3Q73A

Cryptococcus neoformans protein farnesyltransferase, apo enzyme
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
330
structure length
316
Chain Sequence
b'TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSDPLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase, alpha subunit
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase
total genus 127
structure length 316
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q73A00
1MZCA 1S64A 1S63A 1TNOA 3HXCA 3DSSA 4L9PA 1N4SA 3HXBA 3KSLA 3E32A 1LTXA 2H6GA 1N95A 3Q7AA 1D8EA 2ZISA 3PZ4A 3Q75A 1TNYA 3DPYA 1SA4A 2IEJA 2H6HA 3PZ3A 3SFXA 1SA5A 4GTQA 3C72A 3HXFA 1TNZA 4GTTA 1TN8A 1NI1A 1TNUA 1X81A 2BEDA 3DSUA 2ZIRA 1QBQA 4YDOA 1LD8A 1TN6A 2H6FA 1FT2A 2F0YA 1D8DA 1FPPA 4GTSA 3PZ1A 3DSXA 4LNGA 3HXEA 4YDEA 3KSQA 3PZ2A 1N94A 1N4PA 4GTPA 1O5MA 1KZOA 3E30A 1NL4A 3E34A 1TNBA 3DRAA 1JCQA 3Q79A 1KZPA 1O1TA 4LNBA 3Q78A 3E37A 3DSVA 1TN7A 1LD7A 1O1RA 3Q73A 3E33A 3EUVA 2R2LA 1N4QA 1N9AA 1JCSA 3EU5A 3HXDA 1DCEA 3DSTA 3SFYA 4GTVA 4GTMA 1JCRA 4EHMA 4GTRA 3Q7FA 3DSWA 1N4RA 4GTOA 2H6IA 4MBGA 1FT1A 1O1SA
chains in the Genus database with same CATH superfamily
2RD0A 2FF4A 2DZOA 5ARFA 2GROB 3RRMB 2C2LA 4B89A 3EU9A 5HI7A 1MX2A 4XX5A 1XGWA 3T5VA 4KZCA 2UWJG 3ASOE 3SNXA 2I2OA 5AJDA 3CVXA 3I4GA 1JWFA 2OVBA 5CCLA 3ZEFA 1H0AA 2WXRA 3FHEA 5ENSD 4DK5A 3ZKJA 3ULEG 4XEIG 1AP7A 4LG6A 2E2EA 3U66A 2BKKB 3FUFA 1D8DA 4GTSA 2IU1A 2AVPA 2LO6A 3FDHA 3SGHA 3LY9A 5ENOD 2E0IA 4CYMD 3KSQA 2ZU6B 4JL0A 1WAO1 2WMNA 4FULA 1KZOA 3E30A 3OXFA 3W9GA 2NXPA 3QNKA 3ZFWA 1E8XA 3ESKA 3QB2A 4U8VD 4A1GA 4UI9C 5T3RA 2AW6A 3C5RA 3D9LA 2R59A 3S7BA 2GRRB 3UM3A 4EECA 4HFGA 3LKUA 1DNPA 3UINC 4Q69A 3D9HA 4AV7A 2X6HA 3CVVA 4DI3A 4DX2A 4PS8A 4OVVA 3HXFA 2P9IG 1NI1A 3MX3A 4CDNA 1D9SA 1HG5A 2BTDA 2CHWA 2OEVA 3NAWA 4HXIA 5BV1A 3FULA 3WXXA 3D9NA 4TUMA 4BWRA 1N0QA 1Z3XA 4ACKA 3ZRHA 4BFRA 4J8FA 2VTBB 3DEPA 3QJZA 4K5AB 4FU3A 3FEYA 3QDNA 1TNBA 3HHMA 3DRAA 4J0UA 3CVNA 3N71A 4PH4B 3PEVB 3L08A 3R9AB 4U8YD 4U96D 3FTWA 3Q73A 3OTNA 3GW4A 1E8ZA 4ATZD 4TXPA 1INZA 3V2XA 1G3NB 2PZIA 5BXOA 2KATA 3ABLE 2FO1E 2L6JA 4FLHA 3D9JA 4KMOA 3KAEA 2WXQA 1EYHA 3BU8A 4DPRA 3B7SA 3DEOA 1UJKA 4GYWA 2GRLA 4FLBA 5EX3A 5D0OD 4B8CB 1TNOA 4HORA 3L6AA 4W9RA 4G2VA 1Z3YA 1N11A 4FC8A 1LTXA 1ZB1A 2J8SD 3SF4A 2P2CP 3MV2B 5J90A 2H6HA 3AJIA 2PQNA 4RLYA 1H2TC 2QY7A 4BTBA 2BEDA 2ZIRA 4APOA 4IULA 5BW8C 4YDOA 3SHFA 4F3VA 3DWLG 3TWXA 2MOWA 3G2TA 2B6CA 2GRMA 3G2WA 4BETA 4ME2A 3JQ0A 1Y6IA 3PNLB 2VGXA 3PZ1A 3T5XA 4UWFA 2DYSE 4ANVA 2XEHA 2EIJE 3LVRE 5AIJA 3NOGD 2AXUA 3CSTA 3AAAC 2V5QC 4EZJA 1N4PA 4O1OA 3AS4A 1OWMA 4B94A 4CGWA 1KZPA 1SVXA 4LNBA 3Q9UC 1U3DA 5FZQA 2Y1LE 1ZBPA 5JMND 3ASFA 3EUVA 1SQMA 5CMWA 4G8LA 1JCSA 3EU5A 5FQ8A 5CERB 1IYGA 4GMJA 3D9OA 4GA0A 3D9IA 2FBNA 2GRQB 2HM8A 5CRVA 4L2YA 5FQ4A 1ELRA 3B7RL 3PS6A 4ZFHA 4BT8A 3MYVA 4WUYA 2XZDG 1H6PA 3CK9A 4U0UA 3B7TA 2ILRA 4BESA 2J49A 3PZ4A 4ILGA 4XI9A 1TNYA 3PZ3A 3JCKC 1SA5A 2UY1B 1JWGA 4Z68A 1X81A 2GW1A 3TWVA 4DX7D 2B0OE 3TGOA 5ENNA 1LD8A 3VLFA 2KXPC 4TXQA 3TWQA 5JHBA 4N3BA 2AXZA 1UW4B 3ZXSA 2CG2A 3HXEA 4UI9J 1JPLA 1IQRA 2QYJA 4ACLA 2VSOE 3IEGA 3BQOA 2A4ZA 4AXHA 3V30A 1VDYA 3V79K 5AYWD 4GZ5A 3MKQA 1DC2A 4I2ZA 5EYLA 3ZVVA 4A3TA 1A5EA 3Q78A 4RG9A 4UI9K 5LX8A 3JQ1A 5LFAA 3TG5A 1DCEA 5JJ7A 2WQ7A 3SBTB 4OAUC 4WNDA 3L13A 4ANWA 2XCBA 1QZ2A 3CGHA 1MZCA 2ETCA 4Q94A 3KEZA 1S64A 4K0RA 4N39A 4DI4A 4QFVA 3KEAA 2F8YA 3U4TA 1Z6TA 4JEUA 4YVQC 3B95A 4L1BA 1D8EA 3P2BA 4GYOA 4FJYA 3APCA 1H6OA 2KZTA 1HU3A 4L23A 3ASGA 1MJ0A 2PNNA 3DSXA 2P9KG 3UQ3A 1MYOA 1EDUA 1PC2A 1L5JA 5LP0A 1HFAA 3ESLA 2RFMA 3BG1B 1MX4A 2PL2A 5JJTA 2FULA 2R02A 4JW1A 3UM2A 2R17C 2I1JA 4F53A 4I1MA 4G11A 5A7DB 3CVUA 5G04C 3ZIMA 5HS0A 3ZN3A 3MEKA 4J8EA 3T8KA 3BEEA 4UWLA 4GCNA 3BG0B 4I6JA 2LXLA 1OWPA 3I5PA 4C0MA 3UM1A 5A23A 3ZU7B 4MBGA 1OCCE 3CHMA 1OWLA 4JHKA 3B13A 1H2VC 2QFCA 4A63B 2OOEA 3FU5A 1BU9A 4I17A 2GGFA 2WXJA 3RK6A 2EILE 3LXUX 4GZCA 4XI0A 3FU3A 3JUIA 1TR4A 2Q7FA 1TNUA 1OT8A 3F6QA 3FUHA 4CRWA 4CDRA 5KNHD 3QOUA 3PNTB 1KPSB 2EIKE 3TXNA 3FH8A 4C0EA 4XIFA 3D3MA 4I1OB 1E90A 5ENQD 4LNGA 3UI2A 1S70B 3CR3A 3QWVA 3EIJA 3APFA 3LYAA 3UPVA 4BX9A 2R5SA 2XQ0A 3FTZA 1E7VA 3ZXPA 4NQ0A 3QK0A 2NSZA 3CVWA 1N4QA 2PM6A 3MGBA 3IHYA 2VYIA 3HXDA 5B1BE 3LJ3A 4UWHA 3U9WA 4HBDA 3LPZA 2BF0X 2EQXA 3HDXA 4GTRA 1MX6A 4HNAD 4BSZB 5FTPA 1MHQA 2Y69E 2P9NG 4N5QA 4HOTA 4PDXA 1IHGA 3JUEA 3E32A 5FT9A 4JEHA 4ANUA 2L9BA 4LNUD 3D9PA 4YNDA 3ZHEB 4JXTA 3DXKG 5ITZF 1SZAA 2I9CA 4WNFA 3EDTB 5BUZA 3ZYQA 4YDWA 4PS3A 3TWWA 4KYOB 4HB5A 5LCWJ 3DPDA 2XRZA 5EDSA 2VSNA 2RG8A 3AS8A 4B8AA 1N94A 3LS8A 3TWSA 1NL4A 4E6HA 3CEQA 2MRIA 2WQ6A 3ZYMA 4GZDA 3CK7A 2IO2C 3JXJA 5KJMA 2KCVA 5LOZA 1O1TA 3URZA 1OUVA 3IBEA 2AJAA 3SBSA 3L22A 3ML9A 4ILIA 1BI8B 2A5UA 3RU0A 4I6EA 2IO3C 1H6KA 5EIDA 4NACA 3P1UA 4HRNA 4CT0A 1UG3A 3UXGA 3DSWA 2VGEA 1O1SA 1BD8A 5EN5D 2FO7A 4OAVB 1K1AA 2DBAA 4A55A 3DBSA 3Q9NC 4EBAA 1E8WA 1S0PA 4FJZA 5KNGA 3QWWA 3C3QA 4JA7A 4XE0A 4C9BB 3JYSA 3SO8A 1H2UA 2IFUA 2QZAA 4GA2A 4YDYA 3SD5A 5AQ9A 1UOHA 1QBQA 3FTUA 3RSEG 5G04J 5IY5E 5BPPA 1FT2A 2ONDA 5ENPD 2XCCA 4AY5A 1N54A 1NFIE 4CEMA 4RSYA 3HG0D 2VJ8A 5ENRD 5G55A 3IHVA 1O5MA 5CBNA 4H7YA 2KBXA 1YA0A 2Y3AA 3CLJA 3CVYA 3QAQA 3Q79A 4U7EB 2KCKA 3L16A 4JA9A 3IKOB 4TUUA 4BX8A 1LD7A 5D2MC 1WY6A 2ETBA 3AG4E 1BPOA 2VTBA 4U04A 1NA3A 1K1BA 4WAFA 2VGYA 3UKUG 1FT1A 3MV3B 5AAOA 2XEVA 4A1SA 2ETAA 2HO1A 4J8SA 1PAQA 3PUJA 3ONLA 3Q4AB 1WG0A 1HG2A 3ZUVB 4MS6A 4M3OA 3ISMC 3MKQB 1HH8A 3K9IA 3U3WA 4G1TA 4URKA 2WXHA 3PZDA 2RKKA 4K03A 2IONA 4PS7A 3HVEB 3EHRA 3ML8A 4U0SA 1AWCB 4GCOA 3NQPA 3S2AA 4L7TA 2CG3A 4X8QA 3S7JA 3CVQA 2I1KA 2KCLA 3L9TA 4TRQA 1NA0A 2V4LA 1HXIA 3CK8A 5G05C 2LAIA 1LF8A 5D0QD 3UUXA 5T4YA 3CVLA 4YDEA 2X6JA 3UIOC 4UQXA 3PZ2A 4AJWA 3ULYA 5ARGA 5KBAA 1Q2ZA 5JHAA 2XRYA 5CEDB 1HX8A 2KM4A 2AWIA 4HI9A 3CHQA 2HR2A 1H19A 1P5QA 3TG4A 3W9FA 5FJYA 3CHPA 1TJCA 4IN3B 4PUCA 3FUNA 3EHQA 4B93B 2BUGA 4HRLA 3E37A 2X6FA 5AENA 2WXPA 4K5CA 3UTMA 3UIPC 3FTVA 2RFAA 2P58C 3PDNA 2I6HA 2M63A 3ZYKA 3HIZA 3ONKA 3LCAA 5DBKA 4GA1A 2C0MA 5AQAA 4LEUA 4LUNU 3ZGQA 3GZ2A 5FZRA 1FVFA 2P9PG 4U07A 3PREA 3RO2A 3DSSA 2HYZA 4EZKA 2WXGA 2V5FA 3GZ1A 4B0ZA 3AG1E 2GRNB 3Q5MA 4TXRA 4I43A 1N95A 2ZISA 3S7DA 5BXUA 2OV8A 2V4HC 4GPKA 1TNZA 1K8KG 3DSUA 2P9SG 2XS8A 3SI5A 1TN6A 5E75A 2GRPB 1QQEA 1Y8MA 2H6FA 1BI7B 3LJNA 4KZ0A 4GPMA 1N52A 5AJLA 3R7RA 5C1DA 3T9KA 3V31A 4UQYA 2UY1A 3FTYA 5BT1A 3IXEA 3UKRG 1GW6A 2HE0A 2JLBA 4O6FA 1U2VG 2XZTG 3U64A 5D66A 1JCQA 2OCCE 4G8KA 4JHRA 3O48A 4JB8P 2WB2A 3DXMG 4N5CA 4AOFA 1OWNA 2XGMA 3HYMB 4MRUA 3NZUA 2JEKA 3C3RA 4IYPA 4F6RD 3EHMA 2F37A 2DZNA 3L17A 3SZ7A 3OXGA 4GB9A 5M72A 5JJ6A 3FFLA 4OVUA 3APDA 4RVBA 2LSVA 3FUKA 3LVQE 3FWVA 4JVSA 4DX5D 3SFZA 3R7QA 3KSLA 4J8DA 5EKQD 4XKBA 2CHZA 3FY4A 4UQZA 4AIFA 4H7XA 2XEEA 5JA4D 2MHKA 3FP3A 2QYUA 3Q75A 5KJKA 3OXLA 1UN9A 3TAXA 2VQ2A 3DPYA 3LY8A 2IEJA 1FVHA 2QC9A 2YNQA 4LERA 1TN8A 1OCRE 4AM9A 3UM0A 3X2QE 5DIZA 4HOUA 4EPZA 4AVXA 4N2SA 4HQDA 5FQ6A 2IY0C 2J07A 3CSFA 2LUHA 4XKCA 1SW6A 2WXFA 4N3AA 2YHCA 2WQHA 3C98A 4GTPA 3I3NA 2XPZA 5HQ8A 2KC7A 3CKBA 3I4RB 1TEZA 3FUDA 5CEAA 3ASDA 3RKVA 3C3OA 4M7CA 4YVOA 1IQUA 3HRAA 4R7LA 4O60A 4N3CA 3RAUA 4FHJA 2P9LG 4TV3A 3QC1A 3UX4A 5FINA 3TJPA 1V54E 2L0IA 1NP7A 5AQ7A 4WWOA 4DLOA 2IF4A 3ZNGA 1N4RA 4HRMB 4QQIA 1X5BA 2R03A 3RRUA 4FA6A 1NZNA 3IV0A 4KT6B 4AY6A 3KS2A 5A6CA 5C2YA 4NIKA 2V8SE 1RW2A 3HXCA 5G05J 3CKCA 4LCTA 3AS5A 5G2NA 4Q96A 5AQBA 4HI8A 1WM5A 2VSYA 2LAHA 4I1AA 5CMYA 3Q7AA 2IOLA 3FH7A 2R05A 1HO8A 2XGOA 5EIBE 3NBNB 3Q47B 4KBQA 2IJGX 5H7PA 5B1AE 2Y4TA 3RO3A 4ILHB 1MQSA 1YMPA 4JHJA 2F0YA 4A3VA 4HS2A 4KVOA 3MA5A 4F7AA 3TWUA 4RQIA 2YINA 3ABKE 1JUQA 3CHOA 4J6IA 3QWPA 4ATGA 1E7UA 3G2VA 2ZGGA 4JZYA 3TWTA 3KD7A 5EYPF 4Y6CA 2X3MA 5KJNA 3FUEA 3FH5A 2WVIA 2R2LA 1DVPA 4I6GA 4GZ6A 4DJAA 4CGVA 3FU0A 4DX1A 3SFYA 1KT1A 2FI7A 4I9EA 2V0PA 5EILA 3D9MA 3PH0C 1HS6A 2DCPA 5CHEE 2X6KA 4Y6WA 3T8MA 3ASNE 1EPUA 2WXMA 3G2UA 4BERA 1N4SA 4F1PA 4L2LA 5E76A 2VGXB 4BY6A 2WXIA 1FCHA 2LSUA 2VSXE 3PRZA 3GYZA 3LY7A 2X6IA 4BSXA 3O4ZA 3FUIA 3MZLB 3AG3E 4APFA 4UWGA 2XS1A 5KWDA 4D10C 2OVFA 1FPPA 1ELWA 1W3BA 3S7FA 3D9KA 2YHEA 3ZHEA 3VTYA 5HRYA 4CDMA 5EX0A 4FADA 3MJWA 1E8YA 3NOCD 4MKTA 4NURA 3V2OA 1OCZE 4G25A 4EZLA 5BV0A 4AP2A 3DSVA 1TN7A 3CHRA 5CCMA 2L6BA 3E33A 5FWQA 3RJVA 3RIBA 4C48B 1TJFA 3UT8A 3VTXA 1N9AA 3J5QB 4F1SA 4FP7A 5KJLA 3CVPA 4JC8A 2Y4UA 3TWRA 4CCAA 3L82A 3CHSA 1BLXB 3FUJA 4EHMA 3JXIA 5HKPA 4N2QA 3EJNA 5AN8A 4ANXA 3EHNA 4K5BA 1IXVA 3NF1A 3CIAA 4OYSA 3Q15A 4V3IA 4KXKB 3FUMA 1B89A 3HXBA 2P9UG 2PQRA 2PM7A 3PEUB 2WXKA 4HVBA 1XNFA 1U3CA 2EIME 4DRXE 1A17A 2EINE 1E96B 2YQ8A 4NRHB 4HOSA 4J8YA 4JD2G 3GZSA 5ANRA 3RRNB 2IQCA 2NC9A 3R9MA 3CQGB 3AU4A 5B3SE 4AEZC 3FEXA 1KLXA 4GMLA 2DYRE 2MYOA 3UT7A 4DX6D 3ASHA 4GAAA 2XENA 3PE3A 2AXVA 3UMVA 2C0LA 4IRUA 1WDYA 2J9QA 2WMOA 3NB2A 4UUCA 4HLEA 4I9CA 1YYHA 3ULQA 1O1RA 3FU6A 1HZ4A 3B7UX 5FQ7A 1QNFA 3DSTA 2ZGDA 3MKRA 5FIOA 2CFUA 4GTMA 2LNIA 3EIQC 5FZSA 4GTOA 2H6IA 4GMRA 4G23A 4FHKA 2XPIA 2KZTB 4I2WA 1S63A 3WG7E 4CT4A 3ZPJA 4UWKA 1QYMA 4EQFA 4U95D 5CRUA 2H6GA 1OCOE 3QARA 2CFZA 1SA4A 2XGSA 2WXNA 4GU5A 3C72A 2A5EA 2JABA 1V55E 5CBOA 4BEPA 4BT9A 2LXMA 3ZYLA 3E4BA 2CHXA 4WNEA 3QKYA 3TL5A 2J08A 3L54A 3J5PA 4RG6A 5T8IA 1YCSB 4WWPA 1HE8A 4JPSA 4G24A 2X38A 5AARA 1PY1A 3PVLA 1RZ4A 3HVEA 5LCWC 1IKND 1K3ZD 1HF8A 4J7WA 1DCQA 3E34A 1IHBA 4ABNA 3BUAA 4WNGA 4EBAG 1TYQG 3ZW3A 2DWZA 3OAWA 2Y0BG 3ENEA 4U0ZA 4MLPA 4GTVA 2J09A 4WWNA 3SY2A 3CQCB 4DLQA 4E85A 3AG2E 2BKGA 3FTSA 3LEWA 3AU5A 4P29A 2DVWA 1Z5SC 4KVMA 4L9PA 2FEZA 1UN8A 4U8HA 4U63A 3Q49B 1UJJA 2L0TB 4HLLA 2F8XK 4DUIA 2IOSA 2ZXWE 3SFXA 4GTQA 5KCMA 4GTTA 3ABME 4XZ4A 4HOQA 3VLEA 4GYYA 1ZU2A 2J4BA 3MCXA 2XHEA 1SZ9A 3VLDA 3CV0A 5ENTD 5CECB 1N0RA 4GZ3A 3PUKA 3NZSA 2WXOA 2DIWA 2XPYA 3G2SA 4BTAA 3FTXA 2WM9A 4LRZA 4LSZE 4G26A 3TXMA 2J4DA 1EF1C 4O1PA 3SQVA 1ELKA 1OY3D 3B7BA 5BNWA 2WPVA 1OWOA 2WXLA 5ANLA 3LDZA 1OXJA 3UT4A 5J08A 2OEWA 3PE4A 1JCRA 4CZ2D 4ZHBA 3Q7FA 1KT0A 2NYJA
chains in the Genus database with same CATH topology
1MZCA 1S64A 1S63A 1TNOA 3HXCA 3DSSA 4L9PA 1N4SA 3HXBA 3KSLA 3E32A 1LTXA 2H6GA 1N95A 3Q7AA 1D8EA 2ZISA 3PZ4A 3Q75A 1TNYA 3DPYA 1SA4A 2IEJA 2H6HA 3PZ3A 3SFXA 1SA5A 4GTQA 3C72A 3HXFA 1TNZA 4GTTA 1TN8A 1NI1A 1TNUA 1X81A 2BEDA 3DSUA 2ZIRA 1QBQA 4YDOA 1LD8A 1TN6A 2H6FA 1FT2A 2F0YA 1D8DA 1FPPA 4GTSA 3PZ1A 3DSXA 4LNGA 3HXEA 4YDEA 3KSQA 3PZ2A 1N94A 1N4PA 4GTPA 1O5MA 1KZOA 3E30A 1NL4A 3E34A 1TNBA 3DRAA 1JCQA 3Q79A 1KZPA 1O1TA 4LNBA 3Q78A 3E37A 3DSVA 1TN7A 1LD7A 1O1RA 3Q73A 3E33A 3EUVA 2R2LA 1N4QA 1N9AA 1JCSA 3EU5A 3HXDA 1DCEA 3DSTA 3SFYA 4GTVA 4GTMA 1JCRA 4EHMA 4GTRA 3Q7FA 3DSWA 1N4RA 4GTOA 2H6IA 4MBGA 1FT1A 1O1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MZC A;  1S64 A;  1S63 A;  1TNO A;  3HXC A;  3DSS A;  4L9P A;  1N4S A;  3HXB A;  3KSL A;  3E32 A;  1LTX A;  2H6G A;  1N95 A;  3Q7A A;  1D8E A;  2ZIS A;  3PZ4 A;  3Q75 A;  1TNY A;  3DPY A;  1SA4 A;  2IEJ A;  2H6H A;  3PZ3 A;  3SFX A;  1SA5 A;  4GTQ A;  3C72 A;  3HXF A;  1TNZ A;  4GTT A;  1TN8 A;  1NI1 A;  1TNU A;  1X81 A;  2BED A;  3DSU A;  2ZIR A;  1QBQ A;  4YDO A;  1LD8 A;  1TN6 A;  2H6F A;  1FT2 A;  2F0Y A;  1D8D A;  1FPP A;  4GTS A;  3PZ1 A;  3DSX A;  4LNG A;  3HXE A;  4YDE A;  3KSQ A;  3PZ2 A;  1N94 A;  1N4P A;  4GTP A;  1O5M A;  1KZO A;  3E30 A;  1NL4 A;  3E34 A;  1TNB A;  3DRA A;  1JCQ A;  3Q79 A;  1KZP A;  1O1T A;  4LNB A;  3Q78 A;  3E37 A;  3DSV A;  1TN7 A;  1LD7 A;  1O1R A;  3Q73 A;  3E33 A;  3EUV A;  2R2L A;  1N4Q A;  1N9A A;  1JCS A;  3EU5 A;  3HXD A;  1DCE A;  3DST A;  3SFY A;  4GTV A;  4GTM A;  1JCR A;  4EHM A;  4GTR A;  3Q7F A;  3DSW A;  1N4R A;  4GTO A;  2H6I A;  4MBG A;  1FT1 A;  1O1S A; 
#chains in the Genus database with same CATH topology
 2RD0 A;  2FF4 A;  2DZO A;  5ARF A;  2GRO B;  3RRM B;  2C2L A;  4B89 A;  3EU9 A;  5HI7 A;  1MX2 A;  4XX5 A;  1XGW A;  3T5V A;  4KZC A;  2UWJ G;  3ASO E;  3SNX A;  2I2O A;  5AJD A;  3CVX A;  3I4G A;  1JWF A;  2OVB A;  5CCL A;  3ZEF A;  1H0A A;  2WXR A;  3FHE A;  5ENS D;  4DK5 A;  3ZKJ A;  3ULE G;  4XEI G;  1AP7 A;  4LG6 A;  2E2E A;  3U66 A;  2BKK B;  3FUF A;  1D8D A;  4GTS A;  2IU1 A;  2AVP A;  2LO6 A;  3FDH A;  3SGH A;  3LY9 A;  5ENO D;  2E0I A;  4CYM D;  3KSQ A;  2ZU6 B;  4JL0 A;  1WAO 1;  2WMN A;  4FUL A;  1KZO A;  3E30 A;  3OXF A;  3W9G A;  2NXP A;  3QNK A;  3ZFW A;  1E8X A;  3ESK A;  3QB2 A;  4U8V D;  4A1G A;  4UI9 C;  5T3R A;  2AW6 A;  3C5R A;  3D9L A;  2R59 A;  3S7B A;  2GRR B;  3UM3 A;  4EEC A;  4HFG A;  3LKU A;  1DNP A;  3UIN C;  4Q69 A;  3D9H A;  4AV7 A;  2X6H A;  3CVV A;  4DI3 A;  4DX2 A;  4PS8 A;  4OVV A;  3HXF A;  2P9I G;  1NI1 A;  3MX3 A;  4CDN A;  1D9S A;  1HG5 A;  2BTD A;  2CHW A;  2OEV A;  3NAW A;  4HXI A;  5BV1 A;  3FUL A;  3WXX A;  3D9N A;  4TUM A;  4BWR A;  1N0Q A;  1Z3X A;  4ACK A;  3ZRH A;  4BFR A;  4J8F A;  2VTB B;  3DEP A;  3QJZ A;  4K5A B;  4FU3 A;  3FEY A;  3QDN A;  1TNB A;  3HHM A;  3DRA A;  4J0U A;  3CVN A;  3N71 A;  4PH4 B;  3PEV B;  3L08 A;  3R9A B;  4U8Y D;  4U96 D;  3FTW A;  3Q73 A;  3OTN A;  3GW4 A;  1E8Z A;  4ATZ D;  4TXP A;  1INZ A;  3V2X A;  1G3N B;  2PZI A;  5BXO A;  2KAT A;  3ABL E;  2FO1 E;  2L6J A;  4FLH A;  3D9J A;  4KMO A;  3KAE A;  2WXQ A;  1EYH A;  3BU8 A;  4DPR A;  3B7S A;  3DEO A;  1UJK A;  4GYW A;  2GRL A;  4FLB A;  5EX3 A;  5D0O D;  4B8C B;  1TNO A;  4HOR A;  3L6A A;  4W9R A;  4G2V A;  1Z3Y A;  1N11 A;  4FC8 A;  1LTX A;  1ZB1 A;  2J8S D;  3SF4 A;  2P2C P;  3MV2 B;  5J90 A;  2H6H A;  3AJI A;  2PQN A;  4RLY A;  1H2T C;  2QY7 A;  4BTB A;  2BED A;  2ZIR A;  4APO A;  4IUL A;  5BW8 C;  4YDO A;  3SHF A;  4F3V A;  3DWL G;  3TWX A;  2MOW A;  3G2T A;  2B6C A;  2GRM A;  3G2W A;  4BET A;  4ME2 A;  3JQ0 A;  1Y6I A;  3PNL B;  2VGX A;  3PZ1 A;  3T5X A;  4UWF A;  2DYS E;  4ANV A;  2XEH A;  2EIJ E;  3LVR E;  5AIJ A;  3NOG D;  2AXU A;  3CST A;  3AAA C;  2V5Q C;  4EZJ A;  1N4P A;  4O1O A;  3AS4 A;  1OWM A;  4B94 A;  4CGW A;  1KZP A;  1SVX A;  4LNB A;  3Q9U C;  1U3D A;  5FZQ A;  2Y1L E;  1ZBP A;  5JMN D;  3ASF A;  3EUV A;  1SQM A;  5CMW A;  4G8L A;  1JCS A;  3EU5 A;  5FQ8 A;  5CER B;  1IYG A;  4GMJ A;  3D9O A;  4GA0 A;  3D9I A;  2FBN A;  2GRQ B;  2HM8 A;  5CRV A;  4L2Y A;  5FQ4 A;  1ELR A;  3B7R L;  3PS6 A;  4ZFH A;  4BT8 A;  3MYV A;  4WUY A;  2XZD G;  1H6P A;  3CK9 A;  4U0U A;  3B7T A;  2ILR A;  4BES A;  2J49 A;  3PZ4 A;  4ILG A;  4XI9 A;  1TNY A;  3PZ3 A;  3JCK C;  1SA5 A;  2UY1 B;  1JWG A;  4Z68 A;  1X81 A;  2GW1 A;  3TWV A;  4DX7 D;  2B0O E;  3TGO A;  5ENN A;  1LD8 A;  3VLF A;  2KXP C;  4TXQ A;  3TWQ A;  5JHB A;  4N3B A;  2AXZ A;  1UW4 B;  3ZXS A;  2CG2 A;  3HXE A;  4UI9 J;  1JPL A;  1IQR A;  2QYJ A;  4ACL A;  2VSO E;  3IEG A;  3BQO A;  2A4Z A;  4AXH A;  3V30 A;  1VDY A;  3V79 K;  5AYW D;  4GZ5 A;  3MKQ A;  1DC2 A;  4I2Z A;  5EYL A;  3ZVV A;  4A3T A;  1A5E A;  3Q78 A;  4RG9 A;  4UI9 K;  5LX8 A;  3JQ1 A;  5LFA A;  3TG5 A;  1DCE A;  5JJ7 A;  2WQ7 A;  3SBT B;  4OAU C;  4WND A;  3L13 A;  4ANW A;  2XCB A;  1QZ2 A;  3CGH A;  1MZC A;  2ETC A;  4Q94 A;  3KEZ A;  1S64 A;  4K0R A;  4N39 A;  4DI4 A;  4QFV A;  3KEA A;  2F8Y A;  3U4T A;  1Z6T A;  4JEU A;  4YVQ C;  3B95 A;  4L1B A;  1D8E A;  3P2B A;  4GYO A;  4FJY A;  3APC A;  1H6O A;  2KZT A;  1HU3 A;  4L23 A;  3ASG A;  1MJ0 A;  2PNN A;  3DSX A;  2P9K G;  3UQ3 A;  1MYO A;  1EDU A;  1PC2 A;  1L5J A;  5LP0 A;  1HFA A;  3ESL A;  2RFM A;  3BG1 B;  1MX4 A;  2PL2 A;  5JJT A;  2FUL A;  2R02 A;  4JW1 A;  3UM2 A;  2R17 C;  2I1J A;  4F53 A;  4I1M A;  4G11 A;  5A7D B;  3CVU A;  5G04 C;  3ZIM A;  5HS0 A;  3ZN3 A;  3MEK A;  4J8E A;  3T8K A;  3BEE A;  4UWL A;  4GCN A;  3BG0 B;  4I6J A;  2LXL A;  1OWP A;  3I5P A;  4C0M A;  3UM1 A;  5A23 A;  3ZU7 B;  4MBG A;  1OCC E;  3CHM A;  1OWL A;  4JHK A;  3B13 A;  1H2V C;  2QFC A;  4A63 B;  2OOE A;  3FU5 A;  1BU9 A;  4I17 A;  2GGF A;  2WXJ A;  3RK6 A;  2EIL E;  3LXU X;  4GZC A;  4XI0 A;  3FU3 A;  3JUI A;  1TR4 A;  2Q7F A;  1TNU A;  1OT8 A;  3F6Q A;  3FUH A;  4CRW A;  4CDR A;  5KNH D;  3QOU A;  3PNT B;  1KPS B;  2EIK E;  3TXN A;  3FH8 A;  4C0E A;  4XIF A;  3D3M A;  4I1O B;  1E90 A;  5ENQ D;  4LNG A;  3UI2 A;  1S70 B;  3CR3 A;  3QWV A;  3EIJ A;  3APF A;  3LYA A;  3UPV A;  4BX9 A;  2R5S A;  2XQ0 A;  3FTZ A;  1E7V A;  3ZXP A;  4NQ0 A;  3QK0 A;  2NSZ A;  3CVW A;  1N4Q A;  2PM6 A;  3MGB A;  3IHY A;  2VYI A;  3HXD A;  5B1B E;  3LJ3 A;  4UWH A;  3U9W A;  4HBD A;  3LPZ A;  2BF0 X;  2EQX A;  3HDX A;  4GTR A;  1MX6 A;  4HNA D;  4BSZ B;  5FTP A;  1MHQ A;  2Y69 E;  2P9N G;  4N5Q A;  4HOT A;  4PDX A;  1IHG A;  3JUE A;  3E32 A;  5FT9 A;  4JEH A;  4ANU A;  2L9B A;  4LNU D;  3D9P A;  4YND A;  3ZHE B;  4JXT A;  3DXK G;  5ITZ F;  1SZA A;  2I9C A;  4WNF A;  3EDT B;  5BUZ A;  3ZYQ A;  4YDW A;  4PS3 A;  3TWW A;  4KYO B;  4HB5 A;  5LCW J;  3DPD A;  2XRZ A;  5EDS A;  2VSN A;  2RG8 A;  3AS8 A;  4B8A A;  1N94 A;  3LS8 A;  3TWS A;  1NL4 A;  4E6H A;  3CEQ A;  2MRI A;  2WQ6 A;  3ZYM A;  4GZD A;  3CK7 A;  2IO2 C;  3JXJ A;  5KJM A;  2KCV A;  5LOZ A;  1O1T A;  3URZ A;  1OUV A;  3IBE A;  2AJA A;  3SBS A;  3L22 A;  3ML9 A;  4ILI A;  1BI8 B;  2A5U A;  3RU0 A;  4I6E A;  2IO3 C;  1H6K A;  5EID A;  4NAC A;  3P1U A;  4HRN A;  4CT0 A;  1UG3 A;  3UXG A;  3DSW A;  2VGE A;  1O1S A;  1BD8 A;  5EN5 D;  2FO7 A;  4OAV B;  1K1A A;  2DBA A;  4A55 A;  3DBS A;  3Q9N C;  4EBA A;  1E8W A;  1S0P A;  4FJZ A;  5KNG A;  3QWW A;  3C3Q A;  4JA7 A;  4XE0 A;  4C9B B;  3JYS A;  3SO8 A;  1H2U A;  2IFU A;  2QZA A;  4GA2 A;  4YDY A;  3SD5 A;  5AQ9 A;  1UOH A;  1QBQ A;  3FTU A;  3RSE G;  5G04 J;  5IY5 E;  5BPP A;  1FT2 A;  2OND A;  5ENP D;  2XCC A;  4AY5 A;  1N54 A;  1NFI E;  4CEM A;  4RSY A;  3HG0 D;  2VJ8 A;  5ENR D;  5G55 A;  3IHV A;  1O5M A;  5CBN A;  4H7Y A;  2KBX A;  1YA0 A;  2Y3A A;  3CLJ A;  3CVY A;  3QAQ A;  3Q79 A;  4U7E B;  2KCK A;  3L16 A;  4JA9 A;  3IKO B;  4TUU A;  4BX8 A;  1LD7 A;  5D2M C;  1WY6 A;  2ETB A;  3AG4 E;  1BPO A;  2VTB A;  4U04 A;  1NA3 A;  1K1B A;  4WAF A;  2VGY A;  3UKU G;  1FT1 A;  3MV3 B;  5AAO A;  2XEV A;  4A1S A;  2ETA A;  2HO1 A;  4J8S A;  1PAQ A;  3PUJ A;  3ONL A;  3Q4A B;  1WG0 A;  1HG2 A;  3ZUV B;  4MS6 A;  4M3O A;  3ISM C;  3MKQ B;  1HH8 A;  3K9I A;  3U3W A;  4G1T A;  4URK A;  2WXH A;  3PZD A;  2RKK A;  4K03 A;  2ION A;  4PS7 A;  3HVE B;  3EHR A;  3ML8 A;  4U0S A;  1AWC B;  4GCO A;  3NQP A;  3S2A A;  4L7T A;  2CG3 A;  4X8Q A;  3S7J A;  3CVQ A;  2I1K A;  2KCL A;  3L9T A;  4TRQ A;  1NA0 A;  2V4L A;  1HXI A;  3CK8 A;  5G05 C;  2LAI A;  1LF8 A;  5D0Q D;  3UUX A;  5T4Y A;  3CVL A;  4YDE A;  2X6J A;  3UIO C;  4UQX A;  3PZ2 A;  4AJW A;  3ULY A;  5ARG A;  5KBA A;  1Q2Z A;  5JHA A;  2XRY A;  5CED B;  1HX8 A;  2KM4 A;  2AWI A;  4HI9 A;  3CHQ A;  2HR2 A;  1H19 A;  1P5Q A;  3TG4 A;  3W9F A;  5FJY A;  3CHP A;  1TJC A;  4IN3 B;  4PUC A;  3FUN A;  3EHQ A;  4B93 B;  2BUG A;  4HRL A;  3E37 A;  2X6F A;  5AEN A;  2WXP A;  4K5C A;  3UTM A;  3UIP C;  3FTV A;  2RFA A;  2P58 C;  3PDN A;  2I6H A;  2M63 A;  3ZYK A;  3HIZ A;  3ONK A;  3LCA A;  5DBK A;  4GA1 A;  2C0M A;  5AQA A;  4LEU A;  4LUN U;  3ZGQ A;  3GZ2 A;  5FZR A;  1FVF A;  2P9P G;  4U07 A;  3PRE A;  3RO2 A;  3DSS A;  2HYZ A;  4EZK A;  2WXG A;  2V5F A;  3GZ1 A;  4B0Z A;  3AG1 E;  2GRN B;  3Q5M A;  4TXR A;  4I43 A;  1N95 A;  2ZIS A;  3S7D A;  5BXU A;  2OV8 A;  2V4H C;  4GPK A;  1TNZ A;  1K8K G;  3DSU A;  2P9S G;  2XS8 A;  3SI5 A;  1TN6 A;  5E75 A;  2GRP B;  1QQE A;  1Y8M A;  2H6F A;  1BI7 B;  3LJN A;  4KZ0 A;  4GPM A;  1N52 A;  5AJL A;  3R7R A;  5C1D A;  3T9K A;  3V31 A;  4UQY A;  2UY1 A;  3FTY A;  5BT1 A;  3IXE A;  3UKR G;  1GW6 A;  2HE0 A;  2JLB A;  4O6F A;  1U2V G;  2XZT G;  3U64 A;  5D66 A;  1JCQ A;  2OCC E;  4G8K A;  4JHR A;  3O48 A;  4JB8 P;  2WB2 A;  3DXM G;  4N5C A;  4AOF A;  1OWN A;  2XGM A;  3HYM B;  4MRU A;  3NZU A;  2JEK A;  3C3R A;  4IYP A;  4F6R D;  3EHM A;  2F37 A;  2DZN A;  3L17 A;  3SZ7 A;  3OXG A;  4GB9 A;  5M72 A;  5JJ6 A;  3FFL A;  4OVU A;  3APD A;  4RVB A;  2LSV A;  3FUK A;  3LVQ E;  3FWV A;  4JVS A;  4DX5 D;  3SFZ A;  3R7Q A;  3KSL A;  4J8D A;  5EKQ D;  4XKB A;  2CHZ A;  3FY4 A;  4UQZ A;  4AIF A;  4H7X A;  2XEE A;  5JA4 D;  2MHK A;  3FP3 A;  2QYU A;  3Q75 A;  5KJK A;  3OXL A;  1UN9 A;  3TAX A;  2VQ2 A;  3DPY A;  3LY8 A;  2IEJ A;  1FVH A;  2QC9 A;  2YNQ A;  4LER A;  1TN8 A;  1OCR E;  4AM9 A;  3UM0 A;  3X2Q E;  5DIZ A;  4HOU A;  4EPZ A;  4AVX A;  4N2S A;  4HQD A;  5FQ6 A;  2IY0 C;  2J07 A;  3CSF A;  2LUH A;  4XKC A;  1SW6 A;  2WXF A;  4N3A A;  2YHC A;  2WQH A;  3C98 A;  4GTP A;  3I3N A;  2XPZ A;  5HQ8 A;  2KC7 A;  3CKB A;  3I4R B;  1TEZ A;  3FUD A;  5CEA A;  3ASD A;  3RKV A;  3C3O A;  4M7C A;  4YVO A;  1IQU A;  3HRA A;  4R7L A;  4O60 A;  4N3C A;  3RAU A;  4FHJ A;  2P9L G;  4TV3 A;  3QC1 A;  3UX4 A;  5FIN A;  3TJP A;  1V54 E;  2L0I A;  1NP7 A;  5AQ7 A;  4WWO A;  4DLO A;  2IF4 A;  3ZNG A;  1N4R A;  4HRM B;  4QQI A;  1X5B A;  2R03 A;  3RRU A;  4FA6 A;  1NZN A;  3IV0 A;  4KT6 B;  4AY6 A;  3KS2 A;  5A6C A;  5C2Y A;  4NIK A;  2V8S E;  1RW2 A;  3HXC A;  5G05 J;  3CKC A;  4LCT A;  3AS5 A;  5G2N A;  4Q96 A;  5AQB A;  4HI8 A;  1WM5 A;  2VSY A;  2LAH A;  4I1A A;  5CMY A;  3Q7A A;  2IOL A;  3FH7 A;  2R05 A;  1HO8 A;  2XGO A;  5EIB E;  3NBN B;  3Q47 B;  4KBQ A;  2IJG X;  5H7P A;  5B1A E;  2Y4T A;  3RO3 A;  4ILH B;  1MQS A;  1YMP A;  4JHJ A;  2F0Y A;  4A3V A;  4HS2 A;  4KVO A;  3MA5 A;  4F7A A;  3TWU A;  4RQI A;  2YIN A;  3ABK E;  1JUQ A;  3CHO A;  4J6I A;  3QWP A;  4ATG A;  1E7U A;  3G2V A;  2ZGG A;  4JZY A;  3TWT A;  3KD7 A;  5EYP F;  4Y6C A;  2X3M A;  5KJN A;  3FUE A;  3FH5 A;  2WVI A;  2R2L A;  1DVP A;  4I6G A;  4GZ6 A;  4DJA A;  4CGV A;  3FU0 A;  4DX1 A;  3SFY A;  1KT1 A;  2FI7 A;  4I9E A;  2V0P A;  5EIL A;  3D9M A;  3PH0 C;  1HS6 A;  2DCP A;  5CHE E;  2X6K A;  4Y6W A;  3T8M A;  3ASN E;  1EPU A;  2WXM A;  3G2U A;  4BER A;  1N4S A;  4F1P A;  4L2L A;  5E76 A;  2VGX B;  4BY6 A;  2WXI A;  1FCH A;  2LSU A;  2VSX E;  3PRZ A;  3GYZ A;  3LY7 A;  2X6I A;  4BSX A;  3O4Z A;  3FUI A;  3MZL B;  3AG3 E;  4APF A;  4UWG A;  2XS1 A;  5KWD A;  4D10 C;  2OVF A;  1FPP A;  1ELW A;  1W3B A;  3S7F A;  3D9K A;  2YHE A;  3ZHE A;  3VTY A;  5HRY A;  4CDM A;  5EX0 A;  4FAD A;  3MJW A;  1E8Y A;  3NOC D;  4MKT A;  4NUR A;  3V2O A;  1OCZ E;  4G25 A;  4EZL A;  5BV0 A;  4AP2 A;  3DSV A;  1TN7 A;  3CHR A;  5CCM A;  2L6B A;  3E33 A;  5FWQ A;  3RJV A;  3RIB A;  4C48 B;  1TJF A;  3UT8 A;  3VTX A;  1N9A A;  3J5Q B;  4F1S A;  4FP7 A;  5KJL A;  3CVP A;  4JC8 A;  2Y4U A;  3TWR A;  4CCA A;  3L82 A;  3CHS A;  1BLX B;  3FUJ A;  4EHM A;  3JXI A;  5HKP A;  4N2Q A;  3EJN A;  5AN8 A;  4ANX A;  3EHN A;  4K5B A;  1IXV A;  3NF1 A;  3CIA A;  4OYS A;  3Q15 A;  4V3I A;  4KXK B;  3FUM A;  1B89 A;  3HXB A;  2P9U G;  2PQR A;  2PM7 A;  3PEU B;  2WXK A;  4HVB A;  1XNF A;  1U3C A;  2EIM E;  4DRX E;  1A17 A;  2EIN E;  1E96 B;  2YQ8 A;  4NRH B;  4HOS A;  4J8Y A;  4JD2 G;  3GZS A;  5ANR A;  3RRN B;  2IQC A;  2NC9 A;  3R9M A;  3CQG B;  3AU4 A;  5B3S E;  4AEZ C;  3FEX A;  1KLX A;  4GML A;  2DYR E;  2MYO A;  3UT7 A;  4DX6 D;  3ASH A;  4GAA A;  2XEN A;  3PE3 A;  2AXV A;  3UMV A;  2C0L A;  4IRU A;  1WDY A;  2J9Q A;  2WMO A;  3NB2 A;  4UUC A;  4HLE A;  4I9C A;  1YYH A;  3ULQ A;  1O1R A;  3FU6 A;  1HZ4 A;  3B7U X;  5FQ7 A;  1QNF A;  3DST A;  2ZGD A;  3MKR A;  5FIO A;  2CFU A;  4GTM A;  2LNI A;  3EIQ C;  5FZS A;  4GTO A;  2H6I A;  4GMR A;  4G23 A;  4FHK A;  2XPI A;  2KZT B;  4I2W A;  1S63 A;  3WG7 E;  4CT4 A;  3ZPJ A;  4UWK A;  1QYM A;  4EQF A;  4U95 D;  5CRU A;  2H6G A;  1OCO E;  3QAR A;  2CFZ A;  1SA4 A;  2XGS A;  2WXN A;  4GU5 A;  3C72 A;  2A5E A;  2JAB A;  1V55 E;  5CBO A;  4BEP A;  4BT9 A;  2LXM A;  3ZYL A;  3E4B A;  2CHX A;  4WNE A;  3QKY A;  3TL5 A;  2J08 A;  3L54 A;  3J5P A;  4RG6 A;  5T8I A;  1YCS B;  4WWP A;  1HE8 A;  4JPS A;  4G24 A;  2X38 A;  5AAR A;  1PY1 A;  3PVL A;  1RZ4 A;  3HVE A;  5LCW C;  1IKN D;  1K3Z D;  1HF8 A;  4J7W A;  1DCQ A;  3E34 A;  1IHB A;  4ABN A;  3BUA A;  4WNG A;  4EBA G;  1TYQ G;  3ZW3 A;  2DWZ A;  3OAW A;  2Y0B G;  3ENE A;  4U0Z A;  4MLP A;  4GTV A;  2J09 A;  4WWN A;  3SY2 A;  3CQC B;  4DLQ A;  4E85 A;  3AG2 E;  2BKG A;  3FTS A;  3LEW A;  3AU5 A;  4P29 A;  2DVW A;  1Z5S C;  4KVM A;  4L9P A;  2FEZ A;  1UN8 A;  4U8H A;  4U63 A;  3Q49 B;  1UJJ A;  2L0T B;  4HLL A;  2F8X K;  4DUI A;  2IOS A;  2ZXW E;  3SFX A;  4GTQ A;  5KCM A;  4GTT A;  3ABM E;  4XZ4 A;  4HOQ A;  3VLE A;  4GYY A;  1ZU2 A;  2J4B A;  3MCX A;  2XHE A;  1SZ9 A;  3VLD A;  3CV0 A;  5ENT D;  5CEC B;  1N0R A;  4GZ3 A;  3PUK A;  3NZS A;  2WXO A;  2DIW A;  2XPY A;  3G2S A;  4BTA A;  3FTX A;  2WM9 A;  4LRZ A;  4LSZ E;  4G26 A;  3TXM A;  2J4D A;  1EF1 C;  4O1P A;  3SQV A;  1ELK A;  1OY3 D;  3B7B A;  5BNW A;  2WPV A;  1OWO A;  2WXL A;  5ANL A;  3LDZ A;  1OXJ A;  3UT4 A;  5J08 A;  2OEW A;  3PE4 A;  1JCR A;  4CZ2 D;  4ZHB A;  3Q7F A;  1KT0 A;  2NYJ A; 
#chains in the Genus database with same CATH homology
 1MZC A;  1S64 A;  1S63 A;  1TNO A;  3HXC A;  3DSS A;  4L9P A;  1N4S A;  3HXB A;  3KSL A;  3E32 A;  1LTX A;  2H6G A;  1N95 A;  3Q7A A;  1D8E A;  2ZIS A;  3PZ4 A;  3Q75 A;  1TNY A;  3DPY A;  1SA4 A;  2IEJ A;  2H6H A;  3PZ3 A;  3SFX A;  1SA5 A;  4GTQ A;  3C72 A;  3HXF A;  1TNZ A;  4GTT A;  1TN8 A;  1NI1 A;  1TNU A;  1X81 A;  2BED A;  3DSU A;  2ZIR A;  1QBQ A;  4YDO A;  1LD8 A;  1TN6 A;  2H6F A;  1FT2 A;  2F0Y A;  1D8D A;  1FPP A;  4GTS A;  3PZ1 A;  3DSX A;  4LNG A;  3HXE A;  4YDE A;  3KSQ A;  3PZ2 A;  1N94 A;  1N4P A;  4GTP A;  1O5M A;  1KZO A;  3E30 A;  1NL4 A;  3E34 A;  1TNB A;  3DRA A;  1JCQ A;  3Q79 A;  1KZP A;  1O1T A;  4LNB A;  3Q78 A;  3E37 A;  3DSV A;  1TN7 A;  1LD7 A;  1O1R A;  3Q73 A;  3E33 A;  3EUV A;  2R2L A;  1N4Q A;  1N9A A;  1JCS A;  3EU5 A;  3HXD A;  1DCE A;  3DST A;  3SFY A;  4GTV A;  4GTM A;  1JCR A;  4EHM A;  4GTR A;  3Q7F A;  3DSW A;  1N4R A;  4GTO A;  2H6I A;  4MBG A;  1FT1 A;  1O1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...