3Q73A

Cryptococcus neoformans protein farnesyltransferase, apo enzyme
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
330
structure length
316
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSDPLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
molecule keywords Farnesyltransferase, alpha subunit
source organism Cryptococcus neoformans
molecule tags Transferase
total genus 127
structure length 316
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q73A00
1LTXA 3PZ4A 3DSXA 1D8EA 1KZPA 3PZ2A 1JCSA 3SFXA 2R2LA 3Q7FA 4GTOA 4LNGA 3DPYA 3E34A 3E37A 3E32A 1TN6A 3SFYA 2BEDA 1D8DA 1N4QA 1DCEA 3HXEA 1O5MA 1N4SA 4GTRA 1TN8A 1KZOA 3C72A 1O1TA 1N95A 3HXFA 1FT1A 3HXBA 3KSLA 4MBGA 4GTTA 2IEJA 1TNOA 1FPPA 1S64A 2H6FA 4EHMA 3DSSA 3DRAA 3DSUA 3Q75A 4GTVA 2H6HA 1SA4A 3E30A 1X81A 3Q73A 1TN7A 2ZISA 4GTSA 3DSWA 3Q7AA 3HXDA 3KSQA 1LD8A 1N4PA 2ZIRA 4GTPA 1SA5A 1TNYA 3EU5A 4LNBA 3HXCA 1TNBA 3DSVA 1QBQA 4GTQA 1S63A 1LD7A 1NL4A 2F0YA 3Q79A 1N4RA 2H6GA 1O1RA 3DSTA 3EUVA 4YDOA 1TNUA 3PZ3A 1JCQA 4YDEA 1TNZA 1O1SA 4GTMA 1MZCA 1JCRA 1N94A 3PZ1A 1FT2A 4L9PA 3E33A 1NI1A 2H6IA 1N9AA 3Q78A
chains in the Genus database with same CATH superfamily
1LTXA 2CHWA 3JYSA 4JB8P 4B8AA 4UI9K 2XPYA 2L9BA 4H7XA 4ZHBA 2UWJG 1S0PA 3MV3B 3G2VA 3FUDA 5CBNA 3B7SA 1TN6A 3RK6A 4FJYA 3QWPA 4N3BA 2WMNA 1U2VG 5M72A 1G3NB 4L2YA 5EDSA 1QNFA 2OVFA 2P9SG 3Q5MA 5KCMA 3PVLA 1VDYA 4O1OA 3DSSA 2MYOA 2P9IG 4I2WA 2NXPA 3EHRA 1SZAA 2XS8A 2BKGA 2DZOA 4PS3A 5BUZA 2AXZA 2GW1A 4L7TA 2LUHA 1OWLA 2XRZA 2EIJE 3CHQA 3CVLA 3JQ0A 2E2EA 1TNYA 4M7CA 1MQSA 4PH4B 4BT9A 1NL4A 1JUQA 2WXLA 1WG0A 1WAO1 3RSEG 4HXIA 2F8XK 4UQZA 4JA9A 3ENEA 2IONA 3B7TA 2V4HC 5AARA 3BEEA 4RSYA 1HG5A 1UN9A 4GPMA 2RD0A 3IHVA 3UT8A 5FINA 3NZSA 4CDNA 5D66A 3UXGA 3EHNA 2L6JA 3EDTB 3AG4E 3Q15A 4GZ6A 4BX9A 5ENQD 4CCAA 2IJGX 5G05C 5LFAA 4E6HA 4GTRA 3RRUA 2XGOA 4J7WA 2LSVA 4FLHA 3FUFA 1OWPA 1S64A 3ZNGA 1IQUA 1N11A 4N3CA 1ZU2A 2PL2A 4R7LA 3FY4A 3HHMA 2XPZA 4H7YA 1WY6A 1OCOE 5G55A 2X6KA 4UUCA 1AWCB 2ZIRA 4BTAA 2WQ7A 4J8EA 3LJNA 4CGVA 3FTYA 4LERA 3D9OA 5CEDB 3L82A 2QY7A 2J9QA 3QOUA 2YQ8A 2V5QC 4C9BB 4B89A 3VTXA 2L0IA 5JHAA 3QDNA 3D9LA 5D2MC 3FP3A 3CEQA 4GTMA 3FH8A 4F3VA 2HR2A 3RIBA 5EKQD 4W9RA 3UT4A 3NF1A 5B1BE 3OXLA 1H2UA 4JXTA 5ENPD 3KD7A 1TR4A 3UM1A 5EIBE 3UMVA 3PDNA 1MJ0A 1TJFA 1TJCA 3SFZA 2P9PG 4ILIA 4G26A 3E4BA 1DNPA 1OWMA 5LCWC 3Q9UC 2BKKB 1HFAA 5CRUA 4DX5D 1SW6A 4EZKA 3ONLA 1E90A 5JA4D 4BFRA 2VSXE 4GAAA 3R9AB 1OT8A 3ZKJA 4DLOA 1FCHA 3Q9NC 3C5RA 2H6HA 3E30A 2JLBA 4YVQC 1PAQA 3SD5A 4GYOA 3AG2E 5CBOA 4XKBA 1WDYA 3FTXA 3TWQA 2CG3A 1N54A 2DBAA 3FTZA 1JWGA 2CFZA 4HOTA 3AAAC 4YDWA 4XI9A 2XCBA 4ANUA 4ABNA 3EUVA 3D9IA 4U8HA 3VLFA 3ZVVA 3QWWA 3D9JA 3AS8A 3G2TA 4YNDA 5FWQA 4I6JA 5J90A 3ZHEB 2IOSA 3FTSA 2KCKA 3PH0C 3SGHA 3I4GA 2R02A 3EIJA 1FVHA 2MHKA 1Y6IA 4U95D 4ANVA 5AJDA 4EBAA 4E85A 3FH5A 3TGOA 2AWIA 1H0AA 5KNHD 3QKYA 2UY1A 2GRPB 1O5MA 4FLBA 2PM6A 4YDYA 2PNNA 1EPUA 2ZGGA 2MOWA 4FC8A 2E0IA 4CYMD 4FHJA 1QYMA 2WXPA 3KEAA 2WXMA 1YYHA 4KVMA 1E7VA 4HOSA 4QFVA 2F37A 3ABKE 3APDA 5AQBA 3EHMA 2J4BA 2GRQB 4B93B 5DBKA 4K03A 4EZJA 3NZUA 1SA5A 3TWVA 3ML8A 3JUEA 4CGWA 3CGHA 2P58C 4JA7A 4DX6D 2BUGA 1V55E 4KBQA 3EJNA 4YDOA 5D0OD 4B8CB 3L17A 4YDEA 3PUJA 4IRUA 3FEYA 5KWDA 4FP7A 1HX8A 2IU1A 3RAUA 3ASDA 4LNUD 3PE3A 3FU0A 4OVVA 4BY6A 2UY1B 4TUMA 3LEWA 4XEIG 5AAOA 2AXUA 1IXVA 1IKND 3AU5A 1D8EA 3ASNE 1KZPA 2X6IA 1NA3A 1V54E 3LS8A 3L22A 4JPSA 3SZ7A 4HRLA 5KBAA 3ZPJA 3LPZA 3ZFWA 2B6CA 2WXNA 3CHSA 4A1GA 1U3CA 1K1BA 2J49A 3TWRA 3SNXA 1XNFA 5AYWD 5IY5E 4GMRA 3IHYA 4U8YD 3JQ1A 3B95A 2AW6A 5LOZA 4AV7A 2I9CA 1TN7A 4CEMA 3C3QA 4J8SA 2ZISA 4EZLA 3UM2A 2IF4A 2XQ0A 3V2XA 3CKCA 4JVSA 3FUIA 5AN8A 1K1AA 5ITZF 2LAHA 5KJMA 5H7PA 4GA1A 2L0TB 2XZDG 2KCVA 1N0RA 3HYMB 3CK9A 3ZYMA 3GZSA 2GRLA 2XEEA 4FHKA 2RFAA 4J8YA 3T9KA 2KC7A 4PS7A 3WG7E 4O60A 3RO3A 2DWZA 1JCQA 3CVQA 2PZIA 3RO2A 1KT1A 3CHOA 3ULQA 3ZXSA 1NFIE 2P9NG 4DI3A 3TG5A 3D9KA 2ONDA 2DYSE 1ZBPA 3QK0A 4GZ5A 3SHFA 4HLLA 1OWNA 2I6HA 3E34A 2R03A 1BI7B 5FJYA 4UI9J 3LDZA 4I9CA 2BEDA 4GZCA 1N4QA 3UKRG 3Q47B 4OAUC 4IULA 3RRMB 5DIZA 5HKPA 4ACLA 4ME2A 5EN5D 5J08A 3RU0A 5AJLA 1RZ4A 4N5CA 1SA4A 3BG1B 1Q2ZA 2QYJA 4NRHB 5EX0A 1IHGA 2I1JA 3PUKA 4J6IA 4EQFA 5FZSA 2R17C 3OXGA 1IHBA 4EPZA 4QQIA 2V4LA 3ZGQA 4Y6CA 4CT4A 1QBQA 2I1KA 2P9LG 2YHCA 3DWLG 3CSFA 3L9TA 4PS8A 4K0RA 2J4DA 3Q79A 4G23A 4TXPA 3U4TA 3WXXA 4KVOA 3QC1A 4TRQA 1EYHA 4DI4A 3I3NA 5BV0A 3G2SA 4DPRA 4RLYA 2QYUA 1FVFA 5CMYA 2EQXA 3D9NA 5T8IA 2XCCA 4G24A 4N3AA 1HU3A 2J08A 3ULEG 4AXHA 3MV2B 1OUVA 4C0EA 4UWLA 4N2QA 2P9KG 4FA6A 2AJAA 4LNGA 2WXFA 3DPYA 3CVUA 3L08A 2NSZA 2R59A 3EU9A 5ANRA 4LCTA 1N4SA 1TN8A 1ZB1A 2L6BA 2V0PA 5FT9A 1FT1A 1OY3D 1H2VC 2BF0X 3DRAA 3Q75A 5HRYA 4F1PA 4GA2A 4GTVA 3ZXPA 4UWGA 2VGXA 3SI5A 4KZCA 5EX3A 3T8MA 4KXKB 4KYOB 3FH7A 4BEPA 4KT6B 3TXMA 2AXVA 5FQ7A 3UUXA 2XEHA 3CKBA 4LNBA 2QC9A 1S63A 3U64A 4U63A 1TYQG 3P1UA 3UINC 1W3BA 3S7BA 1BI8B 3GZ2A 1O1SA 1OCZE 3HG0D 4JL0A 1H6OA 3AS4A 4EBAG 3PZ1A 4U96D 5BXOA 5EYPF 3ZN3A 1PY1A 3V79K 5BW8C 4HORA 4DK5A 1INZA 1NA0A 2WXGA 2NC9A 3FFLA 3ZW3A 1JCSA 1E96B 4K5AB 2KM4A 4JEHA 3G2WA 4K5CA 2HE0A 1YMPA 2A5UA 2VSOE 4GZDA 4HRNA 1ELRA 3ISMC 1AP7A 2VGXB 4TV3A 1BLXB 5KNGA 4B94A 2OOEA 2WXKA 1BD8A 3DEPA 5LP0A 2RG8A 4XI0A 2J09A 3DSWA 3PEUB 3U66A 4P29A 2VGYA 2BTDA 2WQ6A 3UPVA 1SQMA 3C98A 4YVOA 5ENSD 4L2LA 4RVBA 3APCA 3FU3A 4DX2A 1X5BA 5ARFA 4I1AA 1HF8A 5JJ6A 4HFGA 3FHEA 2YHEA 2LSUA 3FUJA 1N4RA 4ZFHA 2B0OE 3KAEA 2HYZA 4JW1A 3F6QA 2C0LA 1PC2A 4HBDA 3SBTB 3UIOC 2WXQA 5FIOA 3ZU7B 4U0UA 3BQOA 4WNFA 3T5XA 3ONKA 4AY5A 3LY9A 4GU5A 4O6FA 3IV0A 3P2BA 3TL5A 2Y4TA 4F6RD 3BU8A 1OCRE 5BNWA 3SFYA 3HXEA 3MGBA 2CHZA 4ATZD 3AJIA 3R7QA 4B0ZA 5G05J 2Y0BG 1OCCE 2FF4A 2M63A 4KZ0A 4CDRA 3TAXA 5CECB 4U07A 3D9MA 2CHXA 3NB2A 2IO3C 3V30A 3MYVA 3ASGA 3Q7AA 1Z3XA 3HXDA 4HOQA 3CVXA 1OXJA 3B7RL 3RKVA 3IXEA 3EU5A 4OYSA 2GRRB 1NZNA 2EIKE 4BSXA 4I2ZA 3CV0A 4UQXA 3TWWA 1TNUA 2ETBA 3APFA 5AIJA 4CRWA 1S70B 3UIPC 4CDMA 1XGWA 2JABA 4NIKA 3MZLB 4I43A 2VTBA 3OXFA 2OCCE 5BV1A 4GMJA 3B7UX 5E75A 4UWKA 2YNQA 3JXJA 5CHEE 3B13A 4AVXA 3Q7FA 2FI7A 3E32A 3S7FA 1E8YA 3QAQA 4F53A 4ILGA 1DCEA 4LRZA 3ZYLA 1EDUA 4WNGA 3L54A 5E76A 1HH8A 2XHEA 2DZNA 3HXFA 1MX4A 4N39A 1KLXA 3HXBA 3ABME 1TNOA 3TWSA 3HRAA 4Q94A 4WUYA 5LCWJ 3MKQA 1EF1C 1X81A 2WXRA 1UJJA 1HG2A 3OTNA 4CZ2D 1ELKA 4PUCA 2KXPC 5EYLA 2LNIA 4HVBA 4TXRA 4RG9A 3HVEA 1A5EA 3KS2A 3FUMA 3URZA 4OAVB 2PM7A 4WNDA 2C2LA 3W9GA 2X6HA 3DSVA 1UG3A 3FULA 3TG4A 3FTVA 2X6FA 4Z68A 5G04J 3UT7A 3CVNA 2VTBB 3HIZA 2VQ2A 3MKRA 4BERA 5FQ4A 3GYZA 2DIWA 4ANWA 2QZAA 1MZCA 3CLJA 1MX2A 3ZEFA 3W9FA 2Q7FA 3PE4A 2WQHA 4I6EA 1N9AA 4FULA 4UWHA 4RQIA 4IN3B 3IBEA 2WXJA 3SY2A 3S7DA 1JWFA 3LYAA 3S2AA 4BESA 3E37A 1UJKA 3D9PA 3ZYKA 1QZ2A 4DX7D 2J8SD 3MKQB 2KZTA 3FUNA 4M3OA 1HZ4A 4NACA 4HI9A 3J5QB 4HOUA 5A23A 4C48B 5JJTA 3CHMA 2QFCA 2XS1A 5G2NA 3R7RA 3DSUA 3HVEB 3FDHA 5C2YA 1HO8A 4DJAA 1NP7A 2R05A 3PREA 4HQDA 3TWUA 3S7JA 4APFA 3CVVA 5A7DB 1HXIA 1N4PA 5FQ8A 2Y3AA 2HO1A 4XZ4A 3EIQC 1HS6A 3CQCB 3SO8A 3X2QE 4DX1A 4JHRA 2OVBA 1Z5SC 2ILRA 1SZ9A 4I17A 1LD7A 3IKOB 3CHRA 3L16A 3D3MA 5FZQA 5FTPA 4OVUA 2V8SE 2XGSA 1H6KA 2VYIA 3MJWA 4JZYA 4GB9A 1H19A 1IYGA 1N94A 4UQYA 1E8WA 4AM9A 4L9PA 4MRUA 2KATA 1MX6A 2KZTB 2EIME 2IO2C 2ZU6B 3JXIA 2XGMA 3ABLE 3FTWA 2F8YA 5T3RA 4U0SA 3CVPA 3JUIA 1E7UA 5JHBA 4LUNU 4RG6A 4FADA 4URKA 1N52A 1O1TA 3GW4A 4AIFA 4F7AA 3PRZA 3TJPA 4N5QA 3PEVB 3I4RB 2VGEA 4XX5A 2LAIA 2KCLA 3K9IA 4XE0A 3UKUG 5BXUA 5AQ7A 4U04A 3T8KA 4GMLA 1OWOA 3TWTA 2WMOA 2GRNB 3QJZA 3QWVA 4X8QA 4HNAD 3LY8A 1GW6A 2A4ZA 4WAFA 1TNBA 4G11A 3C3RA 2JEKA 3EHQA 1O1RA 5LX8A 4MLPA 3SF4A 5ENNA 3UTMA 3JCKC 4JC8A 4JHKA 3U9WA 4K5BA 3VLEA 2OEWA 3PZ4A 5ENRD 3DBSA 4AP2A 3ASFA 3PNLB 2V5FA 2OV8A 3PS6A 3SFXA 4GCOA 4N2SA 4A55A 4WNEA 5ARGA 5AQAA 2IY0C 5EILA 3MX3A 3OAWA 3MCXA 3CK7A 4IYPA 3BUAA 2ZGDA 5CEAA 2PQRA 1KZOA 3R9MA 4I6GA 2A5EA 2X6JA 3VLDA 1U3DA 3KSLA 4MS6A 4MBGA 4GTTA 4G8LA 1YCSB 3O4ZA 1K3ZD 3DXKG 4G8KA 4A3VA 3ESKA 1H2TC 4GTSA 4AEZC 2Y1LE 5B1AE 4MKTA 2NYJA 3CK8A 3BG0B 4XKCA 4XIFA 2XEVA 4Q69A 3NBNB 3UI2A 5KJKA 2ZXWE 2WB2A 4O1PA 4I1MA 1YA0A 5CERB 4WWPA 3LXUX 2J07A 2F0YA 4J0UA 1D9SA 1E8ZA 4FJZA 2GROB 4A1SA 3QB2A 4WWOA 3U3WA 1KT0A 3CHPA 2XPIA 5JMND 5CRVA 3ZHEA 3ZRHA 5ENTD 4AOFA 2RFMA 2EILE 4F1SA 3SBSA 2I2OA 1FT2A 2P2CP 4ANXA 4DRXE 2FO7A 3Q78A 3DEOA 3HDXA 5HI7A 4GYWA 3ASOE 4G2VA 3C3OA 3DSXA 3PZ2A 5CCLA 3CVYA 2R2LA 3RRNB 1ELWA 1D8DA 2FO1E 4J8FA 3FUEA 3LVRE 4NQ0A 1Z6TA 4HI8A 4ILHB 4LSZE 5B3SE 1BU9A 4NURA 3C72A 2X3MA 3Q49B 4J8DA 5AQ9A 4DUIA 4LEUA 5A6CA 2IEJA 1FPPA 3LCAA 3DPDA 5G04C 2H6FA 4GCNA 3O48A 3ASHA 4KMOA 2WM9A 5ENOD 3LJ3A 2WXHA 3Q4AB 3KSQA 1LD8A 2XZTG 3NAWA 3CSTA 2AVPA 3FUHA 1MHQA 4AY6A 2EINE 4FU3A 3AS5A 2VJ8A 4GYYA 5EIDA 5BT1A 5FQ6A 1JPLA 4GTQA 4A3TA 2ETAA 1KPSB 1UN8A 4U0ZA 4BETA 4HLEA 2Y69E 2VSNA 2HM8A 4U8VD 1WM5A 2PQNA 4WWNA 3NQPA 3ULYA 2MRIA 3AU4A 3GZ1A 2XRYA 4I9EA 2RKKA 3TWXA 3QNKA 2R5SA 4UI9C 4C0MA 4G25A 2WXIA 3PZDA 2ETCA 4DLQA 5HS0A 4BSZB 5T4YA 4TUUA 3I5PA 4BT8A 3VTYA 1DVPA 2CG2A 1H6PA 5CMWA 4HS2A 1K8KG 1N95A 4I1OB 3AG1E 3FTUA 3UX4A 2Y4UA 1L5JA 4G1TA 4EHMA 5AENA 3Q73A 4AJWA 4EECA 3D9HA 1Y8MA 3TXNA 2OEVA 4CT0A 3KEZA 4BX8A 4HB5A 1LF8A 4PDXA 1A17A 3V2OA 3NOGD 4GTPA 2IQCA 1RW2A 3UM0A 3RJVA 2GGFA 1QQEA 1UOHA 5KJLA 3HXCA 4BTBA 3ZIMA 3LVQE 4UWFA 1IQRA 4U7EB 3CVWA 3FWVA 1DC2A 2H6GA 3DSTA 5C1DA 2P9UG 3N71A 2FBNA 3T5VA 3ML9A 2LXLA 2IOLA 4HRMB 3AG3E 1JCRA 3FUKA 3E33A 3SQVA 1Z3YA 2H6IA 3B7BA 3DXMG 2FEZA 3CIAA 2WVIA 1TEZA 3MEKA 1B89A 2DVWA 4GA0A 4GTOA 3LY7A 4GPKA 1N0QA 3V31A 1MYOA 3G2UA 4LG6A 3PNTB 4L23A 5FZRA 3UQ3A 4V3IA 1DCQA 5JJ7A 3L6AA 3FEXA 2YINA 3CQGB 1P5QA 4Q96A 4TXQA 5D0QD 2LO6A 1BPOA 3ESLA 5KJNA 5ANLA 3QARA 1HE8A 4ACKA 4Y6WA 4D10C 2X38A 4JD2G 4BWRA 2LXMA 2DCPA 5BPPA 3IEGA 3LKUA 4L1BA 3MA5A 1SVXA 1E8XA 3CR3A 4A63B 2C0MA 3ZYQA 4APOA 3ZUVB 3J5PA 3FU6A 2XENA 3PZ3A 5CCMA 4JHJA 2GRMA 1TNZA 3FU5A 2WXOA 3NOCD 2FULA 3L13A 2DYRE 5HQ8A 2IFUA 4ATGA 2WPVA 4GZ3A 1UW4B 2CFUA 3UM3A 2VSYA 1NI1A 4JEUA 2KBXA
chains in the Genus database with same CATH topology
1LTXA 3PZ4A 3DSXA 1D8EA 1KZPA 3PZ2A 1JCSA 3SFXA 2R2LA 3Q7FA 4GTOA 4LNGA 3DPYA 3E34A 3E37A 3E32A 1TN6A 3SFYA 2BEDA 1D8DA 1N4QA 1DCEA 3HXEA 1O5MA 1N4SA 4GTRA 1TN8A 1KZOA 3C72A 1O1TA 1N95A 3HXFA 1FT1A 3HXBA 3KSLA 4MBGA 4GTTA 2IEJA 1TNOA 1FPPA 1S64A 2H6FA 4EHMA 3DSSA 3DRAA 3DSUA 3Q75A 4GTVA 2H6HA 1SA4A 3E30A 1X81A 3Q73A 1TN7A 2ZISA 4GTSA 3DSWA 3Q7AA 3HXDA 3KSQA 1LD8A 1N4PA 2ZIRA 4GTPA 1SA5A 1TNYA 3EU5A 4LNBA 3HXCA 1TNBA 3DSVA 1QBQA 4GTQA 1S63A 1LD7A 1NL4A 2F0YA 3Q79A 1N4RA 2H6GA 1O1RA 3DSTA 3EUVA 4YDOA 1TNUA 3PZ3A 1JCQA 4YDEA 1TNZA 1O1SA 4GTMA 1MZCA 1JCRA 1N94A 3PZ1A 1FT2A 4L9PA 3E33A 1NI1A 2H6IA 1N9AA 3Q78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTX A;  3PZ4 A;  3DSX A;  1D8E A;  1KZP A;  3PZ2 A;  1JCS A;  3SFX A;  2R2L A;  3Q7F A;  4GTO A;  4LNG A;  3DPY A;  3E34 A;  3E37 A;  3E32 A;  1TN6 A;  3SFY A;  2BED A;  1D8D A;  1N4Q A;  1DCE A;  3HXE A;  1O5M A;  1N4S A;  4GTR A;  1TN8 A;  1KZO A;  3C72 A;  1O1T A;  1N95 A;  3HXF A;  1FT1 A;  3HXB A;  3KSL A;  4MBG A;  4GTT A;  2IEJ A;  1TNO A;  1FPP A;  1S64 A;  2H6F A;  4EHM A;  3DSS A;  3DRA A;  3DSU A;  3Q75 A;  4GTV A;  2H6H A;  1SA4 A;  3E30 A;  1X81 A;  3Q73 A;  1TN7 A;  2ZIS A;  4GTS A;  3DSW A;  3Q7A A;  3HXD A;  3KSQ A;  1LD8 A;  1N4P A;  2ZIR A;  4GTP A;  1SA5 A;  1TNY A;  3EU5 A;  4LNB A;  3HXC A;  1TNB A;  3DSV A;  1QBQ A;  4GTQ A;  1S63 A;  1LD7 A;  1NL4 A;  2F0Y A;  3Q79 A;  1N4R A;  2H6G A;  1O1R A;  3DST A;  3EUV A;  4YDO A;  1TNU A;  3PZ3 A;  1JCQ A;  4YDE A;  1TNZ A;  1O1S A;  4GTM A;  1MZC A;  1JCR A;  1N94 A;  3PZ1 A;  1FT2 A;  4L9P A;  3E33 A;  1NI1 A;  2H6I A;  1N9A A;  3Q78 A; 
#chains in the Genus database with same CATH topology
 1LTX A;  2CHW A;  3JYS A;  4JB8 P;  4B8A A;  4UI9 K;  2XPY A;  2L9B A;  4H7X A;  4ZHB A;  2UWJ G;  1S0P A;  3MV3 B;  3G2V A;  3FUD A;  5CBN A;  3B7S A;  1TN6 A;  3RK6 A;  4FJY A;  3QWP A;  4N3B A;  2WMN A;  1U2V G;  5M72 A;  1G3N B;  4L2Y A;  5EDS A;  1QNF A;  2OVF A;  2P9S G;  3Q5M A;  5KCM A;  3PVL A;  1VDY A;  4O1O A;  3DSS A;  2MYO A;  2P9I G;  4I2W A;  2NXP A;  3EHR A;  1SZA A;  2XS8 A;  2BKG A;  2DZO A;  4PS3 A;  5BUZ A;  2AXZ A;  2GW1 A;  4L7T A;  2LUH A;  1OWL A;  2XRZ A;  2EIJ E;  3CHQ A;  3CVL A;  3JQ0 A;  2E2E A;  1TNY A;  4M7C A;  1MQS A;  4PH4 B;  4BT9 A;  1NL4 A;  1JUQ A;  2WXL A;  1WG0 A;  1WAO 1;  3RSE G;  4HXI A;  2F8X K;  4UQZ A;  4JA9 A;  3ENE A;  2ION A;  3B7T A;  2V4H C;  5AAR A;  3BEE A;  4RSY A;  1HG5 A;  1UN9 A;  4GPM A;  2RD0 A;  3IHV A;  3UT8 A;  5FIN A;  3NZS A;  4CDN A;  5D66 A;  3UXG A;  3EHN A;  2L6J A;  3EDT B;  3AG4 E;  3Q15 A;  4GZ6 A;  4BX9 A;  5ENQ D;  4CCA A;  2IJG X;  5G05 C;  5LFA A;  4E6H A;  4GTR A;  3RRU A;  2XGO A;  4J7W A;  2LSV A;  4FLH A;  3FUF A;  1OWP A;  1S64 A;  3ZNG A;  1IQU A;  1N11 A;  4N3C A;  1ZU2 A;  2PL2 A;  4R7L A;  3FY4 A;  3HHM A;  2XPZ A;  4H7Y A;  1WY6 A;  1OCO E;  5G55 A;  2X6K A;  4UUC A;  1AWC B;  2ZIR A;  4BTA A;  2WQ7 A;  4J8E A;  3LJN A;  4CGV A;  3FTY A;  4LER A;  3D9O A;  5CED B;  3L82 A;  2QY7 A;  2J9Q A;  3QOU A;  2YQ8 A;  2V5Q C;  4C9B B;  4B89 A;  3VTX A;  2L0I A;  5JHA A;  3QDN A;  3D9L A;  5D2M C;  3FP3 A;  3CEQ A;  4GTM A;  3FH8 A;  4F3V A;  2HR2 A;  3RIB A;  5EKQ D;  4W9R A;  3UT4 A;  3NF1 A;  5B1B E;  3OXL A;  1H2U A;  4JXT A;  5ENP D;  3KD7 A;  1TR4 A;  3UM1 A;  5EIB E;  3UMV A;  3PDN A;  1MJ0 A;  1TJF A;  1TJC A;  3SFZ A;  2P9P G;  4ILI A;  4G26 A;  3E4B A;  1DNP A;  1OWM A;  5LCW C;  3Q9U C;  2BKK B;  1HFA A;  5CRU A;  4DX5 D;  1SW6 A;  4EZK A;  3ONL A;  1E90 A;  5JA4 D;  4BFR A;  2VSX E;  4GAA A;  3R9A B;  1OT8 A;  3ZKJ A;  4DLO A;  1FCH A;  3Q9N C;  3C5R A;  2H6H A;  3E30 A;  2JLB A;  4YVQ C;  1PAQ A;  3SD5 A;  4GYO A;  3AG2 E;  5CBO A;  4XKB A;  1WDY A;  3FTX A;  3TWQ A;  2CG3 A;  1N54 A;  2DBA A;  3FTZ A;  1JWG A;  2CFZ A;  4HOT A;  3AAA C;  4YDW A;  4XI9 A;  2XCB A;  4ANU A;  4ABN A;  3EUV A;  3D9I A;  4U8H A;  3VLF A;  3ZVV A;  3QWW A;  3D9J A;  3AS8 A;  3G2T A;  4YND A;  5FWQ A;  4I6J A;  5J90 A;  3ZHE B;  2IOS A;  3FTS A;  2KCK A;  3PH0 C;  3SGH A;  3I4G A;  2R02 A;  3EIJ A;  1FVH A;  2MHK A;  1Y6I A;  4U95 D;  4ANV A;  5AJD A;  4EBA A;  4E85 A;  3FH5 A;  3TGO A;  2AWI A;  1H0A A;  5KNH D;  3QKY A;  2UY1 A;  2GRP B;  1O5M A;  4FLB A;  2PM6 A;  4YDY A;  2PNN A;  1EPU A;  2ZGG A;  2MOW A;  4FC8 A;  2E0I A;  4CYM D;  4FHJ A;  1QYM A;  2WXP A;  3KEA A;  2WXM A;  1YYH A;  4KVM A;  1E7V A;  4HOS A;  4QFV A;  2F37 A;  3ABK E;  3APD A;  5AQB A;  3EHM A;  2J4B A;  2GRQ B;  4B93 B;  5DBK A;  4K03 A;  4EZJ A;  3NZU A;  1SA5 A;  3TWV A;  3ML8 A;  3JUE A;  4CGW A;  3CGH A;  2P58 C;  4JA7 A;  4DX6 D;  2BUG A;  1V55 E;  4KBQ A;  3EJN A;  4YDO A;  5D0O D;  4B8C B;  3L17 A;  4YDE A;  3PUJ A;  4IRU A;  3FEY A;  5KWD A;  4FP7 A;  1HX8 A;  2IU1 A;  3RAU A;  3ASD A;  4LNU D;  3PE3 A;  3FU0 A;  4OVV A;  4BY6 A;  2UY1 B;  4TUM A;  3LEW A;  4XEI G;  5AAO A;  2AXU A;  1IXV A;  1IKN D;  3AU5 A;  1D8E A;  3ASN E;  1KZP A;  2X6I A;  1NA3 A;  1V54 E;  3LS8 A;  3L22 A;  4JPS A;  3SZ7 A;  4HRL A;  5KBA A;  3ZPJ A;  3LPZ A;  3ZFW A;  2B6C A;  2WXN A;  3CHS A;  4A1G A;  1U3C A;  1K1B A;  2J49 A;  3TWR A;  3SNX A;  1XNF A;  5AYW D;  5IY5 E;  4GMR A;  3IHY A;  4U8Y D;  3JQ1 A;  3B95 A;  2AW6 A;  5LOZ A;  4AV7 A;  2I9C A;  1TN7 A;  4CEM A;  3C3Q A;  4J8S A;  2ZIS A;  4EZL A;  3UM2 A;  2IF4 A;  2XQ0 A;  3V2X A;  3CKC A;  4JVS A;  3FUI A;  5AN8 A;  1K1A A;  5ITZ F;  2LAH A;  5KJM A;  5H7P A;  4GA1 A;  2L0T B;  2XZD G;  2KCV A;  1N0R A;  3HYM B;  3CK9 A;  3ZYM A;  3GZS A;  2GRL A;  2XEE A;  4FHK A;  2RFA A;  4J8Y A;  3T9K A;  2KC7 A;  4PS7 A;  3WG7 E;  4O60 A;  3RO3 A;  2DWZ A;  1JCQ A;  3CVQ A;  2PZI A;  3RO2 A;  1KT1 A;  3CHO A;  3ULQ A;  3ZXS A;  1NFI E;  2P9N G;  4DI3 A;  3TG5 A;  3D9K A;  2OND A;  2DYS E;  1ZBP A;  3QK0 A;  4GZ5 A;  3SHF A;  4HLL A;  1OWN A;  2I6H A;  3E34 A;  2R03 A;  1BI7 B;  5FJY A;  4UI9 J;  3LDZ A;  4I9C A;  2BED A;  4GZC A;  1N4Q A;  3UKR G;  3Q47 B;  4OAU C;  4IUL A;  3RRM B;  5DIZ A;  5HKP A;  4ACL A;  4ME2 A;  5EN5 D;  5J08 A;  3RU0 A;  5AJL A;  1RZ4 A;  4N5C A;  1SA4 A;  3BG1 B;  1Q2Z A;  2QYJ A;  4NRH B;  5EX0 A;  1IHG A;  2I1J A;  3PUK A;  4J6I A;  4EQF A;  5FZS A;  2R17 C;  3OXG A;  1IHB A;  4EPZ A;  4QQI A;  2V4L A;  3ZGQ A;  4Y6C A;  4CT4 A;  1QBQ A;  2I1K A;  2P9L G;  2YHC A;  3DWL G;  3CSF A;  3L9T A;  4PS8 A;  4K0R A;  2J4D A;  3Q79 A;  4G23 A;  4TXP A;  3U4T A;  3WXX A;  4KVO A;  3QC1 A;  4TRQ A;  1EYH A;  4DI4 A;  3I3N A;  5BV0 A;  3G2S A;  4DPR A;  4RLY A;  2QYU A;  1FVF A;  5CMY A;  2EQX A;  3D9N A;  5T8I A;  2XCC A;  4G24 A;  4N3A A;  1HU3 A;  2J08 A;  3ULE G;  4AXH A;  3MV2 B;  1OUV A;  4C0E A;  4UWL A;  4N2Q A;  2P9K G;  4FA6 A;  2AJA A;  4LNG A;  2WXF A;  3DPY A;  3CVU A;  3L08 A;  2NSZ A;  2R59 A;  3EU9 A;  5ANR A;  4LCT A;  1N4S A;  1TN8 A;  1ZB1 A;  2L6B A;  2V0P A;  5FT9 A;  1FT1 A;  1OY3 D;  1H2V C;  2BF0 X;  3DRA A;  3Q75 A;  5HRY A;  4F1P A;  4GA2 A;  4GTV A;  3ZXP A;  4UWG A;  2VGX A;  3SI5 A;  4KZC A;  5EX3 A;  3T8M A;  4KXK B;  4KYO B;  3FH7 A;  4BEP A;  4KT6 B;  3TXM A;  2AXV A;  5FQ7 A;  3UUX A;  2XEH A;  3CKB A;  4LNB A;  2QC9 A;  1S63 A;  3U64 A;  4U63 A;  1TYQ G;  3P1U A;  3UIN C;  1W3B A;  3S7B A;  1BI8 B;  3GZ2 A;  1O1S A;  1OCZ E;  3HG0 D;  4JL0 A;  1H6O A;  3AS4 A;  4EBA G;  3PZ1 A;  4U96 D;  5BXO A;  5EYP F;  3ZN3 A;  1PY1 A;  3V79 K;  5BW8 C;  4HOR A;  4DK5 A;  1INZ A;  1NA0 A;  2WXG A;  2NC9 A;  3FFL A;  3ZW3 A;  1JCS A;  1E96 B;  4K5A B;  2KM4 A;  4JEH A;  3G2W A;  4K5C A;  2HE0 A;  1YMP A;  2A5U A;  2VSO E;  4GZD A;  4HRN A;  1ELR A;  3ISM C;  1AP7 A;  2VGX B;  4TV3 A;  1BLX B;  5KNG A;  4B94 A;  2OOE A;  2WXK A;  1BD8 A;  3DEP A;  5LP0 A;  2RG8 A;  4XI0 A;  2J09 A;  3DSW A;  3PEU B;  3U66 A;  4P29 A;  2VGY A;  2BTD A;  2WQ6 A;  3UPV A;  1SQM A;  3C98 A;  4YVO A;  5ENS D;  4L2L A;  4RVB A;  3APC A;  3FU3 A;  4DX2 A;  1X5B A;  5ARF A;  4I1A A;  1HF8 A;  5JJ6 A;  4HFG A;  3FHE A;  2YHE A;  2LSU A;  3FUJ A;  1N4R A;  4ZFH A;  2B0O E;  3KAE A;  2HYZ A;  4JW1 A;  3F6Q A;  2C0L A;  1PC2 A;  4HBD A;  3SBT B;  3UIO C;  2WXQ A;  5FIO A;  3ZU7 B;  4U0U A;  3BQO A;  4WNF A;  3T5X A;  3ONK A;  4AY5 A;  3LY9 A;  4GU5 A;  4O6F A;  3IV0 A;  3P2B A;  3TL5 A;  2Y4T A;  4F6R D;  3BU8 A;  1OCR E;  5BNW A;  3SFY A;  3HXE A;  3MGB A;  2CHZ A;  4ATZ D;  3AJI A;  3R7Q A;  4B0Z A;  5G05 J;  2Y0B G;  1OCC E;  2FF4 A;  2M63 A;  4KZ0 A;  4CDR A;  3TAX A;  5CEC B;  4U07 A;  3D9M A;  2CHX A;  3NB2 A;  2IO3 C;  3V30 A;  3MYV A;  3ASG A;  3Q7A A;  1Z3X A;  3HXD A;  4HOQ A;  3CVX A;  1OXJ A;  3B7R L;  3RKV A;  3IXE A;  3EU5 A;  4OYS A;  2GRR B;  1NZN A;  2EIK E;  4BSX A;  4I2Z A;  3CV0 A;  4UQX A;  3TWW A;  1TNU A;  2ETB A;  3APF A;  5AIJ A;  4CRW A;  1S70 B;  3UIP C;  4CDM A;  1XGW A;  2JAB A;  4NIK A;  3MZL B;  4I43 A;  2VTB A;  3OXF A;  2OCC E;  5BV1 A;  4GMJ A;  3B7U X;  5E75 A;  4UWK A;  2YNQ A;  3JXJ A;  5CHE E;  3B13 A;  4AVX A;  3Q7F A;  2FI7 A;  3E32 A;  3S7F A;  1E8Y A;  3QAQ A;  4F53 A;  4ILG A;  1DCE A;  4LRZ A;  3ZYL A;  1EDU A;  4WNG A;  3L54 A;  5E76 A;  1HH8 A;  2XHE A;  2DZN A;  3HXF A;  1MX4 A;  4N39 A;  1KLX A;  3HXB A;  3ABM E;  1TNO A;  3TWS A;  3HRA A;  4Q94 A;  4WUY A;  5LCW J;  3MKQ A;  1EF1 C;  1X81 A;  2WXR A;  1UJJ A;  1HG2 A;  3OTN A;  4CZ2 D;  1ELK A;  4PUC A;  2KXP C;  5EYL A;  2LNI A;  4HVB A;  4TXR A;  4RG9 A;  3HVE A;  1A5E A;  3KS2 A;  3FUM A;  3URZ A;  4OAV B;  2PM7 A;  4WND A;  2C2L A;  3W9G A;  2X6H A;  3DSV A;  1UG3 A;  3FUL A;  3TG4 A;  3FTV A;  2X6F A;  4Z68 A;  5G04 J;  3UT7 A;  3CVN A;  2VTB B;  3HIZ A;  2VQ2 A;  3MKR A;  4BER A;  5FQ4 A;  3GYZ A;  2DIW A;  4ANW A;  2QZA A;  1MZC A;  3CLJ A;  1MX2 A;  3ZEF A;  3W9F A;  2Q7F A;  3PE4 A;  2WQH A;  4I6E A;  1N9A A;  4FUL A;  4UWH A;  4RQI A;  4IN3 B;  3IBE A;  2WXJ A;  3SY2 A;  3S7D A;  1JWF A;  3LYA A;  3S2A A;  4BES A;  3E37 A;  1UJK A;  3D9P A;  3ZYK A;  1QZ2 A;  4DX7 D;  2J8S D;  3MKQ B;  2KZT A;  3FUN A;  4M3O A;  1HZ4 A;  4NAC A;  4HI9 A;  3J5Q B;  4HOU A;  5A23 A;  4C48 B;  5JJT A;  3CHM A;  2QFC A;  2XS1 A;  5G2N A;  3R7R A;  3DSU A;  3HVE B;  3FDH A;  5C2Y A;  1HO8 A;  4DJA A;  1NP7 A;  2R05 A;  3PRE A;  4HQD A;  3TWU A;  3S7J A;  4APF A;  3CVV A;  5A7D B;  1HXI A;  1N4P A;  5FQ8 A;  2Y3A A;  2HO1 A;  4XZ4 A;  3EIQ C;  1HS6 A;  3CQC B;  3SO8 A;  3X2Q E;  4DX1 A;  4JHR A;  2OVB A;  1Z5S C;  2ILR A;  1SZ9 A;  4I17 A;  1LD7 A;  3IKO B;  3CHR A;  3L16 A;  3D3M A;  5FZQ A;  5FTP A;  4OVU A;  2V8S E;  2XGS A;  1H6K A;  2VYI A;  3MJW A;  4JZY A;  4GB9 A;  1H19 A;  1IYG A;  1N94 A;  4UQY A;  1E8W A;  4AM9 A;  4L9P A;  4MRU A;  2KAT A;  1MX6 A;  2KZT B;  2EIM E;  2IO2 C;  2ZU6 B;  3JXI A;  2XGM A;  3ABL E;  3FTW A;  2F8Y A;  5T3R A;  4U0S A;  3CVP A;  3JUI A;  1E7U A;  5JHB A;  4LUN U;  4RG6 A;  4FAD A;  4URK A;  1N52 A;  1O1T A;  3GW4 A;  4AIF A;  4F7A A;  3PRZ A;  3TJP A;  4N5Q A;  3PEV B;  3I4R B;  2VGE A;  4XX5 A;  2LAI A;  2KCL A;  3K9I A;  4XE0 A;  3UKU G;  5BXU A;  5AQ7 A;  4U04 A;  3T8K A;  4GML A;  1OWO A;  3TWT A;  2WMO A;  2GRN B;  3QJZ A;  3QWV A;  4X8Q A;  4HNA D;  3LY8 A;  1GW6 A;  2A4Z A;  4WAF A;  1TNB A;  4G11 A;  3C3R A;  2JEK A;  3EHQ A;  1O1R A;  5LX8 A;  4MLP A;  3SF4 A;  5ENN A;  3UTM A;  3JCK C;  4JC8 A;  4JHK A;  3U9W A;  4K5B A;  3VLE A;  2OEW A;  3PZ4 A;  5ENR D;  3DBS A;  4AP2 A;  3ASF A;  3PNL B;  2V5F A;  2OV8 A;  3PS6 A;  3SFX A;  4GCO A;  4N2S A;  4A55 A;  4WNE A;  5ARG A;  5AQA A;  2IY0 C;  5EIL A;  3MX3 A;  3OAW A;  3MCX A;  3CK7 A;  4IYP A;  3BUA A;  2ZGD A;  5CEA A;  2PQR A;  1KZO A;  3R9M A;  4I6G A;  2A5E A;  2X6J A;  3VLD A;  1U3D A;  3KSL A;  4MS6 A;  4MBG A;  4GTT A;  4G8L A;  1YCS B;  3O4Z A;  1K3Z D;  3DXK G;  4G8K A;  4A3V A;  3ESK A;  1H2T C;  4GTS A;  4AEZ C;  2Y1L E;  5B1A E;  4MKT A;  2NYJ A;  3CK8 A;  3BG0 B;  4XKC A;  4XIF A;  2XEV A;  4Q69 A;  3NBN B;  3UI2 A;  5KJK A;  2ZXW E;  2WB2 A;  4O1P A;  4I1M A;  1YA0 A;  5CER B;  4WWP A;  3LXU X;  2J07 A;  2F0Y A;  4J0U A;  1D9S A;  1E8Z A;  4FJZ A;  2GRO B;  4A1S A;  3QB2 A;  4WWO A;  3U3W A;  1KT0 A;  3CHP A;  2XPI A;  5JMN D;  5CRV A;  3ZHE A;  3ZRH A;  5ENT D;  4AOF A;  2RFM A;  2EIL E;  4F1S A;  3SBS A;  2I2O A;  1FT2 A;  2P2C P;  4ANX A;  4DRX E;  2FO7 A;  3Q78 A;  3DEO A;  3HDX A;  5HI7 A;  4GYW A;  3ASO E;  4G2V A;  3C3O A;  3DSX A;  3PZ2 A;  5CCL A;  3CVY A;  2R2L A;  3RRN B;  1ELW A;  1D8D A;  2FO1 E;  4J8F A;  3FUE A;  3LVR E;  4NQ0 A;  1Z6T A;  4HI8 A;  4ILH B;  4LSZ E;  5B3S E;  1BU9 A;  4NUR A;  3C72 A;  2X3M A;  3Q49 B;  4J8D A;  5AQ9 A;  4DUI A;  4LEU A;  5A6C A;  2IEJ A;  1FPP A;  3LCA A;  3DPD A;  5G04 C;  2H6F A;  4GCN A;  3O48 A;  3ASH A;  4KMO A;  2WM9 A;  5ENO D;  3LJ3 A;  2WXH A;  3Q4A B;  3KSQ A;  1LD8 A;  2XZT G;  3NAW A;  3CST A;  2AVP A;  3FUH A;  1MHQ A;  4AY6 A;  2EIN E;  4FU3 A;  3AS5 A;  2VJ8 A;  4GYY A;  5EID A;  5BT1 A;  5FQ6 A;  1JPL A;  4GTQ A;  4A3T A;  2ETA A;  1KPS B;  1UN8 A;  4U0Z A;  4BET A;  4HLE A;  2Y69 E;  2VSN A;  2HM8 A;  4U8V D;  1WM5 A;  2PQN A;  4WWN A;  3NQP A;  3ULY A;  2MRI A;  3AU4 A;  3GZ1 A;  2XRY A;  4I9E A;  2RKK A;  3TWX A;  3QNK A;  2R5S A;  4UI9 C;  4C0M A;  4G25 A;  2WXI A;  3PZD A;  2ETC A;  4DLQ A;  5HS0 A;  4BSZ B;  5T4Y A;  4TUU A;  3I5P A;  4BT8 A;  3VTY A;  1DVP A;  2CG2 A;  1H6P A;  5CMW A;  4HS2 A;  1K8K G;  1N95 A;  4I1O B;  3AG1 E;  3FTU A;  3UX4 A;  2Y4U A;  1L5J A;  4G1T A;  4EHM A;  5AEN A;  3Q73 A;  4AJW A;  4EEC A;  3D9H A;  1Y8M A;  3TXN A;  2OEV A;  4CT0 A;  3KEZ A;  4BX8 A;  4HB5 A;  1LF8 A;  4PDX A;  1A17 A;  3V2O A;  3NOG D;  4GTP A;  2IQC A;  1RW2 A;  3UM0 A;  3RJV A;  2GGF A;  1QQE A;  1UOH A;  5KJL A;  3HXC A;  4BTB A;  3ZIM A;  3LVQ E;  4UWF A;  1IQR A;  4U7E B;  3CVW A;  3FWV A;  1DC2 A;  2H6G A;  3DST A;  5C1D A;  2P9U G;  3N71 A;  2FBN A;  3T5V A;  3ML9 A;  2LXL A;  2IOL A;  4HRM B;  3AG3 E;  1JCR A;  3FUK A;  3E33 A;  3SQV A;  1Z3Y A;  2H6I A;  3B7B A;  3DXM G;  2FEZ A;  3CIA A;  2WVI A;  1TEZ A;  3MEK A;  1B89 A;  2DVW A;  4GA0 A;  4GTO A;  3LY7 A;  4GPK A;  1N0Q A;  3V31 A;  1MYO A;  3G2U A;  4LG6 A;  3PNT B;  4L23 A;  5FZR A;  3UQ3 A;  4V3I A;  1DCQ A;  5JJ7 A;  3L6A A;  3FEX A;  2YIN A;  3CQG B;  1P5Q A;  4Q96 A;  4TXQ A;  5D0Q D;  2LO6 A;  1BPO A;  3ESL A;  5KJN A;  5ANL A;  3QAR A;  1HE8 A;  4ACK A;  4Y6W A;  4D10 C;  2X38 A;  4JD2 G;  4BWR A;  2LXM A;  2DCP A;  5BPP A;  3IEG A;  3LKU A;  4L1B A;  3MA5 A;  1SVX A;  1E8X A;  3CR3 A;  4A63 B;  2C0M A;  3ZYQ A;  4APO A;  3ZUV B;  3J5P A;  3FU6 A;  2XEN A;  3PZ3 A;  5CCM A;  4JHJ A;  2GRM A;  1TNZ A;  3FU5 A;  2WXO A;  3NOC D;  2FUL A;  3L13 A;  2DYR E;  5HQ8 A;  2IFU A;  4ATG A;  2WPV A;  4GZ3 A;  1UW4 B;  2CFU A;  3UM3 A;  2VSY A;  1NI1 A;  4JEU A;  2KBX A; 
#chains in the Genus database with same CATH homology
 1LTX A;  3PZ4 A;  3DSX A;  1D8E A;  1KZP A;  3PZ2 A;  1JCS A;  3SFX A;  2R2L A;  3Q7F A;  4GTO A;  4LNG A;  3DPY A;  3E34 A;  3E37 A;  3E32 A;  1TN6 A;  3SFY A;  2BED A;  1D8D A;  1N4Q A;  1DCE A;  3HXE A;  1O5M A;  1N4S A;  4GTR A;  1TN8 A;  1KZO A;  3C72 A;  1O1T A;  1N95 A;  3HXF A;  1FT1 A;  3HXB A;  3KSL A;  4MBG A;  4GTT A;  2IEJ A;  1TNO A;  1FPP A;  1S64 A;  2H6F A;  4EHM A;  3DSS A;  3DRA A;  3DSU A;  3Q75 A;  4GTV A;  2H6H A;  1SA4 A;  3E30 A;  1X81 A;  3Q73 A;  1TN7 A;  2ZIS A;  4GTS A;  3DSW A;  3Q7A A;  3HXD A;  3KSQ A;  1LD8 A;  1N4P A;  2ZIR A;  4GTP A;  1SA5 A;  1TNY A;  3EU5 A;  4LNB A;  3HXC A;  1TNB A;  3DSV A;  1QBQ A;  4GTQ A;  1S63 A;  1LD7 A;  1NL4 A;  2F0Y A;  3Q79 A;  1N4R A;  2H6G A;  1O1R A;  3DST A;  3EUV A;  4YDO A;  1TNU A;  3PZ3 A;  1JCQ A;  4YDE A;  1TNZ A;  1O1S A;  4GTM A;  1MZC A;  1JCR A;  1N94 A;  3PZ1 A;  1FT2 A;  4L9P A;  3E33 A;  1NI1 A;  2H6I A;  1N9A A;  3Q78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...