3Q73A

Cryptococcus neoformans protein farnesyltransferase, apo enzyme
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
330
structure length
316
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSDPLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase
molecule keywords Farnesyltransferase, alpha subunit
total genus 127
structure length 316
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q73A00
3Q7FA 1MZCA 1N94A 1QBQA 3E33A 3Q79A 1O1SA 1TNBA 4L9PA 3PZ3A 3HXCA 1TNOA 4GTVA 3E34A 1LTXA 4GTRA 4LNBA 2IEJA 1N9AA 1NI1A 4GTTA 3Q7AA 2BEDA 4EHMA 2H6FA 4GTOA 1O1TA 2H6GA 3DSTA 3PZ4A 3SFXA 2ZISA 2H6IA 1S63A 2F0YA 3DPYA 1TN8A 1O1RA 1S64A 3Q75A 3DSWA 1FT2A 1X81A 1KZPA 1JCSA 1TNUA 3DSXA 4GTSA 1NL4A 3E30A 3KSLA 3E32A 1N4PA 1N4QA 4LNGA 1TNYA 1N4SA 3HXEA 1SA5A 3C72A 3DSSA 1JCQA 1SA4A 3Q78A 4YDEA 3DRAA 1JCRA 1LD7A 4GTQA 2ZIRA 1TNZA 3E37A 3PZ1A 3EU5A 1FPPA 3KSQA 3HXFA 4GTMA 3HXBA 2H6HA 4YDOA 1D8EA 3DSVA 1LD8A 3HXDA 3EUVA 3Q73A 1DCEA 1D8DA 3SFYA 1FT1A 4GTPA 1O5MA 1TN6A 1KZOA 1N4RA 1TN7A 2R2LA 4MBGA 1N95A 3PZ2A 3DSUA
chains in the Genus database with same CATH superfamily
5JHBA 5BUZA 2XRZA 4JB8P 3V30A 3P1UA 3ASDA 3RRUA 5KNHD 5FZRA 2GGFA 5ANLA 4GTTA 2DWZA 2FBNA 4ACKA 2UY1B 2XPZA 3FULA 1UOHA 3LEWA 2BTDA 3FTZA 2ZISA 4I2WA 3ZGQA 4A55A 3L9TA 2WMNA 3DEPA 1Q2ZA 4TXPA 5HRYA 4A3TA 4F53A 4DX7D 4DLQA 4AXHA 4U7EB 3ZHEB 1N4QA 2J07A 2A5UA 1N4SA 4J0UA 4OYSA 1JCQA 2LXMA 5A7DB 5LX8A 3LXUX 2R03A 4HNAD 3ML8A 1K8KG 3LJ3A 2XEVA 2BF0X 3G2TA 1SW6A 3CHOA 4J8EA 4DX5D 3T5VA 1HF8A 4NACA 1BU9A 3HVEA 1O5MA 3T8KA 1N4RA 2XGSA 1D9SA 2M63A 5FZQA 5CMWA 3ZYLA 3DSUA 4MS6A 5G05J 3CIAA 2NYJA 4FP7A 2CHXA 3E33A 3OAWA 1TNBA 3E34A 3TG4A 3UIPC 3I3NA 2KC7A 4JVSA 3FTYA 1N9AA 5G05C 5ARFA 4Q94A 4F7AA 5KJNA 1OCOE 3SHFA 4KMOA 4C0MA 1H6OA 3ZXSA 3VLEA 2XEEA 1OCRE 5M72A 2UWJG 4B94A 1NL4A 1OUVA 3IXEA 3SBTB 4PH4B 5HS0A 2NC9A 1BI8B 4HI9A 5FQ8A 4BY6A 2EIME 2FEZA 2JEKA 3TWVA 4J7WA 2WXQA 4YDEA 1BI7B 4BTBA 4EQFA 2FULA 2CG2A 1LD7A 2X6HA 3TAXA 2XCCA 4ATZD 3PNTB 3TG5A 4GTMA 3HXBA 2QFCA 3Q73A 4U0SA 3CK8A 3EHMA 4NQ0A 3SGHA 2WXKA 4BFRA 1FT1A 3D9LA 1DC2A 4GZ5A 3LDZA 3NQPA 4K0RA 2E2EA 5FZSA 5FWQA 5BW8C 1OCCE 3UINC 3CKCA 4UI9C 3D9JA 1NFIE 4WWNA 2ZGGA 1E8ZA 2FI7A 1WM5A 4XE0A 3UPVA 2GRRB 4UI9J 4GTOA 2L0IA 4ILGA 4DUIA 2BKGA 4FLBA 5EYLA 1GW6A 1ZBPA 5H7PA 1K1AA 5AENA 3L54A 5ENNA 3DPYA 2FO1E 3ML9A 4ANXA 3G2WA 3MV2B 1TN8A 2NXPA 1KZPA 4CZ2D 3FUJA 4DLOA 2YHEA 4J8SA 3TXNA 3S2AA 1PC2A 3E30A 4WWOA 3LVQE 3UI2A 1DNPA 3NAWA 4JC8A 1SA5A 2DZOA 3N71A 2P9NG 4XKBA 1MHQA 3ZNGA 2GRQB 3LY7A 2X3MA 3E4BA 3TXMA 3ASGA 2FF4A 3JUEA 3ZRHA 4BSXA 4APFA 5IY5E 4L2LA 1ZB1A 1H2UA 2KCLA 3C3OA 3CHPA 4BX9A 4CCAA 2XENA 2AXVA 3DXMG 4PS8A 5BXUA 3MCXA 4M3OA 3I5PA 1QBQA 2Y3AA 1JUQA 1Z5SC 3L08A 3S7FA 3SQVA 4ME2A 5G04J 3EIJA 3MKQB 3OTNA 4GTVA 4FC8A 1TNOA 2X6JA 1PAQA 2J8SD 4EHMA 3ISMC 4K5BA 4URKA 1AWCB 3JXIA 4E85A 3RU0A 3PZ4A 3MV3B 3FUMA 4U8VD 4WAFA 3FTSA 4PUCA 2WXLA 2V8SE 4JHJA 2HR2A 2X6FA 2Q7FA 4F1SA 4JXTA 5BPPA 3R7QA 1OXJA 5AQ9A 1KT1A 3D9KA 4NRHB 3S7JA 2LSUA 3P2BA 3I4RB 2KXPC 3ASNE 4GAAA 2GROB 3ZIMA 4FJZA 4GTQA 3IHYA 2ZIRA 2GRLA 1QZ2A 3MKQA 3E37A 2EINE 3Q5MA 3HXDA 3O4ZA 3B7SA 1N11A 3EIQC 5LOZA 4CYMD 5KWDA 1G3NB 2WXFA 4Y6CA 2J09A 4L2YA 5FQ4A 4AY5A 3PDNA 4TRQA 1WDYA 4FHJA 4LSZE 1RZ4A 2WXMA 1OWPA 5BV1A 1H0AA 2V0PA 3FP3A 1Y6IA 1HG2A 2B0OE 5E76A 4GTRA 2IEJA 1MJ0A 5EIBE 4FU3A 3W9FA 3PS6A 2QC9A 4DI3A 5DIZA 4N3BA 2H6GA 5AIJA 2F0YA 3PH0C 5CRUA 4I17A 4QQIA 4KBQA 5D2MC 1S64A 5EN5D 4CT4A 2GRNB 5J08A 4G25A 5ENQD 4BSZB 1QYMA 2HM8A 3FY4A 3E32A 5FT9A 1N4PA 1IHBA 1UW4B 1IHGA 2HYZA 3DPDA 5ENRD 2XQ0A 3ZN3A 1EF1C 3SF4A 4DRXE 3V31A 1JCRA 4LERA 3GW4A 2MHKA 3EHNA 3RRMB 3HIZA 3S7BA 2C0LA 5EILA 4WNEA 3PZ1A 3IV0A 4XIFA 5EDSA 2XPIA 2BKKB 1KLXA 3RSEG 3D9MA 2PM7A 5KJKA 2V5FA 3SFZA 2WQHA 4I9EA 4JHRA 4RG6A 2KCVA 3ASOE 4GA2A 4I1MA 4G8KA 5CEAA 2OV8A 3ASHA 2HO1A 1WY6A 4UUCA 4OAVB 3UXGA 5JJ7A 3CVLA 4CDNA 3ZKJA 2LSVA 1MZCA 2VSNA 2KCKA 1SVXA 5EX3A 3S7DA 2I1JA 3AAAC 3TGOA 1LTXA 1TJFA 3U66A 2CHZA 2H6FA 3VLDA 3UTMA 4BTAA 3JQ0A 3QKYA 4JHKA 4N5CA 2J08A 1ELWA 4H7XA 4I1AA 1MX2A 3BQOA 5CRVA 4Q96A 2WPVA 4AIFA 1V54E 3D9OA 2VGXB 2KZTA 4HFGA 4A1SA 4N3AA 3UM1A 4J8YA 1Y8MA 2VGYA 4GZ6A 3CVPA 1FVHA 4DX1A 3FUNA 1FVFA 1OWNA 2QYJA 5EKQD 3Q78A 4HLEA 3LCAA 4AY6A 4JW1A 3QOUA 3PUJA 3QWWA 1Z3YA 3CR3A 3CLJA 4XX5A 3LYAA 4GZCA 5ITZF 1LD8A 1D8DA 5JJ6A 4EBAA 3TWUA 4HRLA 4MLPA 4U95D 4OVVA 3T8MA 1HXIA 3ZPJA 3UT8A 3L16A 2VTBB 2ETAA 4GMRA 3FH7A 3CVQA 2L6JA 2KZTB 3FUDA 3Q7FA 3URZA 1E7VA 3MEKA 2V4HC 4BERA 4LG6A 4XI0A 5ENOD 3HHMA 2OCCE 3LJNA 3JXJA 3NF1A 4AV7A 2OOEA 3PZ3A 2AXUA 4B93B 1X5BA 3LY9A 3ZYKA 1SZ9A 3Q7AA 4I1OB 4KT6B 5B1BE 3G2UA 2ONDA 1S63A 3PE3A 1V55E 4J8DA 1IKND 3ASFA 4A63B 1BD8A 1YCSB 2C0MA 2JABA 2Y1LE 4BX8A 5B3SE 1A5EA 5AYWD 4GYWA 3ZFWA 3MJWA 2IJGX 3BG1B 1MX6A 3HXEA 5E75A 4UWFA 3ONLA 4PDXA 2KBXA 2VGXA 2RFMA 3IKOB 5FTPA 2R5SA 1KT0A 3EDTB 2RKKA 5T4YA 4U8HA 4GZ3A 3QB2A 4CGVA 3SNXA 1MYOA 2R02A 3ZVVA 4G8LA 3EUVA 3JQ1A 2VTBA 3FU6A 3RO3A 3FFLA 1IXVA 3DXKG 4IYPA 3BG0B 4GYOA 5LCWJ 4WWPA 1NA0A 4V3IA 1BPOA 4DPRA 3B7RL 3IBEA 1EPUA 4L9PA 3HXCA 1N52A 3CV0A 3U64A 1TYQG 1ELRA 3QNKA 4YNDA 1N0RA 2VSOE 4UWKA 3ABKE 3UIOC 3HG0D 2JLBA 5CBNA 3ULEG 4O60A 3SBSA 4I6EA 4GMLA 3FU3A 4I6GA 4U8YD 4WNGA 4AJWA 1FT2A 1TNUA 2C2LA 3U4TA 4AM9A 2XS8A 4HOUA 4N2QA 2DBAA 5JMND 3Q9NC 4LRZA 3U3WA 4HORA 1L5JA 3TWQA 3PZDA 3FUFA 3Q47B 3T5XA 4ATGA 3EU5A 4F1PA 2WXIA 4GA1A 4I2ZA 4HOSA 5HI7A 3C3QA 4RLYA 3TWSA 2R17C 3V79K 3R7RA 3B7TA 2PNNA 4FJYA 1UN9A 4LEUA 1UJJA 5FIOA 2VYIA 1WG0A 3HVEB 4BESA 5AJLA 2AJAA 5EYPF 3AJIA 4GPMA 5EX0A 2XS1A 3RRNB 3LY8A 2I9CA 4AOFA 5CECB 3DEOA 4Y6WA 3EJNA 1NI1A 2VSXE 2P58C 4RVBA 5ENSD 3DSTA 3D9PA 5JA4D 2PL2A 3ESKA 3CVXA 4JA9A 2LXLA 3TL5A 1YMPA 4K5CA 5AJDA 5D66A 1IQRA 2R59A 3CVWA 3WG7E 2XZTG 3R9MA 4EPZA 2WXPA 4JEUA 4OAUC 2WXGA 3ONKA 1U2VG 1OT8A 4HB5A 1EYHA 2RG8A 4BT9A 4U04A 4HLLA 2WXOA 3UM0A 3D9IA 3HRAA 2Y0BG 3B95A 5ANRA 3EHQA 3OXGA 2DVWA 3APCA 3KD7A 2H6HA 4EZKA 4EZJA 3QARA 3FUKA 1P5QA 2IONA 4FHKA 4L7TA 3QDNA 3LKUA 3KS2A 3V2XA 2E0IA 4YDYA 3CQCB 2WB2A 3FU0A 4DK5A 2I2OA 2KATA 1XNFA 1NZNA 4M7CA 3R9AB 4ABNA 3FEXA 3APDA 1HO8A 3FTXA 3AG2E 4RSYA 2FO7A 2PM6A 4E6HA 3ZXPA 4ZHBA 5BV0A 1E8YA 2AW6A 2RD0A 4JD2G 2V5QC 3KEAA 1OWMA 1TEZA 3UUXA 3FTWA 5C1DA 3DSWA 4G11A 4MRUA 3UQ3A 3Q9UC 3PVLA 5CBOA 4B8CB 2IOLA 2EQXA 4LNGA 2KM4A 4ZFHA 4KVMA 4CDMA 4G24A 4GU5A 2XRYA 3PRZA 3FUEA 3CHSA 3ZUVB 3DRAA 2L0TB 1TR4A 1W3BA 1H6KA 3AS5A 4JA7A 3MGBA 3UM2A 1MX4A 3VTXA 2PQRA 5G55A 3I4GA 5G04C 5AARA 2GW1A 2P9IG 3RK6A 2CFZA 5FJYA 2MOWA 3ZW3A 2X6IA 1S0PA 1IYGA 3ENEA 4OVUA 3DBSA 4B89A 3SZ7A 4L23A 3PZ2A 5B1AE 5J90A 4CEMA 3HYMB 2VSYA 4WUYA 2IO3C 3GZ1A 3RKVA 2WQ6A 3PUKA 3CGHA 3TWRA 3ULQA 2V4LA 3PEVB 3CHMA 5AQ7A 3NOGD 3VLFA 1N54A 4RQIA 4AVXA 3FH8A 5LP0A 2H6IA 3LPZA 1XGWA 2P9KG 3GYZA 4UQXA 4ILHB 2MRIA 3FTVA 1U3DA 5T8IA 5BT1A 3ABME 4UWLA 3SY2A 5DBKA 4TXQA 5BXOA 4WNDA 1E7UA 2L9BA 3LS8A 2DYRE 1SA4A 3TWWA 3PNLB 2LUHA 4KXKB 4P29A 2DIWA 1E8WA 3CVVA 1JWGA 1EDUA 4LCTA 4APOA 3CK9A 4PS3A 5KCMA 4ACLA 3KSQA 4TUUA 4JZYA 3D9HA 1S70B 3RIBA 3SFYA 3LVRE 2PQNA 4U96D 3MX3A 1TN6A 4J8FA 2XEHA 4HRNA 3GZ2A 4J6IA 4YVOA 2R2LA 3ZEFA 1OWOA 1IQUA 3KEZA 1ELKA 1N95A 1HG5A 3CSFA 1ZU2A 4HXIA 4GYYA 3D3MA 1UN8A 3OXFA 1E96B 4FULA 5KBAA 3D9NA 4LUNU 2NSZA 5FQ7A 5KNGA 2ZGDA 1DVPA 4UWHA 4CDRA 5FINA 3MYVA 4I9CA 3CK7A 1VDYA 2P9PG 4N3CA 3UT7A 4ANUA 3CQGB 4HVBA 2MYOA 3BEEA 4BEPA 1JCSA 3UX4A 4RG9A 3L17A 3DWLG 2I1KA 2EIJE 3B7UX 2YNQA 4O1OA 2WXHA 3SI5A 3W9GA 3DSSA 2GRPB 1E90A 2A5EA 3AU5A 3JCKC 2B6CA 4HOQA 5EIDA 3PREA 4JPSA 3QWVA 3NOCD 4IN3B 2P2CP 4FLHA 1FPPA 2YINA 3K9IA 3C3RA 3L82A 2ZU6B 3VTYA 4DX6D 1KZOA 2WM9A 2IQCA 2OEWA 2ETBA 4YDWA 3U9WA 4XI9A 3NB2A 3C98A 5JHAA 3SO8A 4HI8A 3GZSA 4U63A 3FWVA 4C0EA 3CSTA 3FUHA 4IRUA 4LNBA 1JWFA 3ZYMA 2ILRA 4EBAG 3ZYQA 4KYOB 3ZU7B 1HFAA 2OEVA 5CEDB 3QK0A 2J9QA 2AWIA 2WXNA 2X38A 1NA3A 2QZAA 4N39A 3KAEA 4GA0A 4AP2A 5D0OD 4XEIG 3G2VA 3TWTA 1FCHA 2ETCA 4U0ZA 1OY3D 4K5AB 3AS8A 1KPSB 1H6PA 1TJCA 2AVPA 2WMOA 1H19A 3RO2A 4BT8A 4XZ4A 5AN8A 2F8YA 4G1TA 2P9LG 5T3RA 2BUGA 1E8XA 5CCMA 5CHEE 4KZCA 5ARGA 4AEZC 1HS6A 3CKBA 3Q15A 4BWRA 2WXRA 5JJTA 4G26A 3Q4AB 4ILIA 3QC1A 2YHCA 1HE8A 3CVNA 3T9KA 3SD5A 4H7YA 1QQEA 1AP7A 1BLXB 4CGWA 1INZA 5LFAA 4XKCA 1UJKA 2LAIA 3AG3E 1Z6TA 4DX2A 1K1BA 3AU4A 3JUIA 2RFAA 3Q79A 3CHRA 1HZ4A 4F6RD 5FQ6A 3UKRG 3B7BA 1B89A 4GMJA 2BEDA 2QYUA 3IHVA 1H2VC 1YA0A 3ABLE 3C5RA 2L6BA 3AS4A 2WVIA 3Q75A 2PZIA 4GCNA 4NIKA 3QJZA 3RAUA 3KSLA 4JL0A 4W9RA 3L13A 4GPKA 4NURA 3TWXA 3CVUA 1TNYA 1H2TC 4A3VA 4TV3A 2EIKE 1DCQA 1NP7A 3C72A 1U3CA 3J5QB 5KJLA 4GB9A 4C9BB 2XPYA 3BU8A 3UKUG 4D10C 4I43A 3MA5A 1N0QA 2F37A 3O48A 2IFUA 2P9UG 2YQ8A 4O1PA 5HKPA 2VGEA 3AG1E 3B13A 3UMVA 3UT4A 3WXXA 2HE0A 1OWLA 1JPLA 3Q49B 4Z68A 4U07A 3QAQA 2LNIA 3QWPA 4UWGA 4HQDA 1N94A 3ZHEA 5AQBA 5CCLA 2EILE 3HDXA 3FUIA 3UM3A 4MKTA 1O1SA 4C48B 3AG4E 4B0ZA 4FADA 2XGMA 2ZXWE 4CRWA 2OVFA 1O1TA 2IU1A 1HX8A 4B8AA 2VQ2A 2J4BA 4A1GA 5BNWA 2CG3A 2IOSA 1O1RA 2QY7A 1A17A 3FU5A 5ENPD 2VJ8A 3J5PA 3DSXA 3FEYA 4GTSA 2LO6A 4UQZA 4N2SA 3EU9A 1PY1A 4HOTA 5AQAA 3RJVA 1HH8A 5ENTD 3PE4A 3JYSA 4L1BA 1SZAA 2XCBA 4TXRA 4PS7A 2J49A 1K3ZD 2WQ7A 5AAOA 2Y4TA 2LAHA 5A23A 4G23A 5A6CA 3PEUB 2CFUA 3V2OA 5KJMA 5CMYA 2J4DA 2GRMA 4CT0A 4Q69A 5G2NA 4LNUD 4GZDA 4DJAA 5LCWC 3F6QA 1D8EA 3DSVA 4QFVA 4FA6A 1DCEA 2IO2C 4ANVA 1QNFA 3L22A 2AXZA 4GCOA 1SQMA 2F8XK 3TJPA 3MZLB 2DZNA 5HQ8A 4KZ0A 4HBDA 4BETA 5D0QD 1TN7A 4UI9K 2OVBA 1Z3XA 2DYSE 1UG3A 4K03A 1MQSA 3BUAA 4ANWA 2XHEA 2XZDG 2Y4UA 3ESLA 3FHEA 1OCZE 3OXLA 3FH5A 4DI4A 2WXJA 2Y69E 1WAO1 4WNFA 4N5QA 3SFXA 2DCPA 4TUMA 3MKRA 2UY1A 2CHWA 3EHRA 1X81A 4JEHA 1YYHA 4F3VA 5CERB 4R7LA 3FTUA 1LF8A 2IY0C 4O6FA 4EZLA 4HRMB 3APFA 2I6HA 3G2SA 2XGOA 4IULA 4I6JA 3NZSA 3L6AA 2IF4A 3CEQA 3IEGA 4G2VA 2R05A 4EECA 3NZUA 1TNZA 4UQYA 4U0UA 3NBNB 3HXFA 4X8QA 3FDHA 4YDOA 2P9SG 3ULYA 1RW2A 4GTPA 3CHQA 2A4ZA 4KVOA 5C2YA 3X2QE 3CVYA 4YVQC 4MBGA 1HU3A 2X6KA 4HS2A
chains in the Genus database with same CATH topology
3Q7FA 1MZCA 1N94A 1QBQA 3E33A 3Q79A 1O1SA 1TNBA 4L9PA 3PZ3A 3HXCA 1TNOA 4GTVA 3E34A 1LTXA 4GTRA 4LNBA 2IEJA 1N9AA 1NI1A 4GTTA 3Q7AA 2BEDA 4EHMA 2H6FA 4GTOA 1O1TA 2H6GA 3DSTA 3PZ4A 3SFXA 2ZISA 2H6IA 1S63A 2F0YA 3DPYA 1TN8A 1O1RA 1S64A 3Q75A 3DSWA 1FT2A 1X81A 1KZPA 1JCSA 1TNUA 3DSXA 4GTSA 1NL4A 3E30A 3KSLA 3E32A 1N4PA 1N4QA 4LNGA 1TNYA 1N4SA 3HXEA 1SA5A 3C72A 3DSSA 1JCQA 1SA4A 3Q78A 4YDEA 3DRAA 1JCRA 1LD7A 4GTQA 2ZIRA 1TNZA 3E37A 3PZ1A 3EU5A 1FPPA 3KSQA 3HXFA 4GTMA 3HXBA 2H6HA 4YDOA 1D8EA 3DSVA 1LD8A 3HXDA 3EUVA 3Q73A 1DCEA 1D8DA 3SFYA 1FT1A 4GTPA 1O5MA 1TN6A 1KZOA 1N4RA 1TN7A 2R2LA 4MBGA 1N95A 3PZ2A 3DSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q7F A;  1MZC A;  1N94 A;  1QBQ A;  3E33 A;  3Q79 A;  1O1S A;  1TNB A;  4L9P A;  3PZ3 A;  3HXC A;  1TNO A;  4GTV A;  3E34 A;  1LTX A;  4GTR A;  4LNB A;  2IEJ A;  1N9A A;  1NI1 A;  4GTT A;  3Q7A A;  2BED A;  4EHM A;  2H6F A;  4GTO A;  1O1T A;  2H6G A;  3DST A;  3PZ4 A;  3SFX A;  2ZIS A;  2H6I A;  1S63 A;  2F0Y A;  3DPY A;  1TN8 A;  1O1R A;  1S64 A;  3Q75 A;  3DSW A;  1FT2 A;  1X81 A;  1KZP A;  1JCS A;  1TNU A;  3DSX A;  4GTS A;  1NL4 A;  3E30 A;  3KSL A;  3E32 A;  1N4P A;  1N4Q A;  4LNG A;  1TNY A;  1N4S A;  3HXE A;  1SA5 A;  3C72 A;  3DSS A;  1JCQ A;  1SA4 A;  3Q78 A;  4YDE A;  3DRA A;  1JCR A;  1LD7 A;  4GTQ A;  2ZIR A;  1TNZ A;  3E37 A;  3PZ1 A;  3EU5 A;  1FPP A;  3KSQ A;  3HXF A;  4GTM A;  3HXB A;  2H6H A;  4YDO A;  1D8E A;  3DSV A;  1LD8 A;  3HXD A;  3EUV A;  3Q73 A;  1DCE A;  1D8D A;  3SFY A;  1FT1 A;  4GTP A;  1O5M A;  1TN6 A;  1KZO A;  1N4R A;  1TN7 A;  2R2L A;  4MBG A;  1N95 A;  3PZ2 A;  3DSU A; 
#chains in the Genus database with same CATH topology
 5JHB A;  5BUZ A;  2XRZ A;  4JB8 P;  3V30 A;  3P1U A;  3ASD A;  3RRU A;  5KNH D;  5FZR A;  2GGF A;  5ANL A;  4GTT A;  2DWZ A;  2FBN A;  4ACK A;  2UY1 B;  2XPZ A;  3FUL A;  1UOH A;  3LEW A;  2BTD A;  3FTZ A;  2ZIS A;  4I2W A;  3ZGQ A;  4A55 A;  3L9T A;  2WMN A;  3DEP A;  1Q2Z A;  4TXP A;  5HRY A;  4A3T A;  4F53 A;  4DX7 D;  4DLQ A;  4AXH A;  4U7E B;  3ZHE B;  1N4Q A;  2J07 A;  2A5U A;  1N4S A;  4J0U A;  4OYS A;  1JCQ A;  2LXM A;  5A7D B;  5LX8 A;  3LXU X;  2R03 A;  4HNA D;  3ML8 A;  1K8K G;  3LJ3 A;  2XEV A;  2BF0 X;  3G2T A;  1SW6 A;  3CHO A;  4J8E A;  4DX5 D;  3T5V A;  1HF8 A;  4NAC A;  1BU9 A;  3HVE A;  1O5M A;  3T8K A;  1N4R A;  2XGS A;  1D9S A;  2M63 A;  5FZQ A;  5CMW A;  3ZYL A;  3DSU A;  4MS6 A;  5G05 J;  3CIA A;  2NYJ A;  4FP7 A;  2CHX A;  3E33 A;  3OAW A;  1TNB A;  3E34 A;  3TG4 A;  3UIP C;  3I3N A;  2KC7 A;  4JVS A;  3FTY A;  1N9A A;  5G05 C;  5ARF A;  4Q94 A;  4F7A A;  5KJN A;  1OCO E;  3SHF A;  4KMO A;  4C0M A;  1H6O A;  3ZXS A;  3VLE A;  2XEE A;  1OCR E;  5M72 A;  2UWJ G;  4B94 A;  1NL4 A;  1OUV A;  3IXE A;  3SBT B;  4PH4 B;  5HS0 A;  2NC9 A;  1BI8 B;  4HI9 A;  5FQ8 A;  4BY6 A;  2EIM E;  2FEZ A;  2JEK A;  3TWV A;  4J7W A;  2WXQ A;  4YDE A;  1BI7 B;  4BTB A;  4EQF A;  2FUL A;  2CG2 A;  1LD7 A;  2X6H A;  3TAX A;  2XCC A;  4ATZ D;  3PNT B;  3TG5 A;  4GTM A;  3HXB A;  2QFC A;  3Q73 A;  4U0S A;  3CK8 A;  3EHM A;  4NQ0 A;  3SGH A;  2WXK A;  4BFR A;  1FT1 A;  3D9L A;  1DC2 A;  4GZ5 A;  3LDZ A;  3NQP A;  4K0R A;  2E2E A;  5FZS A;  5FWQ A;  5BW8 C;  1OCC E;  3UIN C;  3CKC A;  4UI9 C;  3D9J A;  1NFI E;  4WWN A;  2ZGG A;  1E8Z A;  2FI7 A;  1WM5 A;  4XE0 A;  3UPV A;  2GRR B;  4UI9 J;  4GTO A;  2L0I A;  4ILG A;  4DUI A;  2BKG A;  4FLB A;  5EYL A;  1GW6 A;  1ZBP A;  5H7P A;  1K1A A;  5AEN A;  3L54 A;  5ENN A;  3DPY A;  2FO1 E;  3ML9 A;  4ANX A;  3G2W A;  3MV2 B;  1TN8 A;  2NXP A;  1KZP A;  4CZ2 D;  3FUJ A;  4DLO A;  2YHE A;  4J8S A;  3TXN A;  3S2A A;  1PC2 A;  3E30 A;  4WWO A;  3LVQ E;  3UI2 A;  1DNP A;  3NAW A;  4JC8 A;  1SA5 A;  2DZO A;  3N71 A;  2P9N G;  4XKB A;  1MHQ A;  3ZNG A;  2GRQ B;  3LY7 A;  2X3M A;  3E4B A;  3TXM A;  3ASG A;  2FF4 A;  3JUE A;  3ZRH A;  4BSX A;  4APF A;  5IY5 E;  4L2L A;  1ZB1 A;  1H2U A;  2KCL A;  3C3O A;  3CHP A;  4BX9 A;  4CCA A;  2XEN A;  2AXV A;  3DXM G;  4PS8 A;  5BXU A;  3MCX A;  4M3O A;  3I5P A;  1QBQ A;  2Y3A A;  1JUQ A;  1Z5S C;  3L08 A;  3S7F A;  3SQV A;  4ME2 A;  5G04 J;  3EIJ A;  3MKQ B;  3OTN A;  4GTV A;  4FC8 A;  1TNO A;  2X6J A;  1PAQ A;  2J8S D;  4EHM A;  3ISM C;  4K5B A;  4URK A;  1AWC B;  3JXI A;  4E85 A;  3RU0 A;  3PZ4 A;  3MV3 B;  3FUM A;  4U8V D;  4WAF A;  3FTS A;  4PUC A;  2WXL A;  2V8S E;  4JHJ A;  2HR2 A;  2X6F A;  2Q7F A;  4F1S A;  4JXT A;  5BPP A;  3R7Q A;  1OXJ A;  5AQ9 A;  1KT1 A;  3D9K A;  4NRH B;  3S7J A;  2LSU A;  3P2B A;  3I4R B;  2KXP C;  3ASN E;  4GAA A;  2GRO B;  3ZIM A;  4FJZ A;  4GTQ A;  3IHY A;  2ZIR A;  2GRL A;  1QZ2 A;  3MKQ A;  3E37 A;  2EIN E;  3Q5M A;  3HXD A;  3O4Z A;  3B7S A;  1N11 A;  3EIQ C;  5LOZ A;  4CYM D;  5KWD A;  1G3N B;  2WXF A;  4Y6C A;  2J09 A;  4L2Y A;  5FQ4 A;  4AY5 A;  3PDN A;  4TRQ A;  1WDY A;  4FHJ A;  4LSZ E;  1RZ4 A;  2WXM A;  1OWP A;  5BV1 A;  1H0A A;  2V0P A;  3FP3 A;  1Y6I A;  1HG2 A;  2B0O E;  5E76 A;  4GTR A;  2IEJ A;  1MJ0 A;  5EIB E;  4FU3 A;  3W9F A;  3PS6 A;  2QC9 A;  4DI3 A;  5DIZ A;  4N3B A;  2H6G A;  5AIJ A;  2F0Y A;  3PH0 C;  5CRU A;  4I17 A;  4QQI A;  4KBQ A;  5D2M C;  1S64 A;  5EN5 D;  4CT4 A;  2GRN B;  5J08 A;  4G25 A;  5ENQ D;  4BSZ B;  1QYM A;  2HM8 A;  3FY4 A;  3E32 A;  5FT9 A;  1N4P A;  1IHB A;  1UW4 B;  1IHG A;  2HYZ A;  3DPD A;  5ENR D;  2XQ0 A;  3ZN3 A;  1EF1 C;  3SF4 A;  4DRX E;  3V31 A;  1JCR A;  4LER A;  3GW4 A;  2MHK A;  3EHN A;  3RRM B;  3HIZ A;  3S7B A;  2C0L A;  5EIL A;  4WNE A;  3PZ1 A;  3IV0 A;  4XIF A;  5EDS A;  2XPI A;  2BKK B;  1KLX A;  3RSE G;  3D9M A;  2PM7 A;  5KJK A;  2V5F A;  3SFZ A;  2WQH A;  4I9E A;  4JHR A;  4RG6 A;  2KCV A;  3ASO E;  4GA2 A;  4I1M A;  4G8K A;  5CEA A;  2OV8 A;  3ASH A;  2HO1 A;  1WY6 A;  4UUC A;  4OAV B;  3UXG A;  5JJ7 A;  3CVL A;  4CDN A;  3ZKJ A;  2LSV A;  1MZC A;  2VSN A;  2KCK A;  1SVX A;  5EX3 A;  3S7D A;  2I1J A;  3AAA C;  3TGO A;  1LTX A;  1TJF A;  3U66 A;  2CHZ A;  2H6F A;  3VLD A;  3UTM A;  4BTA A;  3JQ0 A;  3QKY A;  4JHK A;  4N5C A;  2J08 A;  1ELW A;  4H7X A;  4I1A A;  1MX2 A;  3BQO A;  5CRV A;  4Q96 A;  2WPV A;  4AIF A;  1V54 E;  3D9O A;  2VGX B;  2KZT A;  4HFG A;  4A1S A;  4N3A A;  3UM1 A;  4J8Y A;  1Y8M A;  2VGY A;  4GZ6 A;  3CVP A;  1FVH A;  4DX1 A;  3FUN A;  1FVF A;  1OWN A;  2QYJ A;  5EKQ D;  3Q78 A;  4HLE A;  3LCA A;  4AY6 A;  4JW1 A;  3QOU A;  3PUJ A;  3QWW A;  1Z3Y A;  3CR3 A;  3CLJ A;  4XX5 A;  3LYA A;  4GZC A;  5ITZ F;  1LD8 A;  1D8D A;  5JJ6 A;  4EBA A;  3TWU A;  4HRL A;  4MLP A;  4U95 D;  4OVV A;  3T8M A;  1HXI A;  3ZPJ A;  3UT8 A;  3L16 A;  2VTB B;  2ETA A;  4GMR A;  3FH7 A;  3CVQ A;  2L6J A;  2KZT B;  3FUD A;  3Q7F A;  3URZ A;  1E7V A;  3MEK A;  2V4H C;  4BER A;  4LG6 A;  4XI0 A;  5ENO D;  3HHM A;  2OCC E;  3LJN A;  3JXJ A;  3NF1 A;  4AV7 A;  2OOE A;  3PZ3 A;  2AXU A;  4B93 B;  1X5B A;  3LY9 A;  3ZYK A;  1SZ9 A;  3Q7A A;  4I1O B;  4KT6 B;  5B1B E;  3G2U A;  2OND A;  1S63 A;  3PE3 A;  1V55 E;  4J8D A;  1IKN D;  3ASF A;  4A63 B;  1BD8 A;  1YCS B;  2C0M A;  2JAB A;  2Y1L E;  4BX8 A;  5B3S E;  1A5E A;  5AYW D;  4GYW A;  3ZFW A;  3MJW A;  2IJG X;  3BG1 B;  1MX6 A;  3HXE A;  5E75 A;  4UWF A;  3ONL A;  4PDX A;  2KBX A;  2VGX A;  2RFM A;  3IKO B;  5FTP A;  2R5S A;  1KT0 A;  3EDT B;  2RKK A;  5T4Y A;  4U8H A;  4GZ3 A;  3QB2 A;  4CGV A;  3SNX A;  1MYO A;  2R02 A;  3ZVV A;  4G8L A;  3EUV A;  3JQ1 A;  2VTB A;  3FU6 A;  3RO3 A;  3FFL A;  1IXV A;  3DXK G;  4IYP A;  3BG0 B;  4GYO A;  5LCW J;  4WWP A;  1NA0 A;  4V3I A;  1BPO A;  4DPR A;  3B7R L;  3IBE A;  1EPU A;  4L9P A;  3HXC A;  1N52 A;  3CV0 A;  3U64 A;  1TYQ G;  1ELR A;  3QNK A;  4YND A;  1N0R A;  2VSO E;  4UWK A;  3ABK E;  3UIO C;  3HG0 D;  2JLB A;  5CBN A;  3ULE G;  4O60 A;  3SBS A;  4I6E A;  4GML A;  3FU3 A;  4I6G A;  4U8Y D;  4WNG A;  4AJW A;  1FT2 A;  1TNU A;  2C2L A;  3U4T A;  4AM9 A;  2XS8 A;  4HOU A;  4N2Q A;  2DBA A;  5JMN D;  3Q9N C;  4LRZ A;  3U3W A;  4HOR A;  1L5J A;  3TWQ A;  3PZD A;  3FUF A;  3Q47 B;  3T5X A;  4ATG A;  3EU5 A;  4F1P A;  2WXI A;  4GA1 A;  4I2Z A;  4HOS A;  5HI7 A;  3C3Q A;  4RLY A;  3TWS A;  2R17 C;  3V79 K;  3R7R A;  3B7T A;  2PNN A;  4FJY A;  1UN9 A;  4LEU A;  1UJJ A;  5FIO A;  2VYI A;  1WG0 A;  3HVE B;  4BES A;  5AJL A;  2AJA A;  5EYP F;  3AJI A;  4GPM A;  5EX0 A;  2XS1 A;  3RRN B;  3LY8 A;  2I9C A;  4AOF A;  5CEC B;  3DEO A;  4Y6W A;  3EJN A;  1NI1 A;  2VSX E;  2P58 C;  4RVB A;  5ENS D;  3DST A;  3D9P A;  5JA4 D;  2PL2 A;  3ESK A;  3CVX A;  4JA9 A;  2LXL A;  3TL5 A;  1YMP A;  4K5C A;  5AJD A;  5D66 A;  1IQR A;  2R59 A;  3CVW A;  3WG7 E;  2XZT G;  3R9M A;  4EPZ A;  2WXP A;  4JEU A;  4OAU C;  2WXG A;  3ONK A;  1U2V G;  1OT8 A;  4HB5 A;  1EYH A;  2RG8 A;  4BT9 A;  4U04 A;  4HLL A;  2WXO A;  3UM0 A;  3D9I A;  3HRA A;  2Y0B G;  3B95 A;  5ANR A;  3EHQ A;  3OXG A;  2DVW A;  3APC A;  3KD7 A;  2H6H A;  4EZK A;  4EZJ A;  3QAR A;  3FUK A;  1P5Q A;  2ION A;  4FHK A;  4L7T A;  3QDN A;  3LKU A;  3KS2 A;  3V2X A;  2E0I A;  4YDY A;  3CQC B;  2WB2 A;  3FU0 A;  4DK5 A;  2I2O A;  2KAT A;  1XNF A;  1NZN A;  4M7C A;  3R9A B;  4ABN A;  3FEX A;  3APD A;  1HO8 A;  3FTX A;  3AG2 E;  4RSY A;  2FO7 A;  2PM6 A;  4E6H A;  3ZXP A;  4ZHB A;  5BV0 A;  1E8Y A;  2AW6 A;  2RD0 A;  4JD2 G;  2V5Q C;  3KEA A;  1OWM A;  1TEZ A;  3UUX A;  3FTW A;  5C1D A;  3DSW A;  4G11 A;  4MRU A;  3UQ3 A;  3Q9U C;  3PVL A;  5CBO A;  4B8C B;  2IOL A;  2EQX A;  4LNG A;  2KM4 A;  4ZFH A;  4KVM A;  4CDM A;  4G24 A;  4GU5 A;  2XRY A;  3PRZ A;  3FUE A;  3CHS A;  3ZUV B;  3DRA A;  2L0T B;  1TR4 A;  1W3B A;  1H6K A;  3AS5 A;  4JA7 A;  3MGB A;  3UM2 A;  1MX4 A;  3VTX A;  2PQR A;  5G55 A;  3I4G A;  5G04 C;  5AAR A;  2GW1 A;  2P9I G;  3RK6 A;  2CFZ A;  5FJY A;  2MOW A;  3ZW3 A;  2X6I A;  1S0P A;  1IYG A;  3ENE A;  4OVU A;  3DBS A;  4B89 A;  3SZ7 A;  4L23 A;  3PZ2 A;  5B1A E;  5J90 A;  4CEM A;  3HYM B;  2VSY A;  4WUY A;  2IO3 C;  3GZ1 A;  3RKV A;  2WQ6 A;  3PUK A;  3CGH A;  3TWR A;  3ULQ A;  2V4L A;  3PEV B;  3CHM A;  5AQ7 A;  3NOG D;  3VLF A;  1N54 A;  4RQI A;  4AVX A;  3FH8 A;  5LP0 A;  2H6I A;  3LPZ A;  1XGW A;  2P9K G;  3GYZ A;  4UQX A;  4ILH B;  2MRI A;  3FTV A;  1U3D A;  5T8I A;  5BT1 A;  3ABM E;  4UWL A;  3SY2 A;  5DBK A;  4TXQ A;  5BXO A;  4WND A;  1E7U A;  2L9B A;  3LS8 A;  2DYR E;  1SA4 A;  3TWW A;  3PNL B;  2LUH A;  4KXK B;  4P29 A;  2DIW A;  1E8W A;  3CVV A;  1JWG A;  1EDU A;  4LCT A;  4APO A;  3CK9 A;  4PS3 A;  5KCM A;  4ACL A;  3KSQ A;  4TUU A;  4JZY A;  3D9H A;  1S70 B;  3RIB A;  3SFY A;  3LVR E;  2PQN A;  4U96 D;  3MX3 A;  1TN6 A;  4J8F A;  2XEH A;  4HRN A;  3GZ2 A;  4J6I A;  4YVO A;  2R2L A;  3ZEF A;  1OWO A;  1IQU A;  3KEZ A;  1ELK A;  1N95 A;  1HG5 A;  3CSF A;  1ZU2 A;  4HXI A;  4GYY A;  3D3M A;  1UN8 A;  3OXF A;  1E96 B;  4FUL A;  5KBA A;  3D9N A;  4LUN U;  2NSZ A;  5FQ7 A;  5KNG A;  2ZGD A;  1DVP A;  4UWH A;  4CDR A;  5FIN A;  3MYV A;  4I9C A;  3CK7 A;  1VDY A;  2P9P G;  4N3C A;  3UT7 A;  4ANU A;  3CQG B;  4HVB A;  2MYO A;  3BEE A;  4BEP A;  1JCS A;  3UX4 A;  4RG9 A;  3L17 A;  3DWL G;  2I1K A;  2EIJ E;  3B7U X;  2YNQ A;  4O1O A;  2WXH A;  3SI5 A;  3W9G A;  3DSS A;  2GRP B;  1E90 A;  2A5E A;  3AU5 A;  3JCK C;  2B6C A;  4HOQ A;  5EID A;  3PRE A;  4JPS A;  3QWV A;  3NOC D;  4IN3 B;  2P2C P;  4FLH A;  1FPP A;  2YIN A;  3K9I A;  3C3R A;  3L82 A;  2ZU6 B;  3VTY A;  4DX6 D;  1KZO A;  2WM9 A;  2IQC A;  2OEW A;  2ETB A;  4YDW A;  3U9W A;  4XI9 A;  3NB2 A;  3C98 A;  5JHA A;  3SO8 A;  4HI8 A;  3GZS A;  4U63 A;  3FWV A;  4C0E A;  3CST A;  3FUH A;  4IRU A;  4LNB A;  1JWF A;  3ZYM A;  2ILR A;  4EBA G;  3ZYQ A;  4KYO B;  3ZU7 B;  1HFA A;  2OEV A;  5CED B;  3QK0 A;  2J9Q A;  2AWI A;  2WXN A;  2X38 A;  1NA3 A;  2QZA A;  4N39 A;  3KAE A;  4GA0 A;  4AP2 A;  5D0O D;  4XEI G;  3G2V A;  3TWT A;  1FCH A;  2ETC A;  4U0Z A;  1OY3 D;  4K5A B;  3AS8 A;  1KPS B;  1H6P A;  1TJC A;  2AVP A;  2WMO A;  1H19 A;  3RO2 A;  4BT8 A;  4XZ4 A;  5AN8 A;  2F8Y A;  4G1T A;  2P9L G;  5T3R A;  2BUG A;  1E8X A;  5CCM A;  5CHE E;  4KZC A;  5ARG A;  4AEZ C;  1HS6 A;  3CKB A;  3Q15 A;  4BWR A;  2WXR A;  5JJT A;  4G26 A;  3Q4A B;  4ILI A;  3QC1 A;  2YHC A;  1HE8 A;  3CVN A;  3T9K A;  3SD5 A;  4H7Y A;  1QQE A;  1AP7 A;  1BLX B;  4CGW A;  1INZ A;  5LFA A;  4XKC A;  1UJK A;  2LAI A;  3AG3 E;  1Z6T A;  4DX2 A;  1K1B A;  3AU4 A;  3JUI A;  2RFA A;  3Q79 A;  3CHR A;  1HZ4 A;  4F6R D;  5FQ6 A;  3UKR G;  3B7B A;  1B89 A;  4GMJ A;  2BED A;  2QYU A;  3IHV A;  1H2V C;  1YA0 A;  3ABL E;  3C5R A;  2L6B A;  3AS4 A;  2WVI A;  3Q75 A;  2PZI A;  4GCN A;  4NIK A;  3QJZ A;  3RAU A;  3KSL A;  4JL0 A;  4W9R A;  3L13 A;  4GPK A;  4NUR A;  3TWX A;  3CVU A;  1TNY A;  1H2T C;  4A3V A;  4TV3 A;  2EIK E;  1DCQ A;  1NP7 A;  3C72 A;  1U3C A;  3J5Q B;  5KJL A;  4GB9 A;  4C9B B;  2XPY A;  3BU8 A;  3UKU G;  4D10 C;  4I43 A;  3MA5 A;  1N0Q A;  2F37 A;  3O48 A;  2IFU A;  2P9U G;  2YQ8 A;  4O1P A;  5HKP A;  2VGE A;  3AG1 E;  3B13 A;  3UMV A;  3UT4 A;  3WXX A;  2HE0 A;  1OWL A;  1JPL A;  3Q49 B;  4Z68 A;  4U07 A;  3QAQ A;  2LNI A;  3QWP A;  4UWG A;  4HQD A;  1N94 A;  3ZHE A;  5AQB A;  5CCL A;  2EIL E;  3HDX A;  3FUI A;  3UM3 A;  4MKT A;  1O1S A;  4C48 B;  3AG4 E;  4B0Z A;  4FAD A;  2XGM A;  2ZXW E;  4CRW A;  2OVF A;  1O1T A;  2IU1 A;  1HX8 A;  4B8A A;  2VQ2 A;  2J4B A;  4A1G A;  5BNW A;  2CG3 A;  2IOS A;  1O1R A;  2QY7 A;  1A17 A;  3FU5 A;  5ENP D;  2VJ8 A;  3J5P A;  3DSX A;  3FEY A;  4GTS A;  2LO6 A;  4UQZ A;  4N2S A;  3EU9 A;  1PY1 A;  4HOT A;  5AQA A;  3RJV A;  1HH8 A;  5ENT D;  3PE4 A;  3JYS A;  4L1B A;  1SZA A;  2XCB A;  4TXR A;  4PS7 A;  2J49 A;  1K3Z D;  2WQ7 A;  5AAO A;  2Y4T A;  2LAH A;  5A23 A;  4G23 A;  5A6C A;  3PEU B;  2CFU A;  3V2O A;  5KJM A;  5CMY A;  2J4D A;  2GRM A;  4CT0 A;  4Q69 A;  5G2N A;  4LNU D;  4GZD A;  4DJA A;  5LCW C;  3F6Q A;  1D8E A;  3DSV A;  4QFV A;  4FA6 A;  1DCE A;  2IO2 C;  4ANV A;  1QNF A;  3L22 A;  2AXZ A;  4GCO A;  1SQM A;  2F8X K;  3TJP A;  3MZL B;  2DZN A;  5HQ8 A;  4KZ0 A;  4HBD A;  4BET A;  5D0Q D;  1TN7 A;  4UI9 K;  2OVB A;  1Z3X A;  2DYS E;  1UG3 A;  4K03 A;  1MQS A;  3BUA A;  4ANW A;  2XHE A;  2XZD G;  2Y4U A;  3ESL A;  3FHE A;  1OCZ E;  3OXL A;  3FH5 A;  4DI4 A;  2WXJ A;  2Y69 E;  1WAO 1;  4WNF A;  4N5Q A;  3SFX A;  2DCP A;  4TUM A;  3MKR A;  2UY1 A;  2CHW A;  3EHR A;  1X81 A;  4JEH A;  1YYH A;  4F3V A;  5CER B;  4R7L A;  3FTU A;  1LF8 A;  2IY0 C;  4O6F A;  4EZL A;  4HRM B;  3APF A;  2I6H A;  3G2S A;  2XGO A;  4IUL A;  4I6J A;  3NZS A;  3L6A A;  2IF4 A;  3CEQ A;  3IEG A;  4G2V A;  2R05 A;  4EEC A;  3NZU A;  1TNZ A;  4UQY A;  4U0U A;  3NBN B;  3HXF A;  4X8Q A;  3FDH A;  4YDO A;  2P9S G;  3ULY A;  1RW2 A;  4GTP A;  3CHQ A;  2A4Z A;  4KVO A;  5C2Y A;  3X2Q E;  3CVY A;  4YVQ C;  4MBG A;  1HU3 A;  2X6K A;  4HS2 A; 
#chains in the Genus database with same CATH homology
 3Q7F A;  1MZC A;  1N94 A;  1QBQ A;  3E33 A;  3Q79 A;  1O1S A;  1TNB A;  4L9P A;  3PZ3 A;  3HXC A;  1TNO A;  4GTV A;  3E34 A;  1LTX A;  4GTR A;  4LNB A;  2IEJ A;  1N9A A;  1NI1 A;  4GTT A;  3Q7A A;  2BED A;  4EHM A;  2H6F A;  4GTO A;  1O1T A;  2H6G A;  3DST A;  3PZ4 A;  3SFX A;  2ZIS A;  2H6I A;  1S63 A;  2F0Y A;  3DPY A;  1TN8 A;  1O1R A;  1S64 A;  3Q75 A;  3DSW A;  1FT2 A;  1X81 A;  1KZP A;  1JCS A;  1TNU A;  3DSX A;  4GTS A;  1NL4 A;  3E30 A;  3KSL A;  3E32 A;  1N4P A;  1N4Q A;  4LNG A;  1TNY A;  1N4S A;  3HXE A;  1SA5 A;  3C72 A;  3DSS A;  1JCQ A;  1SA4 A;  3Q78 A;  4YDE A;  3DRA A;  1JCR A;  1LD7 A;  4GTQ A;  2ZIR A;  1TNZ A;  3E37 A;  3PZ1 A;  3EU5 A;  1FPP A;  3KSQ A;  3HXF A;  4GTM A;  3HXB A;  2H6H A;  4YDO A;  1D8E A;  3DSV A;  1LD8 A;  3HXD A;  3EUV A;  3Q73 A;  1DCE A;  1D8D A;  3SFY A;  1FT1 A;  4GTP A;  1O5M A;  1TN6 A;  1KZO A;  1N4R A;  1TN7 A;  2R2L A;  4MBG A;  1N95 A;  3PZ2 A;  3DSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...