3Q7BA

Exonuclease domain of lassa virus nucleoprotein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
207
Chain Sequence
GFTAGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEKKKRGGKEEITPHCALMDCIMFDAAVSGGLVLRAVLPRDMVFRTSTPRVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Lassa virus nucleoprotein reveals a dsRNA-specific 3' to 5' exonuclease activity essential for immune suppression.
pubmed doi rcsb
source organism Lassa virus
molecule tags Hydrolase
molecule keywords Nucleoprotein
total genus 59
structure length 207
sequence length 210
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17290 Arena_ncap_C Arenavirus nucleocapsid C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3q7bA01
3Q7BA 4FVUA 3MWPA 4GV6A 3MX2A 4GVEA 4G9ZA 3MWTA 4GV3A 3MX5A 3R3LA 3Q7CA 4GV9A
chains in the Genus database with same CATH superfamily
1JLAA 1JXEA 5HBMA 4FJNA 3OY9A 2O8EA 3OS1A 3IFRA 3MX2A 2EX3A 3O9RA 4CFCA 5HOOA 2E6MA 1CZ9A 4B3OA 2O8FA 3SPYA 4IDHA 3O08A 3D0PA 4DTJA 3OYIA 1VQ8N 1VQ9N 2E2QA 4IOAL 3PX4A 4BWJA 2YJEA 5AZIA 4DV6K 3T7ZA 3PIPL 4DV1K 3IDHA 1RDUA 2WONA 3ATVA 3TAEA 1S3XA 3BGRA 1NKBA 2FSNA 3AO5A 3KWIA 3LDOA 1EQYA 2DFHA 3OYHA 1VSJA 3QEWA 1FKPA 3A2FA 3VMFB 4CZJA 4R79A 1NK6A 3V1OA 3WNHA 2IIRA 4GKKK 2PAVA 4KB0A 3H3OB 4M7YA 3CJAA 3FZLA 4JKAA 4A62A 3PV8A 1QQMA 4M3RA 2YHWA 1X9WA 2ATQA 4BR0A 4CE9A 4OGCA 2VGNA 3CCLN 2YCHA 4DFKA 4FLZA 2HHWA 4L3QA 3MXIA 4FJ9A 3ENBA 4B9UA 4NYFA 1U47A 4E7LA 3CYMA 1BL3A 3SV3A 3JSMA 1VSMA 2QKBA 4XIUA 3B8AX 3KZBA 1G15A 3G71N 3CQXA 5AFUA 3K5NA 2RHKA 3LANA 3DLRA 5KI6A 2HHSA 2P9UB 3L8BA 1KQSM 4H5NA 4EHTA 2D5RA 2OPPA 4IOCL 4B1ZA 4E1JA 3ZT4A 1JLQA 5T7BA 1FJGK 1TL3A 4CBXA 3OYFA 5AQQA 4N5SA 2D0OA 3TTFA 4CJPA 3OW2M 1EWRA 3M8RA 3RR7A 3M3ZA 4LF8K 4FWNA 1WAJA 4ID1A 4J2DA 4DV3K 2ZE2A 4H4MA 4KI6A 4E7IA 1Q18A 1LAWA 2ZJQL 3BUZB 1YT3A 1GOBA 1HYZA 4H4OA 4DTMA 3DOKA 3L2VA 1L3VA 2OA8A 5FROA 4LFBK 1FKOA 4FYDA 3EY1A 1NGBA 2NRTA 1T05A 2IVPA 3HPGA 1LW0A 5AQPA 1XHZA 2XHBA 1S9GA 2NLXA 3NF8A 4BRNA 4JI0K 3G10A 3QIOA 4F8RA 1R59O 3P5JA 1BUPA 3L3VA 1RDAA 3ZLJA 3G25A 1Q86O 5HRRA 1OVQA 1K9MO 1X9SA 4EP5A 4JS5A 1GLFO 4IOXA 4E19A 1HQUA 3TAQA 4FJGA 2LSNA 1V4SA 3NBPA 2Z1HA 1MDUB 3VQCA 2XO7A 3SI6A 5J2PA 1REVA 1HUXA 4LF6K 2IVOA 4DSIA 3CJ9A 2X78A 3QEVA 2OZMA 3TSQA 3AVBA 1YTUA 2NZTA 1EKEA 3QLHA 2HHQA 2I7NA 3SUOA 1JL1A 4WFNL 1BU6O 4CEFA 4JNEA 4G9ZA 3ZX3A 4HCBA 5AQHA 4MLHA 1K73O 3PIOL 5FRNA 3THWA 3SMPA 2D0PA 3QEXA 3SCXA 2ZD1A 4J2BA 3AVHA 4DKWA 2NRZA 4GY2B 1LWCA 5KGXA 2GUIA 1RILA 1P8ZA 3DI6A 1ASUA 1Z05A 5F1XA 2YKNA 3HL8A 3ULDA 3TAPA 1SS6A 3ZEUA 3T19A 4C8NA 3V4IA 4H0YB 4NXNK 1U48A 3P1GA 1BDGA 3RVCA 1TK5A 1JCFA 4IEEA 3TAGA 4F2RA 2A42A 4EFHA 5C0YA 2FLOA 3ZSQA 4BE0A 3F5TA 4CGHA 3V9WA 3MEDA 3RMDA 4CJVA 5F2RA 1QHTA 4JI2K 1U45A 1A5WA 3I0RA 3SBGA 1SAZA 3VQDA 4M7XA 1NGCA 5AQYA 5FPEA 4DWIA 2IGIA 4JK8A 5KQDA 4PHTX 4I2QA 4DQIA 2WBNA 1TKZA 3AA4A 4LC9B 1E4GT 1A5VA 3A5LC 3AA5X 1WOQA 3AAQA 1T44A 2HBJA 4BR2A 2E2OA 3PO4A 4Z4EA 3QO9A 4DLGA 4LH4A 4EIAA 4CJ4A 1NGJA 1HJRA 2PY5A 1S5JA 3DAWA 4MO5A 3LM9A 3RR8A 3HP9A 1MWMA 2E2PA 2GBZA 3D45A 3J7AP 3LL3A 5LY3A 3LPUA 2G8KA 1VQ6N 2A1RA 1S72N 5AQUA 2NRWA 3ZT3A 2OPRA 4FLXA 3OYDA 3AVCA 4YFUA 1E3MA 3L0QA 5CZ1A 1VHXA 4H0PA 2UXCK 4R5PA 4CF9A 5HRSA 1VQLN 3KK7A 4DV4K 1UA0A 5HROA 3HI0A 3SQ1A 4IZ9A 1C1CA 2J4RA 1BO5O 3H45C 4B8CA 2VG5A 4DF8A 3LP1A 2RN2A 2V7ZA 4FVMA 4DU3A 3FZHA 4E3SA 2HBLA 1YHQN 1HNZK 1VQ4N 1SL2A 1S1TA 4IWVA 4LSNA 2O8BB 4N56A 1YVNA 1MA9B 3DRPA 4CJRA 3HPOA 4FCYA 3VQPA 5EU7A 3VOVA 4WFAL 3DLLL 5BR8K 1N33K 4CERA 4CZLA 4IXCA 4W5OA 1QHAA 3K5OA 2NRXA 4JEPA 5AZJB 2YJFA 4IEIA 3BZCA 3LZJA 2HBMA 3LP2A 4PWDA 2O4GA 1RCHA 1C6VA 4IFEA 1RGIA 5CYMA 3LWLA 4RCHA 2FF6A 5SZTA 1B9FA 1KC8O 2GV9A 3SQ0A 1UWBA 3ZYYX 4BRQA 3M8QA 4AM6A 4K0KK 1KVAA 3M6GA 3E1YA 1XQSC 3CETA 2AJQA 1NKEA 1F21A 4JKDA 4JI4K 4MDBA 4CK3A 4FOEA 2ZF5O 3HOTA 4KTQA 2V52B 1M90O 1XC3A 2RF2A 1W7AA 3ZETA 4BREA 4F2SA 4IDKA 4BRGA 5GAHP 3KD1E 4PY5A 3BF1A 1TK8A 4B1WB 1D9DA 1NK0A 2FSJA 4RW7A 4IO8A 3FFKB 3HVTA 3OYBA 3C7NB 4B9QA 1VQPN 4KHPK 5DK5A 3OTOK 1NGAA 1VSIA 1YAGA 3VTIA 5KQ8A 3F73A 4CEOA 2O8CA 1HYVA 5C24A 4BY9C 4DR4K 3C6TA 1WSJA 5E84A 4DG1A 3T1YK 4M63C 4WQ5A 4CF8A 3TAFA 1HPMA 4CJLA 5AZIB 5KPRA 1RT7A 1ZBLA 5HP1A 3NHGA 1KAYA 1R0AA 5IT9O 1LW2A 2P9SA 3MN9A 1HQEA 5I3UA 2HBKA 1VRTA 4DFJA 3HSCA 3BF3A 1RTHA 5CR4A 5JLFA 3QDKA 4CEQA 3HK2A 3O3GA 2P9LB 4CF1A 1HMVA 1T03A 1VQNN 1TUUA 4KTZA 3VA3A 2GX9A 1KD1O 4J2AA 3RTVA 2DTUA 3H46O 3AVNA 1VRUA 4BRDA 1UAXA 4DU4A 4CD3A 3C65A 1RT2A 4Q5VA 1D9FA 1CLQA 3WQTA 4CGDA 4CF2A 4IKFA 5KPZA 4DQRA 1UA1A 5TKWA 4CJKA 4BG9A 4CEDA 4C8MA 3DLHA 1YF5L 2O8EB 3LM2A 3FLCO 4V19S 3ZX0A 3EKSA 3KHYA 4H0TB 3QERA 4JAXA 4HTUA 4CI6A 2GUPA 4B3MK 1IV0A 3FGUA 3T1HK 1GLLO 2DPNA 4QS8A 3AVIA 3FR0A 4H8KA 4FM0A 4M3WA 1K8KB 5J2NA 2VYPA 4OGEA 1T6CA 1K8KA 4BGAA 4OKKA 2W6KA 3KK1A 3U6FA 5AQWA 4Z0UA 5AZJA 3W3DA 1NJIO 1C0UA 3MN6A 3KKSA 4B9TA 2Z1JA 4E0DA 3VQEA 1O1WA 4IBNA 2D0CA 3DXKB 4X65K 1SKRA 4CESA 3TU5A 1ZXOA 3SJHA 4KO0A 4BVPA 2P51A 2F96A 4CK1A 1VQ7N 5AQSA 4YOTA 3HOSA 4H5TA 3SV4A 4O8KA 3K2PA 5FDLA 3VQ7A 3WXKA 3TARA 3I33A 4C8KA 3MWPA 4BDYA 4N76A 4M3TA 4FJLA 2QM1A 2W6LA 3LDLA 1BHLA 2VG6A 5AR0A 2G8IA 4CVNE 4IO9L 4H5VA 2QWNA 2JGUA 5AJ3K 3ZSXA 3VEZA 4FWQA 2X6NA 1W2BM 2HMPA 3CIPA 4TSXA 3P39A 3SMSA 3DXMA 4WFBL 1BI4A 4B9SA 5BRFA 3SAGA 2F8TA 1HNWK 1WB9A 3V1QA 4HWIA 3KK2A 1HNIA 3NF9A 4BDZA 4KHNA 4B9NA 3AVJA 4CHQA 4O4GA 2ZJRL 4H03B 5H1SQ 1TKDA 3GDQA 1JLBA 4IJAA 2UUAK 2ZGYA 4BQLA 4CJ7A 4YOXA 4CGIA 5E26A 4YDUC 3ATUA 3DWLA 4JI3K 3GE1A 3D6RA 1NKCA 3LAMA 3ZT2A 3ID8A 4PL8A 4BRPA 3AVFA 5K14A 4JKCA 3F2KA 1QQOA 2XY6A 1DEJA 2YHYA 3BY5A 2BTFA 2QWPA 4O0IA 3OYNA 2D0BA 4X66K 4FZXC 2WTUA 4A57A 5MLCQ 5AQTA 3O4NA 2VWJA 2HF4A 5BPNA 1WN7A 3SUPA 1HPZA 1KVCA 4KH4A 1TKXA 4I2PA 1ZBUA 5C15A 2BANA 1LAVA 4CGGA 4YY3K 3IAYA 2HHXA 1RTIA 3OBYA 1VSLA 4DUYK 1CXQA 5I9EB 3VQBA 4YOUA 4NYNA 3LDQA 3UKRA 4DR7K 5M1FA 4QS7A 1WLJA 3QNOA 1GLEG 4ID5A 3FZFA 1U49A 2E6LA 3G4SN 1SKWA 3QFUA 2BH1A 2HF3A 4B9LA 4LF4K 4M3XA 1IKVA 1NJZA 1I94K 1BIUA 1RT6A 3HBTA 5KPTA 5CY4A 3TI0A 4K8ZA 1BA1A 2VGMA 2HMIA 2FSKA 3QBXA 2OPQA 4F4KA 4ELUA 3T69A 5JVGL 4GVEA 4OKJA 3SJJA 4ILGB 3MCPA 1WSIA 1TUYA 4E7KA 3AAPA 4UQGA 4CZFA 5M1QA 2HHVA 3WXJA 4FJIA 4CJFA 2KHOA 4PUOA 3SZ2A 1WSEA 1YI2N 2FBVA 3D2FA 3VF2A 4FJKA 3L4QA 3M5RA 3O9UA 5GAEP 4JN4A 1J5OA 3AO4A 3I56N 4O55A 3I55N 3CXCM 3P31A 1KXPA 1LCUA 4DQSA 2KLAA 2W41A 4DQQA 4H5WA 1BISA 5A2QO 1YTAA 4LSLA 4BVOA 2HVHA 4KAZA 1CZAN 4EZ9A 3QNNA 3UKRB 3MMVA 3QIPA 2X6SA 3WUHA 2A1SA 4LY7A 1CXUA 2XY8A 2Z1GA 1TKTA 1U4BA 2QWQA 2ASMA 1EX4A 3O9QA 1OH8A 5M1OA 1BIZA 4GMJB 1VSKA 1BCMA 3V9UA 3M8PA 4BG8A 3VQ9A 3NVKA 5ADXA 4O0JA 1IKYA 4JRPA 4XEIA 3A5NC 4KI4A 1KAXA 4ISGA 1IH7A 1BCOA 3CCEN 4AHSA 2KKZA 1X9MA 4ISEA 2D0AA 3SLCA 4Y1CA 3NH2A 4BRLA 4Z94A 3VA0A 4BRMA 2QW9A 3ZX2A 3QINA 4M3ZA 3LALA 3NH0A 3G0ZA 5FPNA 1U04A 3VQ4A 2QWRA 3GOIA 1NOZA 1OH5A 4FWOA 4Z4IA 1KFSA 4BR5A 4B9MA 3U4LA 4OVLA 1J6ZA 4G1QA 4JHDB 4F9OA 2XRIA 2HVIA 2V7YA 1QSYA 4GNIA 2P9IB 3V9SA 4EHUA 3AO2A 1VSEA 3S3NA 3AVMA 3CCRN 3FE1A 1H1VA 1T3VA 4C1NK 1TAUA 4M3UA 5B8HA 3SPZA 3LP0A 1QQNA 3AGKA 3K57A 2E1ZA 3ENOA 3MEGA 5AQRA 3CG7A 1YVUA 3OS0A 4A5BA 1VSDA 3VETA 4CJSA 3PSFA 1YIJN 4JI7K 3NMUA 3KLFA 1WSFA 1VQ5N 4DF4A 4E7JA 2P9NB 2IAJA 2B6AA 3VEVA 2UYTA 2G8UA 1C0FA 3AY9A 4KFBA 4OKEA 4BC3A 4FLTA 2VWBA 1NK5A 3NGZA 4NXMK 4L8RB 1NU0A 3CCQN 4E89A 4HCCA 4DLEA 2ZGZA 2BGGA 1YJNN 4FK0A 1K6YA 3ZEUB 1Z6RA 1L3SA 3QETA 2GWKA 4B1UB 3U9ZA 1JCEA 3J7ZO 4KBOA 3CPWM 2QK9A 5GIOA 3ALYA 1KAZA 4CGJA 3EYZA 1U6ZA 1QE1A 3HM8A 3PLAA 1GLAG 2UUCK 2VCPA 2JWLA 4IG0A 4DTXA 4C8OA 3IUCA 2PYLA 4KB1A 3DOLA 4GW6A 2P9NA 2HW3A 2Q97A 5AQKA 4AH9A 4FLUA 5LL6Z 4FK2A 2QWMA 1QS4A 5AQNA 1NK9A 3IG1A 3F9KA 3PUFA 2NNWA 1Y64A 4GV6A 2RKIA 1KLMA 4JK9A 1HKCA 4JKGB 1DT9A 4FJ7A 2GWJA 4KRFA 3QEPA 4FL9A 5C42A 3CQ8A 4ICLA 1TV6A 3R1XA 2CGLA 5BN8A 2XY5A 4XH5A 4KHQA 5BN9A 1I39A 5JICA 1IO2A 3M1FA 1ESVA 1JXBA 3EKUA 3MWTA 3R9PA 4DR3K 3WEEB 5ELZA 1NMNA 1IG8A 1ZC6A 3U3YA 2PYJA 1JLGA 2HSTA 3KKRA 3H1VX 1HJOA 5CYQA 1XUPO 1OKJA 1WBBA 5AQXA 1IBMK 5CZ2A 3CI5A 4C1NI 4OX9K 1J53A 3WNEA 4CD1A 3NCIA 3TSUA 4DTUA 4BRFA 2X74A 4FJXA 2KW4A 3J7YP 3HTVA 4DSKA 3VPZA 1GLJO 3S41A 4U7BA 4CZEA 4E1NA 1SUQA 5AQMA 5TKYA 3D2EB 2QA4N 2P9KA 1Q9YA 2XY7A 5C2FA 2OCEA 1NGDA 3TWHA 3E9PA 4M41A 4FWRA 4DB3A 3CCUN 1ILYA 2RE2A 1T7PA 2KFNA 3SNNA 4AHVA 3HRGA 4JD2A 4O5BA 3EEQA 3SUNA 1NK8A 3LWMA 3DLKA 4HUEA 4DR6K 4JD2B 1BGXT 2B4JA 5EOYA 1RBVA 4B1XB 2BDPA 2Q0UA 5HLFA 5JS2A 1DTQA 4HTLA 3HYFA 4BR4A 3L3UA 4JHDA 1YJ9N 1BI4B 1C0TA 5AQIA 4PKGA 3UE5A 3WXMB 5GINA 4GV3A 1GLDG 2W40A 3MK6A 4FM1A 1VQON 2RPIA 3U8XA 4F3TA 5M1KA 1BQMA 4QAGA 3M8SA 1XMOK 4FXDA 1S6QA 1NM1A 1SV5A 4H0VB 4CHYA 4JKBA 4WQ4A 2HHHK 4BE2A 1NGHA 1N36K 1NGGA 3L6QA 1C1BA 4I9QA 1RBUA 3T1AA 2FC0A 2BE2A 3JAMO 2A6AA 4JI6K 3P38A 3VEWA 4JKEA 3NDKA 1NJWA 4CHZA 4ILJA 1N6QA 3HPHA 3VENA 1E4FT 4IFYA 4PA1A 4AHUA 4ILHA 5KTQA 3UB5A 4A2BA 3CD6N 1XI1A 3IKMA 3VERA 1DKGD 3O80A 2PFUA 3EN9A 4X62K 5BRDA 4FWLA 3JYTA 3RMAA 1RNHA 4BC5A 2O8CB 3V6DA 2JLEA 2AP1A 5CE3A 5HL7L 3O4WA 4K42A 1TK0A 4FW1A 1S1VA 3PSIA 3HM9A 3O9SA 2P1JA 3HSTB 4CECA 3R3LA 2P9SB 1BOTO 4PL7A 3A5OC 2Y1IA 4A59A 1WUAA 1K8AO 1MWKA 3HP6A 3DM2A 2QTDA 3IS9A 3PO5A 2HNZA 2NRHA 4AHCA 1G99A 1NOYA 3O6WA 4A2AA 4DHYA 1FK9A 2CH5A 1SQKA 5DM6L 3CCSN 4C23A 4CHNA 1RBTA 1EXQA 3H08A 4FWPA 4AHTA 5AQGA 1IKXA 3OS2A 4NO7A 3OJSA 2O8BA 2QI2A 3MCAB 4CZKA 1WSGA 3HJFA 1JLEA 3C7NA 3KLGA 4CW7B 3P4IA 4LF9K 2GEMA 3T3FA 3QESA 1IG9A 3ITHA 3CF5L 3K5LA 2G8FA 5AQOA 4FJ5A 3V1RA 4O5FA 1T8EA 1MU2A 4JKFA 1HR0K 5AQLA 3HXMA 4JI8K 3ULEA 3C6HA 3BP8A 2Q36A 1VQMN 4BGBA 1DLOA 4CBWA 4ISFA 4FZYA 1ZBHA 4MFBA 3U3GA 2NUBA 2W42A 5AQJA 3LAKA 4BC4A 3KWGA 1U2VB 3S3OA 1X9JA 1Q81O 3EE9A 3AA2A 2KTQA 3VEYA 3O3HA 1U2VA 3J8AA 5FLXO 5FPDA 4CJEA 2FBXA 1Y97A 1I3AA 4BC2A 3U9DA 3OYCA 2YNIA 1QSLA 4M42A 2I5JA 2JWKA 2E5LK 4ELTA 1RFQA 1D8YA 5C2DA 2CGKA 2P9LA 1M1KO 1QVFM 3O3FA 1TYQB 3OYLA 4H0OA 3LDSA 3LZIA 1W0HA 5CHIA 2A5XA 3C0BA 3WT0A 3WXIA 4WCEL 1TYQA 1ATRA 2QXFA 4B9VA 1OVYA 3SK3A 3KTQA 5BPMA 4OPKA 2IOCA 5FRMA 1IJJA 4B3TK 2OTLN 2E8AA 4CIFA 3DRSA 4KHUA 2ASPA 4BWMA 1Q82O 3TAMA 1N5YA 3H6EA 3QICA 4NCAA 3TR8A 3NVMA 4YNQA 1SL0A 3HT3A 2HHTA 3PY8A 1LOTB 3OJUA 3OYGA 2R7YA 3ULEB 4FJ8A 4B1YB 4W5RA 4BE1A 4JV5K 1ZBFA 1BG3A 3O1WA 2YHAA 3UKUB 2VQFK 3ASMA 3SUQA 2FF3B 4FJJA 4XH4A 4C8LA 2ETJA 3DLGA 4CJWA 2V51B 2GELA 3WXLA 4ELVA 3LDNA 4AQYK 3OBWA 4OPHA 1DGKN 1WNSA 3J80O 2QWOA 1VAZA 1OH6A 1NK7A 3IRXA 3C95A 3V81A 5JMVA 3VQAA 4EAHD 2OANA 3VQ8A 4FLVA 3NF7A 3CERA 1YXQA 2O8DA 2H3GX 1EETA 1L5UA 2VG7A 3VQQA 3CC2N 3MDQA 4NCBA 1SL1A 5C12A 4ZHRA 3C94A 4OLAA 1N8RO 4CHOA 4KPYA 3V9ZA 5FPMA 3TTCA 3I0SA 1NK4A 4KKOA 1HKBA 3OVNA 5ADXH 1HLUA 3RSEA 4B8AB 3A5MC 4RW9A 2HOEA 3DXMB 3EL2A 3UKUA 3Q7BA 1Q9XA 3ZT1A 4M3YA 4LFAK 4MLEA 4E7HA 1ZYQA 1KLNA 4LFCK 2IVNA 3DJCA 3ZSOA 1NJXA 2F8SA 3UIQA 4IFVA 4YDUA 4DS5A 1ZBIA 5KRSA 4WF9L 3K59A 5JS1A 4B3SK 1IKWA 1ATNA 3GBTA 4WQ4C 1KSPA 4F3OA 1WSHA 3TSPA 4CEAA 4N41A 3OYEA 4CCHA 1NGFA 3VGMA 3FZMA 2O4IA 4A5AA 3THWB 1JL2A 4Q0BA 2HHUA 4DFPA 4FWSA 3K9JA 2WUSA 1KRPA 3L4IA 4XH1A 2E20A 1VK0A 1ASVA 1RDWX 1CZBA 1QZ5A 3ZETB 2E2NA 5LMNK 3RWUA 4MQ3A 4PKIA 3L2WA 2DFEA 4YOYA 4CZGA 2ZJPL 1GOCA 3MEEA 1JJ2M 4CGFA 1D5AA 4ZTJA 1VQKN 3CJ7A 1N32K 3MN5A 3SQ2A 4EZ6A 3O1BA 4FO0A 3H1QA 4DV2K 4K41A 1RBRA 4CJQA 1RDBA 3LP3A 3P83D 2O8FB 4BACA 3VESA 1HRHA 4CFAA 4FSVA 3VQ6A 1KCFA 4W5NA 4BROA 1RT3A 2KFZA 4DTRA 3DRRA 3JXUA 3EZ5A 2B5JA 3S3MA 1WBDA 1YJWN 2I7PA 2QWLA 3JS6A 4ZTFA 3DXKA 4KV8A 3NE6A 4RG8A 3KIOA 4QS9A 1RTJA 3QBWA 3CMEN 1Q7YO 1UOCA 3AVGA 4DCHA 3KJVA 2YNGA 4BRIA 4X64K 1S1UA 3R6MA 1A5XA 3VEXA 4CZMA 3ZSWA 1S1XA 3NFAA 3G6EN 4CHPA 3OYMA 1NWKA 3CC7N 3LDPA 4Y1DA 4JI5K 3SQ4A 1VSFA 1LWFA 1S6PA 3O4QA 3AGRA 4OLBA 5J2QA 3CCMN 3CJ1A 1XC9A 4J8FA 2HB5A 1BWFO 3EZWA 2G8WA 4GVMA 4FPAA 4RW6A 2Q2RA 2ZM6K 2WFBA 5LJVA 4DV0K 1GLBG 2OYQA 2UXBK 2F7TA 4MDAA 2YI1A 4AILC 2KZZA 1EP4A 3AVKA 4RW8A 4HUGA 2CGJA 2Q31A 3IMXA 1EWQA 3NGYA 2F9WA 2HNDA 2WOMA 3I8DA 3QFPA 3V9XA 5F0XA 2DY4A 3F9MA 4B3RK 3OYAA 3KLHA 1WAFA 4U67L 2ZQBA 3K0SA 1BA0A 2OPSA 5IWAK 1KFDA 2QXLA 3E66A 3VF6A 5JVHL 3RRHA 3SAHA 1ZBSA 3KVGA 3TABA 4JYAK 4DSFA 3AVLA 1D4XA 5EXWA 4CIEA 3HZ6A 5M1PA 1JLCA 4B1VA 1S1WA 2BUPA 1IBLK 3Q7CA 1RDCA 1RT4A 1W97L 4K43A 4FWMA 1QZ6A 4I9LA 4B08A 4RTFD 4QCLA 3E9OA 3CJCA 4K25A 2Q3SA 3B6OA 4YORA 4FVUA 3ID6A 4EP4A 2EWSA 2DFFA 4I6MA 4CEEA 2E1YA 4DSLA 1RTDA 2GTDA 4CJTA 4I6MB 3TTDA 2YNHA 4K8XA 5LJWA 3D7EO 4E1MA 1YITN 4IJNA 1EO1A 3SBTA 4JI1K 2WC9A 2NRVA 5JLHA 5E41A 5EY4A 3C6UA 3DLEA 3KD5E 4CJ5A 3THYB 2VQEK 4AHRA 1JLFA 2IDOA 4DTPA 5GADP 1TAQA 1ATSA 3MXJA 3THXA 3VEOA 4BR9A 3MXMA 2YKMA 2A41A 5BPLA 3O8MA 3PX6A 4CEBA 4W5QA 4DTNA 3RMCA 1GOAA 1QTMA 4DTSA 4YOWA 4CIGA 4Z4FA 5BR9A 4RW4A 3CFOA 4DUZK 1ASWA 1LWEA 3CFRA 3QEIA 3CHWA 2CH6A 2IC3A 3B6PA 4KREA 1HNVA 1T6DA 2NRRA 4RWTA 3E9LA 2IS3A 5EX5A 4PKHA 2ITMA 5DM7L 4DU1A 4HUFA 1HNXK 4Z4GA 1XWLA 3TANA 3S9HA 3ENHA 5J1EA 5D3GA 1X1PA 5HRNA 3DLBA 4DSJA 4FW2A 4PQUA 3C6AA 4FWKA 2P5GA 3CJBA 2YHXA 3GG4A 4DR5K 5KRTA 3VQ5A 4FLWA 3QMLA 4O8UA 3ZT0A 4UY8O 2KQ2A 3N4PA 4H0XB 2YX6A 4DV7K 1OH7A 1QQCA 3VF4A 4DQ8A 1J5EK 4CZIA 1BQNA 4DS4A 4BRAA 4FOIA 4NCGA 1QSSA 2A40A 3KLEA 3ZSRA 3O9TA 4BDPA 4Y0WA 2HNYA 3K9KA 3AA3A 3N4QA 1NMDA 3CCVN 1XHXA 4MO4A 3OA9A 1TVRA 3MECA 5AQFA 3HVRA 5LMUK 1P90A 1W9HA 4JK7A 4IG3A 4JKGA 2P9PA 2ZWHA 4OJRA 3CCJN 5AQZA 1Z25A 2Z1IA 1TL1A 2ITGA 5I42A 2P9PB 3I8BA 4KTWA 1XNRK 5DMRA 2P9UA 2YHBA 4DSEA 1SZ2A 3H3NO 5GIPA 1X3NA 1O13A 3NGIA 4M45A 3HO1A 2UUBK 4CF0A 1RT5A 3ISNC 3L2QA 4FK4A 1J54A 4JLHA 1RT1A 3QB0A 3W0LA 1C0MA 4A61A 2Q1NA 5C10A 3MAQA 4J2EA 3CQYA 1VSHA 2OZSA 2PZSA 4FJMA 3CMAN 1GLCG 4CFBA 4Z4HA 3CFPA 4LF5K 1L3TA 4CFDA 2YNFA 4W5TA 3DYAA 2UXDK 4WE1A 3FZKA 1XNQK 3E01A 3FFIA 4KH5A 3DMJA 4YHHK 3CC4N 1B92A 4BR7A 4NLBA 2QKKA 1KVBA 2FBYA 1NLVA 3A8YA 2O8DB 4FM2A 2Y1JA 3BZKA 2PBDA 1L3UA 3WNFA 1S9EA 3AO1A 1NJYA 4I7FA 1QVGM 2F4VK 1XMQK 3EE8A 5AQVA 3OYKA 1FW6A 3BEXA 2FBTA 2A3ZA 4DV5K 3RSEB 1HYSA 4N47A 5J2MA 4KHWA 2VWKA 4NB4A 2P9IA 4BQZA 4HVJA 1SKSA 2UU9K 3AO3A 1J9AA 3VGLA 2YV0X 1FXXA 2D1KA 4OO1J 1Q8IA 3O5BA 1KTQA 1Z26A 3GL1A 3AVAA 1HX1A 4OPJA 3SYZA 3OHRA 2E4LA 3MN7A 5GAGP 3KK3A 4DR2K 4H5RA 1NG9A 5BREA 3D2EA 4FJHA 1YUWA 1NBWA 3THYA 4HHTA 3TPQA 2F9TA 4LH5A 1RBSA 4DMNA 5C25A 1TGOA 4CZHA 3L2UA 2E88A 3PX0A 5M1NA 4LD0A 3WQUA 2OTJN 1JCGA 1NGEA 3CM5A 1S22A 4KHSA 3RMBA 4CK2A 5AFUH 4JS4A 2P5OA 1LV5A 3K5MA 1JKHA 3BDPA 4BRHA 4O44A 4BRKA 1NGIA 3VTHA 3NH1A 2AA4A 3L2RA 3LPTA 3MX5A 1C1AA 2ASOA 4FZZA 3D2FB 3EO3A 3VN5A 5HRPA 4AM7A 4QOZB 1B9DA 4CBUA 3ZCMA 4FPBA 5EVZA 2G8HA 5BRHA 4CJ3A 3K58A 5SWMA 4FLYA 1NNEA 3ZSZA 4KHYA 4YOVA 4Z4CA 3J81O 4BRCA 3WEEA 4LF7K 3AARA 2G8VA 1RDDA 4JKHA 3NAEA 1HKGA 4KH6A 2FXUA 1N34K 5KGWA 3VGKA 4DR1K 1ITGA 4DFMA 4GKJK 3CM6A 3OYJA 4GV9A 3ZSYA 2QEXN 2P9KB 2Q0RA 2D4WA 1V4TA 2EHGA 4WQ5C 1C0GA 4CJUA 3WNGA 3ZSVA 4CEZA 3RRGA 3A0IX 1DTTA 3NF6A 3AV9A 4OPAA 1IBKK 4NLCA 3R8EA 3THXB 3THVA 4DQPA 4JRQA 3SAFA 4WYBA 3KLIA 2KZMA 4AF1A 1X3MA 4DTOA 3CPEA
chains in the Genus database with same CATH topology
1HKCA 4JKGB 1KAYA 2P9SA 1DT9A 2GWJA 3JXUA 3MN9A 2HBKA 4FL9A 3IFRA 3HSCA 3BF3A 5CR4A 5JLFA 1YJWN 2I7PA 2QWLA 3JS6A 3MX2A 3R1XA 3QDKA 2CGLA 3DXKA 5BN8A 3O9RA 2P9LB 4XH5A 5HOOA 5BN9A 1VQNN 5JICA 4QS9A 1TUUA 3M1FA 1ESVA 2GX9A 3EKUA 3QBWA 1KD1O 3CMEN 3MWTA 3R9PA 1Q7YO 3H46O 3WEEB 4DCHA 4IDHA 3O08A 5ELZA 4BRIA 1VQ8N 1IG8A 1ZC6A 2E2QA 4BRDA 1VQ9N 4CD3A 3C65A 4IOAL 2YJEA 3R6MA 5AZIA 2HSTA 3T7ZA 3VEXA 3WQTA 3PIPL 3IDHA 1RDUA 3ATVA 4CZMA 5KPZA 5TKWA 1S3XA 4BG9A 2FSNA 1YF5L 3H1VX 1HJOA 3LM2A 3FLCO 3KWIA 1XUPO 1OKJA 3EKSA 3LDOA 5AQXA 1EQYA 3ZX0A 3G6EN 3KHYA 1NWKA 4H0TB 3CC7N 3CI5A 4C1NI 3LDPA 4JAXA 4CI6A 2GUPA 3AGRA 4CD1A 3FGUA 3VMFB 4CZJA 1GLLO 2DPNA 3CCMN 4QS8A 3CJ1A 3TSUA 4J8FA 4BRFA 3FR0A 4R79A 1BWFO 3HTVA 3EZWA 1K8KB 3VPZA 1GLJO 3S41A 4FPAA 2IIRA 2Q2RA 4U7BA 2WFBA 2PAVA 4CZEA 3H3OB 4M7YA 3CJAA 2VYPA 3FZLA 4JKAA 5LJVA 1GLBG 4A62A 1QQMA 1T6CA 5AQMA 1K8KA 5TKYA 2YHWA 3D2EB 2P9KA 2QA4N 4BGAA 4BR0A 5C2FA 2F7TA 4MDAA 2YI1A 5AQWA 1NGDA 5AZJA 3W3DA 2VGNA 1NJIO 3E9PA 3MN6A 3CCLN 4DB3A 4FWRA 1ILYA 3CCUN 2YCHA 2RE2A 2CGJA 2Q31A 3IMXA 3DXKB 4L3QA 2F9WA 3HRGA 4JD2A 3ENBA 3QFPA 3TU5A 1ZXOA 5F0XA 3SJHA 3F9MA 1QVFM 4BVPA 4JD2B 5EOYA 4U67L 4B1XB 1VQ7N 1BA0A 3B8AX 2Q0UA 5AQSA 4HTLA 3KZBA 4YOTA 4BR4A 2QXLA 3HOSA 4H5TA 3E66A 3G71N 3CQXA 4O8KA 3VF6A 5JVHL 4JHDA 1YJ9N 3SAHA 3WXKA 5AQIA 1ZBSA 3I33A 5AFUA 4PKGA 3KVGA 3UE5A 3WXMB 3MWPA 5GINA 2RHKA 4GV3A 2QM1A 3LDLA 2P9UB 1GLDG 5AR0A 1KQSM 2W40A 4H5NA 1D4XA 4EHTA 5EXWA 3MK6A 4IO9L 3HZ6A 4H5VA 2QWNA 5M1PA 4B1VA 4IOCL 2BUPA 4B1ZA 3Q7CA 4E1JA 3U8XA 1VQON 1W97L 4K43A 3VEZA 4FWMA 1QZ6A 4FWQA 5M1KA 4RTFD 3E9OA 3CJCA 4K25A 4CBXA 1W2BM 4YORA 2HMPA 5AQQA 1NM1A 4FVUA 4H0VB 3ID6A 2D0OA 4JKBA 3TTFA 4WQ4A 3OW2M 3CIPA 1NGHA 2EWSA 3P39A 3SMSA 3DXMA 4WFBL 5BRFA 3M3ZA 1NGGA 4FWNA 3SAGA 3L6QA 4I6MA 2E1YA 1Q18A 2A6AA 4HWIA 2GTDA 2ZJQL 3BUZB 3P38A 3VEWA 4JKEA 4I6MB 3TTDA 4ILJA 5LJWA 3D7EO 3VENA 1E4FT 1YITN 4IJNA 1EO1A 3SBTA 2ZJRL 2WC9A 4ILHA 1NGBA 2NRTA 3UB5A 4A2BA 2IVPA 4H03B 3CD6N 5H1SQ 3IKMA 3VERA 1DKGD 5AQPA 2NRVA 5JLHA 3GDQA 4IJAA 3O80A 5EY4A 2PFUA 3EN9A 5JVGL 5BRDA 4FWLA 2ZGYA 4BQLA 2NLXA 4BRNA 4CJ7A 4YOXA 4BC5A 5E26A 1R59O 4YDUC 3ATUA 1BUPA 2AP1A 5GADP 3DWLA 3G25A 1Q86O 5CE3A 5HL7L 3O4WA 3GE1A 4K42A 3D6RA 1ATSA 3VEOA 4BR9A 3ID8A 5BPLA 2A41A 4PL8A 3O9SA 4BRPA 3O8MA 1K9MO 4JKCA 3F2KA 1QQOA 3R3LA 1GLFO 1BOTO 1DEJA 2P9SB 2YHYA 3A5OC 4IOXA 4A59A 1WUAA 2BTFA 4PL7A 4YOWA 1K8AO 2QWPA 5BR9A 1MWKA 1V4SA 5KPRA 4A57A 5MLCQ 1MDUB 5AQTA 3CHWA 2HF4A 2QTDA 2CH6A 5BPNA 1HUXA 2IVOA 3CJ9A 1T6DA 2NRHA 2NRRA 3TSQA 4RWTA 3E9LA 5EX5A 4PKHA 1G99A 2NZTA 3O6WA 4KH4A 2ITMA 5DM7L 4A2AA 4DHYA 5C15A 2I7NA 3ENHA 3OBYA 2CH5A 1SQKA 4WFNL 5I9EB 5DM6L 4YOUA 1BU6O 3LDQA 3CCSN 3UKRA 3C6AA 4C23A 4FWKA 5M1FA 4QS7A 3CJBA 4JNEA 4G9ZA 3ZX3A 1GLEG 3FZFA 2YHXA 3GG4A 4FWPA 5AQGA 3G4SN 4NO7A 3QMLA 5AQHA 3QFUA 2BH1A 4MLHA 4O8UA 1K73O 2HF3A 3PIOL 2QI2A 4UY8O 3MCAB 4CZKA 3N4PA 3SMPA 2D0PA 4H0XB 2YX6A 3C7NA 3P4IA 3HBTA 5KPTA 2GEMA 4DKWA 3VF4A 4DQ8A 1BA1A 2NRZA 4CZIA 2VGMA 4GY2B 3CF5L 5AQOA 4BRAA 4O5FA 1P8ZA 4FOIA 2FSKA 3QBXA 4JKFA 1Z05A 5AQLA 3T69A 3ULEA 2A40A 3C6HA 3BP8A 2Q36A 5F1XA 1SS6A 4GVEA 3O9TA 1VQMN 4BGBA 3ZEUA 4ILGB 4CBWA 3MCPA 4Y0WA 4ISFA 4H0YB 3K9KA 3N4QA 1BDGA 3RVCA 5AQJA 1NMDA 1TUYA 3CCVN 1JCFA 3AAPA 4IEEA 4BC4A 4CZFA 3KWGA 2A42A 5M1QA 4EFHA 3WXJA 1U2VB 4MO4A 1X9JA 2KHOA 1Q81O 2FLOA 3EE9A 3OA9A 5C0YA 3F5TA 3VEYA 1YI2N 1U2VA 5AQFA 1P90A 3J8AA 5FPDA 3D2FA 4JK7A 5F2RA 3VF2A 4JKGA 2P9PA 2ZWHA 4BC2A 3L4QA 3U9DA 3M5RA 5AQZA 3CCJN 3O9UA 5GAEP 4JN4A 3SBGA 3I56N 3CXCM 2JWKA 3I55N 3P31A 2P9PB 1SAZA 3I8BA 1KXPA 1RFQA 1LCUA 5C2DA 2P9UA 4M7XA 1NGCA 2KLAA 2CGKA 2W41A 1SZ2A 2P9LA 3H3NO 1X3NA 5AQYA 1O13A 4H5WA 1TYQB 5GIPA 1M1KO 5FPEA 4JK8A 5KQDA 4H0OA 4BVOA 4PHTX 5CHIA 2A5XA 2WBNA 4LC9B 1CZAN 3C0BA 1E4GT 3WT0A 3WXIA 4WCEL 1TYQA 3A5LC 1WOQA 1ATRA 3QB0A 3UKRB 3W0LA 3MMVA 1OVYA 3AAQA 1T44A 2HBJA 2Q1NA 3WUHA 4A61A 3SK3A 4BR2A 2E2OA 5C10A 5BPMA 3CQYA 1IJJA 2QWQA 2OTLN 2ASMA 2E8AA 4EIAA 3O9QA 2ASPA 1NGJA 3CMAN 1GLCG 5M1OA 1Q82O 3H6EA 3QICA 3DAWA 3NVMA 3LM9A 4MO5A 4BG8A 3NVKA 5ADXA 1MWMA 2E2PA 1LOTB 3LL3A 3FZKA 5LY3A 4XEIA 3A5NC 4KH5A 3ULEB 3CC4N 1VQ6N 1KAXA 4B1YB 4ISGA 4BR7A 4NLBA 3CCEN 1S72N 5AQUA 2NRWA 1NLVA 2KKZA 1BG3A 3O1WA 3A8YA 3UKUB 4ISEA 2FF3B 2PBDA 3SLCA 4BRLA 4XH4A 4Z94A 4BRMA 2QW9A 3ZX2A 3L0QA 4H0PA 1QVGM 2V51B 5FPNA 1VQLN 2GELA 3WXLA 3KK7A 2QWRA 3GOIA 3LDNA 3OBWA 3EE8A 4OPHA 5AQVA 1DGKN 4FWOA 2QWOA 1VAZA 3HI0A 3BEXA 4IZ9A 4BR5A 2A3ZA 3RSEB 2J4RA 1BO5O 3H45C 5JMVA 4NB4A 2P9IA 3U4LA 2V7ZA 4BQZA 4EAHD 2OANA 1J6ZA 3FZHA 4JHDB 4F9OA 2HBLA 3CERA 1YXQA 2V7YA 2H3GX 3VGLA 2D1KA 4OO1J 4GNIA 3CC2N 3MDQA 2P9IB 3O5BA 4EHUA 3GL1A 1YHQN 1VQ4N 1HX1A 5C12A 3OHRA 4IWVA 3MN7A 3CCRN 5GAGP 1N8RO 3FE1A 1H1VA 1YVNA 1MA9B 1T3VA 5FPMA 3TTCA 4H5RA 3VOVA 4C1NK 4WFAL 3DLLL 5BREA 4CZLA 5B8HA 1HKBA 3D2EA 4IXCA 1QQNA 1QHAA 1YUWA 1NBWA 2E1ZA 3AGKA 1HLUA 2NRXA 3ENOA 3RSEA 5AQRA 5ADXH 4JEPA 3TPQA 5AZJB 2F9TA 2YJFA 3A5MC 4IEIA 4A5BA 1YIJN 3VETA 2HBMA 3NMUA 2HOEA 3DXMB 3EL2A 4CZHA 3UKUA 1VQ5N 3Q7BA 4IFEA 2E88A 1RGIA 5M1NA 3WQUA 4MLEA 4RCHA 2P9NB 2OTJN 1JCGA 2FF6A 1NGEA 2UYTA 1S22A 1C0FA 2IVNA 3AY9A 3DJCA 3VEVA 1KC8O 3ZYYX 5AFUH 4BC3A 4BRQA 2VWBA 4YDUA 4BRHA 4AM6A 4BRKA 3M6GA 4WF9L 1NGIA 3VTHA 3CCQN 2AA4A 3E1YA 3MX5A 1XQSC 2ZGZA 1ATNA 3CETA 3GBTA 2ASOA 4WQ4C 3D2FB 3EO3A 1YJNN 4AM7A 4JKDA 3TSPA 3ZEUB 4CBUA 4MDBA 1Z6RA 4FPBA 5EVZA 4FOEA 2ZF5O 3HOTA 1NGFA 5BRHA 3VGMA 2GWKA 4B1UB 3U9ZA 1JCEA 3FZMA 2V52B 1M90O 3J7ZO 4A5AA 1XC3A 4YOVA 4FWSA 4KBOA 4BRCA 3CPWM 3K9JA 2WUSA 3WEEA 3L4IA 3ZETA 4BREA 5GIOA 4XH1A 2E20A 3AARA 1KAZA 4JK9A 4BRGA 5GAHP 4JKHA 3BF1A 1RDWX 1QZ5A 1U6ZA 4B1WB 3ZETB 2E2NA 1HKGA 2FSJA 2FXUA 3HM8A 4KH6A 4PKIA 3PLAA 1GLAG 3VGKA 4IO8A 4YOYA 2VCPA 2JWLA 3FFKB 4CZGA 2ZJPL 4GV9A 2QEXN 2P9KB 1JJ2M 2Q0RA 2D4WA 1V4TA 3C7NB 3IUCA 4WQ5C 1C0GA 3CJ7A 4B9QA 1VQPN 1VQKN 1NGAA 1YAGA 3MN5A 3VTIA 5KQ8A 2P9NA 3O1BA 2Q97A 4FO0A 3H1QA 4K41A 3A0IX 5AQKA 4BY9C 2QWMA 4OPAA 5AQNA 5E84A 3VESA 2NNWA 1Y64A 4NLCA 3R8EA 4FSVA 4M63C 3SAFA 4WQ5A 4BROA 4WYBA 4GV6A 1HPMA 5AZIB 4AF1A 1X3MA 3CPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q7B A;  4FVU A;  3MWP A;  4GV6 A;  3MX2 A;  4GVE A;  4G9Z A;  3MWT A;  4GV3 A;  3MX5 A;  3R3L A;  3Q7C A;  4GV9 A; 
#chains in the Genus database with same CATH topology
 1JLA A;  1JXE A;  5HBM A;  4FJN A;  3OY9 A;  2O8E A;  3OS1 A;  3IFR A;  3MX2 A;  2EX3 A;  3O9R A;  4CFC A;  5HOO A;  2E6M A;  1CZ9 A;  4B3O A;  2O8F A;  3SPY A;  4IDH A;  3O08 A;  3D0P A;  4DTJ A;  3OYI A;  1VQ8 N;  1VQ9 N;  2E2Q A;  4IOA L;  3PX4 A;  4BWJ A;  2YJE A;  5AZI A;  4DV6 K;  3T7Z A;  3PIP L;  4DV1 K;  3IDH A;  1RDU A;  2WON A;  3ATV A;  3TAE A;  1S3X A;  3BGR A;  1NKB A;  2FSN A;  3AO5 A;  3KWI A;  3LDO A;  1EQY A;  2DFH A;  3OYH A;  1VSJ A;  3QEW A;  1FKP A;  3A2F A;  3VMF B;  4CZJ A;  4R79 A;  1NK6 A;  3V1O A;  3WNH A;  2IIR A;  4GKK K;  2PAV A;  4KB0 A;  3H3O B;  4M7Y A;  3CJA A;  3FZL A;  4JKA A;  4A62 A;  3PV8 A;  1QQM A;  4M3R A;  2YHW A;  1X9W A;  2ATQ A;  4BR0 A;  4CE9 A;  4OGC A;  2VGN A;  3CCL N;  2YCH A;  4DFK A;  4FLZ A;  2HHW A;  4L3Q A;  3MXI A;  4FJ9 A;  3ENB A;  4B9U A;  4NYF A;  1U47 A;  4E7L A;  3CYM A;  1BL3 A;  3SV3 A;  3JSM A;  1VSM A;  2QKB A;  4XIU A;  3B8A X;  3KZB A;  1G15 A;  3G71 N;  3CQX A;  5AFU A;  3K5N A;  2RHK A;  3LAN A;  3DLR A;  5KI6 A;  2HHS A;  2P9U B;  3L8B A;  1KQS M;  4H5N A;  4EHT A;  2D5R A;  2OPP A;  4IOC L;  4B1Z A;  4E1J A;  3ZT4 A;  1JLQ A;  5T7B A;  1FJG K;  1TL3 A;  4CBX A;  3OYF A;  5AQQ A;  4N5S A;  2D0O A;  3TTF A;  4CJP A;  3OW2 M;  1EWR A;  3M8R A;  3RR7 A;  3M3Z A;  4LF8 K;  4FWN A;  1WAJ A;  4ID1 A;  4J2D A;  4DV3 K;  2ZE2 A;  4H4M A;  4KI6 A;  4E7I A;  1Q18 A;  1LAW A;  2ZJQ L;  3BUZ B;  1YT3 A;  1GOB A;  1HYZ A;  4H4O A;  4DTM A;  3DOK A;  3L2V A;  1L3V A;  2OA8 A;  5FRO A;  4LFB K;  1FKO A;  4FYD A;  3EY1 A;  1NGB A;  2NRT A;  1T05 A;  2IVP A;  3HPG A;  1LW0 A;  5AQP A;  1XHZ A;  2XHB A;  1S9G A;  2NLX A;  3NF8 A;  4BRN A;  4JI0 K;  3G10 A;  3QIO A;  4F8R A;  1R59 O;  3P5J A;  1BUP A;  3L3V A;  1RDA A;  3ZLJ A;  3G25 A;  1Q86 O;  5HRR A;  1OVQ A;  1K9M O;  1X9S A;  4EP5 A;  4JS5 A;  1GLF O;  4IOX A;  4E19 A;  1HQU A;  3TAQ A;  4FJG A;  2LSN A;  1V4S A;  3NBP A;  2Z1H A;  1MDU B;  3VQC A;  2XO7 A;  3SI6 A;  5J2P A;  1REV A;  1HUX A;  4LF6 K;  2IVO A;  4DSI A;  3CJ9 A;  2X78 A;  3QEV A;  2OZM A;  3TSQ A;  3AVB A;  1YTU A;  2NZT A;  1EKE A;  3QLH A;  2HHQ A;  2I7N A;  3SUO A;  1JL1 A;  4WFN L;  1BU6 O;  4CEF A;  4JNE A;  4G9Z A;  3ZX3 A;  4HCB A;  5AQH A;  4MLH A;  1K73 O;  3PIO L;  5FRN A;  3THW A;  3SMP A;  2D0P A;  3QEX A;  3SCX A;  2ZD1 A;  4J2B A;  3AVH A;  4DKW A;  2NRZ A;  4GY2 B;  1LWC A;  5KGX A;  2GUI A;  1RIL A;  1P8Z A;  3DI6 A;  1ASU A;  1Z05 A;  5F1X A;  2YKN A;  3HL8 A;  3ULD A;  3TAP A;  1SS6 A;  3ZEU A;  3T19 A;  4C8N A;  3V4I A;  4H0Y B;  4NXN K;  1U48 A;  3P1G A;  1BDG A;  3RVC A;  1TK5 A;  1JCF A;  4IEE A;  3TAG A;  4F2R A;  2A42 A;  4EFH A;  5C0Y A;  2FLO A;  3ZSQ A;  4BE0 A;  3F5T A;  4CGH A;  3V9W A;  3MED A;  3RMD A;  4CJV A;  5F2R A;  1QHT A;  4JI2 K;  1U45 A;  1A5W A;  3I0R A;  3SBG A;  1SAZ A;  3VQD A;  4M7X A;  1NGC A;  5AQY A;  5FPE A;  4DWI A;  2IGI A;  4JK8 A;  5KQD A;  4PHT X;  4I2Q A;  4DQI A;  2WBN A;  1TKZ A;  3AA4 A;  4LC9 B;  1E4G T;  1A5V A;  3A5L C;  3AA5 X;  1WOQ A;  3AAQ A;  1T44 A;  2HBJ A;  4BR2 A;  2E2O A;  3PO4 A;  4Z4E A;  3QO9 A;  4DLG A;  4LH4 A;  4EIA A;  4CJ4 A;  1NGJ A;  1HJR A;  2PY5 A;  1S5J A;  3DAW A;  4MO5 A;  3LM9 A;  3RR8 A;  3HP9 A;  1MWM A;  2E2P A;  2GBZ A;  3D45 A;  3J7A P;  3LL3 A;  5LY3 A;  3LPU A;  2G8K A;  1VQ6 N;  2A1R A;  1S72 N;  5AQU A;  2NRW A;  3ZT3 A;  2OPR A;  4FLX A;  3OYD A;  3AVC A;  4YFU A;  1E3M A;  3L0Q A;  5CZ1 A;  1VHX A;  4H0P A;  2UXC K;  4R5P A;  4CF9 A;  5HRS A;  1VQL N;  3KK7 A;  4DV4 K;  1UA0 A;  5HRO A;  3HI0 A;  3SQ1 A;  4IZ9 A;  1C1C A;  2J4R A;  1BO5 O;  3H45 C;  4B8C A;  2VG5 A;  4DF8 A;  3LP1 A;  2RN2 A;  2V7Z A;  4FVM A;  4DU3 A;  3FZH A;  4E3S A;  2HBL A;  1YHQ N;  1HNZ K;  1VQ4 N;  1SL2 A;  1S1T A;  4IWV A;  4LSN A;  2O8B B;  4N56 A;  1YVN A;  1MA9 B;  3DRP A;  4CJR A;  3HPO A;  4FCY A;  3VQP A;  5EU7 A;  3VOV A;  4WFA L;  3DLL L;  5BR8 K;  1N33 K;  4CER A;  4CZL A;  4IXC A;  4W5O A;  1QHA A;  3K5O A;  2NRX A;  4JEP A;  5AZJ B;  2YJF A;  4IEI A;  3BZC A;  3LZJ A;  2HBM A;  3LP2 A;  4PWD A;  2O4G A;  1RCH A;  1C6V A;  4IFE A;  1RGI A;  5CYM A;  3LWL A;  4RCH A;  2FF6 A;  5SZT A;  1B9F A;  1KC8 O;  2GV9 A;  3SQ0 A;  1UWB A;  3ZYY X;  4BRQ A;  3M8Q A;  4AM6 A;  4K0K K;  1KVA A;  3M6G A;  3E1Y A;  1XQS C;  3CET A;  2AJQ A;  1NKE A;  1F21 A;  4JKD A;  4JI4 K;  4MDB A;  4CK3 A;  4FOE A;  2ZF5 O;  3HOT A;  4KTQ A;  2V52 B;  1M90 O;  1XC3 A;  2RF2 A;  1W7A A;  3ZET A;  4BRE A;  4F2S A;  4IDK A;  4BRG A;  5GAH P;  3KD1 E;  4PY5 A;  3BF1 A;  1TK8 A;  4B1W B;  1D9D A;  1NK0 A;  2FSJ A;  4RW7 A;  4IO8 A;  3FFK B;  3HVT A;  3OYB A;  3C7N B;  4B9Q A;  1VQP N;  4KHP K;  5DK5 A;  3OTO K;  1NGA A;  1VSI A;  1YAG A;  3VTI A;  5KQ8 A;  3F73 A;  4CEO A;  2O8C A;  1HYV A;  5C24 A;  4BY9 C;  4DR4 K;  3C6T A;  1WSJ A;  5E84 A;  4DG1 A;  3T1Y K;  4M63 C;  4WQ5 A;  4CF8 A;  3TAF A;  1HPM A;  4CJL A;  5AZI B;  5KPR A;  1RT7 A;  1ZBL A;  5HP1 A;  3NHG A;  1KAY A;  1R0A A;  5IT9 O;  1LW2 A;  2P9S A;  3MN9 A;  1HQE A;  5I3U A;  2HBK A;  1VRT A;  4DFJ A;  3HSC A;  3BF3 A;  1RTH A;  5CR4 A;  5JLF A;  3QDK A;  4CEQ A;  3HK2 A;  3O3G A;  2P9L B;  4CF1 A;  1HMV A;  1T03 A;  1VQN N;  1TUU A;  4KTZ A;  3VA3 A;  2GX9 A;  1KD1 O;  4J2A A;  3RTV A;  2DTU A;  3H46 O;  3AVN A;  1VRU A;  4BRD A;  1UAX A;  4DU4 A;  4CD3 A;  3C65 A;  1RT2 A;  4Q5V A;  1D9F A;  1CLQ A;  3WQT A;  4CGD A;  4CF2 A;  4IKF A;  5KPZ A;  4DQR A;  1UA1 A;  5TKW A;  4CJK A;  4BG9 A;  4CED A;  4C8M A;  3DLH A;  1YF5 L;  2O8E B;  3LM2 A;  3FLC O;  4V19 S;  3ZX0 A;  3EKS A;  3KHY A;  4H0T B;  3QER A;  4JAX A;  4HTU A;  4CI6 A;  2GUP A;  4B3M K;  1IV0 A;  3FGU A;  3T1H K;  1GLL O;  2DPN A;  4QS8 A;  3AVI A;  3FR0 A;  4H8K A;  4FM0 A;  4M3W A;  1K8K B;  5J2N A;  2VYP A;  4OGE A;  1T6C A;  1K8K A;  4BGA A;  4OKK A;  2W6K A;  3KK1 A;  3U6F A;  5AQW A;  4Z0U A;  5AZJ A;  3W3D A;  1NJI O;  1C0U A;  3MN6 A;  3KKS A;  4B9T A;  2Z1J A;  4E0D A;  3VQE A;  1O1W A;  4IBN A;  2D0C A;  3DXK B;  4X65 K;  1SKR A;  4CES A;  3TU5 A;  1ZXO A;  3SJH A;  4KO0 A;  4BVP A;  2P51 A;  2F96 A;  4CK1 A;  1VQ7 N;  5AQS A;  4YOT A;  3HOS A;  4H5T A;  3SV4 A;  4O8K A;  3K2P A;  5FDL A;  3VQ7 A;  3WXK A;  3TAR A;  3I33 A;  4C8K A;  3MWP A;  4BDY A;  4N76 A;  4M3T A;  4FJL A;  2QM1 A;  2W6L A;  3LDL A;  1BHL A;  2VG6 A;  5AR0 A;  2G8I A;  4CVN E;  4IO9 L;  4H5V A;  2QWN A;  2JGU A;  5AJ3 K;  3ZSX A;  3VEZ A;  4FWQ A;  2X6N A;  1W2B M;  2HMP A;  3CIP A;  4TSX A;  3P39 A;  3SMS A;  3DXM A;  4WFB L;  1BI4 A;  4B9S A;  5BRF A;  3SAG A;  2F8T A;  1HNW K;  1WB9 A;  3V1Q A;  4HWI A;  3KK2 A;  1HNI A;  3NF9 A;  4BDZ A;  4KHN A;  4B9N A;  3AVJ A;  4CHQ A;  4O4G A;  2ZJR L;  4H03 B;  5H1S Q;  1TKD A;  3GDQ A;  1JLB A;  4IJA A;  2UUA K;  2ZGY A;  4BQL A;  4CJ7 A;  4YOX A;  4CGI A;  5E26 A;  4YDU C;  3ATU A;  3DWL A;  4JI3 K;  3GE1 A;  3D6R A;  1NKC A;  3LAM A;  3ZT2 A;  3ID8 A;  4PL8 A;  4BRP A;  3AVF A;  5K14 A;  4JKC A;  3F2K A;  1QQO A;  2XY6 A;  1DEJ A;  2YHY A;  3BY5 A;  2BTF A;  2QWP A;  4O0I A;  3OYN A;  2D0B A;  4X66 K;  4FZX C;  2WTU A;  4A57 A;  5MLC Q;  5AQT A;  3O4N A;  2VWJ A;  2HF4 A;  5BPN A;  1WN7 A;  3SUP A;  1HPZ A;  1KVC A;  4KH4 A;  1TKX A;  4I2P A;  1ZBU A;  5C15 A;  2BAN A;  1LAV A;  4CGG A;  4YY3 K;  3IAY A;  2HHX A;  1RTI A;  3OBY A;  1VSL A;  4DUY K;  1CXQ A;  5I9E B;  3VQB A;  4YOU A;  4NYN A;  3LDQ A;  3UKR A;  4DR7 K;  5M1F A;  4QS7 A;  1WLJ A;  3QNO A;  1GLE G;  4ID5 A;  3FZF A;  1U49 A;  2E6L A;  3G4S N;  1SKW A;  3QFU A;  2BH1 A;  2HF3 A;  4B9L A;  4LF4 K;  4M3X A;  1IKV A;  1NJZ A;  1I94 K;  1BIU A;  1RT6 A;  3HBT A;  5KPT A;  5CY4 A;  3TI0 A;  4K8Z A;  1BA1 A;  2VGM A;  2HMI A;  2FSK A;  3QBX A;  2OPQ A;  4F4K A;  4ELU A;  3T69 A;  5JVG L;  4GVE A;  4OKJ A;  3SJJ A;  4ILG B;  3MCP A;  1WSI A;  1TUY A;  4E7K A;  3AAP A;  4UQG A;  4CZF A;  5M1Q A;  2HHV A;  3WXJ A;  4FJI A;  4CJF A;  2KHO A;  4PUO A;  3SZ2 A;  1WSE A;  1YI2 N;  2FBV A;  3D2F A;  3VF2 A;  4FJK A;  3L4Q A;  3M5R A;  3O9U A;  5GAE P;  4JN4 A;  1J5O A;  3AO4 A;  3I56 N;  4O55 A;  3I55 N;  3CXC M;  3P31 A;  1KXP A;  1LCU A;  4DQS A;  2KLA A;  2W41 A;  4DQQ A;  4H5W A;  1BIS A;  5A2Q O;  1YTA A;  4LSL A;  4BVO A;  2HVH A;  4KAZ A;  1CZA N;  4EZ9 A;  3QNN A;  3UKR B;  3MMV A;  3QIP A;  2X6S A;  3WUH A;  2A1S A;  4LY7 A;  1CXU A;  2XY8 A;  2Z1G A;  1TKT A;  1U4B A;  2QWQ A;  2ASM A;  1EX4 A;  3O9Q A;  1OH8 A;  5M1O A;  1BIZ A;  4GMJ B;  1VSK A;  1BCM A;  3V9U A;  3M8P A;  4BG8 A;  3VQ9 A;  3NVK A;  5ADX A;  4O0J A;  1IKY A;  4JRP A;  4XEI A;  3A5N C;  4KI4 A;  1KAX A;  4ISG A;  1IH7 A;  1BCO A;  3CCE N;  4AHS A;  2KKZ A;  1X9M A;  4ISE A;  2D0A A;  3SLC A;  4Y1C A;  3NH2 A;  4BRL A;  4Z94 A;  3VA0 A;  4BRM A;  2QW9 A;  3ZX2 A;  3QIN A;  4M3Z A;  3LAL A;  3NH0 A;  3G0Z A;  5FPN A;  1U04 A;  3VQ4 A;  2QWR A;  3GOI A;  1NOZ A;  1OH5 A;  4FWO A;  4Z4I A;  1KFS A;  4BR5 A;  4B9M A;  3U4L A;  4OVL A;  1J6Z A;  4G1Q A;  4JHD B;  4F9O A;  2XRI A;  2HVI A;  2V7Y A;  1QSY A;  4GNI A;  2P9I B;  3V9S A;  4EHU A;  3AO2 A;  1VSE A;  3S3N A;  3AVM A;  3CCR N;  3FE1 A;  1H1V A;  1T3V A;  4C1N K;  1TAU A;  4M3U A;  5B8H A;  3SPZ A;  3LP0 A;  1QQN A;  3AGK A;  3K57 A;  2E1Z A;  3ENO A;  3MEG A;  5AQR A;  3CG7 A;  1YVU A;  3OS0 A;  4A5B A;  1VSD A;  3VET A;  4CJS A;  3PSF A;  1YIJ N;  4JI7 K;  3NMU A;  3KLF A;  1WSF A;  1VQ5 N;  4DF4 A;  4E7J A;  2P9N B;  2IAJ A;  2B6A A;  3VEV A;  2UYT A;  2G8U A;  1C0F A;  3AY9 A;  4KFB A;  4OKE A;  4BC3 A;  4FLT A;  2VWB A;  1NK5 A;  3NGZ A;  4NXM K;  4L8R B;  1NU0 A;  3CCQ N;  4E89 A;  4HCC A;  4DLE A;  2ZGZ A;  2BGG A;  1YJN N;  4FK0 A;  1K6Y A;  3ZEU B;  1Z6R A;  1L3S A;  3QET A;  2GWK A;  4B1U B;  3U9Z A;  1JCE A;  3J7Z O;  4KBO A;  3CPW M;  2QK9 A;  5GIO A;  3ALY A;  1KAZ A;  4CGJ A;  3EYZ A;  1U6Z A;  1QE1 A;  3HM8 A;  3PLA A;  1GLA G;  2UUC K;  2VCP A;  2JWL A;  4IG0 A;  4DTX A;  4C8O A;  3IUC A;  2PYL A;  4KB1 A;  3DOL A;  4GW6 A;  2P9N A;  2HW3 A;  2Q97 A;  5AQK A;  4AH9 A;  4FLU A;  5LL6 Z;  4FK2 A;  2QWM A;  1QS4 A;  5AQN A;  1NK9 A;  3IG1 A;  3F9K A;  3PUF A;  2NNW A;  1Y64 A;  4GV6 A;  2RKI A;  1KLM A;  4JK9 A;  1HKC A;  4JKG B;  1DT9 A;  4FJ7 A;  2GWJ A;  4KRF A;  3QEP A;  4FL9 A;  5C42 A;  3CQ8 A;  4ICL A;  1TV6 A;  3R1X A;  2CGL A;  5BN8 A;  2XY5 A;  4XH5 A;  4KHQ A;  5BN9 A;  1I39 A;  5JIC A;  1IO2 A;  3M1F A;  1ESV A;  1JXB A;  3EKU A;  3MWT A;  3R9P A;  4DR3 K;  3WEE B;  5ELZ A;  1NMN A;  1IG8 A;  1ZC6 A;  3U3Y A;  2PYJ A;  1JLG A;  2HST A;  3KKR A;  3H1V X;  1HJO A;  5CYQ A;  1XUP O;  1OKJ A;  1WBB A;  5AQX A;  1IBM K;  5CZ2 A;  3CI5 A;  4C1N I;  4OX9 K;  1J53 A;  3WNE A;  4CD1 A;  3NCI A;  3TSU A;  4DTU A;  4BRF A;  2X74 A;  4FJX A;  2KW4 A;  3J7Y P;  3HTV A;  4DSK A;  3VPZ A;  1GLJ O;  3S41 A;  4U7B A;  4CZE A;  4E1N A;  1SUQ A;  5AQM A;  5TKY A;  3D2E B;  2QA4 N;  2P9K A;  1Q9Y A;  2XY7 A;  5C2F A;  2OCE A;  1NGD A;  3TWH A;  3E9P A;  4M41 A;  4FWR A;  4DB3 A;  3CCU N;  1ILY A;  2RE2 A;  1T7P A;  2KFN A;  3SNN A;  4AHV A;  3HRG A;  4JD2 A;  4O5B A;  3EEQ A;  3SUN A;  1NK8 A;  3LWM A;  3DLK A;  4HUE A;  4DR6 K;  4JD2 B;  1BGX T;  2B4J A;  5EOY A;  1RBV A;  4B1X B;  2BDP A;  2Q0U A;  5HLF A;  5JS2 A;  1DTQ A;  4HTL A;  3HYF A;  4BR4 A;  3L3U A;  4JHD A;  1YJ9 N;  1BI4 B;  1C0T A;  5AQI A;  4PKG A;  3UE5 A;  3WXM B;  5GIN A;  4GV3 A;  1GLD G;  2W40 A;  3MK6 A;  4FM1 A;  1VQO N;  2RPI A;  3U8X A;  4F3T A;  5M1K A;  1BQM A;  4QAG A;  3M8S A;  1XMO K;  4FXD A;  1S6Q A;  1NM1 A;  1SV5 A;  4H0V B;  4CHY A;  4JKB A;  4WQ4 A;  2HHH K;  4BE2 A;  1NGH A;  1N36 K;  1NGG A;  3L6Q A;  1C1B A;  4I9Q A;  1RBU A;  3T1A A;  2FC0 A;  2BE2 A;  3JAM O;  2A6A A;  4JI6 K;  3P38 A;  3VEW A;  4JKE A;  3NDK A;  1NJW A;  4CHZ A;  4ILJ A;  1N6Q A;  3HPH A;  3VEN A;  1E4F T;  4IFY A;  4PA1 A;  4AHU A;  4ILH A;  5KTQ A;  3UB5 A;  4A2B A;  3CD6 N;  1XI1 A;  3IKM A;  3VER A;  1DKG D;  3O80 A;  2PFU A;  3EN9 A;  4X62 K;  5BRD A;  4FWL A;  3JYT A;  3RMA A;  1RNH A;  4BC5 A;  2O8C B;  3V6D A;  2JLE A;  2AP1 A;  5CE3 A;  5HL7 L;  3O4W A;  4K42 A;  1TK0 A;  4FW1 A;  1S1V A;  3PSI A;  3HM9 A;  3O9S A;  2P1J A;  3HST B;  4CEC A;  3R3L A;  2P9S B;  1BOT O;  4PL7 A;  3A5O C;  2Y1I A;  4A59 A;  1WUA A;  1K8A O;  1MWK A;  3HP6 A;  3DM2 A;  2QTD A;  3IS9 A;  3PO5 A;  2HNZ A;  2NRH A;  4AHC A;  1G99 A;  1NOY A;  3O6W A;  4A2A A;  4DHY A;  1FK9 A;  2CH5 A;  1SQK A;  5DM6 L;  3CCS N;  4C23 A;  4CHN A;  1RBT A;  1EXQ A;  3H08 A;  4FWP A;  4AHT A;  5AQG A;  1IKX A;  3OS2 A;  4NO7 A;  3OJS A;  2O8B A;  2QI2 A;  3MCA B;  4CZK A;  1WSG A;  3HJF A;  1JLE A;  3C7N A;  3KLG A;  4CW7 B;  3P4I A;  4LF9 K;  2GEM A;  3T3F A;  3QES A;  1IG9 A;  3ITH A;  3CF5 L;  3K5L A;  2G8F A;  5AQO A;  4FJ5 A;  3V1R A;  4O5F A;  1T8E A;  1MU2 A;  4JKF A;  1HR0 K;  5AQL A;  3HXM A;  4JI8 K;  3ULE A;  3C6H A;  3BP8 A;  2Q36 A;  1VQM N;  4BGB A;  1DLO A;  4CBW A;  4ISF A;  4FZY A;  1ZBH A;  4MFB A;  3U3G A;  2NUB A;  2W42 A;  5AQJ A;  3LAK A;  4BC4 A;  3KWG A;  1U2V B;  3S3O A;  1X9J A;  1Q81 O;  3EE9 A;  3AA2 A;  2KTQ A;  3VEY A;  3O3H A;  1U2V A;  3J8A A;  5FLX O;  5FPD A;  4CJE A;  2FBX A;  1Y97 A;  1I3A A;  4BC2 A;  3U9D A;  3OYC A;  2YNI A;  1QSL A;  4M42 A;  2I5J A;  2JWK A;  2E5L K;  4ELT A;  1RFQ A;  1D8Y A;  5C2D A;  2CGK A;  2P9L A;  1M1K O;  1QVF M;  3O3F A;  1TYQ B;  3OYL A;  4H0O A;  3LDS A;  3LZI A;  1W0H A;  5CHI A;  2A5X A;  3C0B A;  3WT0 A;  3WXI A;  4WCE L;  1TYQ A;  1ATR A;  2QXF A;  4B9V A;  1OVY A;  3SK3 A;  3KTQ A;  5BPM A;  4OPK A;  2IOC A;  5FRM A;  1IJJ A;  4B3T K;  2OTL N;  2E8A A;  4CIF A;  3DRS A;  4KHU A;  2ASP A;  4BWM A;  1Q82 O;  3TAM A;  1N5Y A;  3H6E A;  3QIC A;  4NCA A;  3TR8 A;  3NVM A;  4YNQ A;  1SL0 A;  3HT3 A;  2HHT A;  3PY8 A;  1LOT B;  3OJU A;  3OYG A;  2R7Y A;  3ULE B;  4FJ8 A;  4B1Y B;  4W5R A;  4BE1 A;  4JV5 K;  1ZBF A;  1BG3 A;  3O1W A;  2YHA A;  3UKU B;  2VQF K;  3ASM A;  3SUQ A;  2FF3 B;  4FJJ A;  4XH4 A;  4C8L A;  2ETJ A;  3DLG A;  4CJW A;  2V51 B;  2GEL A;  3WXL A;  4ELV A;  3LDN A;  4AQY K;  3OBW A;  4OPH A;  1DGK N;  1WNS A;  3J80 O;  2QWO A;  1VAZ A;  1OH6 A;  1NK7 A;  3IRX A;  3C95 A;  3V81 A;  5JMV A;  3VQA A;  4EAH D;  2OAN A;  3VQ8 A;  4FLV A;  3NF7 A;  3CER A;  1YXQ A;  2O8D A;  2H3G X;  1EET A;  1L5U A;  2VG7 A;  3VQQ A;  3CC2 N;  3MDQ A;  4NCB A;  1SL1 A;  5C12 A;  4ZHR A;  3C94 A;  4OLA A;  1N8R O;  4CHO A;  4KPY A;  3V9Z A;  5FPM A;  3TTC A;  3I0S A;  1NK4 A;  4KKO A;  1HKB A;  3OVN A;  5ADX H;  1HLU A;  3RSE A;  4B8A B;  3A5M C;  4RW9 A;  2HOE A;  3DXM B;  3EL2 A;  3UKU A;  3Q7B A;  1Q9X A;  3ZT1 A;  4M3Y A;  4LFA K;  4MLE A;  4E7H A;  1ZYQ A;  1KLN A;  4LFC K;  2IVN A;  3DJC A;  3ZSO A;  1NJX A;  2F8S A;  3UIQ A;  4IFV A;  4YDU A;  4DS5 A;  1ZBI A;  5KRS A;  4WF9 L;  3K59 A;  5JS1 A;  4B3S K;  1IKW A;  1ATN A;  3GBT A;  4WQ4 C;  1KSP A;  4F3O A;  1WSH A;  3TSP A;  4CEA A;  4N41 A;  3OYE A;  4CCH A;  1NGF A;  3VGM A;  3FZM A;  2O4I A;  4A5A A;  3THW B;  1JL2 A;  4Q0B A;  2HHU A;  4DFP A;  4FWS A;  3K9J A;  2WUS A;  1KRP A;  3L4I A;  4XH1 A;  2E20 A;  1VK0 A;  1ASV A;  1RDW X;  1CZB A;  1QZ5 A;  3ZET B;  2E2N A;  5LMN K;  3RWU A;  4MQ3 A;  4PKI A;  3L2W A;  2DFE A;  4YOY A;  4CZG A;  2ZJP L;  1GOC A;  3MEE A;  1JJ2 M;  4CGF A;  1D5A A;  4ZTJ A;  1VQK N;  3CJ7 A;  1N32 K;  3MN5 A;  3SQ2 A;  4EZ6 A;  3O1B A;  4FO0 A;  3H1Q A;  4DV2 K;  4K41 A;  1RBR A;  4CJQ A;  1RDB A;  3LP3 A;  3P83 D;  2O8F B;  4BAC A;  3VES A;  1HRH A;  4CFA A;  4FSV A;  3VQ6 A;  1KCF A;  4W5N A;  4BRO A;  1RT3 A;  2KFZ A;  4DTR A;  3DRR A;  3JXU A;  3EZ5 A;  2B5J A;  3S3M A;  1WBD A;  1YJW N;  2I7P A;  2QWL A;  3JS6 A;  4ZTF A;  3DXK A;  4KV8 A;  3NE6 A;  4RG8 A;  3KIO A;  4QS9 A;  1RTJ A;  3QBW A;  3CME N;  1Q7Y O;  1UOC A;  3AVG A;  4DCH A;  3KJV A;  2YNG A;  4BRI A;  4X64 K;  1S1U A;  3R6M A;  1A5X A;  3VEX A;  4CZM A;  3ZSW A;  1S1X A;  3NFA A;  3G6E N;  4CHP A;  3OYM A;  1NWK A;  3CC7 N;  3LDP A;  4Y1D A;  4JI5 K;  3SQ4 A;  1VSF A;  1LWF A;  1S6P A;  3O4Q A;  3AGR A;  4OLB A;  5J2Q A;  3CCM N;  3CJ1 A;  1XC9 A;  4J8F A;  2HB5 A;  1BWF O;  3EZW A;  2G8W A;  4GVM A;  4FPA A;  4RW6 A;  2Q2R A;  2ZM6 K;  2WFB A;  5LJV A;  4DV0 K;  1GLB G;  2OYQ A;  2UXB K;  2F7T A;  4MDA A;  2YI1 A;  4AIL C;  2KZZ A;  1EP4 A;  3AVK A;  4RW8 A;  4HUG A;  2CGJ A;  2Q31 A;  3IMX A;  1EWQ A;  3NGY A;  2F9W A;  2HND A;  2WOM A;  3I8D A;  3QFP A;  3V9X A;  5F0X A;  2DY4 A;  3F9M A;  4B3R K;  3OYA A;  3KLH A;  1WAF A;  4U67 L;  2ZQB A;  3K0S A;  1BA0 A;  2OPS A;  5IWA K;  1KFD A;  2QXL A;  3E66 A;  3VF6 A;  5JVH L;  3RRH A;  3SAH A;  1ZBS A;  3KVG A;  3TAB A;  4JYA K;  4DSF A;  3AVL A;  1D4X A;  5EXW A;  4CIE A;  3HZ6 A;  5M1P A;  1JLC A;  4B1V A;  1S1W A;  2BUP A;  1IBL K;  3Q7C A;  1RDC A;  1RT4 A;  1W97 L;  4K43 A;  4FWM A;  1QZ6 A;  4I9L A;  4B08 A;  4RTF D;  4QCL A;  3E9O A;  3CJC A;  4K25 A;  2Q3S A;  3B6O A;  4YOR A;  4FVU A;  3ID6 A;  4EP4 A;  2EWS A;  2DFF A;  4I6M A;  4CEE A;  2E1Y A;  4DSL A;  1RTD A;  2GTD A;  4CJT A;  4I6M B;  3TTD A;  2YNH A;  4K8X A;  5LJW A;  3D7E O;  4E1M A;  1YIT N;  4IJN A;  1EO1 A;  3SBT A;  4JI1 K;  2WC9 A;  2NRV A;  5JLH A;  5E41 A;  5EY4 A;  3C6U A;  3DLE A;  3KD5 E;  4CJ5 A;  3THY B;  2VQE K;  4AHR A;  1JLF A;  2IDO A;  4DTP A;  5GAD P;  1TAQ A;  1ATS A;  3MXJ A;  3THX A;  3VEO A;  4BR9 A;  3MXM A;  2YKM A;  2A41 A;  5BPL A;  3O8M A;  3PX6 A;  4CEB A;  4W5Q A;  4DTN A;  3RMC A;  1GOA A;  1QTM A;  4DTS A;  4YOW A;  4CIG A;  4Z4F A;  5BR9 A;  4RW4 A;  3CFO A;  4DUZ K;  1ASW A;  1LWE A;  3CFR A;  3QEI A;  3CHW A;  2CH6 A;  2IC3 A;  3B6P A;  4KRE A;  1HNV A;  1T6D A;  2NRR A;  4RWT A;  3E9L A;  2IS3 A;  5EX5 A;  4PKH A;  2ITM A;  5DM7 L;  4DU1 A;  4HUF A;  1HNX K;  4Z4G A;  1XWL A;  3TAN A;  3S9H A;  3ENH A;  5J1E A;  5D3G A;  1X1P A;  5HRN A;  3DLB A;  4DSJ A;  4FW2 A;  4PQU A;  3C6A A;  4FWK A;  2P5G A;  3CJB A;  2YHX A;  3GG4 A;  4DR5 K;  5KRT A;  3VQ5 A;  4FLW A;  3QML A;  4O8U A;  3ZT0 A;  4UY8 O;  2KQ2 A;  3N4P A;  4H0X B;  2YX6 A;  4DV7 K;  1OH7 A;  1QQC A;  3VF4 A;  4DQ8 A;  1J5E K;  4CZI A;  1BQN A;  4DS4 A;  4BRA A;  4FOI A;  4NCG A;  1QSS A;  2A40 A;  3KLE A;  3ZSR A;  3O9T A;  4BDP A;  4Y0W A;  2HNY A;  3K9K A;  3AA3 A;  3N4Q A;  1NMD A;  3CCV N;  1XHX A;  4MO4 A;  3OA9 A;  1TVR A;  3MEC A;  5AQF A;  3HVR A;  5LMU K;  1P90 A;  1W9H A;  4JK7 A;  4IG3 A;  4JKG A;  2P9P A;  2ZWH A;  4OJR A;  3CCJ N;  5AQZ A;  1Z25 A;  2Z1I A;  1TL1 A;  2ITG A;  5I42 A;  2P9P B;  3I8B A;  4KTW A;  1XNR K;  5DMR A;  2P9U A;  2YHB A;  4DSE A;  1SZ2 A;  3H3N O;  5GIP A;  1X3N A;  1O13 A;  3NGI A;  4M45 A;  3HO1 A;  2UUB K;  4CF0 A;  1RT5 A;  3ISN C;  3L2Q A;  4FK4 A;  1J54 A;  4JLH A;  1RT1 A;  3QB0 A;  3W0L A;  1C0M A;  4A61 A;  2Q1N A;  5C10 A;  3MAQ A;  4J2E A;  3CQY A;  1VSH A;  2OZS A;  2PZS A;  4FJM A;  3CMA N;  1GLC G;  4CFB A;  4Z4H A;  3CFP A;  4LF5 K;  1L3T A;  4CFD A;  2YNF A;  4W5T A;  3DYA A;  2UXD K;  4WE1 A;  3FZK A;  1XNQ K;  3E01 A;  3FFI A;  4KH5 A;  3DMJ A;  4YHH K;  3CC4 N;  1B92 A;  4BR7 A;  4NLB A;  2QKK A;  1KVB A;  2FBY A;  1NLV A;  3A8Y A;  2O8D B;  4FM2 A;  2Y1J A;  3BZK A;  2PBD A;  1L3U A;  3WNF A;  1S9E A;  3AO1 A;  1NJY A;  4I7F A;  1QVG M;  2F4V K;  1XMQ K;  3EE8 A;  5AQV A;  3OYK A;  1FW6 A;  3BEX A;  2FBT A;  2A3Z A;  4DV5 K;  3RSE B;  1HYS A;  4N47 A;  5J2M A;  4KHW A;  2VWK A;  4NB4 A;  2P9I A;  4BQZ A;  4HVJ A;  1SKS A;  2UU9 K;  3AO3 A;  1J9A A;  3VGL A;  2YV0 X;  1FXX A;  2D1K A;  4OO1 J;  1Q8I A;  3O5B A;  1KTQ A;  1Z26 A;  3GL1 A;  3AVA A;  1HX1 A;  4OPJ A;  3SYZ A;  3OHR A;  2E4L A;  3MN7 A;  5GAG P;  3KK3 A;  4DR2 K;  4H5R A;  1NG9 A;  5BRE A;  3D2E A;  4FJH A;  1YUW A;  1NBW A;  3THY A;  4HHT A;  3TPQ A;  2F9T A;  4LH5 A;  1RBS A;  4DMN A;  5C25 A;  1TGO A;  4CZH A;  3L2U A;  2E88 A;  3PX0 A;  5M1N A;  4LD0 A;  3WQU A;  2OTJ N;  1JCG A;  1NGE A;  3CM5 A;  1S22 A;  4KHS A;  3RMB A;  4CK2 A;  5AFU H;  4JS4 A;  2P5O A;  1LV5 A;  3K5M A;  1JKH A;  3BDP A;  4BRH A;  4O44 A;  4BRK A;  1NGI A;  3VTH A;  3NH1 A;  2AA4 A;  3L2R A;  3LPT A;  3MX5 A;  1C1A A;  2ASO A;  4FZZ A;  3D2F B;  3EO3 A;  3VN5 A;  5HRP A;  4AM7 A;  4QOZ B;  1B9D A;  4CBU A;  3ZCM A;  4FPB A;  5EVZ A;  2G8H A;  5BRH A;  4CJ3 A;  3K58 A;  5SWM A;  4FLY A;  1NNE A;  3ZSZ A;  4KHY A;  4YOV A;  4Z4C A;  3J81 O;  4BRC A;  3WEE A;  4LF7 K;  3AAR A;  2G8V A;  1RDD A;  4JKH A;  3NAE A;  1HKG A;  4KH6 A;  2FXU A;  1N34 K;  5KGW A;  3VGK A;  4DR1 K;  1ITG A;  4DFM A;  4GKJ K;  3CM6 A;  3OYJ A;  4GV9 A;  3ZSY A;  2QEX N;  2P9K B;  2Q0R A;  2D4W A;  1V4T A;  2EHG A;  4WQ5 C;  1C0G A;  4CJU A;  3WNG A;  3ZSV A;  4CEZ A;  3RRG A;  3A0I X;  1DTT A;  3NF6 A;  3AV9 A;  4OPA A;  1IBK K;  4NLC A;  3R8E A;  3THX B;  3THV A;  4DQP A;  4JRQ A;  3SAF A;  4WYB A;  3KLI A;  2KZM A;  4AF1 A;  1X3M A;  4DTO A;  3CPE A; 
#chains in the Genus database with same CATH homology
 1HKC A;  4JKG B;  1KAY A;  2P9S A;  1DT9 A;  2GWJ A;  3JXU A;  3MN9 A;  2HBK A;  4FL9 A;  3IFR A;  3HSC A;  3BF3 A;  5CR4 A;  5JLF A;  1YJW N;  2I7P A;  2QWL A;  3JS6 A;  3MX2 A;  3R1X A;  3QDK A;  2CGL A;  3DXK A;  5BN8 A;  3O9R A;  2P9L B;  4XH5 A;  5HOO A;  5BN9 A;  1VQN N;  5JIC A;  4QS9 A;  1TUU A;  3M1F A;  1ESV A;  2GX9 A;  3EKU A;  3QBW A;  1KD1 O;  3CME N;  3MWT A;  3R9P A;  1Q7Y O;  3H46 O;  3WEE B;  4DCH A;  4IDH A;  3O08 A;  5ELZ A;  4BRI A;  1VQ8 N;  1IG8 A;  1ZC6 A;  2E2Q A;  4BRD A;  1VQ9 N;  4CD3 A;  3C65 A;  4IOA L;  2YJE A;  3R6M A;  5AZI A;  2HST A;  3T7Z A;  3VEX A;  3WQT A;  3PIP L;  3IDH A;  1RDU A;  3ATV A;  4CZM A;  5KPZ A;  5TKW A;  1S3X A;  4BG9 A;  2FSN A;  1YF5 L;  3H1V X;  1HJO A;  3LM2 A;  3FLC O;  3KWI A;  1XUP O;  1OKJ A;  3EKS A;  3LDO A;  5AQX A;  1EQY A;  3ZX0 A;  3G6E N;  3KHY A;  1NWK A;  4H0T B;  3CC7 N;  3CI5 A;  4C1N I;  3LDP A;  4JAX A;  4CI6 A;  2GUP A;  3AGR A;  4CD1 A;  3FGU A;  3VMF B;  4CZJ A;  1GLL O;  2DPN A;  3CCM N;  4QS8 A;  3CJ1 A;  3TSU A;  4J8F A;  4BRF A;  3FR0 A;  4R79 A;  1BWF O;  3HTV A;  3EZW A;  1K8K B;  3VPZ A;  1GLJ O;  3S41 A;  4FPA A;  2IIR A;  2Q2R A;  4U7B A;  2WFB A;  2PAV A;  4CZE A;  3H3O B;  4M7Y A;  3CJA A;  2VYP A;  3FZL A;  4JKA A;  5LJV A;  1GLB G;  4A62 A;  1QQM A;  1T6C A;  5AQM A;  1K8K A;  5TKY A;  2YHW A;  3D2E B;  2P9K A;  2QA4 N;  4BGA A;  4BR0 A;  5C2F A;  2F7T A;  4MDA A;  2YI1 A;  5AQW A;  1NGD A;  5AZJ A;  3W3D A;  2VGN A;  1NJI O;  3E9P A;  3MN6 A;  3CCL N;  4DB3 A;  4FWR A;  1ILY A;  3CCU N;  2YCH A;  2RE2 A;  2CGJ A;  2Q31 A;  3IMX A;  3DXK B;  4L3Q A;  2F9W A;  3HRG A;  4JD2 A;  3ENB A;  3QFP A;  3TU5 A;  1ZXO A;  5F0X A;  3SJH A;  3F9M A;  1QVF M;  4BVP A;  4JD2 B;  5EOY A;  4U67 L;  4B1X B;  1VQ7 N;  1BA0 A;  3B8A X;  2Q0U A;  5AQS A;  4HTL A;  3KZB A;  4YOT A;  4BR4 A;  2QXL A;  3HOS A;  4H5T A;  3E66 A;  3G71 N;  3CQX A;  4O8K A;  3VF6 A;  5JVH L;  4JHD A;  1YJ9 N;  3SAH A;  3WXK A;  5AQI A;  1ZBS A;  3I33 A;  5AFU A;  4PKG A;  3KVG A;  3UE5 A;  3WXM B;  3MWP A;  5GIN A;  2RHK A;  4GV3 A;  2QM1 A;  3LDL A;  2P9U B;  1GLD G;  5AR0 A;  1KQS M;  2W40 A;  4H5N A;  1D4X A;  4EHT A;  5EXW A;  3MK6 A;  4IO9 L;  3HZ6 A;  4H5V A;  2QWN A;  5M1P A;  4B1V A;  4IOC L;  2BUP A;  4B1Z A;  3Q7C A;  4E1J A;  3U8X A;  1VQO N;  1W97 L;  4K43 A;  3VEZ A;  4FWM A;  1QZ6 A;  4FWQ A;  5M1K A;  4RTF D;  3E9O A;  3CJC A;  4K25 A;  4CBX A;  1W2B M;  4YOR A;  2HMP A;  5AQQ A;  1NM1 A;  4FVU A;  4H0V B;  3ID6 A;  2D0O A;  4JKB A;  3TTF A;  4WQ4 A;  3OW2 M;  3CIP A;  1NGH A;  2EWS A;  3P39 A;  3SMS A;  3DXM A;  4WFB L;  5BRF A;  3M3Z A;  1NGG A;  4FWN A;  3SAG A;  3L6Q A;  4I6M A;  2E1Y A;  1Q18 A;  2A6A A;  4HWI A;  2GTD A;  2ZJQ L;  3BUZ B;  3P38 A;  3VEW A;  4JKE A;  4I6M B;  3TTD A;  4ILJ A;  5LJW A;  3D7E O;  3VEN A;  1E4F T;  1YIT N;  4IJN A;  1EO1 A;  3SBT A;  2ZJR L;  2WC9 A;  4ILH A;  1NGB A;  2NRT A;  3UB5 A;  4A2B A;  2IVP A;  4H03 B;  3CD6 N;  5H1S Q;  3IKM A;  3VER A;  1DKG D;  5AQP A;  2NRV A;  5JLH A;  3GDQ A;  4IJA A;  3O80 A;  5EY4 A;  2PFU A;  3EN9 A;  5JVG L;  5BRD A;  4FWL A;  2ZGY A;  4BQL A;  2NLX A;  4BRN A;  4CJ7 A;  4YOX A;  4BC5 A;  5E26 A;  1R59 O;  4YDU C;  3ATU A;  1BUP A;  2AP1 A;  5GAD P;  3DWL A;  3G25 A;  1Q86 O;  5CE3 A;  5HL7 L;  3O4W A;  3GE1 A;  4K42 A;  3D6R A;  1ATS A;  3VEO A;  4BR9 A;  3ID8 A;  5BPL A;  2A41 A;  4PL8 A;  3O9S A;  4BRP A;  3O8M A;  1K9M O;  4JKC A;  3F2K A;  1QQO A;  3R3L A;  1GLF O;  1BOT O;  1DEJ A;  2P9S B;  2YHY A;  3A5O C;  4IOX A;  4A59 A;  1WUA A;  2BTF A;  4PL7 A;  4YOW A;  1K8A O;  2QWP A;  5BR9 A;  1MWK A;  1V4S A;  5KPR A;  4A57 A;  5MLC Q;  1MDU B;  5AQT A;  3CHW A;  2HF4 A;  2QTD A;  2CH6 A;  5BPN A;  1HUX A;  2IVO A;  3CJ9 A;  1T6D A;  2NRH A;  2NRR A;  3TSQ A;  4RWT A;  3E9L A;  5EX5 A;  4PKH A;  1G99 A;  2NZT A;  3O6W A;  4KH4 A;  2ITM A;  5DM7 L;  4A2A A;  4DHY A;  5C15 A;  2I7N A;  3ENH A;  3OBY A;  2CH5 A;  1SQK A;  4WFN L;  5I9E B;  5DM6 L;  4YOU A;  1BU6 O;  3LDQ A;  3CCS N;  3UKR A;  3C6A A;  4C23 A;  4FWK A;  5M1F A;  4QS7 A;  3CJB A;  4JNE A;  4G9Z A;  3ZX3 A;  1GLE G;  3FZF A;  2YHX A;  3GG4 A;  4FWP A;  5AQG A;  3G4S N;  4NO7 A;  3QML A;  5AQH A;  3QFU A;  2BH1 A;  4MLH A;  4O8U A;  1K73 O;  2HF3 A;  3PIO L;  2QI2 A;  4UY8 O;  3MCA B;  4CZK A;  3N4P A;  3SMP A;  2D0P A;  4H0X B;  2YX6 A;  3C7N A;  3P4I A;  3HBT A;  5KPT A;  2GEM A;  4DKW A;  3VF4 A;  4DQ8 A;  1BA1 A;  2NRZ A;  4CZI A;  2VGM A;  4GY2 B;  3CF5 L;  5AQO A;  4BRA A;  4O5F A;  1P8Z A;  4FOI A;  2FSK A;  3QBX A;  4JKF A;  1Z05 A;  5AQL A;  3T69 A;  3ULE A;  2A40 A;  3C6H A;  3BP8 A;  2Q36 A;  5F1X A;  1SS6 A;  4GVE A;  3O9T A;  1VQM N;  4BGB A;  3ZEU A;  4ILG B;  4CBW A;  3MCP A;  4Y0W A;  4ISF A;  4H0Y B;  3K9K A;  3N4Q A;  1BDG A;  3RVC A;  5AQJ A;  1NMD A;  1TUY A;  3CCV N;  1JCF A;  3AAP A;  4IEE A;  4BC4 A;  4CZF A;  3KWG A;  2A42 A;  5M1Q A;  4EFH A;  3WXJ A;  1U2V B;  4MO4 A;  1X9J A;  2KHO A;  1Q81 O;  2FLO A;  3EE9 A;  3OA9 A;  5C0Y A;  3F5T A;  3VEY A;  1YI2 N;  1U2V A;  5AQF A;  1P90 A;  3J8A A;  5FPD A;  3D2F A;  4JK7 A;  5F2R A;  3VF2 A;  4JKG A;  2P9P A;  2ZWH A;  4BC2 A;  3L4Q A;  3U9D A;  3M5R A;  5AQZ A;  3CCJ N;  3O9U A;  5GAE P;  4JN4 A;  3SBG A;  3I56 N;  3CXC M;  2JWK A;  3I55 N;  3P31 A;  2P9P B;  1SAZ A;  3I8B A;  1KXP A;  1RFQ A;  1LCU A;  5C2D A;  2P9U A;  4M7X A;  1NGC A;  2KLA A;  2CGK A;  2W41 A;  1SZ2 A;  2P9L A;  3H3N O;  1X3N A;  5AQY A;  1O13 A;  4H5W A;  1TYQ B;  5GIP A;  1M1K O;  5FPE A;  4JK8 A;  5KQD A;  4H0O A;  4BVO A;  4PHT X;  5CHI A;  2A5X A;  2WBN A;  4LC9 B;  1CZA N;  3C0B A;  1E4G T;  3WT0 A;  3WXI A;  4WCE L;  1TYQ A;  3A5L C;  1WOQ A;  1ATR A;  3QB0 A;  3UKR B;  3W0L A;  3MMV A;  1OVY A;  3AAQ A;  1T44 A;  2HBJ A;  2Q1N A;  3WUH A;  4A61 A;  3SK3 A;  4BR2 A;  2E2O A;  5C10 A;  5BPM A;  3CQY A;  1IJJ A;  2QWQ A;  2OTL N;  2ASM A;  2E8A A;  4EIA A;  3O9Q A;  2ASP A;  1NGJ A;  3CMA N;  1GLC G;  5M1O A;  1Q82 O;  3H6E A;  3QIC A;  3DAW A;  3NVM A;  3LM9 A;  4MO5 A;  4BG8 A;  3NVK A;  5ADX A;  1MWM A;  2E2P A;  1LOT B;  3LL3 A;  3FZK A;  5LY3 A;  4XEI A;  3A5N C;  4KH5 A;  3ULE B;  3CC4 N;  1VQ6 N;  1KAX A;  4B1Y B;  4ISG A;  4BR7 A;  4NLB A;  3CCE N;  1S72 N;  5AQU A;  2NRW A;  1NLV A;  2KKZ A;  1BG3 A;  3O1W A;  3A8Y A;  3UKU B;  4ISE A;  2FF3 B;  2PBD A;  3SLC A;  4BRL A;  4XH4 A;  4Z94 A;  4BRM A;  2QW9 A;  3ZX2 A;  3L0Q A;  4H0P A;  1QVG M;  2V51 B;  5FPN A;  1VQL N;  2GEL A;  3WXL A;  3KK7 A;  2QWR A;  3GOI A;  3LDN A;  3OBW A;  3EE8 A;  4OPH A;  5AQV A;  1DGK N;  4FWO A;  2QWO A;  1VAZ A;  3HI0 A;  3BEX A;  4IZ9 A;  4BR5 A;  2A3Z A;  3RSE B;  2J4R A;  1BO5 O;  3H45 C;  5JMV A;  4NB4 A;  2P9I A;  3U4L A;  2V7Z A;  4BQZ A;  4EAH D;  2OAN A;  1J6Z A;  3FZH A;  4JHD B;  4F9O A;  2HBL A;  3CER A;  1YXQ A;  2V7Y A;  2H3G X;  3VGL A;  2D1K A;  4OO1 J;  4GNI A;  3CC2 N;  3MDQ A;  2P9I B;  3O5B A;  4EHU A;  3GL1 A;  1YHQ N;  1VQ4 N;  1HX1 A;  5C12 A;  3OHR A;  4IWV A;  3MN7 A;  3CCR N;  5GAG P;  1N8R O;  3FE1 A;  1H1V A;  1YVN A;  1MA9 B;  1T3V A;  5FPM A;  3TTC A;  4H5R A;  3VOV A;  4C1N K;  4WFA L;  3DLL L;  5BRE A;  4CZL A;  5B8H A;  1HKB A;  3D2E A;  4IXC A;  1QQN A;  1QHA A;  1YUW A;  1NBW A;  2E1Z A;  3AGK A;  1HLU A;  2NRX A;  3ENO A;  3RSE A;  5AQR A;  5ADX H;  4JEP A;  3TPQ A;  5AZJ B;  2F9T A;  2YJF A;  3A5M C;  4IEI A;  4A5B A;  1YIJ N;  3VET A;  2HBM A;  3NMU A;  2HOE A;  3DXM B;  3EL2 A;  4CZH A;  3UKU A;  1VQ5 N;  3Q7B A;  4IFE A;  2E88 A;  1RGI A;  5M1N A;  3WQU A;  4MLE A;  4RCH A;  2P9N B;  2OTJ N;  1JCG A;  2FF6 A;  1NGE A;  2UYT A;  1S22 A;  1C0F A;  2IVN A;  3AY9 A;  3DJC A;  3VEV A;  1KC8 O;  3ZYY X;  5AFU H;  4BC3 A;  4BRQ A;  2VWB A;  4YDU A;  4BRH A;  4AM6 A;  4BRK A;  3M6G A;  4WF9 L;  1NGI A;  3VTH A;  3CCQ N;  2AA4 A;  3E1Y A;  3MX5 A;  1XQS C;  2ZGZ A;  1ATN A;  3CET A;  3GBT A;  2ASO A;  4WQ4 C;  3D2F B;  3EO3 A;  1YJN N;  4AM7 A;  4JKD A;  3TSP A;  3ZEU B;  4CBU A;  4MDB A;  1Z6R A;  4FPB A;  5EVZ A;  4FOE A;  2ZF5 O;  3HOT A;  1NGF A;  5BRH A;  3VGM A;  2GWK A;  4B1U B;  3U9Z A;  1JCE A;  3FZM A;  2V52 B;  1M90 O;  3J7Z O;  4A5A A;  1XC3 A;  4YOV A;  4FWS A;  4KBO A;  4BRC A;  3CPW M;  3K9J A;  2WUS A;  3WEE A;  3L4I A;  3ZET A;  4BRE A;  5GIO A;  4XH1 A;  2E20 A;  3AAR A;  1KAZ A;  4JK9 A;  4BRG A;  5GAH P;  4JKH A;  3BF1 A;  1RDW X;  1QZ5 A;  1U6Z A;  4B1W B;  3ZET B;  2E2N A;  1HKG A;  2FSJ A;  2FXU A;  3HM8 A;  4KH6 A;  4PKI A;  3PLA A;  1GLA G;  3VGK A;  4IO8 A;  4YOY A;  2VCP A;  2JWL A;  3FFK B;  4CZG A;  2ZJP L;  4GV9 A;  2QEX N;  2P9K B;  1JJ2 M;  2Q0R A;  2D4W A;  1V4T A;  3C7N B;  3IUC A;  4WQ5 C;  1C0G A;  3CJ7 A;  4B9Q A;  1VQP N;  1VQK N;  1NGA A;  1YAG A;  3MN5 A;  3VTI A;  5KQ8 A;  2P9N A;  3O1B A;  2Q97 A;  4FO0 A;  3H1Q A;  4K41 A;  3A0I X;  5AQK A;  4BY9 C;  2QWM A;  4OPA A;  5AQN A;  5E84 A;  3VES A;  2NNW A;  1Y64 A;  4NLC A;  3R8E A;  4FSV A;  4M63 C;  3SAF A;  4WQ5 A;  4BRO A;  4WYB A;  4GV6 A;  1HPM A;  5AZI B;  4AF1 A;  1X3M A;  3CPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...