5JDCC 4ER7A 1VRCA 3KO8A 4ZJYA 2XGMA 3ADCA 1X8KA 4DJTA 1DGQA 2NO4A 3SJ7A 2CXOA 1PJBA 5CDUA 1WOMA 1WZUA 4X41A 5F3WB 1KJJA 1KL7A 2PH3A 2C59A 3C6YA 2B4QA 4X92A 3W8RA 5L7TA 2JA1A 3RC7A 2EFYA 1EBFA 3L8GA 2AW3A 3TAUA 1RQNA 1NATA 1REQA 3WMGA 3HCCA 2RK6A 2V9ZA 3GLHE 1FYDA 2FEWB 5TMEA 1XX6A 4BNKA 3VR3D 1Z36A 2JH3A 4G41A 1BMFA 2E9SA 4X93A 5B2FA 1CY2A 3KVRA 4C21A 4WXPA 2IY9A 2O2EA 1FFDA 2R6R1 2JLCA 3TQIA 5K7SA 4B3SB 5B64A 1RRPA 4DA0A 4B71A 1RWWA 3UK7A 1JAIA 5DT2A 3TD6A 3WTBA 2H4FA 3HN6A 4IWYA 1ECJA 3STWA 3HNOA 4B3IA 5C81A 5EWMA 1YVDA 2DJIA 4FDTA 5SYNA 5K0CA 1TJYA 1M0EA 4RA6A 1J24A 4C3VA 3QKSB 4HO1X 4A3SA 3PVCA 4MGIR 3BXHA 2Y99A 3L6DA 3LC1O 3OMXA 4UEWA 4Z2YA 1MUUA 4AP5A 4AN0A 1CF2O 3BXPA 2OCIA 2JIZA 3KAKA 3PLRA 4XW2A 1OQAA 3S2GA 2FEPA 5GOZA 4ACAA 3C2QA 4H16A 1EFLA 2CKDA 5KTTA 1SXJC 3COSA 4RWZA 4POOA 1M7GA 3R23A 3WHIA 5E3HA 4C20A 1X14A 4XM1A 3K16A 2P9JA 1NQ5A 2C4TA 3ZS8A 1Z83A 4R1UA 2GN8A 1OA0A 1W1WA 3Q2KA 3QE0A 1H6CA 3I9NA 1RP1A 1S96A 4LJYA 4WL0A 2C5HA 2XUIA 3VAAA 1ZCBA 4NMHA 5ALFA 3RNLA 3ELYA 4R69A 2E3JA 2W6QA 4M6WB 4EA6A 1UBTS 1EG2A 2R8BA 5HIIA 1NF8A 1R6TA 4B6JA 1L7QA 5A9SA 1AUXA 3N39C 2VOEA 3ZJTA 4F92B 1K98A 2R2GA 3OLXA 4CEIA 1GFZA 2PSJA 3NT5A 4HLUC 4Y7DA 5EQFA 4AYXA 2L0XA 4QJ3A 2JLSA 3KJZA 3KD2A 3IDFA 5BMVF 1G8YA 2GDJA 2D0PB 2IYSA 4GPIB 1YQ9A 5HPYB 5EIXA 2F1OA 2XRMA 3Q98A 4OQMA 3B13B 2PUWA 1MF7A 4P4SB 2QV7A 2EKDA 4RMHA 3NBYC 4YC7A 4R40A 1EGVB 4KQJA 4GYWA 4Q9AA 1YVUA 2IXBA 3IODA 1EXWA 4R7ZA 4IHJF 1O4VA 1N0UA 2K6GA 2J48A 4WZAA 4XSHA 1LX6A 2C54A 5GONF 3ZYCA 1FVOA 4G0QA 2L42A 2GZDA 1OXVA 1RHJA 2NX2A 1EFCA 3P9IA 3ZHTA 3KAPA 3LBFA 1HEUA 1TZ2A 2BE9A 1CUEA 4YAIA 1M33A 4LK3A 1TCAA 2R1VA 4GUAA 5JJLA 5CCDA 4AQDA 1CZHA 3FZQA 1L3BA 2I6TA 3O4RA 5CNJA 1QIEA 1ZW6A 4Q9KA 1YT5A 4GXRA 4LJKA 5FL7D 2RFLA 1UXHA 1T6XA 1EWQA 2Q0QA 1Z2NX 4ZI7F 5EI5A 2ORWA 3KC2A 1TYAE 1ZOLA 4L15A 3FPFA 4MB0A 5IU6A 5LB2A 1Q12A 4CQMD 3UTCA 1OHHD 1J20A 4Y9DA 5EIEA 5JBNA 1VJTA 4CGYA 2PZJA 1NC1A 4MYTA 3AHJA 2ZJZA 2LCIA 1NW3A 3DFZA 4EARA 4TTTS 3D8TA 1YIOA 1HDGO 4G8JA 3WMFA 2TMYA 2QIOA 2VSXA 3ZLBA 1K9SA 4Y2XA 2ZVJA 2VJQA 1M3SA 5TNXA 1DKRA 2ZCUA 4EY8A 3PRJA 5BVHA 3VKGA 4MAAA 1ECGA 2ZRLA 2WPNA 3KOXA 3LP8A 2ZAIA 2WKSA 4FC7A 4O2BF 2XUQA 5AHWA 3ZBTA 5U9CA 3QM1A 1MFZA 4J1TA 3ROQA 4AZTA 2PKQP 5G1PA 1XAHA 3WWOA 5C37A 4MDEA 1VE7A 4RVUA 4CIVA 3L77A 1DJPA 1OBFO 4G37A 5DTEA 5HIAA 4FM9A 4DLZA 1Z4OA 3IR7A 4C5AA 2WJWA 1Y1QA 1WBDA 1IHPA 1OGIA 5LQSA 1YR3A 2W2XA 4MVJI 1F17A 4QM7A 3GT3A 4HGOA 1OR8A 1QYVA 3RIEA 3KQYA 3S7ZA 3U7EB 3ZLUA 4C6TB 3AX6A 4BMPB 2GF0A 1CRLA 2VS1A 1Q7RA 2NVBA 1ZU5A 2Y0EA 3B2QA 1YAHA 4KQ6A 4BTEA 5IK2D 2APJA 3LUPA 2ZS8A 3AYXB 4BIIA 1AZSC 1KZ4A 3P0EA 3TLBA 1SELA 6CHYA 1Z5GA 5FTJA 5K3CA 4J07A 1XPRA 1U3TA 1FW8A 2C98A 3OIVA 4FPXA 1K7CA 1W1IA 3ST7A 2ERCA 2OO5A 1NYLA 4BN4A 4B3GA 4ZOLF 1E7QA 4NHOA 5IX8A 1A8UA 3JW8A 4JR2A 4A8PA 1EFAA 2P9BA 3QV2A 3AUXA 1WSDA 2D5CA 1CDOA 1TM5E 3KDPA 1YIDA 2GK4A 2GPSA 3QE4A 2ECPA 4ARZB 4Q7LA 6REQA 3ES9A 4ALLA 4UHBA 1T1RA 5ETJA 4F56A 1R7RA 1UEJA 4DY4A 2WB2A 3SOZA 4LBWA 1ZXXA 1VIVA 2F62A 1K8YB 1E3DA 4I4CA 4C3UA 1QV6A 1XMOB 4D4IA 1TVKA 1XVLA 3CWQA 3CIFA 1YDHA 3RVMA 2Q5LA 1L5GB 4RAQA 4HXYA 1QR2A 3CNQS 3TD2A 1QANA 4J0EA 1KY2A 2PGIA 5CW2A 1N0HA 3OQIA 3I28A 2HNKA 3CKYA 2ZJBA 4OA8A 6LDHA 4I9UA 4YJGA 4I1PA 5B5SA 3KUCA 2AK2A 1N6PA 3EBLA 4I4NA 2FWJA 4TXLA 4UMDA 3C4VA 1IG3A 1CZRA 3QOXA 1N6KA 3CVUA 4XARA 4C7JA 4HDNB 3VV3A 2OMKA 3BMNB 3LFHA 4OIMA 4B83A 2PZGA 2PJRA 2B5WA 4GOND 1U90A 4CLRB 3ZWBA 1G21A 4FZJA 9LDBA 3O2SB 3BJEA 1Q77A 3KTDA 2NXJA 4BASA 1A4XA 1S9HA 2F4VB 2HAEA 1DX4A 2JLXA 4P9NA 6NULA 2WE7A 4OHBA 4OHKA 5FF9A 3S4YA 4EZEA 2O3RA 5C8ZA 3GLFA 4D79A 3DTNA 4NIMA 3H9BA 3KJHA 3NTVA 4HDOB 4P35A 4ZCLA 4CUKA 5I4CA 2KSQA 5AOBA 3E3LA 2QQGA 3X0DA 4AB1A 3OIUA 2VJCA 1ODJA 2NIPA 4TV8B 3QLVC 2J9XB 1JTVA 4RK5A 5I3CA 1QRSA 2ZS7A 1IBRA 4OSEA 1P1CA 4W1RA 1NF3A 1LXCA 4TQAA 3DOOA 4F6CA 1JYSA 2X3UA 2NTNA 3IOMA 4F8YA 2AMFA 1YJ5A 2VYCA 1T6NA 2CB0A 3LAWA 4F9EA 2V7QA 3DBVO 4PVCA 5HCUA 3R5HA 4IKOA 2QVZX 1UK9A 1SZPA 4NDZA 1CW2B 1QYWA 4J43A 4FXPA 4U39A 1JHUA 2WHYA 3I2IA 2Q4BA 4EO9A 1JILA 5DASA 1YZKA 4QJBA 2OR3A 4G86A 1ODCA 2QGFA 1MQ9A 3M5DA 4EHLA 1R6AA 1RI3A 4BZZA 1PG0A 4Y6LA 3C8DA 4E6EA 3FRHA 4AO8A 2QLTA 3B36A 5IS2A 3DF7A 3RABA 1O95A 3VNSA 5JSZB 2FPIB 4LXQA 3ZZUA 1SIUA 2J0SA 2J3IA 4NRDA 2YHUA 4DLTA 1N7GA 1Q1AA 2GVZC 5FOTA 1KZ1A 1ABBA 1RM4A 2BDTA 4BVJA 2J6BA 1GUYA 4F7WA 1APBA 3DOUA 3GPCA 3DVLA 3UXEA 3SXJA 4BKOA 5BP7A 2OOSA 5KCMA 3H11B 4OQLA 4E70A 3OOSA 2N46A 3L92A 1AKMA 5KYWA 3LZCA 3KQLA 2QYSA 3GCXA 5TARA 5ELXA 1BN7A 2BFAA 3IOBA 2VPQA 1BE0A 3K1YA 2JGDB 4ZHQF 4M86A 1V35A 1XMXA 1XDBA 2V4MA 3HGMA 1RMQA 3QXHA 2QUZA 1U0FA 2BGMA 4UQOA 4KOAA 4BJ3A 3TSCA 2OY0A 4L75A 3AJ8A 3GA0A 5C51B 2MR6A 1L0BA 2VP6A 4F38A 1A9TA 3CRZA 1NNEA 1ND6A 4AJ1A 1GSIA 4CCAA 1UJ5A 1XDDA 2OC9A 1V7ZA 2P2ZA 2YJTD 2IP2A 3P2EA 3HYRA 3V1KA 4C3ZA 1U8TA 1DBSA 1C8VB 2EVWX 4KIWA 1HY3A 1ZH8A 3CU5A 1NWCA 3FB1A 3MRXA 5JYCA 1ULAA 3CUWA 2XBUA 3IERA 4YJHA 4B3JA 2FN4A 3ER8A 2VLBA 1RPAA 1JLMA 2GBLA 2XRFA 4DCJA 1A98A 4NP6A 4HRYA 2IWHA 4PC6A 3M81A 1EM8B 5GIOE 1H23A 4UCFA 1CG6A 3NJRA 3W6NA 3D8SA 3VU9A 4QU8A 3GA5A 1ZK0A 1YJQA 4IWXA 4JROA 4N82A 4NTZA 3VR2D 2CMGA 3WO1A 2NP6A 3B60A 3VOBA 5J2UB 1PGQA 3O9ZA 3OOEA 4JBNA 2P30A 2C2BA 3OKCA 1Q19A 2IIVA 1JHXA 1JKIA 3B52X 3NEPX 1C14A 3B53X 3LY9A 4M8SA 1WZCA 4XD2A 4BBZA 5KQMA 2QA5A 2F3TA 2BGTA 4UUAA 3LT4A 3IJEB 2ZSAA 4KYVA 4NYJR 4W99A 5JQGA 2MSNA 1EUZA 1XT6A 1II8B 1ULTA 2XPCA 3A4VA 4LRUA 5LKAA 2PZMA 1P1JA 2ZYWX 3AG6A 3NWEA 3T7KA 1QB7A 1EH5A 1RU3A 2OXRA 1RI4A 3IQIX 3KT6A 1QE3A 3WL6A 3OE7D 1ZRSA 3BMCB 1KMHB 2C2XA 3PE4A 1K1EA 1U3UA 4EX6A 2ZXUA 5BMOA 1GM5A 1K7YA 2HU2A 1PUIA 4MQEB 4UVHA 3IDAA 3UHAA 2W2KA 3BBPA 3PD7A 1EX6A 2QPTA 2C4HA 2BI7A 1DEXA 1NXSA 2ZYHA 3ISJA 4U00A 5JHGB 1EP9A 1N33B 3R7WA 3GJ7A 1PTJA 3AINA 4CKYA 2B69A 3KKKA 3TMKA 4G9EA 3DD1A 4QXPA 3V4FA 2C7QA 1JFFB 3UB2A 5JJ5A 5KHLB 2R60A 2MSCB 4Y0AA 3PUIA 3ADPA 3D31A 1NR5A 4WCFB 4H9GA 1TIKA 4YI3A 5FOVA 5LP6A 4COKA 3GLRA 3DGFC 3X1XA 1UWVA 1DWOA 4L8VA 2G9NA 4K1XA 1B3BA 4CQMB 1HF3A 4X94A 4CKZA 1SH7A 2REQA 1OE0A 3NORA 3CNLA 2GEBA 4JFAA 4KKVA 3R7DA 1C9YA 4A73A 2P6RA 4CKXA 3S27A 2FFRA 3CKLA 3ECSA 4ZVNA 5A06A 2JH9A 1CERA 3AVOA 3KQOA 3NHUA 1WSAA 1XTQA 3AH8A 1N2SA 3QTLA 2ZUFA 1P75A 2IOYA 2JJ8A 2JI6A 4FMDB 4P54A 3U4QB 4N03A 3UHFA 1WP4A 5TMDA 2ZE5A 1JE1A 1TK2A 2YASA 3AOGA 3K0BA 4OSPA 2AI2A 3FJOA 1HYGA 1TKRA 3AIIA 3A2KA 3AVTA 2O0LA 3CJQA 1GTJ1 3LYLA 1VI5A 1K63A 2W6ZA 2XMQA 3EWAA 3F9CA 1YCDA 3EQ2A 4QU5A 1DVRA 1DXOA 3G9ZA 2PEYA 5MN4A 4CKEB 2ZE8A 3HVUA 3RREA 1IY0A 1OI3A 3K4QA 1O96A 1L4MA 3DHVA 1JF8A 1QRRA 1UC4B 3LXMA 3T7IA 4BLQA 3IAUA 4HLQB 2CLDX 2OSVA 5SZHB 3EC1A 2PXHA 5CVCA 4HUTA 5IZCA 2SNIE 4J7CA 1YDGA 3JRXA 4N5LA 4MYHA 5DNVA 1ISJA 3U3JA 4HZIA 2NSYA 2OAP1 4E2WA 3T9AA 1RYNA 1A04A 1NUSA 2NYVA 1JEQA 3E9CA 1KZ7B 3I72A 1FYXA 4PXAA 2CMFA 2NGRA 5KC9A 1W7AA 1O4WA 3RUIA 4HH3C 2G80A 2BGRA 4JQYA 3LTNC 1NVTA 3IHTA 4E7PA 3HDJA 4B09A 4ZN6A 4L5AA 2A4MA 4EYGA 5IAAA 3ZD7A 5JBIA 3GVIA 2QRPA 1RZ3A 3LO5A 3EZ6A 2RI0A 4DQLA 4W8HA 5ARCA 5B1HA 1RXYA 2CXRA 2NUPB 1TE2A 4ZTUB 5KUTA 1SHKA 1QHXA 1KOJA 4OHCA 4QUGA 4BMVA 5EWLB 4D44A 3MUEA 1SBYA 1Z6YA 2G1PA 3BYZA 2X0EA 4GVLA 4A0QA 3PUJA 4G9GA 1YBHA 3E7FA 2B4AA 1YR6A 4C87A 2BEUA 1SU7A 3RC3A 2ZLBA 6YASA 4OY3A 2QP9X 3TAHA 1N1MA 4AUMA 5EP1A 3WA6A 2VDJA 1JG2A 1QH0A 2C9YA 2D00A 3EDQA 5D01A 5JOQA 3IL2A 3EN0A 4KJXA 1A7JA 1JFVA 1NNLA 1XF1A 4XIFA 4MVYA 5EVCA 2F8MA 3IE2A 5TQ2B 4LC0A 1UPTA 3FMFA 4US1R 1U28C 3V8QA 3K0AB 4J2TA 1KYXA 2VJNA 1CUSA 3A6JA 4RZSA 1YS4A 4YPFA 2O1EA 4E30A 2O5EA 1EFRA 2JFNA 1J06A 4LYGA 1M1NA 5F1OA 5HGJA 4X9XA 2EWMA 4EJ2A 1N2BA 3AEQA 3FKSA 4J2HA 4JI8B 5JWRA 2F3UA 2EGUA 4D6PA 3PEUA 3ZHSA 1A8SA 1LBTA 3U56A 4NJMB 2R25B 2QQ5A 3LY8A 4TTIA 1PQ4A 3GPLA 2C9OA 1GHTA 1XOIA 8GPBA 3LSYA 1KH1A 5GIPE 4EF6A 2NN3C 4S0XA 2AI3A 2PWYA 4WBNA 3O82A 2JLUA 3RT7A 4AMBA 4HAXA 5BSVA 1X87A 4OUDB 1RW4A 3GQVA 4Q19A 2C8VA 8MHTA 2Q4EA 4BUZA 3EA4A 1GNSA 5KPJA 2ODQA 1E0KA 5IDVA 4KIFA 4R1SA 4TUYA 1EP1B 3E8SA 1B93A 3QLUC 5D2CA 4AP6A 1OOEA 1EAMA 3A6FA 5BQFA 1D1QA 4LKRA 2YBDA 2YWXA 3EZYA 1YRHA 2FW7A 1H94A 3W1WA 3ACDA 1DBPA 1M2HA 1QPBA 2E18A 4HUQB 3FMOB 3F5DA 4LJ8A 5F1PA 4ENWA 2JL1A 2QJRA 3E1KA 2UZ1B 3OPNA 4S1OA 4U2FA 1OXMA 4EVQA 4LY3A 1Z74A 5J9FA 1EJ2A 1SQSA 2ACWA 1A7KA 4EFKA 1T0IA 2GAJA 4ZEWA 1TF7A 1NUHA 1UZAA 5BV2P 5A9SB 4MS1B 3PLAE 1YF3A 1PSDA 2PLNA 3GR6A 2HPHA 1S2OA 3VR4H 4TPKA 4GOKA 2BFFB 3AFIA 4O4HA 3SHWA 5ULLA 3WTCA 4YMGA 5C8VA 1AM4D 5BQOA 5JAUA 1ZG3A 2CFCA 4HGZA 4WY5A 3UC5A 1FYFA 4G9BA 2FPXA 1IBMB 4EA7A 4D5GA 3PWKA 4YCCA 4OHUA 4GPZA 3TQCA 3CGGA 3KXPA 4IMJB 1T4BA 1Q3KA 1QZZA 2VF8A 5EJAA 3IH5A 1SKAA 2QLFA 3VZCA 4AC9A 2NQTA 3OZWA 2QT1A 3IAHA 5F9HA 3O8RA 1HL3A 1XRJA 1RM0A 3L43A 2OM2A 1E2PA 4DXHA 1BDHA 5KNCD 4M0DA 2QHXA 4N18A 4MV1A 5SV2A 1WQ4A 2XGGA 3I8OA 3K5PA 1QCYA 3NU1A 4HQ0A 1M1YE 2WSYB 5IC4A 3EZNA 3H2GA 5FTWA 3EXHC 3CEJA 2JK1A 1NRIA 4IILA 1J9EA 1ORDA 2QD4A 2Y67A 3AUJB 3FYSA 3LIIA 4QJIA 1XD2B 2AZDA 4TS9A 3K9GA 3PKJA 3BH7A 4D9MA 1U8YA 2EL9A 4ZXFA 4PEVA 4EL5A 1TYZA 1BHQ1 2XCTB 3ESDA 2VI5A 3QX7A 2QYHA 2UV8A 4RLHA 3CXUA 1ZJ4A 2YXLA 4UKDA 2Z43A 3JQ9C 4DEXA 1D7OA 4QGFA 3CS3A 2G36A 3IE1A 1N2XA 2Q6IA 3EDMA 4HFRA 5E1BA 3RI3A 5IXJA 2BMEA 1DPFA 1KDOA 5LP6C 5JFGA 3NYIA 1Q0TA 4QTTB 3E9NA 1A7AA 4L5JA 1Z75A 5HK9A 1P2FA 4Q02A 3VSBA 1YKSA 4EB8A 1R3UA 2YYZA 3U39A 1HTWA 1P7VA 3I9OA 3TTUA 1PQPA 4LC1A 5ALIA 4C4AA 3SWWA 4EMBA 1DC4A 4YXWD 1QOZA 3T9CA 3U17A 3A4TA 3OE5A 2IODA 4KUHA 1QYCA 2BEKA 2PCJA 2PU5A 2Z9BA 3L49A 4MV9A 4U7DA 3RAEC 2ZITA 4BNZA 2WF8A 3W7VA 2AZTA 3MWGA 4KPUB 1I0LA 4MPPA 2QAGA 4WLNA 2QGZA 1JU4A 2BFDB 3DL4A 4HJXA 5CH3A 5D6NA 4YALA 1UQTA 4JCOA 5HW0A 1DUVG 1N9GB 4G2NA 1M2FA 4KFRA 4LISA 1TKCA 4BJHB 4ITRC 3NGLA 1FL9A 1WUHS 3DHNA 4L57A 2Z9CA 4N6GA 5REQB 4B3DA 3EDRA 1GSOA 2DY1A 3EVCA 1E4EB 1B73A 4IXWA 3IT1A 1WCWA 2ZIZA 1B6RA 3PLNA 5LD2C 2I2BA 5J5VA 3KP1A 1TZCA 2N3ZA 1E1NA 2FRVA 3PRHA 4Q3KA 4RDIA 2JFOA 2C77A 3BAFA 3MD9A 3PZBA 4M53A 5BSUA 4GYYA 3DOIA 2P27A 4PRKA 3WDSA 4BNIA 4WJKB 4D9IA 3GEMA 2EJCA 4GR4A 3WI7A 3TTYA 4YO7A 5KDDA 2VUIB 2HW8A 3T4UA 1I3LA 3VKWA 1IH8A 4ZJZA 1F0KA 2FZLA 1L7PA 3VTAA 4URWR 1ZSNA 1L5WA 1T13A 2ID7A 2AF3C 2IYAA 3HFRA 4HS9A 5F1KA 1U0BB 1J09A 3UC9A 2EU8A 2GQ0A 2WD9A 1BE6A 1V9CA 2FMXA 2X4GA 3CUYA 3R7AA 5KZMB 1FLAA 1F1JA 2ZQYA 3OPYA 2RC6A 4LSGA 1H9CA 2C2WA 3T3DA 4B4KA 2JFFA 4UZEA 2B7LA 4II7A 4EPTA 2N47A 4HAUA 4XSVA 1OZ0A 3PI7A 5KQGA 2PYIA 5CJJA 1FRZA 4WERA 1WXXA 1M8GA 2OZEA 4LS3A 4NBWA 1MG5A 5LJIA 1PE0A 1LPOA 3ICEA 5EMMA 2WWHA 3UHJA 4ES6A 3KKMA 2Y9PB 4Q15A 4JELA 1ECPA 1JLSA 2AGVA 3LLCA 1CRZA 4MRSA 2A5YB 3I23A 4BLUA 1GQRA 1BGXT 4JUFA 2W6PA 2EX1A 4DMLA 2P4HX 3JVUA 4CG0A 4QEKA 4P4GA 2YW9A 1R9GA 2AB0A 4CF6A 1VLJA 2PQ2A 2RB5A 1D0SA 2YXNA 3GBPA 1FDRA 1PU2A 3AUFA 2Q8NA 2UXDB 3WICA 3D1LA 2HRCA 2LUOA 3N87A 1N2OA 2GD6A 1IZ7A 2X7JA 3B1WA 2YIJA 4KVZA 2W71A 1RRGA 4W8OA 5FUYA 3VJRA 2C9BA 4LZZA 2CV1A 5G3YA 3ER6A 4IUDS 5H4HA 3DTVA 4HAIA 4FGKA 4DY6A 3AR4A 4P4TA 3PNKA 4TLCA 3U44A 3P0JA 1G3QA 5C18A 1FS5A 4L4RA 1VLLA 2IXTA 1L5ZA 3CO5A 3G3EA 3HR8A 3DBHA 1E1MA 5CFLA 4UEQA 4ZJUA 1HE4A 4IDBA 4S24A 4AJLA 2IUEA 3GXBA 1ZEMA 1FP7A 2M9MA 4V1CB 3CX7A 5C1IA 4BXOB 3P71T 3AETA 4CW7A 1K0FA 2ZWIA 3CRVA 3EAQA 2OA0A 4EA8A 5B6PA 2AL7A 1V95A 3DFMA 4KE6A 2CZCA 4PM4A 5ALLA 1R4MB 1KHHA 1PSWA 4RKEA 3QEBZ 1NXTA 4B4UA 4NBLA 1Z6TA 2EC5A 2W2NA 4O2BA 4MMZB 3PF9A 1X7ZB 4L76A 5T7BA 1OKKD 3B48A 4EY7A 2SCUA 3LY5A 3PHJA 3X1DA 2XZLA 4C1BA 4FYXA 4MB6A 2YY6A 5JXGA 4MMXB 2MJLA 1J8MF 1UC9A 4C4SA 3AR5A 2JC3A 4HNGA 2CUKA 2A30A 2BGKA 1Q0UA 4F1KA 4IJVA 2OB2A 2QRNA 3ANNA 4QTXA 5G1OA 3WV4A 4QGAA 3ZJ4A 4IF6A 3JWHA 4G3XA 4KDCA 5B55A 4DW8A 4KREA 1GOTA 4FS8A 2H17A 1D2EA 3T7RA 1VSQA 5BPHA 2VAWA 3RF6A 4ZAWA 4LQLA 1RJ9B 2XOEA 3S8YA 1CC1S 1OLSB 1HT2E 1OXBB 4BQSA 4RY0A 5LQKA 3JARA 4V03A 2IHYA 4EJ0A 2WG0A 1G3RA 2CDBA 2YBEA 4I0WB 3EYWA 1QBKC 2CYBA 2QTCA 1MZVA 2E4AA 1W52X 4I50F 3C3MA 2OD9A 3T3MB 2GEDA 1J4AA 3I04M 1USGA 1YNSA 1G6OA 1YRBA 2O4CA 3KZNA 2FDXA 3N3AC 3O95A 4RACA 5HF5A 3RTAA 1B0UA 4HAVA 3V6LA 4BQNA 2H16A 2H6EA 2IZOA 4MVCA 4W9NA 1AQNA 1KOGA 1IJKA 3NOVA 1GL7A 2QLJA 2YJ5A 2R97A 3HHPA 2A88A 1KSJA 2RHBA 2I3BA 1GDHA 2VJAA 2XQGA 5B2ZA 1XBTA 5IMBA 1ZNXA 3FH0A 5TV2A 5B7QA 3U60B 5FADA 221PA 4UJ5A 3CE6A 2COEA 3BF8A 2AXQA 4TL9A 5AJUA 4F7DA 1W2WB 3L7KA 4OI4A 3SQXA 1VI2A 2OZKA 4NMWA 1HNWB 4DBVO 3TFOA 1KSGA 4L95C 2FP3A 2PO7A 4YRZA 3CF4A 3THRA 1NXOA 1P81A 1N0IA 4BN5A 5KJ6A 3HVRA 4BVHA 1DNPA 3DOFA 2HPZA 3KLBA 3T5GA 1TQ6A 2J59A 1I1NA 1KIAA 1E2NA 2WJVA 1AD2A 1LJUA 1T9HA 3VPFA 1I4OA 5G40A 4C0XA 3QWHA 2Q46A 3SZMA 4L72A 1B6TA 4Z0PA 4K28A 1ZMOA 3ZDFA 1Z0AA 3QFRA 3CT4A 1HRKA 1W8DA 5E4YA 4UFPA 1JLLB 1TGYA 2R1UA 2VATA 1YL6A 4IFBA 1IN5A 2ATVA 2Y1EA 4Y6SA 2WYVA 1GARA 2BEUB 4KGXA 4M8LA 4MQ4A 4BX8A 1J8VA 3V4LA 3U6BA 1VGVA 1AQJA 2ZE7A 1ZESA 4RL6A 3AVWA 2OGTA 2ZFUA 4QOEA 4AKHA 1FP1D 4QEDA 1P45A 5K6TA 4F4DA 2ZP1A 3HMKA 5CPBA 4RTNA 3BPSA 4HEJA 4ILKA 4FD3A 4F9GA 2ZIWB 4BV2A 5FWXB 2NO0A 1QK5A 1TEVA 1AHHA 3FTDA 1LDGA 4AECA 5EJ6A 1MRSA 3OHPA 1VHJA 3BB1A 1XRNA 1G98A 3PK0A 3RK1A 4CE6A 2CDCA 4A7PA 1Y3DE 1P7ZA 2H2WA 2HDHA 5DNEA 2B1GA 1QZTA 4TLMB 5F5XA 1XMSA 3WGJA 3CF4G 1OLXA 1RCUA 4UMVA 1HX7A 5B1SA 3D3JA 1ECBA 2W2KB 3OZ7A 1I3CA 1B2LA 2PKQO 2YFHA 4GQBA 3RTBA 2X5OA 1KFKB 1T8SA 3OZIA 2Z5VA 5TQ0B 5HXAA 3QMMA 1AN0A 1Z4PX 4LPKA 1NULA 3STUA 2C82A 1G7TA 1ZUIA 5L6LB 2FHPA 3U5ZB 4CEJB 1M2JA 2JKYA 1XZIA 2PYZA 4QAQA 3GEGA 4F4UA 3IEVA 4WCFC 4B6EA 2ZETA 1VA5A 2HLHA 3HBNA 4OMDA 2FFHA 1OZAA 1XTVA 3E81A 4J7UA 2G5PA 3QVWA 1E4OA 3RIXA 2D2IA 4L16A 4ZFNA 2DBVO 4RNDB 2VJPA 4GOJA 4YV7A 3FPSA 2PBRA 4IDGA 3IUSA 5JSYA 3EA5A 2OHJA 2WQZA 4OREX 5FFFA 2EZ8A 3OJCA 3ZWWA 2G17A 3PA8A 4G8BA 3FR7A 4UM9B 1JAHA 2VFAA 3MAAC 3WKDA 2WHXA 1XYYA 2GM4A 1T8TA 3BQMB 3BSSA 3TG2A 4C7OA 2IHTA 3U4IA 3ZWCA 3KR0A 4HVTA 1BKDR 3FW1A 1L9XA 2I7VA 1SKYB 1E2BA 1W2GA 2AJBA 1Z4NA 1CQPA 3M2PA 4NJEA 2MOKA 5LZ8A 1ULBA 2CFOA 2G4VA 4Q6BA 1AUVA 1UAGA 3JD4A 4NZPA 4E94A 3DOJA 5A3RA 4DM3A 1LDMA 3ABSB 1AKNA 2FLVA 4QOSA 1K7XB 4PZYA 3KZKA 3BXFA 4RZ2A 5LBTA 2BFFA 1QFYA 5DI3A 3GRCA 5FI3A 4AY2A 3FHCB 1YB2A 3VZDA 4X8MA 4M0KA 1R8SA 2ZBDA 3ZV4A 5D5QA 3D59A 4C0HA 2CCGA 4DN6A 1P0MA 4FOLA 4M7WA 1HDRA 1AV6A 4HWRA 1QM5A 1TZMA 2EW2A 2A94A 4FIZA 2V7TA 3RBAA 1KWGA 3JWPA 1JEQB 1W85B 4D3YA 3G2QA 4Z9BA 3LBIA 5JEEA 3GYBA 3F46A 1L5FA 3HM2A 1T24A 4GBJA 4PLZA 3T94A 1LZLA 2W4IA 3D02A 4G5OA 4DJJA 3R9XA 3MQ2A 1PJ4A 2GX6A 3OCJA 4IWNA 4PSUA 4WZ6A 1X9IA 4Q4AB 1KKMA 3W5AA 4HDMA 4WASA 4K0KB 1KYZA 3DC2A 5CEFA 3V2UA 1WSWA 1V47A 4L9AA 2O8CB 3WL3A 1NHGA 2ROQA 3G9XA 5DBOA 3HR4A 4NV0A 5J4KA 3A8TA 4LFBB 3GC6A 1WUJS 4AIRA 2JLRA 4BJ1A 2N1BA 3N0TA 4MS3A 5KVVA 1TA9A 2NUBA 3UA3A 2JNWA 3SN6A 4P92A 2OESA 1SZJG 2AEFA 4H0FA 3MOGA 1PW7A 3V2HA 1CQIA 3UAVA 4BO3A 1AUQA 3RE1A 1DEKA 3ZU3A 5CVJA 1HLFA 1X8JA 3NKFA 3PT9A 1JG6A 2GJSA 4KGDA 3T61A 1RHRA 2GFIA 5DNAA 3EVFA 2H1OA 2CE7A 2Q1WA 4WHMA 3EHDA 2PGJA 2ZJ3A 3BULA 1J7JA 4WNAB 3GRAA 5HQJA 3WWEA 3K15A 2P9CA 4V2UA 1OI2A 5AKIA 4DLAA 4QRIA 3GN2A 1QDEA 3COJA 2UZ1A 2W8BA 1H1TA 2OLKA 2QQEA 2WSMA 3EH2A 4NU6A 1VHDA 2W2TA 1JRLA 1EK1A 1TUBA 1A96A 1WZEA 4U2GA 2QTVA 3HUEA 1GLVA 2YHSA 3NFRA 4B6QA 1TJ3A 2ZJ1A 2CYAA 1T6ZA 4PYOA 1E64A 2ZKLA 1XLTA 1IPFA 2VCHA 1IZ9A 3D81A 2X86A 1KFJB 3S1AB 2IE0A 4YWHA 1DC6A 4RENA 2JFHA 2EIXA 2H06A 3G2KA 5DLDA 5CVEA 1MP0A 1Y8AA 5L3VA 2KBEA 3ZJVA 4H35A 4IRUB 3LHDA 3EF1A 4UC0A 1DIAA 1V6CA 4EPXA 3LNCA 3DMFA 4IIFA 1E32A 2HDNB 2IYOA 1U28A 2UDPA 2YN2A 4R2HA 5TSDA 5CIWA 1NVXQ 3FTEA 4ABYA 2NZVG 5IHXA 3WGOA 4D9EA 1IK6A 4MQ5A 3CLRC 2ZVDA 4WOKA 4CLOB 1FMJA 3LHIA 1RJ9A 1KVRA 2WF7A 4M1TA 4HFNA 1BWRA 3RLIA 1QF9A 2W98A 3O7WA 2VP3A 4RPJA 1V3QE 1PT6A 4TKVA 2C4UA 1IHDA 2C83A 1ITZA 2F6RA 3MG9A 4KP7A 4NU8X 1T29A 1Z47A 3MTBA 4QOIA 3HXLA 4WINA 1UDRA 1TF5A 1A97A 1LLFA 1PZGA 1U3VA 1V1MB 2REOA 4GKBA 4C4TA 1FFXA 1HDYA 4NOKA 3IBFA 4CEHA 4OXNA 2JEOA 4X5OA 1ZM4A 2RGDA 2V7GA 3OEHA 4QLBA 1S02A 2HWWA 4DAEA 1BHO1 5EL0A 4XR9A 4F6LA 4JDPA 5E7QA 4YRGA 3BC1A 2HYIC 1Z6GA 3LVRE 2CK3A 4JZYA 4KH1A 4C22A 4CF4A 1JQ5A 3CW8X 2J3EA 4DANA 1ZY2A 4Y18A 2NP7A 2IHNA 5DGXA 4M8NE 1DJLA 3SS7X 4NENB 1HT1E 3DMTA 1DAEA 4CBVA 3BB3A 2G9ZA 3M1YA 4L8LA 1K8ZB 3FXAA 3PHLA 3VH3A 4F4HA 3CLUD 1MOPA 2BBOA 2FN3A 2LD4A 3DBHB 3FGNA 4OB7A 2GM5A 3S2SA 2XUPA 4QUEA 1JIUA 2NWQA 4R6XA 4ON9A 2YL2A 4ISBA 4ARIA 3V8PA 1EVQA 3QYJA 2A9VA 3RS9A 5KSWB 2AI1A 3B6KA 1ORIA 5JNTA 2W83A 3E0XA 3MWYW 5K0BA 1B74A 4ZQIA 3OT1B 1F14A 5FWNA 3NTOA 1TJPB 5ALNA 1IIRA 4R8RA 1VCIA 4LUCA 1XC7A 3M3DA 1NJ6A 2C95A 3KZVA 1DWQA 4Q9JA 2JANA 3ENQA 3OM1A 2IV2X 1GNPA 3F49S 1OA1A 4OXKA 3VNBA 4D97A 2VTBA 4KNYA 2IQ5A 1XZGA 1KRHA 3GARA 1ZRMA 3IEIA 3K72B 4NH4A 1BROA 4YROA 5K0LA 3WYNA 2G67A 1TFUA 1PD1A 2P8SA 1F5SA 2WK1A 3QA3E 4DDHA 1R6XA 1QIIA 2Q4DA 3DKVA 1JKJB 4H0NA 1FUIA 4MV6A 4N0DA 2V6MA 3A4LA 1R0RE 2IUFA 1ABEA 5BSMA 1EFPA 3PC8A 2VPWA 1C3VA 1HGXA 3FDXA 1I7SB 1IMOA 1KBOA 1YO6A 5IT4A 1HOXA 2O9JA 4GZ6A 2X5XA 3ESXA 1CUZA 4TV9A 1EIZA 1TAUA 1ST3A 4EDHA 2WDZA 1NM5C 3D2BA 3MS4A 4RD6A 4M8KA 1U81A 1NBHA 4O4LF