3Q73A

Cryptococcus neoformans protein farnesyltransferase, apo enzyme
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
330
structure length
316
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSDPLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase, alpha subunit
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase
total genus 127
structure length 316
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q73A00
1O1TA 1JCQA 1TNUA 3DSXA 1N4RA 3Q78A 4MBGA 1KZPA 3Q75A 3DSSA 1D8DA 1S63A 2H6HA 3PZ4A 3EU5A 3HXFA 2ZIRA 4LNBA 4YDEA 1S64A 1TN8A 3Q79A 1LD7A 3DSVA 1LD8A 1LTXA 3E37A 1D8EA 4GTSA 4GTQA 3E32A 3E34A 4GTRA 1TNBA 3DSWA 3PZ3A 1KZOA 1N9AA 3E30A 1SA5A 3HXDA 3PZ1A 3Q73A 1N4PA 4GTMA 3SFYA 1JCSA 3DPYA 2IEJA 3Q7FA 1FT2A 3KSQA 2H6FA 3SFXA 1FT1A 1QBQA 1N94A 2ZISA 1N4QA 4GTPA 3E33A 3KSLA 2H6IA 2R2LA 4EHMA 1O1RA 1FPPA 1N95A 3DSUA 2F0YA 3EUVA 1JCRA 1NI1A 4GTVA 4LNGA 1O5MA 1O1SA 4GTOA 1TNOA 1MZCA 3DSTA 3Q7AA 1X81A 4YDOA 3HXEA 1TNZA 1TN7A 4L9PA 1TN6A 1N4SA 3DRAA 4GTTA 2BEDA 2H6GA 1TNYA 3PZ2A 1DCEA 1NL4A 3HXCA 3C72A 3HXBA 1SA4A
chains in the Genus database with same CATH superfamily
4GB9A 1K3ZD 4JW1A 1MHQA 2KZTB 3DWLG 4CT0A 3AJIA 2QC9A 4FHJA 2QY7A 2RFAA 5KJNA 2LXLA 1S64A 4ZFHA 4CDMA 3HHMA 4HB5A 3KAEA 4WNDA 5CBNA 1JUQA 4N2QA 1INZA 1TNBA 5D66A 4CGWA 2PQRA 3QWWA 3ONLA 4U8HA 3R9AB 3GZ1A 2BTDA 4G2VA 4JZYA 1E8YA 5KJKA 4FU3A 1DCQA 5G05J 1E90A 3AG1E 3UMVA 4HBDA 4GMJA 2X38A 4W9RA 2LUHA 5EDSA 5EIDA 3UQ3A 2VYIA 3I3NA 2L6JA 3L13A 4O1PA 5G04C 4BY6A 5A23A 3UXGA 5E76A 1RW2A 1OWNA 5DIZA 4XEIG 4U0ZA 4KMOA 3PH0C 4CDNA 3PZ2A 2LSUA 3UT8A 5BUZA 2M63A 4WUYA 5AN8A 4PS8A 2XRZA 1K1AA 2WXNA 3B7RL 2AXUA 4YDWA 3PDNA 3CVLA 1SQMA 2NXPA 4GZ5A 3UPVA 4F7AA 1MQSA 2PZIA 2XCCA 1PY1A 3CVXA 3NOGD 4GA0A 4EZLA 4N5CA 3CVUA 1LF8A 4D10C 2DZOA 2QYUA 1HG5A 2HE0A 1OT8A 3E34A 4OYSA 3UM1A 4WNFA 1PAQA 5ENOD 2EIKE 4QQIA 3HXDA 5EX3A 1NZNA 2ZGGA 4DX2A 1HE8A 2YINA 1IHGA 1YYHA 4HNAD 4EBAA 3PEUB 3OXGA 3FEYA 4A55A 2X6HA 5T3RA 4KT6B 3P2BA 3ZXPA 4HFGA 3Q4AB 2CHWA 4GAAA 1YCSB 4BTAA 2XEHA 2GRQB 3EHNA 5FQ6A 3R9MA 4CCAA 4EPZA 3LPZA 3JUEA 5KNGA 1E8XA 3D9LA 3SFZA 2IQCA 4JHKA 5G2NA 2WXFA 3CKCA 2R59A 1UOHA 3MZLB 1KZPA 2VQ2A 2WVIA 4BEPA 3CHMA 5ENQD 4G26A 4LUNU 1V54E 3L08A 3W9FA 1EF1C 2CHZA 1YMPA 2WM9A 4K5BA 2GROB 3FHEA 1D8EA 2J8SD 3G2TA 4I6GA 3AG4E 3FTUA 4UWFA 2WXQA 2WB2A 1HU3A 1N94A 3ML8A 1N4QA 4DI4A 4JA9A 4EZJA 4I1AA 1AP7A 1H2TC 4NQ0A 4RSYA 5CBOA 3PUJA 5G05C 3SD5A 3ULYA 4GYWA 1E8WA 5FTPA 4IYPA 3QOUA 3ZU7B 2P9NG 2FF4A 3WXXA 1E8ZA 3QAQA 4AEZC 4J8EA 5KNHD 3CVPA 3ZYKA 3HXEA 3FU3A 1FVFA 2P58C 1HZ4A 2FBNA 3K9IA 4TUMA 5E75A 4ZHBA 5BPPA 2Y4UA 3EHQA 3L54A 3EHRA 5FZRA 1KPSB 2NC9A 5CEAA 3D9HA 3BQOA 4ILGA 1BLXB 4A3TA 3JQ0A 4I9CA 3DSSA 1S63A 4HLLA 2I6HA 4ILIA 2LSVA 3LYAA 3AAAC 3FUJA 4L7TA 3CSTA 2FEZA 3RK6A 1LD8A 3D9IA 4KZCA 1IHBA 1V55E 5JJ7A 4OVVA 3RO2A 3JXIA 3JQ1A 4JVSA 2L0IA 4AVXA 1IQRA 3CHQA 3KSQA 3FUIA 3C5RA 2P9IG 4FHKA 2HO1A 5EKQD 4GTPA 2H6IA 2R2LA 4ACKA 1O1RA 2DCPA 5CRVA 2PM7A 3SBTB 3ASGA 1WM5A 4TXQA 4KXKB 3PRZA 4XE0A 4FA6A 2F8XK 2VSXE 1WY6A 2LXMA 1FVHA 3LY8A 3T8KA 3U64A 5CERB 2LO6A 2XQ0A 3Q49B 3ASFA 5CECB 2YNQA 4G23A 2WXGA 4DPRA 5ENRD 4BX8A 1S0PA 4UI9K 3ASDA 5CEDB 1ELKA 2ETCA 5EYLA 4I2ZA 3X2QE 3O4ZA 3LEWA 4TXRA 3VLDA 3LVRE 2F8YA 1N4RA 3FH8A 3Q78A 3IHVA 4EECA 4KZ0A 4UQZA 3CV0A 1VDYA 3DEOA 3MKRA 2A4ZA 1Y8MA 2UY1A 4GPKA 1H6OA 1Z5SC 3J5PA 2GGFA 1LTXA 1RZ4A 4K5CA 3UI2A 5ARGA 4GTQA 3E32A 3PS6A 5AQ9A 3B7BA 4CT4A 2VSOE 1N9AA 2J07A 3T8MA 1YA0A 3IEGA 5EIBE 1QBQA 4HORA 2WXLA 2KBXA 3E33A 5BNWA 2XHEA 1TJFA 3OXLA 1FPPA 1QZ2A 2R02A 4OVUA 3W9GA 4A1GA 4UQYA 4XI9A 3FU6A 2BUGA 3URZA 1SZ9A 3PNTB 1HX8A 2XS1A 2PNNA 5LX8A 4U04A 5HRYA 4F3VA 4WNEA 2LAHA 4WWOA 3JXJA 1H2VC 3LXUX 2VTBA 4ANUA 3HXCA 5FZSA 3ESKA 1FCHA 1QYMA 5EILA 3D9KA 5AQAA 3Q5MA 1TJCA 3GZSA 3TWQA 4G24A 2IFUA 1DVPA 1MX2A 5KWDA 1HF8A 3CK9A 3ZKJA 3U3WA 4BX9A 3RRNB 3HVEA 5ENTD 2V8SE 2ZIRA 3ZYQA 3SBSA 4UWLA 4UUCA 1MYOA 2IONA 5EX0A 4ATGA 1EDUA 3LDZA 3FULA 3FU0A 4C9BB 2XGMA 4R7LA 3TWWA 2CG2A 2XPZA 4GTMA 4HS2A 4L2LA 1JCSA 1E7VA 3Q7FA 4APOA 5FINA 1TYQG 4GA1A 3RRMB 1NA0A 3APCA 1JWGA 3EU9A 5AQ7A 3DSUA 3CVQA 5CCMA 4G1TA 4LNGA 5J90A 3AU4A 5LCWJ 4X8QA 4WNGA 3FUKA 4H7XA 2RFMA 3SQVA 4TUUA 3UT7A 2OV8A 2VJ8A 4GU5A 2WMNA 3ZHEB 4I6JA 4YDOA 3QARA 5AARA 1TNZA 5JHAA 3MKQA 3CLJA 1N52A 2JLBA 2YHEA 5HKPA 5KBAA 2YHCA 1Z3YA 3KEZA 4HOUA 4I17A 4XKCA 3S7FA 3ABKE 4GMRA 5B1BE 3ESLA 2QYJA 3UKRG 4ABNA 3MV2B 4H7YA 1B89A 1OWMA 5ARFA 4PH4B 4PUCA 3CHOA 4LNBA 4U63A 2I1JA 2J4BA 1UN9A 4CDRA 4BERA 3FTYA 3DSVA 4F1PA 4P29A 4FULA 3RO3A 4XIFA 2WXJA 4GTSA 4G11A 4F6RD 4APFA 4DUIA 4U0SA 3TWRA 3ENEA 2X3MA 3ZNGA 2WXOA 5FWQA 4YDYA 3TWUA 3TJPA 2VSYA 3NB2A 3MYVA 2R03A 4QFVA 4JEUA 2JABA 3FP3A 1L5JA 4BFRA 3LCAA 3MCXA 2VSNA 2Y1LE 4DX6D 4N39A 1BI7B 4UWHA 4GTTA 2BEDA 3NZUA 1KT0A 1N11A 3D9MA 3QWPA 1NL4A 3B13A 4B8CB 3Q9NC 4URKA 4JL0A 2MRIA 3CK8A 3PREA 2DYRE 3U9WA 3L6AA 3BG1B 3ABLE 4A3VA 1K8KG 1BPOA 3KEAA 4AM9A 3CR3A 3SHFA 1UJJA 4HOQA 1SZAA 3TAXA 4CYMD 5D2MC 1A5EA 4C0MA 2HM8A 5FIOA 4CEMA 2KZTA 3OAWA 4J8FA 4G25A 3Q73A 3J5QB 3DPYA 2J9QA 3TXNA 3SFXA 5FQ7A 4HRLA 2ZISA 3TG4A 2ZU6B 3CQCB 4EZKA 4U7EB 2XGSA 3QDNA 2V4HC 2ZXWE 3BEEA 5BV1A 4LCTA 4JPSA 3S2AA 4BSZB 2OVFA 1O1SA 4LSZE 1U2VG 3CVVA 4NACA 2IOLA 1XGWA 2XZDG 2I1KA 5LCWC 4L9PA 2DZNA 1Z6TA 4FADA 3UM3A 4K0RA 1W3BA 4BETA 4B8AA 1E96B 2H6GA 1OWPA 2XCBA 3ONKA 2OEVA 3T5XA 1H2UA 1UW4B 2XS8A 4B94A 4KVMA 1TR4A 2KXPC 3TWSA 4LERA 2QFCA 2X6KA 2FULA 4F1SA 3HXFA 5JA4D 4L2YA 3I4GA 1OCZE 2WQ6A 3UM2A 3ML9A 1IXVA 3O48A 3GYZA 3PZ3A 2NYJA 3V2XA 4PDXA 3LS8A 2GW1A 4G8KA 4I6EA 4A63B 2VGXB 1WAO1 4EQFA 4Q96A 2WQHA 1FT1A 3GZ2A 4O60A 3SY2A 4U0UA 3WG7E 3FH7A 4L1BA 4LEUA 2I9CA 4EHMA 4BT9A 1OUVA 3APDA 1H6KA 1H19A 1UN8A 1JCRA 1BU9A 4HOTA 1DC2A 3B7SA 1IKND 1QQEA 3D9PA 4FLBA 4JC8A 2GRNB 2C0MA 4JA7A 3EDTB 1OCRE 3DSTA 2EIJE 2XPIA 2EIME 1JPLA 1TN6A 2HYZA 4BTBA 2BKGA 3G2VA 2UWJG 3NF1A 3S7DA 1OWOA 1DNPA 2J4DA 3L17A 4UWGA 3QC1A 2NSZA 3ZVVA 5FQ4A 1NP7A 2DVWA 3Q9UC 1KLXA 3HG0D 4O6FA 4U8VD 4ANXA 4KBQA 2X6FA 3RIBA 3DXMG 2Y0BG 3FTXA 5A7DB 3C3RA 2XRYA 4B0ZA 3AS5A 3AS8A 3ASOE 4EBAG 4ANWA 4GZCA 5AQBA 5JJTA 4TRQA 4E85A 4Y6CA 3APFA 4HQDA 5KJLA 1IQUA 3RJVA 3VTXA 2EINE 4B93B 2PL2A 4YVQC 2ETBA 2FO7A 4C48B 4JEHA 1FT2A 4FJYA 2AXZA 4BESA 3ZEFA 3TWVA 3V79K 3QK0A 3OXFA 3SNXA 2IF4A 4UI9J 3CGHA 4DJAA 1TNOA 2OCCE 3UIPC 3LVQE 5LP0A 4PS7A 4NIKA 5KCMA 3G2SA 4GYYA 3DBSA 5B3SE 2Y3AA 3FTZA 5AAOA 2X6IA 4BWRA 2C2LA 2WQ7A 2XEEA 3AG3E 1O1TA 5BXOA 4MKTA 4KYOB 2L6BA 2P9KG 3FWVA 3HDXA 5C1DA 4OAVB 3CKBA 3DXKG 4GZDA 3IKOB 3LJ3A 3VLFA 5JHBA 4AY5A 2OOEA 4M7CA 3B7UX 5HI7A 3Q15A 4RLYA 4B89A 2X6JA 1KZOA 3DPDA 2A5EA 2KCLA 2V4LA 5CMWA 3BG0B 4DK5A 4FLHA 3PZ1A 3S7JA 5BT1A 3HYMB 2XENA 2V5QC 5C2YA 5AJDA 2IY0C 4DLQA 2Q7FA 3UX4A 3FH5A 3L9TA 4A1SA 2RD0A 2P2CP 3UT4A 1X5BA 4U96D 4GTVA 3ZIMA 3D9JA 3PE3A 4WWPA 5FT9A 1ZU2A 5H7PA 1MZCA 4AJWA 4J8YA 5ENPD 4DX5D 4J8SA 1OWLA 4GYOA 3ZYMA 1TEZA 3V2OA 4JHJA 3RRUA 4M3OA 2P9SG 1SW6A 1BD8A 1KT1A 2R5SA 2OEWA 3GW4A 4K03A 2ZGDA 4CRWA 2KCVA 3U66A 3TGOA 4N5QA 1PC2A 2CFUA 3ULEG 1QNFA 3L82A 1TNUA 2V5FA 2GRPB 3ASNE 3Q75A 4HI8A 4XZ4A 5A6CA 4JB8P 3HRAA 2B6CA 3E4BA 3QKYA 4FP7A 4Z68A 1SVXA 1MJ0A 4AOFA 3IHYA 3FUFA 3VLEA 2GRRB 3VTYA 5DBKA 5AYWD 2HR2A 3MX3A 4I1MA 2WXIA 3ZGQA 3EIJA 1N4PA 1ZBPA 2RKKA 5T4YA 3U4TA 1K1BA 4J8DA 4AXHA 3MEKA 3CEQA 3PEVB 2KCKA 1XNFA 3C98A 1HO8A 1N0RA 2XZTG 2DYSE 4JHRA 1P5QA 2CG3A 3ULQA 3FEXA 4UI9C 4AP2A 1U3DA 4GA2A 4U8YD 5AJLA 4UQXA 1TN7A 4DRXE 3QWVA 3NZSA 2MHKA 4ME2A 4HRMB 4MLPA 2AWIA 1BI8B 3TWTA 1Y6IA 3KS2A 3MA5A 3HXBA 3EIQC 1MX4A 2ILRA 3PE4A 2R17C 4RVBA 3P1UA 1HS6A 5B1AE 3FTVA 3UM0A 4GCNA 2LNIA 1WG0A 4HXIA 1N54A 5CRUA 4CGVA 2H6HA 5D0QD 1NFIE 5ENSD 3EU5A 4HLEA 2Y69E 5FZQA 3CHRA 3FUDA 3UTMA 1ELWA 3EJNA 3ISMC 2JEKA 1TN8A 2YQ8A 3PZDA 3RKVA 4DX1A 4N2SA 4DLOA 4F53A 4ANVA 3SZ7A 3C3QA 4GTRA 3CK7A 2WXKA 4TV3A 3ZYLA 1HH8A 1SA5A 1U3CA 2FO1E 3CVNA 4XX5A 2EILE 3FTWA 4V3IA 3ABME 3FY4A 3ZN3A 2PQNA 4DX7D 4MRUA 4RG6A 4HOSA 2DBAA 3ZPJA 1OXJA 3B95A 3KSLA 2ETAA 3CSFA 4YNDA 3AS4A 3EUVA 2CFZA 2RG8A 2L0TB 2MOWA 3AG2E 1HXIA 3Q7AA 3PNLB 3ZUVB 3D3MA 2KC7A 4C0EA 3JCKC 2UY1B 3SI5A 4Q69A 3IXEA 3G2WA 3LJNA 5EN5D 4XI0A 3SO8A 4AIFA 4U07A 5LOZA 4E6HA 3UUXA 3KD7A 3ASHA 4TXPA 4FC8A 3DRAA 3LY7A 1ZB1A 3I5PA 3JUIA 4N3CA 2R05A 3T5VA 4RQIA 3ZHEA 2GRMA 3L16A 2BKKB 2IOSA 2J49A 3EHMA 4BT8A 3SGHA 4OAUC 5AIJA 4YDEA 5HQ8A 3MV3B 1LD7A 4Q94A 3QJZA 5T8IA 1A17A 2J08A 3IV0A 4LNUD 4I9EA 3V31A 3E30A 4BSXA 3HIZA 1H0AA 5CMYA 5AENA 1UJKA 1NA3A 3D9OA 4I2WA 1G3NB 3I4RB 2VTBB 2WPVA 2QZAA 1WDYA 3QB2A 2GRLA 1HFAA 4ILHB 1AWCB 3TWXA 2C0LA 3N71A 3NAWA 5IY5E 4K5AB 2AXVA 3C3OA 2ONDA 3TXMA 3HVEB 1OY3D 4IULA 2OVBA 1TNYA 4YVOA 3FUHA 4Y6WA 4O1OA 2E2EA 5FJYA 1JWFA 4RG9A 1JCQA 4GCOA 3PUKA 3RU0A 5JMND 5G55A 1H6PA 4MBGA 4PS3A 4CZ2D 4JD2G 2DIWA 3FU5A 2P9PG 5CHEE 2IO3C 2AW6A 3PZ4A 5J08A 4U95D 3L22A 4G8LA 4FJZA 4HRNA 3Q79A 4N3AA 1EYHA 3CVWA 4IRUA 4LRZA 2AJAA 2PM6A 1IYGA 4UWKA 3QNKA 5ENNA 4I1OB 2FI7A 4I43A 1S70B 1GW6A 2IEJA 4GZ3A 3MKQB 5G04J 1Q2ZA 4NURA 2P9UG 3AU5A 3IBEA 1D9SA 4AY6A 2CHXA 4MS6A 2B0OE 2F0YA 1NI1A 4LG6A 1O5MA 4AV7A 4GTOA 1ELRA 5FQ8A 3ZXSA 3JYSA 5ANLA 1X81A 3F6QA 2J09A 2L9BA 5BV0A 2XPYA 3FUMA 3TG5A 3V30A 3ZFWA 2WXRA 5CCLA 2Y4TA 2AVPA 2BF0X 3FUNA 3NQPA 3C72A 5JJ6A 2VGEA 1SA4A 3FDHA 3CVYA 3NOCD 4HVBA 1EPUA 3UINC 3DSXA 4HI9A 4KVOA 3FFLA 1HG2A 3S7BA 3R7RA 3MGBA 1D8DA 5EYPF 4WAFA 3TL5A 2EQXA 5M72A 3UIOC 3D9NA 3CHPA 3UKUG 5HS0A 1OCCE 3T9KA 4J7WA 2A5UA 3CQGB 4J0UA 4JXTA 2IU1A 4ACLA 3OTNA 4NRHB 2XGOA 3E37A 2E0IA 4DI3A 2XEVA 3G2UA 3SF4A 2WMOA 3BU8A 3NBNB 3DSWA 3MJWA 2DWZA 2WXHA 3SFYA 3ZW3A 2H6FA 4GZ6A 3B7TA 3R7QA 4N3BA 5BXUA 5ANRA 4GPMA 1MX6A 1OCOE 2LAIA 3CHSA 4L23A 3ZRHA 1N95A 3CIAA 2KM4A 2P9LG 2MYOA 2WXMA 3PVLA 2IO2C 2WXPA 4J6IA 2VGYA 2KATA 5KJMA 3LY9A 4IN3B 3RSEG 3FUEA 4WWNA 5LFAA 2VGXA 3FTSA 5D0OD 3Q47B 1UG3A 1Z3XA 1N4SA 4GMLA 2I2OA 5ITZF 3BUAA 2IJGX 2F37A 2V0PA 3LKUA 3DEPA 3RAUA 4ATZD 1DCEA 1E7UA 4XKBA 5BW8C 1N0QA
chains in the Genus database with same CATH topology
1O1TA 1JCQA 1TNUA 3DSXA 1N4RA 3Q78A 4MBGA 1KZPA 3Q75A 3DSSA 1D8DA 1S63A 2H6HA 3PZ4A 3EU5A 3HXFA 2ZIRA 4LNBA 4YDEA 1S64A 1TN8A 3Q79A 1LD7A 3DSVA 1LD8A 1LTXA 3E37A 1D8EA 4GTSA 4GTQA 3E32A 3E34A 4GTRA 1TNBA 3DSWA 3PZ3A 1KZOA 1N9AA 3E30A 1SA5A 3HXDA 3PZ1A 3Q73A 1N4PA 4GTMA 3SFYA 1JCSA 3DPYA 2IEJA 3Q7FA 1FT2A 3KSQA 2H6FA 3SFXA 1FT1A 1QBQA 1N94A 2ZISA 1N4QA 4GTPA 3E33A 3KSLA 2H6IA 2R2LA 4EHMA 1O1RA 1FPPA 1N95A 3DSUA 2F0YA 3EUVA 1JCRA 1NI1A 4GTVA 4LNGA 1O5MA 1O1SA 4GTOA 1TNOA 1MZCA 3DSTA 3Q7AA 1X81A 4YDOA 3HXEA 1TNZA 1TN7A 4L9PA 1TN6A 1N4SA 3DRAA 4GTTA 2BEDA 2H6GA 1TNYA 3PZ2A 1DCEA 1NL4A 3HXCA 3C72A 3HXBA 1SA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O1T A;  1JCQ A;  1TNU A;  3DSX A;  1N4R A;  3Q78 A;  4MBG A;  1KZP A;  3Q75 A;  3DSS A;  1D8D A;  1S63 A;  2H6H A;  3PZ4 A;  3EU5 A;  3HXF A;  2ZIR A;  4LNB A;  4YDE A;  1S64 A;  1TN8 A;  3Q79 A;  1LD7 A;  3DSV A;  1LD8 A;  1LTX A;  3E37 A;  1D8E A;  4GTS A;  4GTQ A;  3E32 A;  3E34 A;  4GTR A;  1TNB A;  3DSW A;  3PZ3 A;  1KZO A;  1N9A A;  3E30 A;  1SA5 A;  3HXD A;  3PZ1 A;  3Q73 A;  1N4P A;  4GTM A;  3SFY A;  1JCS A;  3DPY A;  2IEJ A;  3Q7F A;  1FT2 A;  3KSQ A;  2H6F A;  3SFX A;  1FT1 A;  1QBQ A;  1N94 A;  2ZIS A;  1N4Q A;  4GTP A;  3E33 A;  3KSL A;  2H6I A;  2R2L A;  4EHM A;  1O1R A;  1FPP A;  1N95 A;  3DSU A;  2F0Y A;  3EUV A;  1JCR A;  1NI1 A;  4GTV A;  4LNG A;  1O5M A;  1O1S A;  4GTO A;  1TNO A;  1MZC A;  3DST A;  3Q7A A;  1X81 A;  4YDO A;  3HXE A;  1TNZ A;  1TN7 A;  4L9P A;  1TN6 A;  1N4S A;  3DRA A;  4GTT A;  2BED A;  2H6G A;  1TNY A;  3PZ2 A;  1DCE A;  1NL4 A;  3HXC A;  3C72 A;  3HXB A;  1SA4 A; 
#chains in the Genus database with same CATH topology
 4GB9 A;  1K3Z D;  4JW1 A;  1MHQ A;  2KZT B;  3DWL G;  4CT0 A;  3AJI A;  2QC9 A;  4FHJ A;  2QY7 A;  2RFA A;  5KJN A;  2LXL A;  1S64 A;  4ZFH A;  4CDM A;  3HHM A;  4HB5 A;  3KAE A;  4WND A;  5CBN A;  1JUQ A;  4N2Q A;  1INZ A;  1TNB A;  5D66 A;  4CGW A;  2PQR A;  3QWW A;  3ONL A;  4U8H A;  3R9A B;  3GZ1 A;  2BTD A;  4G2V A;  4JZY A;  1E8Y A;  5KJK A;  4FU3 A;  1DCQ A;  5G05 J;  1E90 A;  3AG1 E;  3UMV A;  4HBD A;  4GMJ A;  2X38 A;  4W9R A;  2LUH A;  5EDS A;  5EID A;  3UQ3 A;  2VYI A;  3I3N A;  2L6J A;  3L13 A;  4O1P A;  5G04 C;  4BY6 A;  5A23 A;  3UXG A;  5E76 A;  1RW2 A;  1OWN A;  5DIZ A;  4XEI G;  4U0Z A;  4KMO A;  3PH0 C;  4CDN A;  3PZ2 A;  2LSU A;  3UT8 A;  5BUZ A;  2M63 A;  4WUY A;  5AN8 A;  4PS8 A;  2XRZ A;  1K1A A;  2WXN A;  3B7R L;  2AXU A;  4YDW A;  3PDN A;  3CVL A;  1SQM A;  2NXP A;  4GZ5 A;  3UPV A;  4F7A A;  1MQS A;  2PZI A;  2XCC A;  1PY1 A;  3CVX A;  3NOG D;  4GA0 A;  4EZL A;  4N5C A;  3CVU A;  1LF8 A;  4D10 C;  2DZO A;  2QYU A;  1HG5 A;  2HE0 A;  1OT8 A;  3E34 A;  4OYS A;  3UM1 A;  4WNF A;  1PAQ A;  5ENO D;  2EIK E;  4QQI A;  3HXD A;  5EX3 A;  1NZN A;  2ZGG A;  4DX2 A;  1HE8 A;  2YIN A;  1IHG A;  1YYH A;  4HNA D;  4EBA A;  3PEU B;  3OXG A;  3FEY A;  4A55 A;  2X6H A;  5T3R A;  4KT6 B;  3P2B A;  3ZXP A;  4HFG A;  3Q4A B;  2CHW A;  4GAA A;  1YCS B;  4BTA A;  2XEH A;  2GRQ B;  3EHN A;  5FQ6 A;  3R9M A;  4CCA A;  4EPZ A;  3LPZ A;  3JUE A;  5KNG A;  1E8X A;  3D9L A;  3SFZ A;  2IQC A;  4JHK A;  5G2N A;  2WXF A;  3CKC A;  2R59 A;  1UOH A;  3MZL B;  1KZP A;  2VQ2 A;  2WVI A;  4BEP A;  3CHM A;  5ENQ D;  4G26 A;  4LUN U;  1V54 E;  3L08 A;  3W9F A;  1EF1 C;  2CHZ A;  1YMP A;  2WM9 A;  4K5B A;  2GRO B;  3FHE A;  1D8E A;  2J8S D;  3G2T A;  4I6G A;  3AG4 E;  3FTU A;  4UWF A;  2WXQ A;  2WB2 A;  1HU3 A;  1N94 A;  3ML8 A;  1N4Q A;  4DI4 A;  4JA9 A;  4EZJ A;  4I1A A;  1AP7 A;  1H2T C;  4NQ0 A;  4RSY A;  5CBO A;  3PUJ A;  5G05 C;  3SD5 A;  3ULY A;  4GYW A;  1E8W A;  5FTP A;  4IYP A;  3QOU A;  3ZU7 B;  2P9N G;  2FF4 A;  3WXX A;  1E8Z A;  3QAQ A;  4AEZ C;  4J8E A;  5KNH D;  3CVP A;  3ZYK A;  3HXE A;  3FU3 A;  1FVF A;  2P58 C;  1HZ4 A;  2FBN A;  3K9I A;  4TUM A;  5E75 A;  4ZHB A;  5BPP A;  2Y4U A;  3EHQ A;  3L54 A;  3EHR A;  5FZR A;  1KPS B;  2NC9 A;  5CEA A;  3D9H A;  3BQO A;  4ILG A;  1BLX B;  4A3T A;  3JQ0 A;  4I9C A;  3DSS A;  1S63 A;  4HLL A;  2I6H A;  4ILI A;  2LSV A;  3LYA A;  3AAA C;  3FUJ A;  4L7T A;  3CST A;  2FEZ A;  3RK6 A;  1LD8 A;  3D9I A;  4KZC A;  1IHB A;  1V55 E;  5JJ7 A;  4OVV A;  3RO2 A;  3JXI A;  3JQ1 A;  4JVS A;  2L0I A;  4AVX A;  1IQR A;  3CHQ A;  3KSQ A;  3FUI A;  3C5R A;  2P9I G;  4FHK A;  2HO1 A;  5EKQ D;  4GTP A;  2H6I A;  2R2L A;  4ACK A;  1O1R A;  2DCP A;  5CRV A;  2PM7 A;  3SBT B;  3ASG A;  1WM5 A;  4TXQ A;  4KXK B;  3PRZ A;  4XE0 A;  4FA6 A;  2F8X K;  2VSX E;  1WY6 A;  2LXM A;  1FVH A;  3LY8 A;  3T8K A;  3U64 A;  5CER B;  2LO6 A;  2XQ0 A;  3Q49 B;  3ASF A;  5CEC B;  2YNQ A;  4G23 A;  2WXG A;  4DPR A;  5ENR D;  4BX8 A;  1S0P A;  4UI9 K;  3ASD A;  5CED B;  1ELK A;  2ETC A;  5EYL A;  4I2Z A;  3X2Q E;  3O4Z A;  3LEW A;  4TXR A;  3VLD A;  3LVR E;  2F8Y A;  1N4R A;  3FH8 A;  3Q78 A;  3IHV A;  4EEC A;  4KZ0 A;  4UQZ A;  3CV0 A;  1VDY A;  3DEO A;  3MKR A;  2A4Z A;  1Y8M A;  2UY1 A;  4GPK A;  1H6O A;  1Z5S C;  3J5P A;  2GGF A;  1LTX A;  1RZ4 A;  4K5C A;  3UI2 A;  5ARG A;  4GTQ A;  3E32 A;  3PS6 A;  5AQ9 A;  3B7B A;  4CT4 A;  2VSO E;  1N9A A;  2J07 A;  3T8M A;  1YA0 A;  3IEG A;  5EIB E;  1QBQ A;  4HOR A;  2WXL A;  2KBX A;  3E33 A;  5BNW A;  2XHE A;  1TJF A;  3OXL A;  1FPP A;  1QZ2 A;  2R02 A;  4OVU A;  3W9G A;  4A1G A;  4UQY A;  4XI9 A;  3FU6 A;  2BUG A;  3URZ A;  1SZ9 A;  3PNT B;  1HX8 A;  2XS1 A;  2PNN A;  5LX8 A;  4U04 A;  5HRY A;  4F3V A;  4WNE A;  2LAH A;  4WWO A;  3JXJ A;  1H2V C;  3LXU X;  2VTB A;  4ANU A;  3HXC A;  5FZS A;  3ESK A;  1FCH A;  1QYM A;  5EIL A;  3D9K A;  5AQA A;  3Q5M A;  1TJC A;  3GZS A;  3TWQ A;  4G24 A;  2IFU A;  1DVP A;  1MX2 A;  5KWD A;  1HF8 A;  3CK9 A;  3ZKJ A;  3U3W A;  4BX9 A;  3RRN B;  3HVE A;  5ENT D;  2V8S E;  2ZIR A;  3ZYQ A;  3SBS A;  4UWL A;  4UUC A;  1MYO A;  2ION A;  5EX0 A;  4ATG A;  1EDU A;  3LDZ A;  3FUL A;  3FU0 A;  4C9B B;  2XGM A;  4R7L A;  3TWW A;  2CG2 A;  2XPZ A;  4GTM A;  4HS2 A;  4L2L A;  1JCS A;  1E7V A;  3Q7F A;  4APO A;  5FIN A;  1TYQ G;  4GA1 A;  3RRM B;  1NA0 A;  3APC A;  1JWG A;  3EU9 A;  5AQ7 A;  3DSU A;  3CVQ A;  5CCM A;  4G1T A;  4LNG A;  5J90 A;  3AU4 A;  5LCW J;  4X8Q A;  4WNG A;  3FUK A;  4H7X A;  2RFM A;  3SQV A;  4TUU A;  3UT7 A;  2OV8 A;  2VJ8 A;  4GU5 A;  2WMN A;  3ZHE B;  4I6J A;  4YDO A;  3QAR A;  5AAR A;  1TNZ A;  5JHA A;  3MKQ A;  3CLJ A;  1N52 A;  2JLB A;  2YHE A;  5HKP A;  5KBA A;  2YHC A;  1Z3Y A;  3KEZ A;  4HOU A;  4I17 A;  4XKC A;  3S7F A;  3ABK E;  4GMR A;  5B1B E;  3ESL A;  2QYJ A;  3UKR G;  4ABN A;  3MV2 B;  4H7Y A;  1B89 A;  1OWM A;  5ARF A;  4PH4 B;  4PUC A;  3CHO A;  4LNB A;  4U63 A;  2I1J A;  2J4B A;  1UN9 A;  4CDR A;  4BER A;  3FTY A;  3DSV A;  4F1P A;  4P29 A;  4FUL A;  3RO3 A;  4XIF A;  2WXJ A;  4GTS A;  4G11 A;  4F6R D;  4APF A;  4DUI A;  4U0S A;  3TWR A;  3ENE A;  2X3M A;  3ZNG A;  2WXO A;  5FWQ A;  4YDY A;  3TWU A;  3TJP A;  2VSY A;  3NB2 A;  3MYV A;  2R03 A;  4QFV A;  4JEU A;  2JAB A;  3FP3 A;  1L5J A;  4BFR A;  3LCA A;  3MCX A;  2VSN A;  2Y1L E;  4DX6 D;  4N39 A;  1BI7 B;  4UWH A;  4GTT A;  2BED A;  3NZU A;  1KT0 A;  1N11 A;  3D9M A;  3QWP A;  1NL4 A;  3B13 A;  4B8C B;  3Q9N C;  4URK A;  4JL0 A;  2MRI A;  3CK8 A;  3PRE A;  2DYR E;  3U9W A;  3L6A A;  3BG1 B;  3ABL E;  4A3V A;  1K8K G;  1BPO A;  3KEA A;  4AM9 A;  3CR3 A;  3SHF A;  1UJJ A;  4HOQ A;  1SZA A;  3TAX A;  4CYM D;  5D2M C;  1A5E A;  4C0M A;  2HM8 A;  5FIO A;  4CEM A;  2KZT A;  3OAW A;  4J8F A;  4G25 A;  3Q73 A;  3J5Q B;  3DPY A;  2J9Q A;  3TXN A;  3SFX A;  5FQ7 A;  4HRL A;  2ZIS A;  3TG4 A;  2ZU6 B;  3CQC B;  4EZK A;  4U7E B;  2XGS A;  3QDN A;  2V4H C;  2ZXW E;  3BEE A;  5BV1 A;  4LCT A;  4JPS A;  3S2A A;  4BSZ B;  2OVF A;  1O1S A;  4LSZ E;  1U2V G;  3CVV A;  4NAC A;  2IOL A;  1XGW A;  2XZD G;  2I1K A;  5LCW C;  4L9P A;  2DZN A;  1Z6T A;  4FAD A;  3UM3 A;  4K0R A;  1W3B A;  4BET A;  4B8A A;  1E96 B;  2H6G A;  1OWP A;  2XCB A;  3ONK A;  2OEV A;  3T5X A;  1H2U A;  1UW4 B;  2XS8 A;  4B94 A;  4KVM A;  1TR4 A;  2KXP C;  3TWS A;  4LER A;  2QFC A;  2X6K A;  2FUL A;  4F1S A;  3HXF A;  5JA4 D;  4L2Y A;  3I4G A;  1OCZ E;  2WQ6 A;  3UM2 A;  3ML9 A;  1IXV A;  3O48 A;  3GYZ A;  3PZ3 A;  2NYJ A;  3V2X A;  4PDX A;  3LS8 A;  2GW1 A;  4G8K A;  4I6E A;  4A63 B;  2VGX B;  1WAO 1;  4EQF A;  4Q96 A;  2WQH A;  1FT1 A;  3GZ2 A;  4O60 A;  3SY2 A;  4U0U A;  3WG7 E;  3FH7 A;  4L1B A;  4LEU A;  2I9C A;  4EHM A;  4BT9 A;  1OUV A;  3APD A;  1H6K A;  1H19 A;  1UN8 A;  1JCR A;  1BU9 A;  4HOT A;  1DC2 A;  3B7S A;  1IKN D;  1QQE A;  3D9P A;  4FLB A;  4JC8 A;  2GRN B;  2C0M A;  4JA7 A;  3EDT B;  1OCR E;  3DST A;  2EIJ E;  2XPI A;  2EIM E;  1JPL A;  1TN6 A;  2HYZ A;  4BTB A;  2BKG A;  3G2V A;  2UWJ G;  3NF1 A;  3S7D A;  1OWO A;  1DNP A;  2J4D A;  3L17 A;  4UWG A;  3QC1 A;  2NSZ A;  3ZVV A;  5FQ4 A;  1NP7 A;  2DVW A;  3Q9U C;  1KLX A;  3HG0 D;  4O6F A;  4U8V D;  4ANX A;  4KBQ A;  2X6F A;  3RIB A;  3DXM G;  2Y0B G;  3FTX A;  5A7D B;  3C3R A;  2XRY A;  4B0Z A;  3AS5 A;  3AS8 A;  3ASO E;  4EBA G;  4ANW A;  4GZC A;  5AQB A;  5JJT A;  4TRQ A;  4E85 A;  4Y6C A;  3APF A;  4HQD A;  5KJL A;  1IQU A;  3RJV A;  3VTX A;  2EIN E;  4B93 B;  2PL2 A;  4YVQ C;  2ETB A;  2FO7 A;  4C48 B;  4JEH A;  1FT2 A;  4FJY A;  2AXZ A;  4BES A;  3ZEF A;  3TWV A;  3V79 K;  3QK0 A;  3OXF A;  3SNX A;  2IF4 A;  4UI9 J;  3CGH A;  4DJA A;  1TNO A;  2OCC E;  3UIP C;  3LVQ E;  5LP0 A;  4PS7 A;  4NIK A;  5KCM A;  3G2S A;  4GYY A;  3DBS A;  5B3S E;  2Y3A A;  3FTZ A;  5AAO A;  2X6I A;  4BWR A;  2C2L A;  2WQ7 A;  2XEE A;  3AG3 E;  1O1T A;  5BXO A;  4MKT A;  4KYO B;  2L6B A;  2P9K G;  3FWV A;  3HDX A;  5C1D A;  4OAV B;  3CKB A;  3DXK G;  4GZD A;  3IKO B;  3LJ3 A;  3VLF A;  5JHB A;  4AY5 A;  2OOE A;  4M7C A;  3B7U X;  5HI7 A;  3Q15 A;  4RLY A;  4B89 A;  2X6J A;  1KZO A;  3DPD A;  2A5E A;  2KCL A;  2V4L A;  5CMW A;  3BG0 B;  4DK5 A;  4FLH A;  3PZ1 A;  3S7J A;  5BT1 A;  3HYM B;  2XEN A;  2V5Q C;  5C2Y A;  5AJD A;  2IY0 C;  4DLQ A;  2Q7F A;  3UX4 A;  3FH5 A;  3L9T A;  4A1S A;  2RD0 A;  2P2C P;  3UT4 A;  1X5B A;  4U96 D;  4GTV A;  3ZIM A;  3D9J A;  3PE3 A;  4WWP A;  5FT9 A;  1ZU2 A;  5H7P A;  1MZC A;  4AJW A;  4J8Y A;  5ENP D;  4DX5 D;  4J8S A;  1OWL A;  4GYO A;  3ZYM A;  1TEZ A;  3V2O A;  4JHJ A;  3RRU A;  4M3O A;  2P9S G;  1SW6 A;  1BD8 A;  1KT1 A;  2R5S A;  2OEW A;  3GW4 A;  4K03 A;  2ZGD A;  4CRW A;  2KCV A;  3U66 A;  3TGO A;  4N5Q A;  1PC2 A;  2CFU A;  3ULE G;  1QNF A;  3L82 A;  1TNU A;  2V5F A;  2GRP B;  3ASN E;  3Q75 A;  4HI8 A;  4XZ4 A;  5A6C A;  4JB8 P;  3HRA A;  2B6C A;  3E4B A;  3QKY A;  4FP7 A;  4Z68 A;  1SVX A;  1MJ0 A;  4AOF A;  3IHY A;  3FUF A;  3VLE A;  2GRR B;  3VTY A;  5DBK A;  5AYW D;  2HR2 A;  3MX3 A;  4I1M A;  2WXI A;  3ZGQ A;  3EIJ A;  1N4P A;  1ZBP A;  2RKK A;  5T4Y A;  3U4T A;  1K1B A;  4J8D A;  4AXH A;  3MEK A;  3CEQ A;  3PEV B;  2KCK A;  1XNF A;  3C98 A;  1HO8 A;  1N0R A;  2XZT G;  2DYS E;  4JHR A;  1P5Q A;  2CG3 A;  3ULQ A;  3FEX A;  4UI9 C;  4AP2 A;  1U3D A;  4GA2 A;  4U8Y D;  5AJL A;  4UQX A;  1TN7 A;  4DRX E;  3QWV A;  3NZS A;  2MHK A;  4ME2 A;  4HRM B;  4MLP A;  2AWI A;  1BI8 B;  3TWT A;  1Y6I A;  3KS2 A;  3MA5 A;  3HXB A;  3EIQ C;  1MX4 A;  2ILR A;  3PE4 A;  2R17 C;  4RVB A;  3P1U A;  1HS6 A;  5B1A E;  3FTV A;  3UM0 A;  4GCN A;  2LNI A;  1WG0 A;  4HXI A;  1N54 A;  5CRU A;  4CGV A;  2H6H A;  5D0Q D;  1NFI E;  5ENS D;  3EU5 A;  4HLE A;  2Y69 E;  5FZQ A;  3CHR A;  3FUD A;  3UTM A;  1ELW A;  3EJN A;  3ISM C;  2JEK A;  1TN8 A;  2YQ8 A;  3PZD A;  3RKV A;  4DX1 A;  4N2S A;  4DLO A;  4F53 A;  4ANV A;  3SZ7 A;  3C3Q A;  4GTR A;  3CK7 A;  2WXK A;  4TV3 A;  3ZYL A;  1HH8 A;  1SA5 A;  1U3C A;  2FO1 E;  3CVN A;  4XX5 A;  2EIL E;  3FTW A;  4V3I A;  3ABM E;  3FY4 A;  3ZN3 A;  2PQN A;  4DX7 D;  4MRU A;  4RG6 A;  4HOS A;  2DBA A;  3ZPJ A;  1OXJ A;  3B95 A;  3KSL A;  2ETA A;  3CSF A;  4YND A;  3AS4 A;  3EUV A;  2CFZ A;  2RG8 A;  2L0T B;  2MOW A;  3AG2 E;  1HXI A;  3Q7A A;  3PNL B;  3ZUV B;  3D3M A;  2KC7 A;  4C0E A;  3JCK C;  2UY1 B;  3SI5 A;  4Q69 A;  3IXE A;  3G2W A;  3LJN A;  5EN5 D;  4XI0 A;  3SO8 A;  4AIF A;  4U07 A;  5LOZ A;  4E6H A;  3UUX A;  3KD7 A;  3ASH A;  4TXP A;  4FC8 A;  3DRA A;  3LY7 A;  1ZB1 A;  3I5P A;  3JUI A;  4N3C A;  2R05 A;  3T5V A;  4RQI A;  3ZHE A;  2GRM A;  3L16 A;  2BKK B;  2IOS A;  2J49 A;  3EHM A;  4BT8 A;  3SGH A;  4OAU C;  5AIJ A;  4YDE A;  5HQ8 A;  3MV3 B;  1LD7 A;  4Q94 A;  3QJZ A;  5T8I A;  1A17 A;  2J08 A;  3IV0 A;  4LNU D;  4I9E A;  3V31 A;  3E30 A;  4BSX A;  3HIZ A;  1H0A A;  5CMY A;  5AEN A;  1UJK A;  1NA3 A;  3D9O A;  4I2W A;  1G3N B;  3I4R B;  2VTB B;  2WPV A;  2QZA A;  1WDY A;  3QB2 A;  2GRL A;  1HFA A;  4ILH B;  1AWC B;  3TWX A;  2C0L A;  3N71 A;  3NAW A;  5IY5 E;  4K5A B;  2AXV A;  3C3O A;  2OND A;  3TXM A;  3HVE B;  1OY3 D;  4IUL A;  2OVB A;  1TNY A;  4YVO A;  3FUH A;  4Y6W A;  4O1O A;  2E2E A;  5FJY A;  1JWF A;  4RG9 A;  1JCQ A;  4GCO A;  3PUK A;  3RU0 A;  5JMN D;  5G55 A;  1H6P A;  4MBG A;  4PS3 A;  4CZ2 D;  4JD2 G;  2DIW A;  3FU5 A;  2P9P G;  5CHE E;  2IO3 C;  2AW6 A;  3PZ4 A;  5J08 A;  4U95 D;  3L22 A;  4G8L A;  4FJZ A;  4HRN A;  3Q79 A;  4N3A A;  1EYH A;  3CVW A;  4IRU A;  4LRZ A;  2AJA A;  2PM6 A;  1IYG A;  4UWK A;  3QNK A;  5ENN A;  4I1O B;  2FI7 A;  4I43 A;  1S70 B;  1GW6 A;  2IEJ A;  4GZ3 A;  3MKQ B;  5G04 J;  1Q2Z A;  4NUR A;  2P9U G;  3AU5 A;  3IBE A;  1D9S A;  4AY6 A;  2CHX A;  4MS6 A;  2B0O E;  2F0Y A;  1NI1 A;  4LG6 A;  1O5M A;  4AV7 A;  4GTO A;  1ELR A;  5FQ8 A;  3ZXS A;  3JYS A;  5ANL A;  1X81 A;  3F6Q A;  2J09 A;  2L9B A;  5BV0 A;  2XPY A;  3FUM A;  3TG5 A;  3V30 A;  3ZFW A;  2WXR A;  5CCL A;  2Y4T A;  2AVP A;  2BF0 X;  3FUN A;  3NQP A;  3C72 A;  5JJ6 A;  2VGE A;  1SA4 A;  3FDH A;  3CVY A;  3NOC D;  4HVB A;  1EPU A;  3UIN C;  3DSX A;  4HI9 A;  4KVO A;  3FFL A;  1HG2 A;  3S7B A;  3R7R A;  3MGB A;  1D8D A;  5EYP F;  4WAF A;  3TL5 A;  2EQX A;  5M72 A;  3UIO C;  3D9N A;  3CHP A;  3UKU G;  5HS0 A;  1OCC E;  3T9K A;  4J7W A;  2A5U A;  3CQG B;  4J0U A;  4JXT A;  2IU1 A;  4ACL A;  3OTN A;  4NRH B;  2XGO A;  3E37 A;  2E0I A;  4DI3 A;  2XEV A;  3G2U A;  3SF4 A;  2WMO A;  3BU8 A;  3NBN B;  3DSW A;  3MJW A;  2DWZ A;  2WXH A;  3SFY A;  3ZW3 A;  2H6F A;  4GZ6 A;  3B7T A;  3R7Q A;  4N3B A;  5BXU A;  5ANR A;  4GPM A;  1MX6 A;  1OCO E;  2LAI A;  3CHS A;  4L23 A;  3ZRH A;  1N95 A;  3CIA A;  2KM4 A;  2P9L G;  2MYO A;  2WXM A;  3PVL A;  2IO2 C;  2WXP A;  4J6I A;  2VGY A;  2KAT A;  5KJM A;  3LY9 A;  4IN3 B;  3RSE G;  3FUE A;  4WWN A;  5LFA A;  2VGX A;  3FTS A;  5D0O D;  3Q47 B;  1UG3 A;  1Z3X A;  1N4S A;  4GML A;  2I2O A;  5ITZ F;  3BUA A;  2IJG X;  2F37 A;  2V0P A;  3LKU A;  3DEP A;  3RAU A;  4ATZ D;  1DCE A;  1E7U A;  4XKB A;  5BW8 C;  1N0Q A; 
#chains in the Genus database with same CATH homology
 1O1T A;  1JCQ A;  1TNU A;  3DSX A;  1N4R A;  3Q78 A;  4MBG A;  1KZP A;  3Q75 A;  3DSS A;  1D8D A;  1S63 A;  2H6H A;  3PZ4 A;  3EU5 A;  3HXF A;  2ZIR A;  4LNB A;  4YDE A;  1S64 A;  1TN8 A;  3Q79 A;  1LD7 A;  3DSV A;  1LD8 A;  1LTX A;  3E37 A;  1D8E A;  4GTS A;  4GTQ A;  3E32 A;  3E34 A;  4GTR A;  1TNB A;  3DSW A;  3PZ3 A;  1KZO A;  1N9A A;  3E30 A;  1SA5 A;  3HXD A;  3PZ1 A;  3Q73 A;  1N4P A;  4GTM A;  3SFY A;  1JCS A;  3DPY A;  2IEJ A;  3Q7F A;  1FT2 A;  3KSQ A;  2H6F A;  3SFX A;  1FT1 A;  1QBQ A;  1N94 A;  2ZIS A;  1N4Q A;  4GTP A;  3E33 A;  3KSL A;  2H6I A;  2R2L A;  4EHM A;  1O1R A;  1FPP A;  1N95 A;  3DSU A;  2F0Y A;  3EUV A;  1JCR A;  1NI1 A;  4GTV A;  4LNG A;  1O5M A;  1O1S A;  4GTO A;  1TNO A;  1MZC A;  3DST A;  3Q7A A;  1X81 A;  4YDO A;  3HXE A;  1TNZ A;  1TN7 A;  4L9P A;  1TN6 A;  1N4S A;  3DRA A;  4GTT A;  2BED A;  2H6G A;  1TNY A;  3PZ2 A;  1DCE A;  1NL4 A;  3HXC A;  3C72 A;  3HXB A;  1SA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...