3Q7BA

Exonuclease domain of lassa virus nucleoprotein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
207
Chain Sequence
GFTAGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEKKKRGGKEEITPHCALMDCIMFDAAVSGGLVLRAVLPRDMVFRTSTPRVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nucleoprotein
publication title Structure of the Lassa virus nucleoprotein reveals a dsRNA-specific 3' to 5' exonuclease activity essential for immune suppression.
pubmed doi rcsb
source organism Lassa virus
molecule tags Hydrolase
total genus 59
structure length 207
sequence length 210
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17290 Arena_ncap_C Arenavirus nucleocapsid C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3q7bA01
3MWPA 3MX2A 3Q7BA 4GV6A 4G9ZA 3Q7CA 4GV3A 3MWTA 3R3LA 4FVUA 3MX5A 4GV9A 4GVEA
chains in the Genus database with same CATH superfamily
3TSPA 3CQ8A 2YKMA 2GUIA 1QZ6A 3D6RA 4KH6A 1S9EA 2EX3A 4DV1K 2CH5A 3E01A 5AQIA 2HMIA 1R59O 1E3MA 3C94A 4CJEA 4CF9A 1YAGA 2IIRA 5AFUA 5KPRA 1W0HA 4CEDA 3A5LC 1NGIA 5I9EB 2O8EB 2NLXA 3MAQA 4PA1A 1KAXA 4O8UA 3MN7A 3M6GA 1KRPA 1ZXOA 4JKBA 3T69A 1GLAG 1BQNA 4Z4IA 1BIZA 1I3AA 3RSEB 4OKEA 2Q0RA 2E6MA 3IMXA 3KHYA 1NG9A 4KHQA 3MCAB 4MDAA 5M1FA 1SV5A 5AQJA 4FJ5A 3P1GA 3D0PA 2VQEK 2E88A 3AVBA 1VSJA 5F0XA 1ASWA 1L3TA 1GOAA 3H08A 3THYB 4KHYA 4FLZA 4JKCA 3CCUN 1OH5A 4H0TB 3K57A 4UY8O 3AV9A 4DG1A 4DCHA 4DS5A 3HSCA 4CF1A 5FPDA 4K42A 1IKXA 4JKGA 4MDBA 1RILA 3OHRA 2ITMA 2VG7A 4DSKA 3CIPA 3OYKA 4GY2B 3T1YK 3OYJA 1H1VA 5HRSA 2FBTA 4J2AA 1REVA 3MN9A 4N41A 4IEEA 4EP5A 3DLKA 4U67L 1WSJA 5AQMA 1J6ZA 3KLGA 3BZCA 4H0XB 4CEBA 4CFDA 1HUXA 3HP6A 4E7LA 1ATSA 4JS5A 4JK7A 4DSFA 5EY4A 1EXQA 1P8ZA 3O9QA 1NU0A 5A2QO 4BVOA 1CZ9A 4CJUA 4CZHA 4OKKA 1QQOA 4IOXA 2A41A 3NFAA 3HXMA 1MWMA 3KLHA 3U3YA 4K25A 3K5MA 2VG5A 3ZSZA 3P31A 1ASVA 2IDOA 3QICA 4FJJA 2Y1IA 4CFAA 4BRMA 3HM8A 4BRLA 3SV4A 1ATNA 1GLCG 4FOIA 3N4QA 2YX6A 3GG4A 2D4WA 4RG8A 2F9TA 1U2VB 4CHNA 3MECA 2PZSA 4ISEA 4BQZA 3MN6A 3SJJA 4F3OA 3HK2A 1IKVA 4H5NA 3Q7CA 3L2WA 3TAFA 3O3HA 4CJTA 2DFHA 3CQYA 4LSLA 4DB3A 2KHOA 2FF3B 4M3ZA 3NCIA 1NJXA 3B6OA 2F96A 1A5XA 4CJWA 3OYLA 4AHSA 4KBOA 4X65K 4DQRA 4OKJA 5CYMA 3DXKB 4QOZB 2FSJA 3M8SA 1XUPO 4C8KA 5GAEP 2ASPA 4KHUA 2P9LA 4H4MA 4B8CA 1LWCA 3OBWA 3JYTA 2UUAK 3RR8A 3NMUA 4ID1A 4O5BA 3ZT3A 4LH4A 3PSFA 3HL8A 4F9OA 1N32K 3M1FA 1BCMA 5AZIA 3THWA 3CERA 4CGDA 1XC3A 3ULEB 1Q7YO 3SPZA 3LPTA 4O4GA 3WQUA 4LD0A 3KIOA 3CM5A 4DTXA 1U04A 3LDOA 2F4VK 4WF9L 1NGEA 2ZM6K 4YDUC 5TKYA 1NJIO 1VRUA 1XC9A 2PBDA 2A42A 4PKGA 4B1WB 4BY9C 3OTOK 1Z05A 1G15A 4DQQA 1OKJA 4JRPA 4FJ7A 3D7EO 3J7AP 1NGHA 4B9UA 3MX2A 3LDLA 3FZMA 2FLOA 5JVHL 1BDGA 1C1AA 1I39A 4HUGA 4CHZA 5KTQA 3CCSN 1HR0K 2BE2A 1FW6A 1N33K 4CJKA 3KTQA 2CGLA 4AILC 2Q97A 1RDAA 1LW2A 3AY9A 3AO1A 1SAZA 2BGGA 1T6CA 4DFPA 1RDUA 3CJ9A 2YNIA 4BRCA 5C2DA 1JLCA 2P9LB 3AO3A 2E6LA 1NWKA 1EKEA 2YNGA 4BDZA 4CJ5A 4N76A 4BDYA 2E4LA 4CJ7A 3UE5A 5CY4A 2E2OA 1WSHA 4PKIA 1NMDA 4WFBL 3VGMA 3H3NO 4DTJA 1D9DA 4XIUA 3HOTA 1X9JA 5LMUK 2Q3SA 4FM2A 3HM9A 4EHTA 1RGIA 4LF5K 1QQNA 3E9OA 1X9MA 3AA2A 2ITGA 3VQBA 1J54A 3OYAA 4CEFA 4LF4K 3A5NC 5M1QA 4JKDA 2WFBA 2LSNA 4JLHA 4GV3A 4I2QA 3VQQA 3H1QA 4IO9L 2NRXA 1NK8A 3AA4A 4TSXA 1GOBA 5HRNA 3ZLJA 3AVFA 3ZSOA 1VK0A 1C0UA 1C0TA 4M3WA 4B9MA 3CC4N 2ASMA 4CBXA 3V4IA 2OPSA 1RBRA 3LDQA 3TU5A 3V9SA 4HHTA 3UKUA 3JSMA 1X3MA 4LFAK 3AVKA 4BRGA 1BISA 4A61A 4BWMA 2HHXA 4CJVA 5M1KA 2ZD1A 3BEXA 4O0IA 2DY4A 5C25A 2Q1NA 4CK1A 5AQZA 5EXWA 1KLMA 3QEPA 4CJPA 5AQOA 3V81A 1D5AA 4KB1A 4AM6A 5DK5A 4EIAA 2GWJA 3DRRA 2OANA 5BPMA 4DU3A 4H8KA 3ZT4A 2YHWA 1DLOA 2NRWA 2RN2A 2YNHA 2XY6A 3NBPA 3C6TA 3CMEN 4B9VA 5AQQA 3RMDA 4KTQA 3CJ7A 4EFHA 2E8AA 3F9MA 5AQGA 2GEMA 2NZTA 3LP2A 4E1JA 4CJRA 4HVJA 4QCLA 3NGYA 4XH4A 1KFSA 1ZBLA 3WXLA 1VQ6N 3HVRA 3OYDA 3VN5A 5KPZA 4PUOA 4B9SA 3EEQA 4JI2K 3WNFA 4CZJA 1F21A 4AM7A 2E2NA 4A57A 4AH9A 5F2RA 1NKEA 3DJCA 3K5LA 3OJSA 4CZLA 2W41A 3DLRA 4MLHA 4KI6A 4YORA 3L3VA 3CG7A 1JLBA 3W0LA 4YOVA 1TAUA 1IBLK 1ILYA 4LF6K 1J5OA 4Z0UA 4CJLA 4PL8A 3SMPA 1RBTA 1HNWK 5CE3A 2X74A 1KVAA 1RDWX 3CJCA 4CD1A 3G71N 3BUZB 2GELA 4FLXA 4O0JA 3FGUA 1BU6O 3TSQA 2EHGA 4BE0A 2QKBA 5HL7L 3CXCM 1JCEA 1Q8IA 4JD2B 4F2SA 3ENHA 3WXIA 2HHVA 4B1UB 4DV4K 4FJIA 2A3ZA 2D0OA 3WNGA 4GVMA 4X62K 4RW7A 1OVQA 3AGRA 2UXCK 3KLIA 4DUZK 1WN7A 2QK9A 4KV8A 5IT9O 4FK0A 3VQAA 4C8LA 4FWSA 1TL3A 2G8HA 1TYQA 2WBNA 4B3RK 3ZX2A 1TK8A 1JJ2M 4WQ5A 1Q9XA 5HOOA 4AQYK 2O8BA 3F9KA 2QKKA 3E1YA 4QS8A 3HPOA 4DSLA 4AF1A 4DR4K 1JKHA 1YF5L 4FK2A 4FWQA 4OO1J 3VQCA 2G8FA 4K41A 1CZAN 1P90A 3VESA 5CR4A 4FOEA 4FJKA 1JXEA 3Q7BA 4DV2K 3VERA 3VEZA 4W5RA 1HYZA 3CPWM 2UXDK 3R8EA 4CEOA 3NE6A 2YCHA 2Z1GA 4B3SK 1VHXA 2YI1A 2KFNA 2P9NA 5JLFA 1T3VA 3RRGA 1S1VA 3KWIA 2KKZA 1C0FA 4WCEL 4B8AB 3SV3A 2YJFA 4CIGA 1M90O 4KFBA 3H46O 4GVEA 2P9PB 4JK9A 1C1BA 4FLYA 2O8BB 3N4PA 1XI1A 2VWBA 3LP3A 3J81O 3NDKA 2FXUA 1IKWA 3AVMA 5AQSA 1RTIA 4FWLA 3QO9A 3MXMA 1HX1A 2FBYA 1KQSM 3VQ9A 4RCHA 3VEOA 2HF4A 1DEJA 3PIPL 1X9WA 4YOXA 1YHQN 1TKTA 4JNEA 4Z4EA 2OPPA 3ZT0A 3L2VA 4IOCL 3OYHA 1CXQA 2NRHA 4HWIA 4WQ4C 3VQDA 4BC5A 3KK1A 3LWLA 4DR5K 1C0GA 1RDBA 1SZ2A 4BACA 1WLJA 3PIOL 2G8IA 1YIJN 3DLEA 3TTCA 3TWHA 4DKWA 2ZGZA 4BROA 3O4WA 1HJOA 2KQ2A 1B9FA 3HVTA 1WOQA 1N6QA 4ILGB 3O9RA 3IUCA 1KAYA 1ZBSA 1RT4A 4FJGA 4M7XA 3FFIA 3DAWA 4YNQA 4F3TA 4M63C 3KVGA 2HNYA 2Z1JA 3GE1A 2O8EA 4DUYK 1RTDA 3WXKA 4K8XA 3OYCA 2GUPA 5LL6Z 3CF5L 4YDUA 3U9ZA 2I7PA 4B3OA 4ELVA 3K5OA 5JVGL 1RT5A 1CXUA 1TUUA 2E1YA 1GLBG 1KTQA 3AGKA 3TAQA 4F4KA 4FLUA 2IAJA 3QBXA 3QEXA 2XY7A 5EVZA 3SQ4A 5BRFA 1RDDA 2O8CB 2E2QA 1VSKA 3THYA 3ZYYX 1LOTB 1IKYA 2DPNA 2QXFA 2HB5A 1SKSA 4FK4A 1T8EA 3S9HA 3C0BA 3VMFB 2YHBA 4I7FA 3O9SA 3O4NA 5ELZA 4N5SA 3OS2A 3SJHA 2KZMA 5AQFA 1VRTA 4DTOA 2OA8A 1O13A 4DTNA 3MWPA 1A5WA 1W97L 3AVHA 4GKKK 2D5RA 5F1XA 2QA4N 4DR2K 2ZWHA 3ZT1A 4IJNA 4WYBA 1Q86O 3QNNA 3ENBA 1WBBA 4BREA 3O1WA 3DRSA 1S72N 3WNEA 2B6AA 4OPJA 1QTMA 3IKMA 4DTSA 5I42A 2P9KA 4QS7A 4M41A 3MX5A 5M1NA 3CJAA 2QW9A 4A5BA 3O4QA 3S3NA 3GOIA 3WUHA 4IFYA 3K58A 3OVNA 2XY5A 1VSLA 2NRTA 4DR6K 3AA3A 3BGRA 3SUOA 1MU2A 1FK9A 4AHCA 1DTTA 3ULDA 3LP0A 1JL2A 4C8MA 3ZSVA 2HHQA 2QWQA 1VQ5N 1WB9A 5AQRA 3OYNA 3CFRA 2PFUA 1S6QA 4DHYA 1OH8A 1W7AA 1YTAA 4C8OA 3GBTA 1UWBA 3CJ1A 4BGAA 2IVPA 1KC8O 1NOYA 1RCHA 1U2VA 3QB0A 2IS3A 4BQLA 2QTDA 1KD1O 1K9MO 2ZJQL 1LWFA 4M45A 1SKRA 4F2RA 1UA0A 2D0AA 3KKSA 5AQUA 4O44A 3DWLA 2P9KB 5D3GA 1TAQA 3L2QA 1VQ8N 1BL3A 4NCBA 2HNZA 2WC9A 3J80O 2UYTA 4DSJA 4FZZA 3DM2A 3NHGA 2PYLA 1NK7A 3KJVA 4EZ9A 4CD3A 4CGFA 1L5UA 2V7ZA 2P9SB 3DXKA 2HF3A 4L3QA 2KFZA 5J2MA 3PV8A 1MWKA 5BN8A 3MDQA 1FKPA 3NAEA 4DTPA 3ZSQA 3S3OA 5BREA 1SL0A 3F5TA 2DTUA 3ULEA 1VSIA 1RFQA 2JWLA 3SI6A 1KVBA 4NCAA 3KKRA 3MCPA 1RNHA 4CEAA 3ZX0A 3R3LA 5AQVA 4Y1CA 1N34K 4KHWA 3TSUA 3MXIA 4CGIA 4LY7A 1KSPA 1GLFO 3VEVA 1QSLA 1JLAA 4AHUA 3KLEA 4DFKA 5BR8K 3ZSYA 5HLFA 1HNXK 4NLCA 4NYFA 2BH1A 1EO1A 3B8AX 2DFFA 2KLAA 3WNHA 2VGNA 4C1NI 4CE9A 2B5JA 1QVGM 4JKAA 4FJ8A 4G9ZA 3J7YP 2JWKA 2YHXA 3HT3A 2D0CA 4FWKA 5KQ8A 2RF2A 1RT7A 2FSNA 3P83D 5CHIA 1ZBFA 4KH5A 3KD5E 4K0KK 3QBWA 1VQ9N 4A62A 2YJEA 1R0AA 2OTJN 3IS9A 4BRPA 4DQPA 3SQ1A 2QWRA 2HHUA 3CPEA 5T7BA 1WNSA 2O8FB 2I5JA 3PO5A 1XNRK 2KW4A 4CBUA 3P38A 3SAHA 2A5XA 3MMVA 1QZ5A 4W5OA 3VQPA 4BRIA 3A8YA 1JL1A 3I55N 1RT2A 3OYIA 3OY9A 4FM1A 1NJZA 5HBMA 3HYFA 4IWVA 4DV6K 2CGJA 2QWMA 4CW7B 4JHDB 1E4FT 4EAHD 4Z94A 1KVCA 3CCVN 3QERA 5GAGP 5BR9A 5JS1A 2ASOA 4R5PA 4CJQA 1HKCA 3OJUA 3SUNA 3SMSA 4CCHA 3JXUA 5JS2A 1VSMA 5BPLA 4JI3K 3NF9A 3ITHA 1NGJA 3M5RA 3VQ6A 3PY8A 3VETA 3CHWA 2X78A 2HBMA 1NGFA 3EYZA 3VF4A 2G8WA 5TKWA 4J2EA 4DR3K 4E7IA 5HROA 1JLGA 3UKRA 3FZFA 3PX0A 3A2FA 2BANA 2AA4A 4I6MB 3QFUA 1GLLO 1Q9YA 2OPRA 1DGKN 2FSKA 1KLNA 3F2KA 2JGUA 1VQMN 2BDPA 1KCFA 4J2BA 3T19A 3THXB 1XHXA 3DI6A 4M3RA 4YOUA 4KPYA 1HKBA 3O5BA 4JI1K 4CHPA 1NNEA 2XO7A 4JI6K 1N36K 1NK4A 1BCOA 1HQEA 3VQ8A 4BR9A 5AJ3K 2QXLA 1SL1A 1NK0A 1D9FA 1WAJA 3R6MA 3EO3A 3EKSA 3VOVA 2KZZA 2HHTA 2NRRA 2NRVA 4BVPA 3OS1A 1VQON 4PY5A 3HO1A 3EY1A 1TUYA 2FC0A 4B3TK 2YKNA 1RBVA 1XNQK 3OS0A 1QE1A 4ZTJA 3UKRB 4U7BA 3HJFA 2FBVA 4ICLA 4OX9K 3AO2A 3KK2A 3J8AA 3NH2A 4JAXA 1T7PA 3VEWA 4CFCA 3WT0A 2VGMA 4JN4A 2HBLA 3QEIA 4IKFA 4E7KA 1BOTO 1YVUA 1TKZA 3HBTA 2UUCK 1VQKN 2IVNA 4H03B 2P9UB 1U45A 1Q81O 5DM7L 4IG3A 4FXDA 3SPYA 3AVIA 3CCRN 1S9GA 3RTVA 3OW2M 4JD2A 4E0DA 1BWFO 3FZHA 4W5NA 3CETA 4H0VB 1Q82O 3AARA 2QWPA 2A6AA 4M3YA 1ZC6A 4O8KA 3AA5X 3SLCA 3SCXA 3O08A 1RDCA 4B1YB 3S3MA 5BPNA 4B1XB 1NJWA 2Y1JA 5MLCQ 3G10A 4BG9A 2P51A 1EX4A 2GBZA 1IJJA 1SUQA 3ID6A 4WFNL 1HJRA 4LF8K 1N5YA 1HPMA 3SAFA 4H5WA 5E26A 1S6PA 4DF8A 2XHBA 4K8ZA 5KPTA 4Q5VA 4PL7A 3PSIA 4FW1A 1Y97A 4PWDA 2GTDA 3O80A 3BZKA 4EHUA 2Q2RA 4ILJA 3RRHA 4J2DA 1XMQK 3IG1A 3D2FB 5KI6A 2V7YA 5LJVA 4FWPA 1BG3A 4JKEA 3VGLA 1NGBA 4KKOA 2F8SA 2D0PA 1QS4A 5CZ1A 3WEEB 3I56N 4K43A 3G6EN 3C6HA 4AHRA 2P9PA 2X6SA 3HP9A 4DR7K 3TAEA 4BRFA 5FPMA 2P5GA 2HOEA 3NVMA 4RW8A 5FPNA 2OZSA 3EL2A 4OLBA 1YTUA 4CECA 1NGDA 4H0PA 3E9PA 1S5JA 2P1JA 3AVNA 4N47A 3MN5A 1NMNA 3PO4A 5C24A 3G0ZA 1ZYQA 1E4GT 4BC4A 5M1PA 3F73A 2W40A 3H3OB 1B92A 3D2EB 1VQPN 1UA1A 5GAHP 5KGWA 4CZFA 4RWTA 4HCBA 4FLVA 4CZEA 4FJLA 3HOSA 2GWKA 3VQ4A 3JS6A 3VEYA 3VENA 3VQ5A 4KHSA 3ID8A 4JEPA 3V1RA 2VWJA 3LDPA 3K0SA 4MQ3A 4FCYA 3I0RA 4BRHA 3IAYA 4CFBA 1VQ4N 3RMAA 2IGIA 3O3GA 3EZ5A 4DV0K 4Y0WA 1XHZA 2YHAA 1OVYA 1NM1A 3EN9A 4CJFA 4E19A 3L2UA 1JLQA 4CI6A 4FO0A 3KD1E 3L4QA 4B9NA 4FZXC 2HVIA 2YNFA 3QEVA 3ZSRA 4AHTA 1HQUA 1GLJO 1YI2N 2IOCA 2F7TA 4LF9K 1MDUB 3OYBA 4DV7K 2F8TA 4B9QA 3LM2A 1BQMA 3P39A 1WBDA 3VF6A 4X66K 1BI4A 3CFOA 3SUQA 2HSTA 3I0SA 1HRHA 1KFDA 3ASMA 4OGEA 1YJWN 4FPBA 5J2NA 3I8DA 1VSHA 1NKCA 3TTDA 3LANA 2G8VA 3GDQA 3CCQN 3CI5A 1DTQA 4KTZA 2RE2A 5SWMA 2O8CA 1TKXA 4DFMA 3KK3A 4OJRA 3T7ZA 5ADXH 1ITGA 4JS4A 4JI8K 4GW6A 4YOYA 4HCCA 1NOZA 3BY5A 3G4SN 5HRPA 1K73O 1C6VA 4X64K 4BC2A 3ENOA 3OYMA 4CBWA 3I33A 3PUFA 1L3VA 1NK5A 4O5FA 3THVA 5BN9A 1G99A 5FROA 4CHQA 1RT6A 1RBSA 5KRSA 3M8PA 2XRIA 4DTUA 4EP4A 1BI4B 1X3NA 1IBMK 3MEDA 3KZBA 3CCMN 1J53A 5FPEA 3DMJA 3DLHA 1J9AA 1ATRA 2QWLA 4YHHK 4JI7K 4UQGA 3ZX3A 4DQ8A 4Z4CA 2IVOA 2A1RA 4KI4A 5SZTA 4KHNA 3VGKA 4FYDA 5KRTA 3V6DA 4WFAL 5B8HA 3I8BA 4B1ZA 1RBUA 3O6WA 1FJGK 1W9HA 1EQYA 3ZCMA 4BE2A 1I94K 4M3XA 2V51B 2P9IB 4BR0A 4DSIA 3CYMA 3C7NB 4FW2A 4L8RB 2FBXA 5DM6L 1JCFA 1K8KB 4IXCA 4B08A 3UIQA 1JCGA 1LW0A 4AHVA 2HHSA 3EKUA 3U4LA 4H0YB 2OCEA 1W2BM 3SZ2A 1Z6RA 3R9PA 4FLTA 3KLFA 4LH5A 3U6FA 1T6DA 1SKWA 4NO7A 4BC3A 1LAVA 3H1VX 4E7HA 3ZEUB 2VWKA 3QIPA 4IO8A 3DRPA 2Z1IA 3CC2N 3V9WA 2JLEA 4GKJK 4XEIA 4HTUA 3A0IX 3J7ZO 5LJWA 4KTWA 4WE1A 4C8NA 4CGHA 5J2QA 3EE8A 2PYJA 2P9SA 2OZMA 4CEEA 3P4IA 1UOCA 4DV5K 4Q0BA 3LL3A 4ILHA 4JI4K 1N8RO 3OYFA 2HBKA 3AVLA 4A59A 3CCEN 3AVCA 4H5VA 1TVRA 3QMLA 1U48A 3FFKB 4CGGA 4FJXA 2NRZA 5CYQA 3LALA 2O8DA 4HUEA 2GX9A 5DMRA 3MEEA 1T03A 3O9UA 2W6KA 2UU9K 1LWEA 3FLCO 5AZJA 2HW3A 2DFEA 1U4BA 1MA9B 4BG8A 4YOTA 1HNVA 5AQXA 1CZBA 3CC7N 4DLEA 3QFPA 1QHTA 4WQ5C 2PY5A 5AQNA 5JMVA 4H5TA 1ZBUA 2Q36A 4CF0A 4FSVA 1NK6A 1KAZA 3NGZA 5FRNA 4BRAA 3LZJA 4ELUA 2HVHA 4MO4A 1EWRA 4CJ4A 1YJNN 4M3TA 5C0YA 3MK6A 3K5NA 4E89A 5GADP 4FVMA 1BO5O 4IDHA 4GV9A 1NLVA 2RPIA 4O55A 1YT3A 3CQXA 4IDKA 3L6QA 3KK7A 2O8DB 4KREA 4F8RA 4ZHRA 2OTLN 1IG8A 2B4JA 3SK3A 2QWNA 2Q0UA 1NGCA 2G8UA 5AZJB 5AFUH 5J1EA 2O8FA 2YHYA 3LAKA 4JKGB 2NNWA 4Z4HA 2H3GX 5KQDA 1VAZA 1VQLN 4IJAA 3ZETA 4KB0A 4LF7K 2UXBK 2E20A 2ATQA 3TAMA 5AQTA 2ZE2A 4KAZA 1ZBHA 3TAPA 4IFEA 1YJ9N 3HPGA 3MXJA 1BA0A 3K9JA 3ISNC 1S1TA 3NF8A 1EP4A 1RTHA 4A2BA 4M42A 1S22A 4JHDA 2KTQA 1A5VA 2OYQA 3U9DA 1TGOA 2P5OA 4ISGA 4E1NA 3TR8A 3T1AA 4KO0A 4LFBK 5H1SQ 1EETA 4KH4A 1IBKK 2XY8A 1K8AO 1DKGD 3E66A 3FE1A 4QS9A 4BRNA 1RT3A 4FPAA 1TK5A 1XQSC 2PAVA 5BRHA 4FWOA 3SQ0A 3RR7A 1DT9A 4A5AA 3QINA 1ZBIA 3FZLA 4DF4A 3SBGA 4I6MA 3RMBA 3ATUA 1SL2A 1HNZK 4FJMA 4NLBA 3ZETB 3BP8A 1LAWA 4GNIA 1NGAA 4BR2A 3VTIA 3TARA 4IBNA 2Q31A 4CZGA 3THXA 3SUPA 5AQKA 3AAPA 4W5TA 1IV0A 2QI2A 4DLGA 5GIOA 4V19S 5AQYA 4M7YA 1KXPA 3DLBA 3W3DA 3NH1A 3AVGA 5C2FA 1HPZA 3LDNA 4R79A 3ZT2A 1NKBA 2IC3A 4XH5A 4B9LA 1JLFA 5GIPA 2VYPA 3VQEA 3NF7A 4JI0K 3CJBA 5LMNK 4YFUA 3RVCA 3HRGA 4Z4FA 4JI5K 1QQMA 4CEZA 3NH0A 4I9QA 1M1KO 3L8BA 4FM0A 3K9KA 1JLEA 5C12A 4CZMA 3A5OC 4LC9B 3U8XA 3HPHA 1YUWA 4GV6A 4DQIA 5AZIB 3S41A 1CLQA 3THWB 4C23A 1U47A 5K14A 1ASUA 3O3FA 5AQWA 4OPHA 4CK3A 1K6YA 4CK2A 4E1MA 4M3UA 4B9TA 3ALYA 4FWNA 1T05A 4HTLA 4OLAA 3VF2A 4GMJB 5BRDA 4CIEA 4OGCA 3TPQA 4CF2A 2QWOA 2P9UA 2WTUA 4FWRA 4CHYA 1XWLA 3R1XA 1HLUA 4WQ4A 4HUFA 3PX6A 3VQ7A 1D8YA 3CMAN 3SYZA 2E5LK 4A2AA 3TI0A 1YITN 3IFRA 3LPUA 2I7NA 3OBYA 1JXBA 1L3UA 3SBTA 1S1UA 3MWTA 4FJ9A 5IWAK 1XMOK 1ESVA 1T44A 3QIOA 3G25A 3AVAA 2AJQA 1EWQA 1OH6A 1WUAA 4C1NK 4LSNA 1L3SA 5HRRA 2F9WA 1J5EK 3C6UA 2HHWA 5LY3A 1WSIA 3HTVA 2CGKA 4XH1A 3LAMA 5E84A 3LZIA 4DSEA 1TKDA 5CZ2A 4QAGA 4CERA 4DU1A 3M3ZA 3DOKA 3EZWA 4BR4A 1QSYA 3L2RA 3C6AA 4KHPK 4FWMA 4MO5A 3D2FA 1VQNN 4H5RA 3WXMB 4MLEA 4BWJA 4DMNA 1OH7A 3OYEA 5AQPA 1VSEA 1UAXA 2O4IA 4MFBA 3ZSXA 3L0QA 3VPZA 3GL1A 3HZ6A 3WEEA 3RMCA 3L4IA 4H0OA 3K2PA 3VTHA 2BUPA 1NBWA 3UKUB 2E2PA 4JV5K 4RTFD 3TAGA 4DS4A 2FF6A 4B1VA 4PQUA 4CVNE 4I2PA 5M1OA 1SS6A 3UB5A 2R7YA 1YVNA 3K59A 5E41A 3CCLN 1Z26A 1C1CA 1RTJA 1IO2A 1VSDA 2A40A 4PKHA 1NJYA 3FR0A 4DV3K 4DQSA 3HSTB 3D2EA 3PX4A 5C15A 3NVKA 1V4TA 4NXNK 4IFVA 2ZJRL 1U49A 2HBJA 4IOAL 3IRXA 1GLDG 2CH6A 5EU7A 3QNOA 3OYGA 1TV6A 3KWGA 1D4XA 3AO5A 3TTFA 5FDLA 5J2PA 4H4OA 1WSFA 5ADXA 1S1WA 2X6NA 2ZGYA 3DXMA 3M8RA 3BF3A 5HP1A 3B6PA 1QHAA 1RT1A 1FKOA 4BRDA 4N56A 1HMVA 4I9LA 2G8KA 2ZJPL 2ZQBA 4CF8A 4BRKA 2NUBA 3NF6A 4IG0A 3OA9A 4JK8A 4RW6A 1WAFA 4CGJA 2AP1A 1YXQA 4Y1DA 4OVLA 3VA0A 2W6LA 2OPQA 4DU4A 1S1XA 2J4RA 4RW9A 3SAGA 3LDSA 4ID5A 2D1KA 5EX5A 3SQ2A 2RKIA 3O9TA 1GLEG 1BIUA 1S3XA 3BF1A 3QESA 3QEWA 2HHHK 1QQCA 3AAQA 1GOCA 3E9LA 4JKHA 3V9ZA 3LM9A 5C10A 2HMPA 4PHTX 3HI0A 5AQHA 4ISFA 3SNNA 4JKFA 3O8MA 1LV5A 5FLXO 2VG6A 1C0MA 3C65A 1QSSA 3IDHA 1NK9A 4CHOA 3O1BA 3DXMB 4CEQA 4BR5A 3V9XA 3CM6A 1WSEA 4ZTFA 4E7JA 4EZ6A 2WUSA 4FLWA 4KRFA 1FXXA 1BGXT 1TL1A 1WSGA 4FZYA 1HYSA 2EWSA 4B3MK 2WONA 3T1HK 5KGXA 2QM1A 2ETJA 5JLHA 4CIFA 2O4GA 1V4SA 2QEXN 1TYQB 4NB4A 4JYAK 1NGGA 1BHLA 1X1PA 1IG9A 3DOLA 4W5QA 2BTFA 4IEIA 1X9SA 3TABA 4ELTA 3AVJA 1HKGA 3DYAA 1TK0A 5FRMA 3ZSWA 3LWMA 3V1OA 3AO4A 4J8FA 3VEXA 3PLAA 3QLHA 3P5JA 4NCGA 1HYVA 2W42A 3DLGA 1B9DA 1BA1A 1SQKA 4CJSA 1BUPA 4CESA 3H6EA 2HNDA 2A1SA 4DTRA 3CD6N 5AR0A 4RW4A 1Z25A 4DTMA 4BDPA 2P9IA 2ZF5O 4CZIA 3EE9A 3ATVA 3CCJN 1HNIA 3C7NA 2P9NB 2RHKA 1VSFA 2UUBK 1K8KA 4OPKA 3QDKA 5JICA 2YV0X 4BGBA 5C42A 2VQFK 3BDPA 4FJNA 5EOYA 4DR1K 4IZ9A 4OPAA 3L3UA 4NYNA 2V52B 5AQLA 4DWIA 5GINA 1LCUA 4G1QA 3CFPA 3JAMO 3ZEUA 3WQTA 4LFCK 3C95A 3TANA 2GV9A 4BE1A 1U6ZA 4FL9A 3LP1A 2Z1HA 4YOWA 3D45A 3U3GA 4FVUA 2WOMA 3V1QA 1Q18A 1VQ7N 3FZKA 3M8QA 4CJ3A 4E3SA 3RSEA 3MEGA 1QVFM 4DFJA 3WXJA 2D0BA 4NXMK 4BR7A 4YY3K 4CZKA 2VCPA 1O1WA 3VA3A 3QETA 4JRQA 4FJHA 4Z4GA 3NGIA 3RWUA 3H45C 3T3FA 1IH7A 3V9UA 5I3UA 4BRQA 1Y64A 3DLLL 2E1ZA 3A5MC
chains in the Genus database with same CATH topology
3TSPA 3K9JA 4FOEA 5CR4A 3Q7BA 3VERA 4A2BA 1QZ6A 3D6RA 1S22A 4JHDA 4KH6A 3VEZA 3UKRB 3U9DA 4U7BA 2CH5A 5AQIA 1R59O 3CPWM 4ISGA 1YAGA 3R8EA 2IIRA 5AFUA 5KPRA 3J8AA 4JAXA 5H1SQ 4KH4A 3A5LC 2YCHA 3VEWA 1K8AO 1DKGD 3E66A 3FE1A 4QS9A 2YI1A 4BRNA 1NGIA 2P9NA 4FPAA 5I9EB 5JLFA 1XQSC 3WT0A 1T3VA 2NLXA 2PAVA 1KAXA 4O8UA 2VGMA 3MN7A 4FWOA 2HBLA 4JN4A 5BRHA 3KWIA 3M6GA 2KKZA 1C0FA 1ZXOA 4JKBA 1BOTO 3T69A 4WCEL 1DT9A 1GLAG 4A5AA 2YJFA 1M90O 3FZLA 3H46O 3HBTA 2Q0RA 4GVEA 3KHYA 3IMXA 3RSEB 2P9PB 4JK9A 3SBGA 3MCAB 4I6MA 3ATUA 4MDAA 5M1FA 2IVNA 4H03B 1VQKN 2P9UB 4NLBA 5AQJA 3ZETB 3N4PA 1Q81O 3BP8A 5DM7L 4GNIA 1NGAA 4BR2A 2E88A 2VWBA 5F0XA 3CCRN 3VTIA 3OW2M 2FXUA 2Q31A 4CZGA 4JD2A 1BWFO 3FZHA 3AAPA 3CETA 4H0VB 5AQKA 5AQSA 1Q82O 2QI2A 4FWLA 3AARA 5GIOA 4JKCA 3CCUN 2QWPA 1HX1A 4H0TB 2A6AA 5AQYA 4M7YA 1KXPA 1KQSM 1ZC6A 4UY8O 3W3DA 4O8KA 3SLCA 4RCHA 3VEOA 4DCHA 2HF4A 3HSCA 5C2FA 1DEJA 3O08A 5FPDA 3LDNA 4K42A 4JKGA 4MDBA 3OHRA 3PIPL 2ITMA 4B1YB 4YOXA 1YHQN 5BPNA 3CIPA 4R79A 4B1XB 4GY2B 4JNEA 4XH5A 1H1VA 4IOCL 5GIPA 5MLCQ 2VYPA 2NRHA 4BG9A 4HWIA 4WQ4C 4BC5A 3MN9A 1C0GA 1IJJA 4IEEA 3CJBA 3ID6A 1SZ2A 4WFNL 3RVCA 3HRGA 4U67L 3PIOL 1HPMA 3SAFA 1QQMA 4H5WA 1J6ZA 5E26A 5AQMA 1YIJN 1M1KO 3TTCA 4H0XB 4DKWA 2ZGZA 4BROA 5KPTA 3O4WA 3K9KA 4PL7A 5C12A 1HJOA 1HUXA 4CZMA 3A5OC 4LC9B 3U8XA 1ATSA 1WOQA 4JK7A 1YUWA 2GTDA 4GV6A 3O80A 5EY4A 4ILGB 4EHUA 3O9RA 3IUCA 5AZIB 2Q2RA 4ILJA 3S41A 1KAYA 1ZBSA 1P8ZA 3O9QA 4M7XA 4C23A 3DAWA 3D2FB 4BVOA 4M63C 4CZHA 3KVGA 2V7YA 1QQOA 3GE1A 5LJVA 4FWPA 1BG3A 5AQWA 4OPHA 4IOXA 4JKEA 3WXKA 2A41A 3VGLA 1MWMA 1NGBA 2GUPA 3CF5L 2D0PA 3WEEB 4YDUA 4FWNA 3I56N 4K43A 4K25A 3U9ZA 2I7PA 4HTLA 3G6EN 3VF2A 5JVGL 3P31A 3C6HA 3QICA 1TUUA 2P9PA 2E1YA 1GLBG 5BRDA 3AGKA 3TPQA 4BRFA 2QWOA 2P9UA 3VESA 3QBXA 4BRMA 5FPMA 5EVZA 2HOEA 4FWRA 3HM8A 4BRLA 1ATNA 1GLCG 3NVMA 4FOIA 3N4QA 3R1XA 1HLUA 2YX6A 5FPNA 3GG4A 4WQ4A 5BRFA 2D4WA 2F9TA 1U2VB 3EL2A 3CMAN 2E2QA 4A2AA 1YITN 3ZYYX 1LOTB 2DPNA 1NGDA 4ISEA 3IFRA 4BQZA 3MN6A 4H0PA 2I7NA 3E9PA 3OBYA 3C0BA 3MN5A 3SBTA 4H5NA 3Q7CA 3VMFB 1E4GT 3MWTA 4BC4A 5M1PA 3O9SA 5ELZA 2W40A 3SJHA 5AQFA 3H3OB 1ESVA 1T44A 3CQYA 3D2EB 4DB3A 2KHOA 2FF3B 1VQPN 5GAHP 4RWTA 4CZFA 1O13A 4CZEA 3MWPA 1W97L 3G25A 2GWKA 3HOSA 3JS6A 3VEYA 3VENA 3ID8A 4JEPA 5F1XA 3LDPA 4KBOA 2QA4N 1WUAA 4C1NK 2ZWHA 4IJNA 4BRHA 4WYBA 1Q86O 2F9WA 3ENBA 1VQ4N 5LY3A 4BREA 3HTVA 3O1WA 3DXKB 2CGKA 4Y0WA 2FSJA 4XH1A 5E84A 1S72N 1XUPO 3EN9A 1OVYA 1NM1A 5GAEP 2ASPA 2P9LA 4CI6A 3OBWA 4FO0A 3IKMA 3L4QA 3NMUA 2P9KA 4QS7A 4F9OA 3MX5A 5M1NA 3M3ZA 3EZWA 3M1FA 4BR4A 3CJAA 5AZIA 1GLJO 3C6AA 3CERA 2QW9A 1YI2N 2F7TA 4A5BA 4FWMA 4MO5A 1MDUB 3D2FA 3GOIA 1XC3A 3WUHA 3ULEB 1Q7YO 1VQNN 4H5RA 3WXMB 4MLEA 3WQUA 4B9QA 2NRTA 3LM2A 5AQPA 3P39A 3VF6A 3LDOA 3L0QA 3VPZA 3GL1A 3HZ6A 4WF9L 1NGEA 4YDUC 5TKYA 3WEEA 2QWQA 1VQ5N 1NJIO 5AQRA 2HSTA 3L4IA 4H0OA 2PBDA 2A42A 4PKGA 2PFUA 2BUPA 1NBWA 3UKUB 3VTHA 1Z05A 4B1WB 4BY9C 4DHYA 1YJWN 1OKJA 2E2PA 4RTFD 4FPBA 3D7EO 2FF6A 1NGHA 4B1VA 3MX2A 3GBTA 3LDLA 3FZMA 2FLOA 3CJ1A 3TTDA 5JVHL 1BDGA 3GDQA 3CCQN 5M1OA 1SS6A 3UB5A 3CI5A 4BGAA 2IVPA 1YVNA 1KC8O 3CCSN 1U2VA 2RE2A 3QB0A 3CCLN 2CGLA 2Q97A 4BQLA 2QTDA 3T7ZA 5ADXH 1KD1O 2A40A 2ZJQL 1K9MO 3AY9A 4PKHA 1SAZA 1T6CA 1RDUA 3FR0A 4YOYA 3CJ9A 4BRCA 5C2DA 2P9LB 1NWKA 5AQUA 3D2EA 5C15A 3DWLA 2P9KB 3G4SN 3NVKA 1K73O 1V4TA 4BC2A 3ENOA 3UE5A 4CBWA 4CJ7A 3I33A 2E2OA 1VQ8N 2ZJRL 4PKIA 1NMDA 4WFBL 2WC9A 4O5FA 5BN9A 3VGMA 2HBJA 2UYTA 4IOAL 3H3NO 1GLDG 1G99A 3HOTA 2CH6A 1X9JA 4CD3A 4EHTA 3KWGA 1D4XA 1RGIA 3TTFA 2V7ZA 2P9SB 3DXKA 1QQNA 2HF3A 1X3NA 3E9OA 4L3QA 5ADXA 2ZGYA 3KZBA 3DXMA 3CCMN 1MWKA 3BF3A 3MDQA 5BN8A 5FPEA 1QHAA 3A5NC 1ATRA 2QWLA 4JKDA 2WFBA 5M1QA 4BRDA 4GV3A 4IO9L 3H1QA 2NRXA 5BREA 3ZX3A 4DQ8A 3F5TA 3ULEA 2ZJPL 4BRKA 2IVOA 3OA9A 4JK8A 1RFQA 2JWLA 3VGKA 3MCPA 2AP1A 1YXQA 3CC4N 4WFAL 2ASMA 5B8HA 3ZX0A 3I8BA 4B1ZA 4CBXA 3R3LA 5AQVA 2J4RA 3O6WA 3SAGA 3LDQA 3TU5A 3TSUA 1EQYA 2D1KA 5EX5A 3UKUA 3O9TA 1X3MA 1GLFO 1GLEG 2V51B 3VEVA 1S3XA 3BF1A 2P9IB 4BR0A 4BRGA 3AAQA 4A61A 3E9LA 3C7NB 4JKHA 3LM9A 5DM6L 5M1KA 3BEXA 1JCFA 1K8KB 4IXCA 2HMPA 2Q1NA 4NLCA 3HI0A 4PHTX 5C10A 2BH1A 1JCGA 5AQZA 1EO1A 5AQHA 5EXWA 3B8AX 4ISFA 3EKUA 3U4LA 2KLAA 4H0YB 5AQOA 1W2BM 2VGNA 4C1NI 4JKFA 3O8MA 1Z6RA 3R9PA 4AM6A 3C65A 1QVGM 1T6DA 3IDHA 4JKAA 4EIAA 4G9ZA 3O1BA 3DXMB 4NO7A 4BC3A 2GWJA 2JWKA 2OANA 5BPMA 3H1VX 2YHXA 3ZEUB 4BR5A 4FWKA 5KQ8A 4IO8A 2FSNA 5CHIA 4KH5A 2YHWA 2WUSA 3QBWA 2NRWA 1VQ9N 4A62A 2YJEA 3CC2N 2OTJN 4XEIA 2EWSA 4BRPA 3A0IX 3J7ZO 3CMEN 5LJWA 2QWRA 3CPEA 5AQQA 2QM1A 3EE8A 3CJ7A 2P9SA 4EFHA 5JLHA 2E8AA 1V4SA 3P4IA 3F9MA 4CBUA 3LL3A 4ILHA 2GEMA 3P38A 5AQGA 1TYQB 4NB4A 1P90A 3SAHA 2QEXN 2A5XA 2NZTA 4E1JA 1N8RO 2HBKA 1NGGA 1QZ5A 3MMVA 4A59A 3CCEN 4BRIA 4XH4A 4H5VA 3A8YA 3QMLA 3WXLA 3FFKB 1VQ6N 3I55N 5KPZA 2BTFA 4IEIA 2NRZA 1HKGA 2GX9A 3VEXA 4J8FA 4CZJA 3O9UA 3PLAA 4AM7A 4IWVA 2E2NA 4A57A 2CGJA 2QWMA 3FLCO 5AZJA 1BA1A 1SQKA 5F2RA 1MA9B 4JHDB 4BG8A 1E4FT 1BUPA 4YOTA 4EAHD 3H6EA 4Z94A 3CCVN 5GAGP 3DJCA 5AQXA 5BR9A 2ASOA 3CC7N 3CD6N 1HKCA 3QFPA 5AR0A 4WQ5C 3SMSA 4CZLA 5AQNA 5JMVA 2W41A 3JXUA 4MLHA 4H5TA 4YORA 5BPLA 2Q36A 2P9IA 4FSVA 1NGJA 2ZF5O 1KAZA 3W0LA 4CZIA 3EE9A 4YOVA 3ATVA 3M5RA 4BRAA 3CCJN 1ILYA 3C7NA 3VETA 3CHWA 2P9NB 2RHKA 2HBMA 1K8KA 1NGFA 3VF4A 3QDKA 5TKWA 5JICA 4MO4A 4PL8A 4BGBA 3SMPA 1YJNN 5EOYA 5C0YA 3MK6A 4IZ9A 5CE3A 4OPAA 3UKRA 5GADP 1RDWX 2V52B 3FZFA 3CJCA 4CD1A 3G71N 3BUZB 1BO5O 2GELA 5AQLA 2AA4A 4I6MB 3QFUA 1LCUA 5GINA 3FGUA 1GLLO 4IDHA 4GV9A 1NLVA 3ZEUA 1DGKN 1BU6O 2FSKA 3TSQA 3WQTA 3F2KA 1VQMN 3CQXA 5HL7L 3CXCM 1JCEA 4JD2B 1U6ZA 4FL9A 3L6QA 3ENHA 3KK7A 3WXIA 4B1UB 4YOWA 2A3ZA 2D0OA 2OTLN 1IG8A 4YOUA 4FVUA 1HKBA 3O5BA 3SK3A 2QWNA 3AGRA 2Q0UA 1NGCA 5AZJB 1Q18A 1VQ7N 3FZKA 5AFUH 2YHYA 3RSEA 4JKGB 2NNWA 4FWSA 2H3GX 5KQDA 1QVFM 1VAZA 1TYQA 2WBNA 3WXJA 3ZX2A 1JJ2M 1VQLN 4IJAA 4WQ5A 5HOOA 3ZETA 4BR9A 4BR7A 2QXLA 4CZKA 2VCPA 3E1YA 4QS8A 2E20A 3R6MA 4AF1A 3EO3A 3EKSA 5AQTA 3H45C 3VOVA 2NRRA 1YF5L 2NRVA 4BVPA 1VQON 4IFEA 4FWQA 4BRQA 1Y64A 1TUYA 1YJ9N 4OO1J 3DLLL 4K41A 1CZAN 2E1ZA 1BA0A 3A5MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MWP A;  3MX2 A;  3Q7B A;  4GV6 A;  4G9Z A;  3Q7C A;  4GV3 A;  3MWT A;  3R3L A;  4FVU A;  3MX5 A;  4GV9 A;  4GVE A; 
#chains in the Genus database with same CATH topology
 3TSP A;  3CQ8 A;  2YKM A;  2GUI A;  1QZ6 A;  3D6R A;  4KH6 A;  1S9E A;  2EX3 A;  4DV1 K;  2CH5 A;  3E01 A;  5AQI A;  2HMI A;  1R59 O;  1E3M A;  3C94 A;  4CJE A;  4CF9 A;  1YAG A;  2IIR A;  5AFU A;  5KPR A;  1W0H A;  4CED A;  3A5L C;  1NGI A;  5I9E B;  2O8E B;  2NLX A;  3MAQ A;  4PA1 A;  1KAX A;  4O8U A;  3MN7 A;  3M6G A;  1KRP A;  1ZXO A;  4JKB A;  3T69 A;  1GLA G;  1BQN A;  4Z4I A;  1BIZ A;  1I3A A;  3RSE B;  4OKE A;  2Q0R A;  2E6M A;  3IMX A;  3KHY A;  1NG9 A;  4KHQ A;  3MCA B;  4MDA A;  5M1F A;  1SV5 A;  5AQJ A;  4FJ5 A;  3P1G A;  3D0P A;  2VQE K;  2E88 A;  3AVB A;  1VSJ A;  5F0X A;  1ASW A;  1L3T A;  1GOA A;  3H08 A;  3THY B;  4KHY A;  4FLZ A;  4JKC A;  3CCU N;  1OH5 A;  4H0T B;  3K57 A;  4UY8 O;  3AV9 A;  4DG1 A;  4DCH A;  4DS5 A;  3HSC A;  4CF1 A;  5FPD A;  4K42 A;  1IKX A;  4JKG A;  4MDB A;  1RIL A;  3OHR A;  2ITM A;  2VG7 A;  4DSK A;  3CIP A;  3OYK A;  4GY2 B;  3T1Y K;  3OYJ A;  1H1V A;  5HRS A;  2FBT A;  4J2A A;  1REV A;  3MN9 A;  4N41 A;  4IEE A;  4EP5 A;  3DLK A;  4U67 L;  1WSJ A;  5AQM A;  1J6Z A;  3KLG A;  3BZC A;  4H0X B;  4CEB A;  4CFD A;  1HUX A;  3HP6 A;  4E7L A;  1ATS A;  4JS5 A;  4JK7 A;  4DSF A;  5EY4 A;  1EXQ A;  1P8Z A;  3O9Q A;  1NU0 A;  5A2Q O;  4BVO A;  1CZ9 A;  4CJU A;  4CZH A;  4OKK A;  1QQO A;  4IOX A;  2A41 A;  3NFA A;  3HXM A;  1MWM A;  3KLH A;  3U3Y A;  4K25 A;  3K5M A;  2VG5 A;  3ZSZ A;  3P31 A;  1ASV A;  2IDO A;  3QIC A;  4FJJ A;  2Y1I A;  4CFA A;  4BRM A;  3HM8 A;  4BRL A;  3SV4 A;  1ATN A;  1GLC G;  4FOI A;  3N4Q A;  2YX6 A;  3GG4 A;  2D4W A;  4RG8 A;  2F9T A;  1U2V B;  4CHN A;  3MEC A;  2PZS A;  4ISE A;  4BQZ A;  3MN6 A;  3SJJ A;  4F3O A;  3HK2 A;  1IKV A;  4H5N A;  3Q7C A;  3L2W A;  3TAF A;  3O3H A;  4CJT A;  2DFH A;  3CQY A;  4LSL A;  4DB3 A;  2KHO A;  2FF3 B;  4M3Z A;  3NCI A;  1NJX A;  3B6O A;  2F96 A;  1A5X A;  4CJW A;  3OYL A;  4AHS A;  4KBO A;  4X65 K;  4DQR A;  4OKJ A;  5CYM A;  3DXK B;  4QOZ B;  2FSJ A;  3M8S A;  1XUP O;  4C8K A;  5GAE P;  2ASP A;  4KHU A;  2P9L A;  4H4M A;  4B8C A;  1LWC A;  3OBW A;  3JYT A;  2UUA K;  3RR8 A;  3NMU A;  4ID1 A;  4O5B A;  3ZT3 A;  4LH4 A;  3PSF A;  3HL8 A;  4F9O A;  1N32 K;  3M1F A;  1BCM A;  5AZI A;  3THW A;  3CER A;  4CGD A;  1XC3 A;  3ULE B;  1Q7Y O;  3SPZ A;  3LPT A;  4O4G A;  3WQU A;  4LD0 A;  3KIO A;  3CM5 A;  4DTX A;  1U04 A;  3LDO A;  2F4V K;  4WF9 L;  1NGE A;  2ZM6 K;  4YDU C;  5TKY A;  1NJI O;  1VRU A;  1XC9 A;  2PBD A;  2A42 A;  4PKG A;  4B1W B;  4BY9 C;  3OTO K;  1Z05 A;  1G15 A;  4DQQ A;  1OKJ A;  4JRP A;  4FJ7 A;  3D7E O;  3J7A P;  1NGH A;  4B9U A;  3MX2 A;  3LDL A;  3FZM A;  2FLO A;  5JVH L;  1BDG A;  1C1A A;  1I39 A;  4HUG A;  4CHZ A;  5KTQ A;  3CCS N;  1HR0 K;  2BE2 A;  1FW6 A;  1N33 K;  4CJK A;  3KTQ A;  2CGL A;  4AIL C;  2Q97 A;  1RDA A;  1LW2 A;  3AY9 A;  3AO1 A;  1SAZ A;  2BGG A;  1T6C A;  4DFP A;  1RDU A;  3CJ9 A;  2YNI A;  4BRC A;  5C2D A;  1JLC A;  2P9L B;  3AO3 A;  2E6L A;  1NWK A;  1EKE A;  2YNG A;  4BDZ A;  4CJ5 A;  4N76 A;  4BDY A;  2E4L A;  4CJ7 A;  3UE5 A;  5CY4 A;  2E2O A;  1WSH A;  4PKI A;  1NMD A;  4WFB L;  3VGM A;  3H3N O;  4DTJ A;  1D9D A;  4XIU A;  3HOT A;  1X9J A;  5LMU K;  2Q3S A;  4FM2 A;  3HM9 A;  4EHT A;  1RGI A;  4LF5 K;  1QQN A;  3E9O A;  1X9M A;  3AA2 A;  2ITG A;  3VQB A;  1J54 A;  3OYA A;  4CEF A;  4LF4 K;  3A5N C;  5M1Q A;  4JKD A;  2WFB A;  2LSN A;  4JLH A;  4GV3 A;  4I2Q A;  3VQQ A;  3H1Q A;  4IO9 L;  2NRX A;  1NK8 A;  3AA4 A;  4TSX A;  1GOB A;  5HRN A;  3ZLJ A;  3AVF A;  3ZSO A;  1VK0 A;  1C0U A;  1C0T A;  4M3W A;  4B9M A;  3CC4 N;  2ASM A;  4CBX A;  3V4I A;  2OPS A;  1RBR A;  3LDQ A;  3TU5 A;  3V9S A;  4HHT A;  3UKU A;  3JSM A;  1X3M A;  4LFA K;  3AVK A;  4BRG A;  1BIS A;  4A61 A;  4BWM A;  2HHX A;  4CJV A;  5M1K A;  2ZD1 A;  3BEX A;  4O0I A;  2DY4 A;  5C25 A;  2Q1N A;  4CK1 A;  5AQZ A;  5EXW A;  1KLM A;  3QEP A;  4CJP A;  5AQO A;  3V81 A;  1D5A A;  4KB1 A;  4AM6 A;  5DK5 A;  4EIA A;  2GWJ A;  3DRR A;  2OAN A;  5BPM A;  4DU3 A;  4H8K A;  3ZT4 A;  2YHW A;  1DLO A;  2NRW A;  2RN2 A;  2YNH A;  2XY6 A;  3NBP A;  3C6T A;  3CME N;  4B9V A;  5AQQ A;  3RMD A;  4KTQ A;  3CJ7 A;  4EFH A;  2E8A A;  3F9M A;  5AQG A;  2GEM A;  2NZT A;  3LP2 A;  4E1J A;  4CJR A;  4HVJ A;  4QCL A;  3NGY A;  4XH4 A;  1KFS A;  1ZBL A;  3WXL A;  1VQ6 N;  3HVR A;  3OYD A;  3VN5 A;  5KPZ A;  4PUO A;  4B9S A;  3EEQ A;  4JI2 K;  3WNF A;  4CZJ A;  1F21 A;  4AM7 A;  2E2N A;  4A57 A;  4AH9 A;  5F2R A;  1NKE A;  3DJC A;  3K5L A;  3OJS A;  4CZL A;  2W41 A;  3DLR A;  4MLH A;  4KI6 A;  4YOR A;  3L3V A;  3CG7 A;  1JLB A;  3W0L A;  4YOV A;  1TAU A;  1IBL K;  1ILY A;  4LF6 K;  1J5O A;  4Z0U A;  4CJL A;  4PL8 A;  3SMP A;  1RBT A;  1HNW K;  5CE3 A;  2X74 A;  1KVA A;  1RDW X;  3CJC A;  4CD1 A;  3G71 N;  3BUZ B;  2GEL A;  4FLX A;  4O0J A;  3FGU A;  1BU6 O;  3TSQ A;  2EHG A;  4BE0 A;  2QKB A;  5HL7 L;  3CXC M;  1JCE A;  1Q8I A;  4JD2 B;  4F2S A;  3ENH A;  3WXI A;  2HHV A;  4B1U B;  4DV4 K;  4FJI A;  2A3Z A;  2D0O A;  3WNG A;  4GVM A;  4X62 K;  4RW7 A;  1OVQ A;  3AGR A;  2UXC K;  3KLI A;  4DUZ K;  1WN7 A;  2QK9 A;  4KV8 A;  5IT9 O;  4FK0 A;  3VQA A;  4C8L A;  4FWS A;  1TL3 A;  2G8H A;  1TYQ A;  2WBN A;  4B3R K;  3ZX2 A;  1TK8 A;  1JJ2 M;  4WQ5 A;  1Q9X A;  5HOO A;  4AQY K;  2O8B A;  3F9K A;  2QKK A;  3E1Y A;  4QS8 A;  3HPO A;  4DSL A;  4AF1 A;  4DR4 K;  1JKH A;  1YF5 L;  4FK2 A;  4FWQ A;  4OO1 J;  3VQC A;  2G8F A;  4K41 A;  1CZA N;  1P90 A;  3VES A;  5CR4 A;  4FOE A;  4FJK A;  1JXE A;  3Q7B A;  4DV2 K;  3VER A;  3VEZ A;  4W5R A;  1HYZ A;  3CPW M;  2UXD K;  3R8E A;  4CEO A;  3NE6 A;  2YCH A;  2Z1G A;  4B3S K;  1VHX A;  2YI1 A;  2KFN A;  2P9N A;  5JLF A;  1T3V A;  3RRG A;  1S1V A;  3KWI A;  2KKZ A;  1C0F A;  4WCE L;  4B8A B;  3SV3 A;  2YJF A;  4CIG A;  1M90 O;  4KFB A;  3H46 O;  4GVE A;  2P9P B;  4JK9 A;  1C1B A;  4FLY A;  2O8B B;  3N4P A;  1XI1 A;  2VWB A;  3LP3 A;  3J81 O;  3NDK A;  2FXU A;  1IKW A;  3AVM A;  5AQS A;  1RTI A;  4FWL A;  3QO9 A;  3MXM A;  1HX1 A;  2FBY A;  1KQS M;  3VQ9 A;  4RCH A;  3VEO A;  2HF4 A;  1DEJ A;  3PIP L;  1X9W A;  4YOX A;  1YHQ N;  1TKT A;  4JNE A;  4Z4E A;  2OPP A;  3ZT0 A;  3L2V A;  4IOC L;  3OYH A;  1CXQ A;  2NRH A;  4HWI A;  4WQ4 C;  3VQD A;  4BC5 A;  3KK1 A;  3LWL A;  4DR5 K;  1C0G A;  1RDB A;  1SZ2 A;  4BAC A;  1WLJ A;  3PIO L;  2G8I A;  1YIJ N;  3DLE A;  3TTC A;  3TWH A;  4DKW A;  2ZGZ A;  4BRO A;  3O4W A;  1HJO A;  2KQ2 A;  1B9F A;  3HVT A;  1WOQ A;  1N6Q A;  4ILG B;  3O9R A;  3IUC A;  1KAY A;  1ZBS A;  1RT4 A;  4FJG A;  4M7X A;  3FFI A;  3DAW A;  4YNQ A;  4F3T A;  4M63 C;  3KVG A;  2HNY A;  2Z1J A;  3GE1 A;  2O8E A;  4DUY K;  1RTD A;  3WXK A;  4K8X A;  3OYC A;  2GUP A;  5LL6 Z;  3CF5 L;  4YDU A;  3U9Z A;  2I7P A;  4B3O A;  4ELV A;  3K5O A;  5JVG L;  1RT5 A;  1CXU A;  1TUU A;  2E1Y A;  1GLB G;  1KTQ A;  3AGK A;  3TAQ A;  4F4K A;  4FLU A;  2IAJ A;  3QBX A;  3QEX A;  2XY7 A;  5EVZ A;  3SQ4 A;  5BRF A;  1RDD A;  2O8C B;  2E2Q A;  1VSK A;  3THY A;  3ZYY X;  1LOT B;  1IKY A;  2DPN A;  2QXF A;  2HB5 A;  1SKS A;  4FK4 A;  1T8E A;  3S9H A;  3C0B A;  3VMF B;  2YHB A;  4I7F A;  3O9S A;  3O4N A;  5ELZ A;  4N5S A;  3OS2 A;  3SJH A;  2KZM A;  5AQF A;  1VRT A;  4DTO A;  2OA8 A;  1O13 A;  4DTN A;  3MWP A;  1A5W A;  1W97 L;  3AVH A;  4GKK K;  2D5R A;  5F1X A;  2QA4 N;  4DR2 K;  2ZWH A;  3ZT1 A;  4IJN A;  4WYB A;  1Q86 O;  3QNN A;  3ENB A;  1WBB A;  4BRE A;  3O1W A;  3DRS A;  1S72 N;  3WNE A;  2B6A A;  4OPJ A;  1QTM A;  3IKM A;  4DTS A;  5I42 A;  2P9K A;  4QS7 A;  4M41 A;  3MX5 A;  5M1N A;  3CJA A;  2QW9 A;  4A5B A;  3O4Q A;  3S3N A;  3GOI A;  3WUH A;  4IFY A;  3K58 A;  3OVN A;  2XY5 A;  1VSL A;  2NRT A;  4DR6 K;  3AA3 A;  3BGR A;  3SUO A;  1MU2 A;  1FK9 A;  4AHC A;  1DTT A;  3ULD A;  3LP0 A;  1JL2 A;  4C8M A;  3ZSV A;  2HHQ A;  2QWQ A;  1VQ5 N;  1WB9 A;  5AQR A;  3OYN A;  3CFR A;  2PFU A;  1S6Q A;  4DHY A;  1OH8 A;  1W7A A;  1YTA A;  4C8O A;  3GBT A;  1UWB A;  3CJ1 A;  4BGA A;  2IVP A;  1KC8 O;  1NOY A;  1RCH A;  1U2V A;  3QB0 A;  2IS3 A;  4BQL A;  2QTD A;  1KD1 O;  1K9M O;  2ZJQ L;  1LWF A;  4M45 A;  1SKR A;  4F2R A;  1UA0 A;  2D0A A;  3KKS A;  5AQU A;  4O44 A;  3DWL A;  2P9K B;  5D3G A;  1TAQ A;  3L2Q A;  1VQ8 N;  1BL3 A;  4NCB A;  2HNZ A;  2WC9 A;  3J80 O;  2UYT A;  4DSJ A;  4FZZ A;  3DM2 A;  3NHG A;  2PYL A;  1NK7 A;  3KJV A;  4EZ9 A;  4CD3 A;  4CGF A;  1L5U A;  2V7Z A;  2P9S B;  3DXK A;  2HF3 A;  4L3Q A;  2KFZ A;  5J2M A;  3PV8 A;  1MWK A;  5BN8 A;  3MDQ A;  1FKP A;  3NAE A;  4DTP A;  3ZSQ A;  3S3O A;  5BRE A;  1SL0 A;  3F5T A;  2DTU A;  3ULE A;  1VSI A;  1RFQ A;  2JWL A;  3SI6 A;  1KVB A;  4NCA A;  3KKR A;  3MCP A;  1RNH A;  4CEA A;  3ZX0 A;  3R3L A;  5AQV A;  4Y1C A;  1N34 K;  4KHW A;  3TSU A;  3MXI A;  4CGI A;  4LY7 A;  1KSP A;  1GLF O;  3VEV A;  1QSL A;  1JLA A;  4AHU A;  3KLE A;  4DFK A;  5BR8 K;  3ZSY A;  5HLF A;  1HNX K;  4NLC A;  4NYF A;  2BH1 A;  1EO1 A;  3B8A X;  2DFF A;  2KLA A;  3WNH A;  2VGN A;  4C1N I;  4CE9 A;  2B5J A;  1QVG M;  4JKA A;  4FJ8 A;  4G9Z A;  3J7Y P;  2JWK A;  2YHX A;  3HT3 A;  2D0C A;  4FWK A;  5KQ8 A;  2RF2 A;  1RT7 A;  2FSN A;  3P83 D;  5CHI A;  1ZBF A;  4KH5 A;  3KD5 E;  4K0K K;  3QBW A;  1VQ9 N;  4A62 A;  2YJE A;  1R0A A;  2OTJ N;  3IS9 A;  4BRP A;  4DQP A;  3SQ1 A;  2QWR A;  2HHU A;  3CPE A;  5T7B A;  1WNS A;  2O8F B;  2I5J A;  3PO5 A;  1XNR K;  2KW4 A;  4CBU A;  3P38 A;  3SAH A;  2A5X A;  3MMV A;  1QZ5 A;  4W5O A;  3VQP A;  4BRI A;  3A8Y A;  1JL1 A;  3I55 N;  1RT2 A;  3OYI A;  3OY9 A;  4FM1 A;  1NJZ A;  5HBM A;  3HYF A;  4IWV A;  4DV6 K;  2CGJ A;  2QWM A;  4CW7 B;  4JHD B;  1E4F T;  4EAH D;  4Z94 A;  1KVC A;  3CCV N;  3QER A;  5GAG P;  5BR9 A;  5JS1 A;  2ASO A;  4R5P A;  4CJQ A;  1HKC A;  3OJU A;  3SUN A;  3SMS A;  4CCH A;  3JXU A;  5JS2 A;  1VSM A;  5BPL A;  4JI3 K;  3NF9 A;  3ITH A;  1NGJ A;  3M5R A;  3VQ6 A;  3PY8 A;  3VET A;  3CHW A;  2X78 A;  2HBM A;  1NGF A;  3EYZ A;  3VF4 A;  2G8W A;  5TKW A;  4J2E A;  4DR3 K;  4E7I A;  5HRO A;  1JLG A;  3UKR A;  3FZF A;  3PX0 A;  3A2F A;  2BAN A;  2AA4 A;  4I6M B;  3QFU A;  1GLL O;  1Q9Y A;  2OPR A;  1DGK N;  2FSK A;  1KLN A;  3F2K A;  2JGU A;  1VQM N;  2BDP A;  1KCF A;  4J2B A;  3T19 A;  3THX B;  1XHX A;  3DI6 A;  4M3R A;  4YOU A;  4KPY A;  1HKB A;  3O5B A;  4JI1 K;  4CHP A;  1NNE A;  2XO7 A;  4JI6 K;  1N36 K;  1NK4 A;  1BCO A;  1HQE A;  3VQ8 A;  4BR9 A;  5AJ3 K;  2QXL A;  1SL1 A;  1NK0 A;  1D9F A;  1WAJ A;  3R6M A;  3EO3 A;  3EKS A;  3VOV A;  2KZZ A;  2HHT A;  2NRR A;  2NRV A;  4BVP A;  3OS1 A;  1VQO N;  4PY5 A;  3HO1 A;  3EY1 A;  1TUY A;  2FC0 A;  4B3T K;  2YKN A;  1RBV A;  1XNQ K;  3OS0 A;  1QE1 A;  4ZTJ A;  3UKR B;  4U7B A;  3HJF A;  2FBV A;  4ICL A;  4OX9 K;  3AO2 A;  3KK2 A;  3J8A A;  3NH2 A;  4JAX A;  1T7P A;  3VEW A;  4CFC A;  3WT0 A;  2VGM A;  4JN4 A;  2HBL A;  3QEI A;  4IKF A;  4E7K A;  1BOT O;  1YVU A;  1TKZ A;  3HBT A;  2UUC K;  1VQK N;  2IVN A;  4H03 B;  2P9U B;  1U45 A;  1Q81 O;  5DM7 L;  4IG3 A;  4FXD A;  3SPY A;  3AVI A;  3CCR N;  1S9G A;  3RTV A;  3OW2 M;  4JD2 A;  4E0D A;  1BWF O;  3FZH A;  4W5N A;  3CET A;  4H0V B;  1Q82 O;  3AAR A;  2QWP A;  2A6A A;  4M3Y A;  1ZC6 A;  4O8K A;  3AA5 X;  3SLC A;  3SCX A;  3O08 A;  1RDC A;  4B1Y B;  3S3M A;  5BPN A;  4B1X B;  1NJW A;  2Y1J A;  5MLC Q;  3G10 A;  4BG9 A;  2P51 A;  1EX4 A;  2GBZ A;  1IJJ A;  1SUQ A;  3ID6 A;  4WFN L;  1HJR A;  4LF8 K;  1N5Y A;  1HPM A;  3SAF A;  4H5W A;  5E26 A;  1S6P A;  4DF8 A;  2XHB A;  4K8Z A;  5KPT A;  4Q5V A;  4PL7 A;  3PSI A;  4FW1 A;  1Y97 A;  4PWD A;  2GTD A;  3O80 A;  3BZK A;  4EHU A;  2Q2R A;  4ILJ A;  3RRH A;  4J2D A;  1XMQ K;  3IG1 A;  3D2F B;  5KI6 A;  2V7Y A;  5LJV A;  4FWP A;  1BG3 A;  4JKE A;  3VGL A;  1NGB A;  4KKO A;  2F8S A;  2D0P A;  1QS4 A;  5CZ1 A;  3WEE B;  3I56 N;  4K43 A;  3G6E N;  3C6H A;  4AHR A;  2P9P A;  2X6S A;  3HP9 A;  4DR7 K;  3TAE A;  4BRF A;  5FPM A;  2P5G A;  2HOE A;  3NVM A;  4RW8 A;  5FPN A;  2OZS A;  3EL2 A;  4OLB A;  1YTU A;  4CEC A;  1NGD A;  4H0P A;  3E9P A;  1S5J A;  2P1J A;  3AVN A;  4N47 A;  3MN5 A;  1NMN A;  3PO4 A;  5C24 A;  3G0Z A;  1ZYQ A;  1E4G T;  4BC4 A;  5M1P A;  3F73 A;  2W40 A;  3H3O B;  1B92 A;  3D2E B;  1VQP N;  1UA1 A;  5GAH P;  5KGW A;  4CZF A;  4RWT A;  4HCB A;  4FLV A;  4CZE A;  4FJL A;  3HOS A;  2GWK A;  3VQ4 A;  3JS6 A;  3VEY A;  3VEN A;  3VQ5 A;  4KHS A;  3ID8 A;  4JEP A;  3V1R A;  2VWJ A;  3LDP A;  3K0S A;  4MQ3 A;  4FCY A;  3I0R A;  4BRH A;  3IAY A;  4CFB A;  1VQ4 N;  3RMA A;  2IGI A;  3O3G A;  3EZ5 A;  4DV0 K;  4Y0W A;  1XHZ A;  2YHA A;  1OVY A;  1NM1 A;  3EN9 A;  4CJF A;  4E19 A;  3L2U A;  1JLQ A;  4CI6 A;  4FO0 A;  3KD1 E;  3L4Q A;  4B9N A;  4FZX C;  2HVI A;  2YNF A;  3QEV A;  3ZSR A;  4AHT A;  1HQU A;  1GLJ O;  1YI2 N;  2IOC A;  2F7T A;  4LF9 K;  1MDU B;  3OYB A;  4DV7 K;  2F8T A;  4B9Q A;  3LM2 A;  1BQM A;  3P39 A;  1WBD A;  3VF6 A;  4X66 K;  1BI4 A;  3CFO A;  3SUQ A;  2HST A;  3I0S A;  1HRH A;  1KFD A;  3ASM A;  4OGE A;  1YJW N;  4FPB A;  5J2N A;  3I8D A;  1VSH A;  1NKC A;  3TTD A;  3LAN A;  2G8V A;  3GDQ A;  3CCQ N;  3CI5 A;  1DTQ A;  4KTZ A;  2RE2 A;  5SWM A;  2O8C A;  1TKX A;  4DFM A;  3KK3 A;  4OJR A;  3T7Z A;  5ADX H;  1ITG A;  4JS4 A;  4JI8 K;  4GW6 A;  4YOY A;  4HCC A;  1NOZ A;  3BY5 A;  3G4S N;  5HRP A;  1K73 O;  1C6V A;  4X64 K;  4BC2 A;  3ENO A;  3OYM A;  4CBW A;  3I33 A;  3PUF A;  1L3V A;  1NK5 A;  4O5F A;  3THV A;  5BN9 A;  1G99 A;  5FRO A;  4CHQ A;  1RT6 A;  1RBS A;  5KRS A;  3M8P A;  2XRI A;  4DTU A;  4EP4 A;  1BI4 B;  1X3N A;  1IBM K;  3MED A;  3KZB A;  3CCM N;  1J53 A;  5FPE A;  3DMJ A;  3DLH A;  1J9A A;  1ATR A;  2QWL A;  4YHH K;  4JI7 K;  4UQG A;  3ZX3 A;  4DQ8 A;  4Z4C A;  2IVO A;  2A1R A;  4KI4 A;  5SZT A;  4KHN A;  3VGK A;  4FYD A;  5KRT A;  3V6D A;  4WFA L;  5B8H A;  3I8B A;  4B1Z A;  1RBU A;  3O6W A;  1FJG K;  1W9H A;  1EQY A;  3ZCM A;  4BE2 A;  1I94 K;  4M3X A;  2V51 B;  2P9I B;  4BR0 A;  4DSI A;  3CYM A;  3C7N B;  4FW2 A;  4L8R B;  2FBX A;  5DM6 L;  1JCF A;  1K8K B;  4IXC A;  4B08 A;  3UIQ A;  1JCG A;  1LW0 A;  4AHV A;  2HHS A;  3EKU A;  3U4L A;  4H0Y B;  2OCE A;  1W2B M;  3SZ2 A;  1Z6R A;  3R9P A;  4FLT A;  3KLF A;  4LH5 A;  3U6F A;  1T6D A;  1SKW A;  4NO7 A;  4BC3 A;  1LAV A;  3H1V X;  4E7H A;  3ZEU B;  2VWK A;  3QIP A;  4IO8 A;  3DRP A;  2Z1I A;  3CC2 N;  3V9W A;  2JLE A;  4GKJ K;  4XEI A;  4HTU A;  3A0I X;  3J7Z O;  5LJW A;  4KTW A;  4WE1 A;  4C8N A;  4CGH A;  5J2Q A;  3EE8 A;  2PYJ A;  2P9S A;  2OZM A;  4CEE A;  3P4I A;  1UOC A;  4DV5 K;  4Q0B A;  3LL3 A;  4ILH A;  4JI4 K;  1N8R O;  3OYF A;  2HBK A;  3AVL A;  4A59 A;  3CCE N;  3AVC A;  4H5V A;  1TVR A;  3QML A;  1U48 A;  3FFK B;  4CGG A;  4FJX A;  2NRZ A;  5CYQ A;  3LAL A;  2O8D A;  4HUE A;  2GX9 A;  5DMR A;  3MEE A;  1T03 A;  3O9U A;  2W6K A;  2UU9 K;  1LWE A;  3FLC O;  5AZJ A;  2HW3 A;  2DFE A;  1U4B A;  1MA9 B;  4BG8 A;  4YOT A;  1HNV A;  5AQX A;  1CZB A;  3CC7 N;  4DLE A;  3QFP A;  1QHT A;  4WQ5 C;  2PY5 A;  5AQN A;  5JMV A;  4H5T A;  1ZBU A;  2Q36 A;  4CF0 A;  4FSV A;  1NK6 A;  1KAZ A;  3NGZ A;  5FRN A;  4BRA A;  3LZJ A;  4ELU A;  2HVH A;  4MO4 A;  1EWR A;  4CJ4 A;  1YJN N;  4M3T A;  5C0Y A;  3MK6 A;  3K5N A;  4E89 A;  5GAD P;  4FVM A;  1BO5 O;  4IDH A;  4GV9 A;  1NLV A;  2RPI A;  4O55 A;  1YT3 A;  3CQX A;  4IDK A;  3L6Q A;  3KK7 A;  2O8D B;  4KRE A;  4F8R A;  4ZHR A;  2OTL N;  1IG8 A;  2B4J A;  3SK3 A;  2QWN A;  2Q0U A;  1NGC A;  2G8U A;  5AZJ B;  5AFU H;  5J1E A;  2O8F A;  2YHY A;  3LAK A;  4JKG B;  2NNW A;  4Z4H A;  2H3G X;  5KQD A;  1VAZ A;  1VQL N;  4IJA A;  3ZET A;  4KB0 A;  4LF7 K;  2UXB K;  2E20 A;  2ATQ A;  3TAM A;  5AQT A;  2ZE2 A;  4KAZ A;  1ZBH A;  3TAP A;  4IFE A;  1YJ9 N;  3HPG A;  3MXJ A;  1BA0 A;  3K9J A;  3ISN C;  1S1T A;  3NF8 A;  1EP4 A;  1RTH A;  4A2B A;  4M42 A;  1S22 A;  4JHD A;  2KTQ A;  1A5V A;  2OYQ A;  3U9D A;  1TGO A;  2P5O A;  4ISG A;  4E1N A;  3TR8 A;  3T1A A;  4KO0 A;  4LFB K;  5H1S Q;  1EET A;  4KH4 A;  1IBK K;  2XY8 A;  1K8A O;  1DKG D;  3E66 A;  3FE1 A;  4QS9 A;  4BRN A;  1RT3 A;  4FPA A;  1TK5 A;  1XQS C;  2PAV A;  5BRH A;  4FWO A;  3SQ0 A;  3RR7 A;  1DT9 A;  4A5A A;  3QIN A;  1ZBI A;  3FZL A;  4DF4 A;  3SBG A;  4I6M A;  3RMB A;  3ATU A;  1SL2 A;  1HNZ K;  4FJM A;  4NLB A;  3ZET B;  3BP8 A;  1LAW A;  4GNI A;  1NGA A;  4BR2 A;  3VTI A;  3TAR A;  4IBN A;  2Q31 A;  4CZG A;  3THX A;  3SUP A;  5AQK A;  3AAP A;  4W5T A;  1IV0 A;  2QI2 A;  4DLG A;  5GIO A;  4V19 S;  5AQY A;  4M7Y A;  1KXP A;  3DLB A;  3W3D A;  3NH1 A;  3AVG A;  5C2F A;  1HPZ A;  3LDN A;  4R79 A;  3ZT2 A;  1NKB A;  2IC3 A;  4XH5 A;  4B9L A;  1JLF A;  5GIP A;  2VYP A;  3VQE A;  3NF7 A;  4JI0 K;  3CJB A;  5LMN K;  4YFU A;  3RVC A;  3HRG A;  4Z4F A;  4JI5 K;  1QQM A;  4CEZ A;  3NH0 A;  4I9Q A;  1M1K O;  3L8B A;  4FM0 A;  3K9K A;  1JLE A;  5C12 A;  4CZM A;  3A5O C;  4LC9 B;  3U8X A;  3HPH A;  1YUW A;  4GV6 A;  4DQI A;  5AZI B;  3S41 A;  1CLQ A;  3THW B;  4C23 A;  1U47 A;  5K14 A;  1ASU A;  3O3F A;  5AQW A;  4OPH A;  4CK3 A;  1K6Y A;  4CK2 A;  4E1M A;  4M3U A;  4B9T A;  3ALY A;  4FWN A;  1T05 A;  4HTL A;  4OLA A;  3VF2 A;  4GMJ B;  5BRD A;  4CIE A;  4OGC A;  3TPQ A;  4CF2 A;  2QWO A;  2P9U A;  2WTU A;  4FWR A;  4CHY A;  1XWL A;  3R1X A;  1HLU A;  4WQ4 A;  4HUF A;  3PX6 A;  3VQ7 A;  1D8Y A;  3CMA N;  3SYZ A;  2E5L K;  4A2A A;  3TI0 A;  1YIT N;  3IFR A;  3LPU A;  2I7N A;  3OBY A;  1JXB A;  1L3U A;  3SBT A;  1S1U A;  3MWT A;  4FJ9 A;  5IWA K;  1XMO K;  1ESV A;  1T44 A;  3QIO A;  3G25 A;  3AVA A;  2AJQ A;  1EWQ A;  1OH6 A;  1WUA A;  4C1N K;  4LSN A;  1L3S A;  5HRR A;  2F9W A;  1J5E K;  3C6U A;  2HHW A;  5LY3 A;  1WSI A;  3HTV A;  2CGK A;  4XH1 A;  3LAM A;  5E84 A;  3LZI A;  4DSE A;  1TKD A;  5CZ2 A;  4QAG A;  4CER A;  4DU1 A;  3M3Z A;  3DOK A;  3EZW A;  4BR4 A;  1QSY A;  3L2R A;  3C6A A;  4KHP K;  4FWM A;  4MO5 A;  3D2F A;  1VQN N;  4H5R A;  3WXM B;  4MLE A;  4BWJ A;  4DMN A;  1OH7 A;  3OYE A;  5AQP A;  1VSE A;  1UAX A;  2O4I A;  4MFB A;  3ZSX A;  3L0Q A;  3VPZ A;  3GL1 A;  3HZ6 A;  3WEE A;  3RMC A;  3L4I A;  4H0O A;  3K2P A;  3VTH A;  2BUP A;  1NBW A;  3UKU B;  2E2P A;  4JV5 K;  4RTF D;  3TAG A;  4DS4 A;  2FF6 A;  4B1V A;  4PQU A;  4CVN E;  4I2P A;  5M1O A;  1SS6 A;  3UB5 A;  2R7Y A;  1YVN A;  3K59 A;  5E41 A;  3CCL N;  1Z26 A;  1C1C A;  1RTJ A;  1IO2 A;  1VSD A;  2A40 A;  4PKH A;  1NJY A;  3FR0 A;  4DV3 K;  4DQS A;  3HST B;  3D2E A;  3PX4 A;  5C15 A;  3NVK A;  1V4T A;  4NXN K;  4IFV A;  2ZJR L;  1U49 A;  2HBJ A;  4IOA L;  3IRX A;  1GLD G;  2CH6 A;  5EU7 A;  3QNO A;  3OYG A;  1TV6 A;  3KWG A;  1D4X A;  3AO5 A;  3TTF A;  5FDL A;  5J2P A;  4H4O A;  1WSF A;  5ADX A;  1S1W A;  2X6N A;  2ZGY A;  3DXM A;  3M8R A;  3BF3 A;  5HP1 A;  3B6P A;  1QHA A;  1RT1 A;  1FKO A;  4BRD A;  4N56 A;  1HMV A;  4I9L A;  2G8K A;  2ZJP L;  2ZQB A;  4CF8 A;  4BRK A;  2NUB A;  3NF6 A;  4IG0 A;  3OA9 A;  4JK8 A;  4RW6 A;  1WAF A;  4CGJ A;  2AP1 A;  1YXQ A;  4Y1D A;  4OVL A;  3VA0 A;  2W6L A;  2OPQ A;  4DU4 A;  1S1X A;  2J4R A;  4RW9 A;  3SAG A;  3LDS A;  4ID5 A;  2D1K A;  5EX5 A;  3SQ2 A;  2RKI A;  3O9T A;  1GLE G;  1BIU A;  1S3X A;  3BF1 A;  3QES A;  3QEW A;  2HHH K;  1QQC A;  3AAQ A;  1GOC A;  3E9L A;  4JKH A;  3V9Z A;  3LM9 A;  5C10 A;  2HMP A;  4PHT X;  3HI0 A;  5AQH A;  4ISF A;  3SNN A;  4JKF A;  3O8M A;  1LV5 A;  5FLX O;  2VG6 A;  1C0M A;  3C65 A;  1QSS A;  3IDH A;  1NK9 A;  4CHO A;  3O1B A;  3DXM B;  4CEQ A;  4BR5 A;  3V9X A;  3CM6 A;  1WSE A;  4ZTF A;  4E7J A;  4EZ6 A;  2WUS A;  4FLW A;  4KRF A;  1FXX A;  1BGX T;  1TL1 A;  1WSG A;  4FZY A;  1HYS A;  2EWS A;  4B3M K;  2WON A;  3T1H K;  5KGX A;  2QM1 A;  2ETJ A;  5JLH A;  4CIF A;  2O4G A;  1V4S A;  2QEX N;  1TYQ B;  4NB4 A;  4JYA K;  1NGG A;  1BHL A;  1X1P A;  1IG9 A;  3DOL A;  4W5Q A;  2BTF A;  4IEI A;  1X9S A;  3TAB A;  4ELT A;  3AVJ A;  1HKG A;  3DYA A;  1TK0 A;  5FRM A;  3ZSW A;  3LWM A;  3V1O A;  3AO4 A;  4J8F A;  3VEX A;  3PLA A;  3QLH A;  3P5J A;  4NCG A;  1HYV A;  2W42 A;  3DLG A;  1B9D A;  1BA1 A;  1SQK A;  4CJS A;  1BUP A;  4CES A;  3H6E A;  2HND A;  2A1S A;  4DTR A;  3CD6 N;  5AR0 A;  4RW4 A;  1Z25 A;  4DTM A;  4BDP A;  2P9I A;  2ZF5 O;  4CZI A;  3EE9 A;  3ATV A;  3CCJ N;  1HNI A;  3C7N A;  2P9N B;  2RHK A;  1VSF A;  2UUB K;  1K8K A;  4OPK A;  3QDK A;  5JIC A;  2YV0 X;  4BGB A;  5C42 A;  2VQF K;  3BDP A;  4FJN A;  5EOY A;  4DR1 K;  4IZ9 A;  4OPA A;  3L3U A;  4NYN A;  2V52 B;  5AQL A;  4DWI A;  5GIN A;  1LCU A;  4G1Q A;  3CFP A;  3JAM O;  3ZEU A;  3WQT A;  4LFC K;  3C95 A;  3TAN A;  2GV9 A;  4BE1 A;  1U6Z A;  4FL9 A;  3LP1 A;  2Z1H A;  4YOW A;  3D45 A;  3U3G A;  4FVU A;  2WOM A;  3V1Q A;  1Q18 A;  1VQ7 N;  3FZK A;  3M8Q A;  4CJ3 A;  4E3S A;  3RSE A;  3MEG A;  1QVF M;  4DFJ A;  3WXJ A;  2D0B A;  4NXM K;  4BR7 A;  4YY3 K;  4CZK A;  2VCP A;  1O1W A;  3VA3 A;  3QET A;  4JRQ A;  4FJH A;  4Z4G A;  3NGI A;  3RWU A;  3H45 C;  3T3F A;  1IH7 A;  3V9U A;  5I3U A;  4BRQ A;  1Y64 A;  3DLL L;  2E1Z A;  3A5M C; 
#chains in the Genus database with same CATH homology
 3TSP A;  3K9J A;  4FOE A;  5CR4 A;  3Q7B A;  3VER A;  4A2B A;  1QZ6 A;  3D6R A;  1S22 A;  4JHD A;  4KH6 A;  3VEZ A;  3UKR B;  3U9D A;  4U7B A;  2CH5 A;  5AQI A;  1R59 O;  3CPW M;  4ISG A;  1YAG A;  3R8E A;  2IIR A;  5AFU A;  5KPR A;  3J8A A;  4JAX A;  5H1S Q;  4KH4 A;  3A5L C;  2YCH A;  3VEW A;  1K8A O;  1DKG D;  3E66 A;  3FE1 A;  4QS9 A;  2YI1 A;  4BRN A;  1NGI A;  2P9N A;  4FPA A;  5I9E B;  5JLF A;  1XQS C;  3WT0 A;  1T3V A;  2NLX A;  2PAV A;  1KAX A;  4O8U A;  2VGM A;  3MN7 A;  4FWO A;  2HBL A;  4JN4 A;  5BRH A;  3KWI A;  3M6G A;  2KKZ A;  1C0F A;  1ZXO A;  4JKB A;  1BOT O;  3T69 A;  4WCE L;  1DT9 A;  1GLA G;  4A5A A;  2YJF A;  1M90 O;  3FZL A;  3H46 O;  3HBT A;  2Q0R A;  4GVE A;  3KHY A;  3IMX A;  3RSE B;  2P9P B;  4JK9 A;  3SBG A;  3MCA B;  4I6M A;  3ATU A;  4MDA A;  5M1F A;  2IVN A;  4H03 B;  1VQK N;  2P9U B;  4NLB A;  5AQJ A;  3ZET B;  3N4P A;  1Q81 O;  3BP8 A;  5DM7 L;  4GNI A;  1NGA A;  4BR2 A;  2E88 A;  2VWB A;  5F0X A;  3CCR N;  3VTI A;  3OW2 M;  2FXU A;  2Q31 A;  4CZG A;  4JD2 A;  1BWF O;  3FZH A;  3AAP A;  3CET A;  4H0V B;  5AQK A;  5AQS A;  1Q82 O;  2QI2 A;  4FWL A;  3AAR A;  5GIO A;  4JKC A;  3CCU N;  2QWP A;  1HX1 A;  4H0T B;  2A6A A;  5AQY A;  4M7Y A;  1KXP A;  1KQS M;  1ZC6 A;  4UY8 O;  3W3D A;  4O8K A;  3SLC A;  4RCH A;  3VEO A;  4DCH A;  2HF4 A;  3HSC A;  5C2F A;  1DEJ A;  3O08 A;  5FPD A;  3LDN A;  4K42 A;  4JKG A;  4MDB A;  3OHR A;  3PIP L;  2ITM A;  4B1Y B;  4YOX A;  1YHQ N;  5BPN A;  3CIP A;  4R79 A;  4B1X B;  4GY2 B;  4JNE A;  4XH5 A;  1H1V A;  4IOC L;  5GIP A;  5MLC Q;  2VYP A;  2NRH A;  4BG9 A;  4HWI A;  4WQ4 C;  4BC5 A;  3MN9 A;  1C0G A;  1IJJ A;  4IEE A;  3CJB A;  3ID6 A;  1SZ2 A;  4WFN L;  3RVC A;  3HRG A;  4U67 L;  3PIO L;  1HPM A;  3SAF A;  1QQM A;  4H5W A;  1J6Z A;  5E26 A;  5AQM A;  1YIJ N;  1M1K O;  3TTC A;  4H0X B;  4DKW A;  2ZGZ A;  4BRO A;  5KPT A;  3O4W A;  3K9K A;  4PL7 A;  5C12 A;  1HJO A;  1HUX A;  4CZM A;  3A5O C;  4LC9 B;  3U8X A;  1ATS A;  1WOQ A;  4JK7 A;  1YUW A;  2GTD A;  4GV6 A;  3O80 A;  5EY4 A;  4ILG B;  4EHU A;  3O9R A;  3IUC A;  5AZI B;  2Q2R A;  4ILJ A;  3S41 A;  1KAY A;  1ZBS A;  1P8Z A;  3O9Q A;  4M7X A;  4C23 A;  3DAW A;  3D2F B;  4BVO A;  4M63 C;  4CZH A;  3KVG A;  2V7Y A;  1QQO A;  3GE1 A;  5LJV A;  4FWP A;  1BG3 A;  5AQW A;  4OPH A;  4IOX A;  4JKE A;  3WXK A;  2A41 A;  3VGL A;  1MWM A;  1NGB A;  2GUP A;  3CF5 L;  2D0P A;  3WEE B;  4YDU A;  4FWN A;  3I56 N;  4K43 A;  4K25 A;  3U9Z A;  2I7P A;  4HTL A;  3G6E N;  3VF2 A;  5JVG L;  3P31 A;  3C6H A;  3QIC A;  1TUU A;  2P9P A;  2E1Y A;  1GLB G;  5BRD A;  3AGK A;  3TPQ A;  4BRF A;  2QWO A;  2P9U A;  3VES A;  3QBX A;  4BRM A;  5FPM A;  5EVZ A;  2HOE A;  4FWR A;  3HM8 A;  4BRL A;  1ATN A;  1GLC G;  3NVM A;  4FOI A;  3N4Q A;  3R1X A;  1HLU A;  2YX6 A;  5FPN A;  3GG4 A;  4WQ4 A;  5BRF A;  2D4W A;  2F9T A;  1U2V B;  3EL2 A;  3CMA N;  2E2Q A;  4A2A A;  1YIT N;  3ZYY X;  1LOT B;  2DPN A;  1NGD A;  4ISE A;  3IFR A;  4BQZ A;  3MN6 A;  4H0P A;  2I7N A;  3E9P A;  3OBY A;  3C0B A;  3MN5 A;  3SBT A;  4H5N A;  3Q7C A;  3VMF B;  1E4G T;  3MWT A;  4BC4 A;  5M1P A;  3O9S A;  5ELZ A;  2W40 A;  3SJH A;  5AQF A;  3H3O B;  1ESV A;  1T44 A;  3CQY A;  3D2E B;  4DB3 A;  2KHO A;  2FF3 B;  1VQP N;  5GAH P;  4RWT A;  4CZF A;  1O13 A;  4CZE A;  3MWP A;  1W97 L;  3G25 A;  2GWK A;  3HOS A;  3JS6 A;  3VEY A;  3VEN A;  3ID8 A;  4JEP A;  5F1X A;  3LDP A;  4KBO A;  2QA4 N;  1WUA A;  4C1N K;  2ZWH A;  4IJN A;  4BRH A;  4WYB A;  1Q86 O;  2F9W A;  3ENB A;  1VQ4 N;  5LY3 A;  4BRE A;  3HTV A;  3O1W A;  3DXK B;  2CGK A;  4Y0W A;  2FSJ A;  4XH1 A;  5E84 A;  1S72 N;  1XUP O;  3EN9 A;  1OVY A;  1NM1 A;  5GAE P;  2ASP A;  2P9L A;  4CI6 A;  3OBW A;  4FO0 A;  3IKM A;  3L4Q A;  3NMU A;  2P9K A;  4QS7 A;  4F9O A;  3MX5 A;  5M1N A;  3M3Z A;  3EZW A;  3M1F A;  4BR4 A;  3CJA A;  5AZI A;  1GLJ O;  3C6A A;  3CER A;  2QW9 A;  1YI2 N;  2F7T A;  4A5B A;  4FWM A;  4MO5 A;  1MDU B;  3D2F A;  3GOI A;  1XC3 A;  3WUH A;  3ULE B;  1Q7Y O;  1VQN N;  4H5R A;  3WXM B;  4MLE A;  3WQU A;  4B9Q A;  2NRT A;  3LM2 A;  5AQP A;  3P39 A;  3VF6 A;  3LDO A;  3L0Q A;  3VPZ A;  3GL1 A;  3HZ6 A;  4WF9 L;  1NGE A;  4YDU C;  5TKY A;  3WEE A;  2QWQ A;  1VQ5 N;  1NJI O;  5AQR A;  2HST A;  3L4I A;  4H0O A;  2PBD A;  2A42 A;  4PKG A;  2PFU A;  2BUP A;  1NBW A;  3UKU B;  3VTH A;  1Z05 A;  4B1W B;  4BY9 C;  4DHY A;  1YJW N;  1OKJ A;  2E2P A;  4RTF D;  4FPB A;  3D7E O;  2FF6 A;  1NGH A;  4B1V A;  3MX2 A;  3GBT A;  3LDL A;  3FZM A;  2FLO A;  3CJ1 A;  3TTD A;  5JVH L;  1BDG A;  3GDQ A;  3CCQ N;  5M1O A;  1SS6 A;  3UB5 A;  3CI5 A;  4BGA A;  2IVP A;  1YVN A;  1KC8 O;  3CCS N;  1U2V A;  2RE2 A;  3QB0 A;  3CCL N;  2CGL A;  2Q97 A;  4BQL A;  2QTD A;  3T7Z A;  5ADX H;  1KD1 O;  2A40 A;  2ZJQ L;  1K9M O;  3AY9 A;  4PKH A;  1SAZ A;  1T6C A;  1RDU A;  3FR0 A;  4YOY A;  3CJ9 A;  4BRC A;  5C2D A;  2P9L B;  1NWK A;  5AQU A;  3D2E A;  5C15 A;  3DWL A;  2P9K B;  3G4S N;  3NVK A;  1K73 O;  1V4T A;  4BC2 A;  3ENO A;  3UE5 A;  4CBW A;  4CJ7 A;  3I33 A;  2E2O A;  1VQ8 N;  2ZJR L;  4PKI A;  1NMD A;  4WFB L;  2WC9 A;  4O5F A;  5BN9 A;  3VGM A;  2HBJ A;  2UYT A;  4IOA L;  3H3N O;  1GLD G;  1G99 A;  3HOT A;  2CH6 A;  1X9J A;  4CD3 A;  4EHT A;  3KWG A;  1D4X A;  1RGI A;  3TTF A;  2V7Z A;  2P9S B;  3DXK A;  1QQN A;  2HF3 A;  1X3N A;  3E9O A;  4L3Q A;  5ADX A;  2ZGY A;  3KZB A;  3DXM A;  3CCM N;  1MWK A;  3BF3 A;  3MDQ A;  5BN8 A;  5FPE A;  1QHA A;  3A5N C;  1ATR A;  2QWL A;  4JKD A;  2WFB A;  5M1Q A;  4BRD A;  4GV3 A;  4IO9 L;  3H1Q A;  2NRX A;  5BRE A;  3ZX3 A;  4DQ8 A;  3F5T A;  3ULE A;  2ZJP L;  4BRK A;  2IVO A;  3OA9 A;  4JK8 A;  1RFQ A;  2JWL A;  3VGK A;  3MCP A;  2AP1 A;  1YXQ A;  3CC4 N;  4WFA L;  2ASM A;  5B8H A;  3ZX0 A;  3I8B A;  4B1Z A;  4CBX A;  3R3L A;  5AQV A;  2J4R A;  3O6W A;  3SAG A;  3LDQ A;  3TU5 A;  3TSU A;  1EQY A;  2D1K A;  5EX5 A;  3UKU A;  3O9T A;  1X3M A;  1GLF O;  1GLE G;  2V51 B;  3VEV A;  1S3X A;  3BF1 A;  2P9I B;  4BR0 A;  4BRG A;  3AAQ A;  4A61 A;  3E9L A;  3C7N B;  4JKH A;  3LM9 A;  5DM6 L;  5M1K A;  3BEX A;  1JCF A;  1K8K B;  4IXC A;  2HMP A;  2Q1N A;  4NLC A;  3HI0 A;  4PHT X;  5C10 A;  2BH1 A;  1JCG A;  5AQZ A;  1EO1 A;  5AQH A;  5EXW A;  3B8A X;  4ISF A;  3EKU A;  3U4L A;  2KLA A;  4H0Y B;  5AQO A;  1W2B M;  2VGN A;  4C1N I;  4JKF A;  3O8M A;  1Z6R A;  3R9P A;  4AM6 A;  3C65 A;  1QVG M;  1T6D A;  3IDH A;  4JKA A;  4EIA A;  4G9Z A;  3O1B A;  3DXM B;  4NO7 A;  4BC3 A;  2GWJ A;  2JWK A;  2OAN A;  5BPM A;  3H1V X;  2YHX A;  3ZEU B;  4BR5 A;  4FWK A;  5KQ8 A;  4IO8 A;  2FSN A;  5CHI A;  4KH5 A;  2YHW A;  2WUS A;  3QBW A;  2NRW A;  1VQ9 N;  4A62 A;  2YJE A;  3CC2 N;  2OTJ N;  4XEI A;  2EWS A;  4BRP A;  3A0I X;  3J7Z O;  3CME N;  5LJW A;  2QWR A;  3CPE A;  5AQQ A;  2QM1 A;  3EE8 A;  3CJ7 A;  2P9S A;  4EFH A;  5JLH A;  2E8A A;  1V4S A;  3P4I A;  3F9M A;  4CBU A;  3LL3 A;  4ILH A;  2GEM A;  3P38 A;  5AQG A;  1TYQ B;  4NB4 A;  1P90 A;  3SAH A;  2QEX N;  2A5X A;  2NZT A;  4E1J A;  1N8R O;  2HBK A;  1NGG A;  1QZ5 A;  3MMV A;  4A59 A;  3CCE N;  4BRI A;  4XH4 A;  4H5V A;  3A8Y A;  3QML A;  3WXL A;  3FFK B;  1VQ6 N;  3I55 N;  5KPZ A;  2BTF A;  4IEI A;  2NRZ A;  1HKG A;  2GX9 A;  3VEX A;  4J8F A;  4CZJ A;  3O9U A;  3PLA A;  4AM7 A;  4IWV A;  2E2N A;  4A57 A;  2CGJ A;  2QWM A;  3FLC O;  5AZJ A;  1BA1 A;  1SQK A;  5F2R A;  1MA9 B;  4JHD B;  4BG8 A;  1E4F T;  1BUP A;  4YOT A;  4EAH D;  3H6E A;  4Z94 A;  3CCV N;  5GAG P;  3DJC A;  5AQX A;  5BR9 A;  2ASO A;  3CC7 N;  3CD6 N;  1HKC A;  3QFP A;  5AR0 A;  4WQ5 C;  3SMS A;  4CZL A;  5AQN A;  5JMV A;  2W41 A;  3JXU A;  4MLH A;  4H5T A;  4YOR A;  5BPL A;  2Q36 A;  2P9I A;  4FSV A;  1NGJ A;  2ZF5 O;  1KAZ A;  3W0L A;  4CZI A;  3EE9 A;  4YOV A;  3ATV A;  3M5R A;  4BRA A;  3CCJ N;  1ILY A;  3C7N A;  3VET A;  3CHW A;  2P9N B;  2RHK A;  2HBM A;  1K8K A;  1NGF A;  3VF4 A;  3QDK A;  5TKW A;  5JIC A;  4MO4 A;  4PL8 A;  4BGB A;  3SMP A;  1YJN N;  5EOY A;  5C0Y A;  3MK6 A;  4IZ9 A;  5CE3 A;  4OPA A;  3UKR A;  5GAD P;  1RDW X;  2V52 B;  3FZF A;  3CJC A;  4CD1 A;  3G71 N;  3BUZ B;  1BO5 O;  2GEL A;  5AQL A;  2AA4 A;  4I6M B;  3QFU A;  1LCU A;  5GIN A;  3FGU A;  1GLL O;  4IDH A;  4GV9 A;  1NLV A;  3ZEU A;  1DGK N;  1BU6 O;  2FSK A;  3TSQ A;  3WQT A;  3F2K A;  1VQM N;  3CQX A;  5HL7 L;  3CXC M;  1JCE A;  4JD2 B;  1U6Z A;  4FL9 A;  3L6Q A;  3ENH A;  3KK7 A;  3WXI A;  4B1U B;  4YOW A;  2A3Z A;  2D0O A;  2OTL N;  1IG8 A;  4YOU A;  4FVU A;  1HKB A;  3O5B A;  3SK3 A;  2QWN A;  3AGR A;  2Q0U A;  1NGC A;  5AZJ B;  1Q18 A;  1VQ7 N;  3FZK A;  5AFU H;  2YHY A;  3RSE A;  4JKG B;  2NNW A;  4FWS A;  2H3G X;  5KQD A;  1QVF M;  1VAZ A;  1TYQ A;  2WBN A;  3WXJ A;  3ZX2 A;  1JJ2 M;  1VQL N;  4IJA A;  4WQ5 A;  5HOO A;  3ZET A;  4BR9 A;  4BR7 A;  2QXL A;  4CZK A;  2VCP A;  3E1Y A;  4QS8 A;  2E20 A;  3R6M A;  4AF1 A;  3EO3 A;  3EKS A;  5AQT A;  3H45 C;  3VOV A;  2NRR A;  1YF5 L;  2NRV A;  4BVP A;  1VQO N;  4IFE A;  4FWQ A;  4BRQ A;  1Y64 A;  1TUY A;  1YJ9 N;  4OO1 J;  3DLL L;  4K41 A;  1CZA N;  2E1Z A;  1BA0 A;  3A5M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...