3Q73A

Cryptococcus neoformans protein farnesyltransferase, apo enzyme
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
330
structure length
316
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSDPLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase
molecule keywords Farnesyltransferase, alpha subunit
total genus 127
structure length 316
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q73A00
1X81A 3EU5A 2R2LA 4EHMA 1S64A 2F0YA 1FPPA 3C72A 3DSTA 3SFYA 3DSWA 1O1RA 3PZ1A 1MZCA 4GTTA 3E30A 2ZIRA 1FT2A 1N9AA 1TNUA 3DSUA 4GTVA 3DSVA 4GTPA 1QBQA 1TN6A 1TNZA 3PZ2A 3HXFA 1SA4A 1D8DA 1SA5A 4GTRA 2ZISA 1KZOA 1LD7A 3Q75A 1N4SA 1JCSA 3PZ4A 1TNYA 1DCEA 4YDOA 1N4QA 3DSSA 2H6IA 2IEJA 1N95A 3E32A 4GTSA 3DPYA 4GTMA 1O5MA 4GTQA 4GTOA 3SFXA 3EUVA 3HXBA 3Q79A 4YDEA 2BEDA 1S63A 1O1TA 4L9PA 3Q7FA 1FT1A 3DSXA 3HXEA 3HXDA 1N94A 3Q73A 2H6HA 2H6GA 3Q78A 1TNBA 3KSLA 1NL4A 1NI1A 1O1SA 1TN8A 3HXCA 3Q7AA 3PZ3A 4LNBA 1LD8A 1N4RA 4MBGA 1TNOA 4LNGA 3E37A 1N4PA 1JCRA 3KSQA 2H6FA 1LTXA 1D8EA 1KZPA 3DRAA 3E34A 3E33A 1TN7A 1JCQA
chains in the Genus database with same CATH superfamily
3X2QE 1Y8MA 3VTXA 2J07A 2V5QC 1W3BA 2BTDA 2OV8A 4EHMA 2F0YA 3URZA 3TWUA 3CV0A 4JEUA 5HS0A 5HQ8A 4GTTA 1FT2A 3U66A 1PC2A 3LS8A 3LPZA 2WPVA 3ASNE 3LYAA 1ZB1A 4ZFHA 4FJZA 4U7EB 2WQ7A 2R17C 5FTPA 4HOSA 5IY5E 4WNDA 2VGXA 4GCOA 2VYIA 3S7DA 1EDUA 3MJWA 3V2OA 3AS8A 4HXIA 3UXGA 1A5EA 2M63A 3FULA 5CBNA 3B7BA 4HOQA 4CYMD 3FUHA 2R59A 1KPSB 1ELWA 1WY6A 4NURA 1SQMA 3CVPA 3ULYA 3UKRG 4J7WA 2GROB 4B94A 1N4RA 3SHFA 2UY1B 2VSYA 1WDYA 3ZEFA 1LTXA 5G04C 2J09A 3TWQA 4C9BB 3DRAA 3TJPA 1D9SA 4LUNU 2C0LA 2V4LA 1E8ZA 2X6JA 3Q9NC 3T9KA 2YHEA 2KM4A 4MRUA 3AU5A 4APFA 3MX3A 4MLPA 4FULA 3AG1E 3S7JA 2YNQA 5HI7A 5FWQA 2XGOA 5FIOA 1JPLA 4G24A 3ASOE 3IXEA 3DSUA 4B8AA 1QBQA 3JQ1A 4O60A 5FQ8A 4ABNA 1S0PA 5FQ6A 3NZSA 2DWZA 1N4SA 2E2EA 3FUJA 4N3AA 4GA0A 3CGHA 3RO3A 1YA0A 3RRUA 3ZXSA 3J5PA 1TJFA 1Z5SC 5T4YA 2R02A 4DI3A 2V0PA 3TG5A 4U8YD 4KZCA 3D3MA 3G2UA 2FI7A 2FBNA 3QC1A 3QOUA 1O1SA 3AS4A 2KXPC 4OVVA 4HLEA 4UQYA 2IONA 5H7PA 1HH8A 5KJMA 5FZQA 2DCPA 1MX2A 3D9KA 3SBSA 5KBAA 4BFRA 2I9CA 2WXGA 2X6IA 3TGOA 4TUMA 1B89A 5HRYA 4JA9A 1JWGA 3ONKA 4J8EA 4ILGA 3UM1A 2WB2A 2XEVA 5FQ4A 5A23A 1EF1C 3G2WA 4DLQA 2FO1E 4FLHA 3C72A 3ZW3A 3MKQB 5LP0A 4LERA 4GYOA 1HX8A 2KZTA 4BERA 2EILE 3PZ2A 4DUIA 2AXVA 5KNHD 5D66A 3TL5A 2OEWA 4GTRA 4CCAA 3CVVA 4U07A 1E8WA 4F7AA 5D2MC 2PL2A 4UWGA 3NZUA 1N4QA 4HFGA 1H2TC 1SZAA 3I3NA 1DNPA 1HE8A 3DXMG 2J08A 4WNGA 4ACKA 3APCA 2A5UA 4N3BA 4K5CA 2WMNA 1S63A 5C1DA 4RQIA 2NXPA 2BKKB 4GPKA 4F6RD 4N2QA 4FA6A 4B93B 4A63B 3NOGD 4TXRA 3SBTB 4KVOA 2H6HA 1HXIA 3CKBA 4I17A 1E90A 1HO8A 2XHEA 1VDYA 4NACA 1HFAA 3UT4A 1LF8A 3LVRE 4Z68A 3LDZA 4BWRA 3FH7A 4ME2A 5BUZA 4HVBA 2DIWA 1FVHA 1OWMA 3HIZA 3SO8A 4Q94A 1PY1A 3S2AA 2Y4UA 3ABLE 5EIBE 4I6EA 2XZDG 3ESKA 1NZNA 5EX0A 4F3VA 4QQIA 3VLDA 1RZ4A 2ILRA 3FUMA 2GRNB 4BEPA 4DX6D 1N54A 5ENNA 2NYJA 4XX5A 3OXLA 1E96B 3HHMA 1D8DA 3HRAA 4AV7A 1KLXA 3Q15A 1DCQA 3S7FA 1UW4B 3DSSA 3PRZA 3DPYA 1YMPA 3C5RA 5LFAA 2IFUA 2XQ0A 4QFVA 1OWPA 3ZNGA 3FTXA 3SFZA 4TRQA 4HRLA 4E6HA 4XIFA 2LAHA 2R05A 5AARA 1MQSA 4UQXA 2DVWA 2QY7A 2GRMA 2LAIA 2AVPA 1H2UA 5ENQD 3IV0A 3QWPA 5M72A 3MV3B 3ZN3A 4U8VD 1BI7B 4XI9A 4KZ0A 3L54A 1WAO1 3LKUA 1H19A 4GZDA 2X6KA 3NB2A 1HS6A 3GW4A 4K5AB 2VGEA 3E34A 4EBAG 3AG3E 2E0IA 3DBSA 5AAOA 2J49A 2Y4TA 2KCKA 5DIZA 3MV2B 3GYZA 3BEEA 2VJ8A 4BSXA 5AJDA 1FPPA 4JHRA 1KT0A 1MZCA 4RVBA 4RG9A 2J4DA 1XNFA 5JJ6A 3EU9A 3RU0A 3MA5A 1NP7A 2HM8A 3HVEB 4J8DA 3TWVA 3QDNA 2RG8A 4MKTA 4JVSA 4UQZA 3L13A 2L0IA 1TYQG 3OAWA 4HOUA 1TNYA 3L6AA 3Q9UC 3B7TA 2JLBA 4GTMA 2GGFA 2EIJE 3CQGB 1H6PA 4E85A 1TR4A 4TXPA 5G04J 2DBAA 3TXMA 4I9EA 4CEMA 5D0OD 4EZLA 5BPPA 1BPOA 1ZBPA 4OAVB 4I1AA 3UT8A 1TN8A 1HF8A 2YINA 3ZHEA 4GB9A 1IYGA 1OCOE 1N4PA 4M3OA 2CHWA 3B7UX 3SD5A 2AXUA 3W9GA 2XS1A 5CECB 3CSFA 3ABME 4DX5D 3AG2E 2IQCA 4FHKA 1MYOA 2LXLA 4GYWA 2IJGX 4G25A 3PEUB 2X38A 1OT8A 5KJNA 4KMOA 1WM5A 2IO3C 3CHMA 4GMLA 3ASGA 4RSYA 4HI9A 2L0TB 3G2TA 1K1AA 1N9AA 4O1OA 2P9LG 3R9AB 3ZPJA 3LY8A 4CT0A 4XZ4A 2EINE 2ZGGA 4EQFA 4I6GA 4PS3A 4I43A 3TXNA 1NA0A 4RG6A 3PS6A 2OEVA 3MGBA 1YCSB 1QZ2A 4YDOA 2V4HC 5LOZA 3VLFA 4IN3B 4UUCA 3ZYMA 3UM2A 1E8XA 3MKRA 3PDNA 3IHYA 4WWOA 5AQAA 1Z6TA 3ONLA 1OWLA 3DPDA 2I2OA 3Q7FA 3FUEA 1L5JA 5AJLA 5G2NA 3LY9A 3FUNA 3KS2A 1OCZE 3HXCA 4F53A 4EZJA 2MRIA 4J0UA 3E37A 3PREA 1IQUA 1BI8B 2WXPA 1D8EA 3R7QA 3CKCA 4OAUC 2CFUA 2ETAA 4WNFA 3FH5A 5FT9A 1U3DA 5AENA 3MZLB 2PNNA 3PUJA 1KT1A 1UG3A 1OXJA 5BXOA 4I2WA 5LCWC 3OXGA 4W9RA 2MOWA 2XRYA 1OUVA 4BT8A 2WVIA 3BG1B 1K8KG 4UWFA 4BSZB 4F1PA 2ZU6B 4BY6A 3PZ1A 3V31A 3E30A 5G05J 2FF4A 4HORA 2Y3AA 3I4GA 2AXZA 3BUAA 3CVYA 5EYPF 2CFZA 1H6KA 5BNWA 4GZ5A 4JXTA 4L2LA 1RW2A 4G1TA 2LUHA 3MYVA 5FINA 2XPZA 2LSVA 2BF0X 2BEDA 1O1TA 1S70B 3GZSA 4F1SA 3UPVA 2JEKA 1PAQA 3L9TA 2XEEA 3FDHA 1JUQA 4A1SA 4P29A 2PQRA 3P2BA 2UWJG 1E7UA 2PM6A 4Y6WA 4C0EA 4LEUA 5KNGA 2CHXA 4AEZC 4YNDA 1Z3YA 3QB2A 4LNGA 3U9WA 4UI9K 4IYPA 4PH4B 2WM9A 1H0AA 2WXRA 4D10C 3V2XA 3CHRA 3ENEA 2A5EA 2XGSA 3JXIA 4Q96A 4RLYA 3LEWA 3B7SA 3V79K 2L6JA 3QK0A 2P9UG 4WUYA 4I1OB 5AN8A 3BG0B 3JUIA 2DZOA 5EILA 3UTMA 4B8CB 4GPMA 4G8KA 1SA5A 2ZISA 3AS5A 4EBAA 4A3TA 2P9IG 2B0OE 2LNIA 4GZ3A 3UX4A 2HR2A 1TEZA 2H6IA 4B0ZA 3G2SA 3RJVA 1OY3D 3MKQA 4WWPA 2NC9A 2F37A 3D9OA 5AYWD 3C3QA 4AP2A 4K03A 3UT7A 2MHKA 1N94A 3PEVB 5FQ7A 4FADA 3Q78A 5J08A 3ZIMA 4ANWA 2A4ZA 1ZU2A 3Q47B 4DRXE 5BV1A 3NBNB 2XENA 1SVXA 2OOEA 5CRUA 2DZNA 3GZ1A 4G11A 3FU3A 5AIJA 1MJ0A 2R03A 4HI8A 2L6BA 3HG0D 2RFAA 5JA4D 1X5BA 2I1JA 4G8LA 3ULQA 3BU8A 4JHKA 4FC8A 5HKPA 4FLBA 3CHPA 1IKND 3SGHA 5BXUA 4JB8P 2R2LA 3FFLA 4JA7A 5ANRA 4HQDA 4BX8A 3EHQA 1TNUA 2FEZA 2I6HA 1MX6A 2HYZA 5KWDA 4U0ZA 3ZYKA 4J6IA 2FULA 3ZRHA 1QNFA 1IXVA 4EECA 2Y1LE 4GA2A 4JW1A 3SI5A 5B1BE 3CVQA 3UI2A 3MCXA 4GMRA 1N0RA 2P2CP 2VSNA 3CR3A 2CG3A 1H6OA 2X6FA 4LRZA 4IULA 3LJNA 5EDSA 3C3RA 3FUFA 3ISMC 3EIJA 3Q5MA 3TWXA 4GMJA 2MYOA 2OVBA 3TWTA 4U63A 2UY1A 3ZU7B 3J5QB 3OTNA 4I1MA 3QJZA 1JCQA 3FTWA 4ANUA 1S64A 4XKBA 4ATGA 2RFMA 4NRHB 1O1RA 3S7BA 2IO2C 5CMWA 4UI9C 3ZUVB 3TG4A 4BETA 3VTYA 1MHQA 3FU6A 3LXUX 1E7VA 5ANLA 4HLLA 2XGMA 3UM3A 2WXOA 1QYMA 2KZTB 3D9NA 1DC2A 3JUEA 4AXHA 5EIDA 3PZDA 3EUVA 4N39A 1YYHA 2V5FA 4YDEA 3SQVA 3ZFWA 1FT1A 1QQEA 3HXEA 2WQHA 4BTAA 3D9HA 4DX7D 1Z3XA 3ZVVA 3L08A 5AQ7A 3Q7AA 2XS8A 4MBGA 4JPSA 2RD0A 4NQ0A 4YDWA 3QAQA 4FP7A 3K9IA 5AQ9A 4CT4A 3DEPA 3FEXA 3QKYA 5G05C 2GRLA 4V3IA 3L16A 1BD8A 5KCMA 1HU3A 1UN8A 3CEQA 5ENTD 2NSZA 1V54E 4C48B 2ETBA 2VGYA 1HZ4A 5EKQD 3FWVA 5CMYA 3ZGQA 3DSWA 3UUXA 3JQ0A 4X8QA 2ZIRA 4KT6B 4A3VA 1UOHA 2Y69E 2C2LA 2XEHA 4GTVA 4GTPA 1TN6A 3HXFA 5LCWJ 2XPYA 4UWHA 2WXIA 3DWLG 3B7RL 2VTBA 4PDXA 3RIBA 1JCSA 4O1PA 1DCEA 3UMVA 3AU4A 4U0SA 2IEJA 4U95D 1OCCE 5BV0A 4GTSA 3IHVA 3T8KA 1K3ZD 1Q2ZA 1O5MA 2IU1A 4TUUA 2WQ6A 3L22A 4FU3A 4BT9A 3ASHA 4L9PA 5DBKA 5EYLA 3F6QA 1OWNA 1UJJA 4JL0A 2L9BA 2XCBA 4Y6CA 4PS7A 1FCHA 3PNLB 3L17A 3O48A 5CEDB 4L1BA 1TNBA 4R7LA 3V30A 3SY2A 5CERB 3GZ2A 3EIQC 1K1BA 3VLEA 3N71A 4AJWA 4AY6A 3T8MA 2HE0A 1U3CA 2H6FA 3UQ3A 3CK8A 4JZYA 4GU5A 4N3CA 4CGVA 4WNEA 5JJTA 3CHQA 4TXQA 4H7YA 3P1UA 1FVFA 2KC7A 1HG5A 3FHEA 2ZGDA 2HO1A 4BX9A 3IBEA 4AOFA 2PM7A 4AVXA 3CVXA 4AY5A 2GRRB 3RSEG 4MS6A 4GZCA 3WG7E 4TV3A 4DLOA 2IF4A 3JYSA 2J4BA 3U64A 1SA4A 2VGXB 3KD7A 3LVQE 3OXFA 3NQPA 4XI0A 4G26A 2PZIA 3SF4A 1Y6IA 2WXKA 4HNAD 3Q75A 5EX3A 3UIOC 3PZ4A 4U04A 3RAUA 2WXNA 5J90A 1E8YA 4L23A 3DXKG 3LCAA 3W9FA 4YDYA 1IQRA 1OWOA 4XEIG 2KCVA 4CGWA 3CVNA 3EHNA 3QWVA 1HG2A 2KCLA 2ONDA 5FZSA 1AWCB 3LJ3A 3R9MA 2LSUA 3AAAC 3PZ3A 4M7CA 5CRVA 3UINC 4J8SA 4PS8A 5CCMA 2DYRE 3U4TA 2AWIA 3MEKA 2AJAA 2YQ8A 1EPUA 4LG6A 2Y0BG 4KXKB 2PQNA 4KVMA 2WMOA 1BLXB 5LX8A 5KJKA 5ENPD 5C2YA 5EN5D 1WG0A 3PNTB 4Q69A 2CHZA 3FU5A 4B89A 3SFYA 4FJYA 3KAEA 4EPZA 3I4RB 4HS2A 3CHOA 5CHEE 4N5QA 4LNUD 1TNZA 2F8XK 1ELRA 3EHMA 3CVWA 4WWNA 2AW6A 2VSOE 4FHJA 1H2VC 2CG2A 4A55A 1UN9A 3ML8A 2ZXWE 2OCCE 3CLJA 3NF1A 2GRQB 5KJLA 2QFCA 4N2SA 4C0MA 4GTQA 4HB5A 3RKVA 3PVLA 3FUKA 3RO2A 5CBOA 2YHCA 3BQOA 2VSXE 2ETCA 3KSLA 1NL4A 3ESLA 3PE4A 2WXQA 2QC9A 4LNBA 1NA3A 3CVUA 1G3NB 2EQXA 3D9PA 3I5PA 3KEAA 4AM9A 5CCLA 2OVFA 5JJ7A 3G2VA 4DX2A 5E75A 4AIFA 4ATZD 5ARGA 4CDMA 3QARA 4K5BA 3U3WA 2EIKE 3RRMB 4CDRA 3B13A 2XPIA 4OYSA 3AJIA 4YVQC 3E33A 3L82A 4UI9J 2KATA 4CRWA 2Q7FA 2IOLA 2XCCA 3R7RA 3ASDA 4DX1A 4GA1A 1GW6A 2QYUA 3EDTB 3RK6A 3ZYQA 5ENSD 3DSTA 4N5CA 5B1AE 4CDNA 4YVOA 4HRNA 3FTZA 2QZAA 2C0MA 4NIKA 2WXMA 4UWKA 2V8SE 1KZOA 3ULEG 3FUDA 3NAWA 3CIAA 3SZ7A 5ENRD 3SNXA 1N0QA 1P5QA 4JEHA 4GTOA 4ANVA 3HXBA 1BU9A 4HOTA 3NOCD 4JHJA 3UKUG 2WXJA 4H7XA 4I2ZA 3T5XA 4I6JA 3CK7A 3IEGA 3E4BA 3Q73A 2H6GA 1NI1A 3FH8A 1NFIE 3Q49B 2XZTG 4L2YA 5T3RA 3APDA 1JCRA 3FY4A 3KSQA 5B3SE 3TWRA 4U96D 5E76A 3FTSA 5ENOD 2F8YA 3APFA 4ANXA 4LSZE 3C98A 4DK5A 3AG4E 2JABA 1X81A 4A1GA 2RKKA 3ZYLA 3EU5A 4ACLA 2IOSA 2WXHA 3FEYA 3FU0A 2XRZA 2WXFA 1INZA 2P9KG 3QNKA 3ZHEB 3TWSA 3D9JA 4U8HA 4G2VA 1U2VG 2P9NG 1SW6A 4DJAA 1UJKA 4OVUA 4BESA 3LY7A 3CK9A 1LD7A 1MX4A 3TWWA 1IHBA 4XE0A 4GCNA 4ILHB 5JHAA 5AQBA 3JXJA 1N95A 3E32A 2QYJA 4JC8A 3PH0C 3FTVA 2B6CA 2J8SD 1V55E 2I1KA 1OCRE 2BUGA 5FJYA 4EZKA 3ASFA 1ELKA 3FTYA 3HVEA 4HBDA 2GW1A 1DVPA 4GAAA 3ZXPA 3PE3A 1TNOA 4JD2G 3RRNB 3FP3A 5D0QD 3QWWA 5BW8C 5ITZF 4KBQA 5BT1A 4PUCA 3O4ZA 4UWLA 1TN7A 4DI4A 3D9LA 4O6FA 2EIME 5CEAA 5T8IA 2IY0C 5A6CA 4GZ6A 3WXXA 1TJCA 4K0RA 3PUKA 5A7DB 2FO7A 2J9QA 1IHGA 5G55A 2KBXA 3FTUA 4BTBA 2GRPB 4DPRA 1AP7A 3DSVA 3B95A 2BKGA 2P9SG 4U0UA 3Q4AB 4L7TA 4XKCA 4KYOB 4WAFA 2VTBB 4GYYA 4J8FA 1EYHA 4LCTA 3ABKE 3HDXA 3C3OA 3DEOA 3EHRA 2VQ2A 2P9PG 3CQCB 4ZHBA 1SZ9A 3UIPC 3UM0A 3SFXA 3EJNA 1XGWA 3Q79A 4I9CA 4G23A 1JWFA 5JHBA 3ML9A 3DSXA 5FZRA 3HXDA 2DYSE 3KEZA 3CSTA 1N11A 1N52A 2P58C 4CZ2D 2X3MA 4APOA 4HRMB 1LD8A 3IKOB 3CHSA 5ARFA 3ZKJA 1A17A 3JCKC 3D9MA 3D9IA 1KZPA 3HYMB 3TAXA 5JMND 3CVLA 2WXLA 3T5VA 4J8YA 2X6HA 2LO6A 4URKA 2R5SA 4IRUA 2LXMA 3FUIA 4ILIA
chains in the Genus database with same CATH topology
1X81A 3EU5A 2R2LA 4EHMA 1S64A 2F0YA 1FPPA 3C72A 3DSTA 3SFYA 3DSWA 1O1RA 3PZ1A 1MZCA 4GTTA 3E30A 2ZIRA 1FT2A 1N9AA 1TNUA 3DSUA 4GTVA 3DSVA 4GTPA 1QBQA 1TN6A 1TNZA 3PZ2A 3HXFA 1SA4A 1D8DA 1SA5A 4GTRA 2ZISA 1KZOA 1LD7A 3Q75A 1N4SA 1JCSA 3PZ4A 1TNYA 1DCEA 4YDOA 1N4QA 3DSSA 2H6IA 2IEJA 1N95A 3E32A 4GTSA 3DPYA 4GTMA 1O5MA 4GTQA 4GTOA 3SFXA 3EUVA 3HXBA 3Q79A 4YDEA 2BEDA 1S63A 1O1TA 4L9PA 3Q7FA 1FT1A 3DSXA 3HXEA 3HXDA 1N94A 3Q73A 2H6HA 2H6GA 3Q78A 1TNBA 3KSLA 1NL4A 1NI1A 1O1SA 1TN8A 3HXCA 3Q7AA 3PZ3A 4LNBA 1LD8A 1N4RA 4MBGA 1TNOA 4LNGA 3E37A 1N4PA 1JCRA 3KSQA 2H6FA 1LTXA 1D8EA 1KZPA 3DRAA 3E34A 3E33A 1TN7A 1JCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X81 A;  3EU5 A;  2R2L A;  4EHM A;  1S64 A;  2F0Y A;  1FPP A;  3C72 A;  3DST A;  3SFY A;  3DSW A;  1O1R A;  3PZ1 A;  1MZC A;  4GTT A;  3E30 A;  2ZIR A;  1FT2 A;  1N9A A;  1TNU A;  3DSU A;  4GTV A;  3DSV A;  4GTP A;  1QBQ A;  1TN6 A;  1TNZ A;  3PZ2 A;  3HXF A;  1SA4 A;  1D8D A;  1SA5 A;  4GTR A;  2ZIS A;  1KZO A;  1LD7 A;  3Q75 A;  1N4S A;  1JCS A;  3PZ4 A;  1TNY A;  1DCE A;  4YDO A;  1N4Q A;  3DSS A;  2H6I A;  2IEJ A;  1N95 A;  3E32 A;  4GTS A;  3DPY A;  4GTM A;  1O5M A;  4GTQ A;  4GTO A;  3SFX A;  3EUV A;  3HXB A;  3Q79 A;  4YDE A;  2BED A;  1S63 A;  1O1T A;  4L9P A;  3Q7F A;  1FT1 A;  3DSX A;  3HXE A;  3HXD A;  1N94 A;  3Q73 A;  2H6H A;  2H6G A;  3Q78 A;  1TNB A;  3KSL A;  1NL4 A;  1NI1 A;  1O1S A;  1TN8 A;  3HXC A;  3Q7A A;  3PZ3 A;  4LNB A;  1LD8 A;  1N4R A;  4MBG A;  1TNO A;  4LNG A;  3E37 A;  1N4P A;  1JCR A;  3KSQ A;  2H6F A;  1LTX A;  1D8E A;  1KZP A;  3DRA A;  3E34 A;  3E33 A;  1TN7 A;  1JCQ A; 
#chains in the Genus database with same CATH topology
 3X2Q E;  1Y8M A;  3VTX A;  2J07 A;  2V5Q C;  1W3B A;  2BTD A;  2OV8 A;  4EHM A;  2F0Y A;  3URZ A;  3TWU A;  3CV0 A;  4JEU A;  5HS0 A;  5HQ8 A;  4GTT A;  1FT2 A;  3U66 A;  1PC2 A;  3LS8 A;  3LPZ A;  2WPV A;  3ASN E;  3LYA A;  1ZB1 A;  4ZFH A;  4FJZ A;  4U7E B;  2WQ7 A;  2R17 C;  5FTP A;  4HOS A;  5IY5 E;  4WND A;  2VGX A;  4GCO A;  2VYI A;  3S7D A;  1EDU A;  3MJW A;  3V2O A;  3AS8 A;  4HXI A;  3UXG A;  1A5E A;  2M63 A;  3FUL A;  5CBN A;  3B7B A;  4HOQ A;  4CYM D;  3FUH A;  2R59 A;  1KPS B;  1ELW A;  1WY6 A;  4NUR A;  1SQM A;  3CVP A;  3ULY A;  3UKR G;  4J7W A;  2GRO B;  4B94 A;  1N4R A;  3SHF A;  2UY1 B;  2VSY A;  1WDY A;  3ZEF A;  1LTX A;  5G04 C;  2J09 A;  3TWQ A;  4C9B B;  3DRA A;  3TJP A;  1D9S A;  4LUN U;  2C0L A;  2V4L A;  1E8Z A;  2X6J A;  3Q9N C;  3T9K A;  2YHE A;  2KM4 A;  4MRU A;  3AU5 A;  4APF A;  3MX3 A;  4MLP A;  4FUL A;  3AG1 E;  3S7J A;  2YNQ A;  5HI7 A;  5FWQ A;  2XGO A;  5FIO A;  1JPL A;  4G24 A;  3ASO E;  3IXE A;  3DSU A;  4B8A A;  1QBQ A;  3JQ1 A;  4O60 A;  5FQ8 A;  4ABN A;  1S0P A;  5FQ6 A;  3NZS A;  2DWZ A;  1N4S A;  2E2E A;  3FUJ A;  4N3A A;  4GA0 A;  3CGH A;  3RO3 A;  1YA0 A;  3RRU A;  3ZXS A;  3J5P A;  1TJF A;  1Z5S C;  5T4Y A;  2R02 A;  4DI3 A;  2V0P A;  3TG5 A;  4U8Y D;  4KZC A;  3D3M A;  3G2U A;  2FI7 A;  2FBN A;  3QC1 A;  3QOU A;  1O1S A;  3AS4 A;  2KXP C;  4OVV A;  4HLE A;  4UQY A;  2ION A;  5H7P A;  1HH8 A;  5KJM A;  5FZQ A;  2DCP A;  1MX2 A;  3D9K A;  3SBS A;  5KBA A;  4BFR A;  2I9C A;  2WXG A;  2X6I A;  3TGO A;  4TUM A;  1B89 A;  5HRY A;  4JA9 A;  1JWG A;  3ONK A;  4J8E A;  4ILG A;  3UM1 A;  2WB2 A;  2XEV A;  5FQ4 A;  5A23 A;  1EF1 C;  3G2W A;  4DLQ A;  2FO1 E;  4FLH A;  3C72 A;  3ZW3 A;  3MKQ B;  5LP0 A;  4LER A;  4GYO A;  1HX8 A;  2KZT A;  4BER A;  2EIL E;  3PZ2 A;  4DUI A;  2AXV A;  5KNH D;  5D66 A;  3TL5 A;  2OEW A;  4GTR A;  4CCA A;  3CVV A;  4U07 A;  1E8W A;  4F7A A;  5D2M C;  2PL2 A;  4UWG A;  3NZU A;  1N4Q A;  4HFG A;  1H2T C;  1SZA A;  3I3N A;  1DNP A;  1HE8 A;  3DXM G;  2J08 A;  4WNG A;  4ACK A;  3APC A;  2A5U A;  4N3B A;  4K5C A;  2WMN A;  1S63 A;  5C1D A;  4RQI A;  2NXP A;  2BKK B;  4GPK A;  4F6R D;  4N2Q A;  4FA6 A;  4B93 B;  4A63 B;  3NOG D;  4TXR A;  3SBT B;  4KVO A;  2H6H A;  1HXI A;  3CKB A;  4I17 A;  1E90 A;  1HO8 A;  2XHE A;  1VDY A;  4NAC A;  1HFA A;  3UT4 A;  1LF8 A;  3LVR E;  4Z68 A;  3LDZ A;  4BWR A;  3FH7 A;  4ME2 A;  5BUZ A;  4HVB A;  2DIW A;  1FVH A;  1OWM A;  3HIZ A;  3SO8 A;  4Q94 A;  1PY1 A;  3S2A A;  2Y4U A;  3ABL E;  5EIB E;  4I6E A;  2XZD G;  3ESK A;  1NZN A;  5EX0 A;  4F3V A;  4QQI A;  3VLD A;  1RZ4 A;  2ILR A;  3FUM A;  2GRN B;  4BEP A;  4DX6 D;  1N54 A;  5ENN A;  2NYJ A;  4XX5 A;  3OXL A;  1E96 B;  3HHM A;  1D8D A;  3HRA A;  4AV7 A;  1KLX A;  3Q15 A;  1DCQ A;  3S7F A;  1UW4 B;  3DSS A;  3PRZ A;  3DPY A;  1YMP A;  3C5R A;  5LFA A;  2IFU A;  2XQ0 A;  4QFV A;  1OWP A;  3ZNG A;  3FTX A;  3SFZ A;  4TRQ A;  4HRL A;  4E6H A;  4XIF A;  2LAH A;  2R05 A;  5AAR A;  1MQS A;  4UQX A;  2DVW A;  2QY7 A;  2GRM A;  2LAI A;  2AVP A;  1H2U A;  5ENQ D;  3IV0 A;  3QWP A;  5M72 A;  3MV3 B;  3ZN3 A;  4U8V D;  1BI7 B;  4XI9 A;  4KZ0 A;  3L54 A;  1WAO 1;  3LKU A;  1H19 A;  4GZD A;  2X6K A;  3NB2 A;  1HS6 A;  3GW4 A;  4K5A B;  2VGE A;  3E34 A;  4EBA G;  3AG3 E;  2E0I A;  3DBS A;  5AAO A;  2J49 A;  2Y4T A;  2KCK A;  5DIZ A;  3MV2 B;  3GYZ A;  3BEE A;  2VJ8 A;  4BSX A;  5AJD A;  1FPP A;  4JHR A;  1KT0 A;  1MZC A;  4RVB A;  4RG9 A;  2J4D A;  1XNF A;  5JJ6 A;  3EU9 A;  3RU0 A;  3MA5 A;  1NP7 A;  2HM8 A;  3HVE B;  4J8D A;  3TWV A;  3QDN A;  2RG8 A;  4MKT A;  4JVS A;  4UQZ A;  3L13 A;  2L0I A;  1TYQ G;  3OAW A;  4HOU A;  1TNY A;  3L6A A;  3Q9U C;  3B7T A;  2JLB A;  4GTM A;  2GGF A;  2EIJ E;  3CQG B;  1H6P A;  4E85 A;  1TR4 A;  4TXP A;  5G04 J;  2DBA A;  3TXM A;  4I9E A;  4CEM A;  5D0O D;  4EZL A;  5BPP A;  1BPO A;  1ZBP A;  4OAV B;  4I1A A;  3UT8 A;  1TN8 A;  1HF8 A;  2YIN A;  3ZHE A;  4GB9 A;  1IYG A;  1OCO E;  1N4P A;  4M3O A;  2CHW A;  3B7U X;  3SD5 A;  2AXU A;  3W9G A;  2XS1 A;  5CEC B;  3CSF A;  3ABM E;  4DX5 D;  3AG2 E;  2IQC A;  4FHK A;  1MYO A;  2LXL A;  4GYW A;  2IJG X;  4G25 A;  3PEU B;  2X38 A;  1OT8 A;  5KJN A;  4KMO A;  1WM5 A;  2IO3 C;  3CHM A;  4GML A;  3ASG A;  4RSY A;  4HI9 A;  2L0T B;  3G2T A;  1K1A A;  1N9A A;  4O1O A;  2P9L G;  3R9A B;  3ZPJ A;  3LY8 A;  4CT0 A;  4XZ4 A;  2EIN E;  2ZGG A;  4EQF A;  4I6G A;  4PS3 A;  4I43 A;  3TXN A;  1NA0 A;  4RG6 A;  3PS6 A;  2OEV A;  3MGB A;  1YCS B;  1QZ2 A;  4YDO A;  2V4H C;  5LOZ A;  3VLF A;  4IN3 B;  4UUC A;  3ZYM A;  3UM2 A;  1E8X A;  3MKR A;  3PDN A;  3IHY A;  4WWO A;  5AQA A;  1Z6T A;  3ONL A;  1OWL A;  3DPD A;  2I2O A;  3Q7F A;  3FUE A;  1L5J A;  5AJL A;  5G2N A;  3LY9 A;  3FUN A;  3KS2 A;  1OCZ E;  3HXC A;  4F53 A;  4EZJ A;  2MRI A;  4J0U A;  3E37 A;  3PRE A;  1IQU A;  1BI8 B;  2WXP A;  1D8E A;  3R7Q A;  3CKC A;  4OAU C;  2CFU A;  2ETA A;  4WNF A;  3FH5 A;  5FT9 A;  1U3D A;  5AEN A;  3MZL B;  2PNN A;  3PUJ A;  1KT1 A;  1UG3 A;  1OXJ A;  5BXO A;  4I2W A;  5LCW C;  3OXG A;  4W9R A;  2MOW A;  2XRY A;  1OUV A;  4BT8 A;  2WVI A;  3BG1 B;  1K8K G;  4UWF A;  4BSZ B;  4F1P A;  2ZU6 B;  4BY6 A;  3PZ1 A;  3V31 A;  3E30 A;  5G05 J;  2FF4 A;  4HOR A;  2Y3A A;  3I4G A;  2AXZ A;  3BUA A;  3CVY A;  5EYP F;  2CFZ A;  1H6K A;  5BNW A;  4GZ5 A;  4JXT A;  4L2L A;  1RW2 A;  4G1T A;  2LUH A;  3MYV A;  5FIN A;  2XPZ A;  2LSV A;  2BF0 X;  2BED A;  1O1T A;  1S70 B;  3GZS A;  4F1S A;  3UPV A;  2JEK A;  1PAQ A;  3L9T A;  2XEE A;  3FDH A;  1JUQ A;  4A1S A;  4P29 A;  2PQR A;  3P2B A;  2UWJ G;  1E7U A;  2PM6 A;  4Y6W A;  4C0E A;  4LEU A;  5KNG A;  2CHX A;  4AEZ C;  4YND A;  1Z3Y A;  3QB2 A;  4LNG A;  3U9W A;  4UI9 K;  4IYP A;  4PH4 B;  2WM9 A;  1H0A A;  2WXR A;  4D10 C;  3V2X A;  3CHR A;  3ENE A;  2A5E A;  2XGS A;  3JXI A;  4Q96 A;  4RLY A;  3LEW A;  3B7S A;  3V79 K;  2L6J A;  3QK0 A;  2P9U G;  4WUY A;  4I1O B;  5AN8 A;  3BG0 B;  3JUI A;  2DZO A;  5EIL A;  3UTM A;  4B8C B;  4GPM A;  4G8K A;  1SA5 A;  2ZIS A;  3AS5 A;  4EBA A;  4A3T A;  2P9I G;  2B0O E;  2LNI A;  4GZ3 A;  3UX4 A;  2HR2 A;  1TEZ A;  2H6I A;  4B0Z A;  3G2S A;  3RJV A;  1OY3 D;  3MKQ A;  4WWP A;  2NC9 A;  2F37 A;  3D9O A;  5AYW D;  3C3Q A;  4AP2 A;  4K03 A;  3UT7 A;  2MHK A;  1N94 A;  3PEV B;  5FQ7 A;  4FAD A;  3Q78 A;  5J08 A;  3ZIM A;  4ANW A;  2A4Z A;  1ZU2 A;  3Q47 B;  4DRX E;  5BV1 A;  3NBN B;  2XEN A;  1SVX A;  2OOE A;  5CRU A;  2DZN A;  3GZ1 A;  4G11 A;  3FU3 A;  5AIJ A;  1MJ0 A;  2R03 A;  4HI8 A;  2L6B A;  3HG0 D;  2RFA A;  5JA4 D;  1X5B A;  2I1J A;  4G8L A;  3ULQ A;  3BU8 A;  4JHK A;  4FC8 A;  5HKP A;  4FLB A;  3CHP A;  1IKN D;  3SGH A;  5BXU A;  4JB8 P;  2R2L A;  3FFL A;  4JA7 A;  5ANR A;  4HQD A;  4BX8 A;  3EHQ A;  1TNU A;  2FEZ A;  2I6H A;  1MX6 A;  2HYZ A;  5KWD A;  4U0Z A;  3ZYK A;  4J6I A;  2FUL A;  3ZRH A;  1QNF A;  1IXV A;  4EEC A;  2Y1L E;  4GA2 A;  4JW1 A;  3SI5 A;  5B1B E;  3CVQ A;  3UI2 A;  3MCX A;  4GMR A;  1N0R A;  2P2C P;  2VSN A;  3CR3 A;  2CG3 A;  1H6O A;  2X6F A;  4LRZ A;  4IUL A;  3LJN A;  5EDS A;  3C3R A;  3FUF A;  3ISM C;  3EIJ A;  3Q5M A;  3TWX A;  4GMJ A;  2MYO A;  2OVB A;  3TWT A;  4U63 A;  2UY1 A;  3ZU7 B;  3J5Q B;  3OTN A;  4I1M A;  3QJZ A;  1JCQ A;  3FTW A;  4ANU A;  1S64 A;  4XKB A;  4ATG A;  2RFM A;  4NRH B;  1O1R A;  3S7B A;  2IO2 C;  5CMW A;  4UI9 C;  3ZUV B;  3TG4 A;  4BET A;  3VTY A;  1MHQ A;  3FU6 A;  3LXU X;  1E7V A;  5ANL A;  4HLL A;  2XGM A;  3UM3 A;  2WXO A;  1QYM A;  2KZT B;  3D9N A;  1DC2 A;  3JUE A;  4AXH A;  5EID A;  3PZD A;  3EUV A;  4N39 A;  1YYH A;  2V5F A;  4YDE A;  3SQV A;  3ZFW A;  1FT1 A;  1QQE A;  3HXE A;  2WQH A;  4BTA A;  3D9H A;  4DX7 D;  1Z3X A;  3ZVV A;  3L08 A;  5AQ7 A;  3Q7A A;  2XS8 A;  4MBG A;  4JPS A;  2RD0 A;  4NQ0 A;  4YDW A;  3QAQ A;  4FP7 A;  3K9I A;  5AQ9 A;  4CT4 A;  3DEP A;  3FEX A;  3QKY A;  5G05 C;  2GRL A;  4V3I A;  3L16 A;  1BD8 A;  5KCM A;  1HU3 A;  1UN8 A;  3CEQ A;  5ENT D;  2NSZ A;  1V54 E;  4C48 B;  2ETB A;  2VGY A;  1HZ4 A;  5EKQ D;  3FWV A;  5CMY A;  3ZGQ A;  3DSW A;  3UUX A;  3JQ0 A;  4X8Q A;  2ZIR A;  4KT6 B;  4A3V A;  1UOH A;  2Y69 E;  2C2L A;  2XEH A;  4GTV A;  4GTP A;  1TN6 A;  3HXF A;  5LCW J;  2XPY A;  4UWH A;  2WXI A;  3DWL G;  3B7R L;  2VTB A;  4PDX A;  3RIB A;  1JCS A;  4O1P A;  1DCE A;  3UMV A;  3AU4 A;  4U0S A;  2IEJ A;  4U95 D;  1OCC E;  5BV0 A;  4GTS A;  3IHV A;  3T8K A;  1K3Z D;  1Q2Z A;  1O5M A;  2IU1 A;  4TUU A;  2WQ6 A;  3L22 A;  4FU3 A;  4BT9 A;  3ASH A;  4L9P A;  5DBK A;  5EYL A;  3F6Q A;  1OWN A;  1UJJ A;  4JL0 A;  2L9B A;  2XCB A;  4Y6C A;  4PS7 A;  1FCH A;  3PNL B;  3L17 A;  3O48 A;  5CED B;  4L1B A;  1TNB A;  4R7L A;  3V30 A;  3SY2 A;  5CER B;  3GZ2 A;  3EIQ C;  1K1B A;  3VLE A;  3N71 A;  4AJW A;  4AY6 A;  3T8M A;  2HE0 A;  1U3C A;  2H6F A;  3UQ3 A;  3CK8 A;  4JZY A;  4GU5 A;  4N3C A;  4CGV A;  4WNE A;  5JJT A;  3CHQ A;  4TXQ A;  4H7Y A;  3P1U A;  1FVF A;  2KC7 A;  1HG5 A;  3FHE A;  2ZGD A;  2HO1 A;  4BX9 A;  3IBE A;  4AOF A;  2PM7 A;  4AVX A;  3CVX A;  4AY5 A;  2GRR B;  3RSE G;  4MS6 A;  4GZC A;  3WG7 E;  4TV3 A;  4DLO A;  2IF4 A;  3JYS A;  2J4B A;  3U64 A;  1SA4 A;  2VGX B;  3KD7 A;  3LVQ E;  3OXF A;  3NQP A;  4XI0 A;  4G26 A;  2PZI A;  3SF4 A;  1Y6I A;  2WXK A;  4HNA D;  3Q75 A;  5EX3 A;  3UIO C;  3PZ4 A;  4U04 A;  3RAU A;  2WXN A;  5J90 A;  1E8Y A;  4L23 A;  3DXK G;  3LCA A;  3W9F A;  4YDY A;  1IQR A;  1OWO A;  4XEI G;  2KCV A;  4CGW A;  3CVN A;  3EHN A;  3QWV A;  1HG2 A;  2KCL A;  2OND A;  5FZS A;  1AWC B;  3LJ3 A;  3R9M A;  2LSU A;  3AAA C;  3PZ3 A;  4M7C A;  5CRV A;  3UIN C;  4J8S A;  4PS8 A;  5CCM A;  2DYR E;  3U4T A;  2AWI A;  3MEK A;  2AJA A;  2YQ8 A;  1EPU A;  4LG6 A;  2Y0B G;  4KXK B;  2PQN A;  4KVM A;  2WMO A;  1BLX B;  5LX8 A;  5KJK A;  5ENP D;  5C2Y A;  5EN5 D;  1WG0 A;  3PNT B;  4Q69 A;  2CHZ A;  3FU5 A;  4B89 A;  3SFY A;  4FJY A;  3KAE A;  4EPZ A;  3I4R B;  4HS2 A;  3CHO A;  5CHE E;  4N5Q A;  4LNU D;  1TNZ A;  2F8X K;  1ELR A;  3EHM A;  3CVW A;  4WWN A;  2AW6 A;  2VSO E;  4FHJ A;  1H2V C;  2CG2 A;  4A55 A;  1UN9 A;  3ML8 A;  2ZXW E;  2OCC E;  3CLJ A;  3NF1 A;  2GRQ B;  5KJL A;  2QFC A;  4N2S A;  4C0M A;  4GTQ A;  4HB5 A;  3RKV A;  3PVL A;  3FUK A;  3RO2 A;  5CBO A;  2YHC A;  3BQO A;  2VSX E;  2ETC A;  3KSL A;  1NL4 A;  3ESL A;  3PE4 A;  2WXQ A;  2QC9 A;  4LNB A;  1NA3 A;  3CVU A;  1G3N B;  2EQX A;  3D9P A;  3I5P A;  3KEA A;  4AM9 A;  5CCL A;  2OVF A;  5JJ7 A;  3G2V A;  4DX2 A;  5E75 A;  4AIF A;  4ATZ D;  5ARG A;  4CDM A;  3QAR A;  4K5B A;  3U3W A;  2EIK E;  3RRM B;  4CDR A;  3B13 A;  2XPI A;  4OYS A;  3AJI A;  4YVQ C;  3E33 A;  3L82 A;  4UI9 J;  2KAT A;  4CRW A;  2Q7F A;  2IOL A;  2XCC A;  3R7R A;  3ASD A;  4DX1 A;  4GA1 A;  1GW6 A;  2QYU A;  3EDT B;  3RK6 A;  3ZYQ A;  5ENS D;  3DST A;  4N5C A;  5B1A E;  4CDN A;  4YVO A;  4HRN A;  3FTZ A;  2QZA A;  2C0M A;  4NIK A;  2WXM A;  4UWK A;  2V8S E;  1KZO A;  3ULE G;  3FUD A;  3NAW A;  3CIA A;  3SZ7 A;  5ENR D;  3SNX A;  1N0Q A;  1P5Q A;  4JEH A;  4GTO A;  4ANV A;  3HXB A;  1BU9 A;  4HOT A;  3NOC D;  4JHJ A;  3UKU G;  2WXJ A;  4H7X A;  4I2Z A;  3T5X A;  4I6J A;  3CK7 A;  3IEG A;  3E4B A;  3Q73 A;  2H6G A;  1NI1 A;  3FH8 A;  1NFI E;  3Q49 B;  2XZT G;  4L2Y A;  5T3R A;  3APD A;  1JCR A;  3FY4 A;  3KSQ A;  5B3S E;  3TWR A;  4U96 D;  5E76 A;  3FTS A;  5ENO D;  2F8Y A;  3APF A;  4ANX A;  4LSZ E;  3C98 A;  4DK5 A;  3AG4 E;  2JAB A;  1X81 A;  4A1G A;  2RKK A;  3ZYL A;  3EU5 A;  4ACL A;  2IOS A;  2WXH A;  3FEY A;  3FU0 A;  2XRZ A;  2WXF A;  1INZ A;  2P9K G;  3QNK A;  3ZHE B;  3TWS A;  3D9J A;  4U8H A;  4G2V A;  1U2V G;  2P9N G;  1SW6 A;  4DJA A;  1UJK A;  4OVU A;  4BES A;  3LY7 A;  3CK9 A;  1LD7 A;  1MX4 A;  3TWW A;  1IHB A;  4XE0 A;  4GCN A;  4ILH B;  5JHA A;  5AQB A;  3JXJ A;  1N95 A;  3E32 A;  2QYJ A;  4JC8 A;  3PH0 C;  3FTV A;  2B6C A;  2J8S D;  1V55 E;  2I1K A;  1OCR E;  2BUG A;  5FJY A;  4EZK A;  3ASF A;  1ELK A;  3FTY A;  3HVE A;  4HBD A;  2GW1 A;  1DVP A;  4GAA A;  3ZXP A;  3PE3 A;  1TNO A;  4JD2 G;  3RRN B;  3FP3 A;  5D0Q D;  3QWW A;  5BW8 C;  5ITZ F;  4KBQ A;  5BT1 A;  4PUC A;  3O4Z A;  4UWL A;  1TN7 A;  4DI4 A;  3D9L A;  4O6F A;  2EIM E;  5CEA A;  5T8I A;  2IY0 C;  5A6C A;  4GZ6 A;  3WXX A;  1TJC A;  4K0R A;  3PUK A;  5A7D B;  2FO7 A;  2J9Q A;  1IHG A;  5G55 A;  2KBX A;  3FTU A;  4BTB A;  2GRP B;  4DPR A;  1AP7 A;  3DSV A;  3B95 A;  2BKG A;  2P9S G;  4U0U A;  3Q4A B;  4L7T A;  4XKC A;  4KYO B;  4WAF A;  2VTB B;  4GYY A;  4J8F A;  1EYH A;  4LCT A;  3ABK E;  3HDX A;  3C3O A;  3DEO A;  3EHR A;  2VQ2 A;  2P9P G;  3CQC B;  4ZHB A;  1SZ9 A;  3UIP C;  3UM0 A;  3SFX A;  3EJN A;  1XGW A;  3Q79 A;  4I9C A;  4G23 A;  1JWF A;  5JHB A;  3ML9 A;  3DSX A;  5FZR A;  3HXD A;  2DYS E;  3KEZ A;  3CST A;  1N11 A;  1N52 A;  2P58 C;  4CZ2 D;  2X3M A;  4APO A;  4HRM B;  1LD8 A;  3IKO B;  3CHS A;  5ARF A;  3ZKJ A;  1A17 A;  3JCK C;  3D9M A;  3D9I A;  1KZP A;  3HYM B;  3TAX A;  5JMN D;  3CVL A;  2WXL A;  3T5V A;  4J8Y A;  2X6H A;  2LO6 A;  4URK A;  2R5S A;  4IRU A;  2LXM A;  3FUI A;  4ILI A; 
#chains in the Genus database with same CATH homology
 1X81 A;  3EU5 A;  2R2L A;  4EHM A;  1S64 A;  2F0Y A;  1FPP A;  3C72 A;  3DST A;  3SFY A;  3DSW A;  1O1R A;  3PZ1 A;  1MZC A;  4GTT A;  3E30 A;  2ZIR A;  1FT2 A;  1N9A A;  1TNU A;  3DSU A;  4GTV A;  3DSV A;  4GTP A;  1QBQ A;  1TN6 A;  1TNZ A;  3PZ2 A;  3HXF A;  1SA4 A;  1D8D A;  1SA5 A;  4GTR A;  2ZIS A;  1KZO A;  1LD7 A;  3Q75 A;  1N4S A;  1JCS A;  3PZ4 A;  1TNY A;  1DCE A;  4YDO A;  1N4Q A;  3DSS A;  2H6I A;  2IEJ A;  1N95 A;  3E32 A;  4GTS A;  3DPY A;  4GTM A;  1O5M A;  4GTQ A;  4GTO A;  3SFX A;  3EUV A;  3HXB A;  3Q79 A;  4YDE A;  2BED A;  1S63 A;  1O1T A;  4L9P A;  3Q7F A;  1FT1 A;  3DSX A;  3HXE A;  3HXD A;  1N94 A;  3Q73 A;  2H6H A;  2H6G A;  3Q78 A;  1TNB A;  3KSL A;  1NL4 A;  1NI1 A;  1O1S A;  1TN8 A;  3HXC A;  3Q7A A;  3PZ3 A;  4LNB A;  1LD8 A;  1N4R A;  4MBG A;  1TNO A;  4LNG A;  3E37 A;  1N4P A;  1JCR A;  3KSQ A;  2H6F A;  1LTX A;  1D8E A;  1KZP A;  3DRA A;  3E34 A;  3E33 A;  1TN7 A;  1JCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...