3Q7SA

2.1a resolution structure of the chxr receiver domain containing i3c from chlamydia trachomatis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
109
structure length
109
Chain Sequence
b'GPKHVLLVSEHWDLFFQTKELLNPEEYRCTIGQQYKQELSADLVVCEYSLLPREIRSPKSLEGSFVLVLLDFFDEETSVDLLDRGFWYLIRPITPRILKSAISLFLSQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein
publication title The atypical response regulator protein ChxR has structural characteristics and dimer interface interactions that are unique within the OmpR/PhoB subfamily.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Transcription
total genus 35
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3q7sA00
4ZMRA 1JDNA 3N75A 2R4QA 3CKMA 3HSYA 1QO0D 2ID9A 2PJUA 3DGFC 3VNBA 1VPWA 1DCKA 1AB6A 3K9CA 4JAVC 4MR7A 3GA5A 3DBIA 1Z17A 3LUJA 1RXEA 2JCGA 4Q6BA 2PL9A 3KCNA 3QELB 4HYEA 3LUAA 4MS1A 5KQLA 3GL9A 3I42A 3RVMA 1GCGA 1Z2EA 1H9CA 1BDIA 4ETNA 4RK7A 4TN5A 3SNKA 5JNVA 4Z0NA 1APBA 1JBEA 4DQDA 2E4XA 3HDVA 1DJMA 3FFWA 1FFSA 5EWJA 1J56A 2LUOA 2FQXA 4QYMA 3CHYA 3RVOA 4XAQA 4GNRA 2FMHA 4IGAA 2YHBA 1SXIA 3CZ5A 4MLCA 4N0QA 2PUAA 2OQRA 1Z18A 2O20A 4M88A 5CNKA 3LUKA 4MR7B 5HM6A 5CNMA 2R48A 4W5RA 4MYRA 4OBBA 4N76A 4OTZA 2YHAA 5DCLA 2B4AA 3QEMB 3H75A 1USKA 2DRIA 3EGCA 3ILYA 3N0XA 3RH0A 4JOQA 2FQYA 5CHYA 3JS5A 2HQRA 5B3JA 1JHZA 1NXPA 2MYNA 3GWGA 5FBHA 3LUGA 3SAJA 1Z13A 1EWVA 3H5IA 3SM9A 2HQBA 5JNTA 4JB2A 1RXIA 3A3KA 1P6UA 4RXTA 5EWJB 3T6KA 4YV7A 1DRJA 1FFWA 3QLUC 4MLDA 3TD9A 4MQFB 3UUGA 6ABPA 2FEPA 2QSJA 5TQ2A 4RK4A 4O1HA 4XASA 3HEBA 2R25B 3N53A 2IPAB 1M2EA 3DLBA 2L2QA 1ZY2A 5CNIA 2IOYA 5IUJC 4RY9A 4N41A 2JVJA 4EGSA 3KJXA 1YMUA 3HVRA 1OXKB 3MF4A 3C97A 1VLZA 3K4HA 3KS9A 4TMYA 4E7PA 3DGEC 2HQOA 2P4UA 2RGYA 5GQSA 4RS3A 2V0NA 4LE1A 4W5OA 1DCFA 1ZVVA 5BR1A 5IX8A 3JPYA 3OLVA 4RU1A 1LBHA 1TMYA 1YVUA 4PZ0A 3SG0A 2QZJA 2CHFA 2HPHA 3JVDA 4G86A 4LX8A 5BRAA 3HJFA 3H5WA 5TQ0A 1QPZA 2JB9A 1P2FA 1D1PA 2F8SA 1ZITA 3FDFA 5F64A 3E3MA 3H6GA 5IEBA 4N0PA 3TB6A 3ROFA 1JYFA 2H0AA 4EVSA 4W5TA 3L49A 2FQWA 3OMWA 1BDJA 3OM1A 4WT7A 1LBIA 3TX6A 4ETIA 4OLBA 4D6YA 2L18A 3FMVA 4MQEA 2WJWA 3LUCA 3OQMA 1LJLA 4WXMA 3BRQA 4E7OA 4OLAA 3BREA 4G0MA 1XWWA 4XLTA 5C5CA 1ABEA 4YCSA 5IUNC 1NXTA 3NHZA 5TQ0B 4OATA 4QICA 1PEAA 5IULC 2WB4A 2AYZA 1DZ3A 2FEKA 2FW0A 4UHJA 3QLUA 1YS7A 4KK4A 2N9UA 3KLNA 3EJWA 3A0UA 3QELA 3O21A 1C0EA 3QK7A 4N03A 1KGSA 1DRKA 3Q9SA 4KZKA 3LOPA 1SD5A 3F73A 4MS4B 4CBVA 1AB5A 2B1JA 1L5ZA 4RK1A 3OLWA 4NV3A 4PE5B 3EQZA 2WMYA 1SRRA 2FN8A 1SXGA 3LTEA 4F12A 4G0PA 1CYEA 1A0OA 1JYEA 3GYBA 5ABPA 1ABFA 1JL3A 3EQ2A 3H5OA 2LIVA 3QX9A 4G0OA 4KK3A 1NXVA 2A9RA 4S05A 2QW1A 4RY0A 1EWTA 4P1ZA 3F6CA 5JNUA 2GBPA 2QR3A 3CRNA 3O74A 5IUKC 5IBQA 5FWYA 3QEMA 3GBVA 3E61A 4Q7EA 4PEVA 2FEWB 1BDHA 1E6LA 2OENG 3OM0A 4JASB 5TPZD 4JA2A 1JFSA 2VUIB 6CHYA 3H1GA 4RK0A 4EVRA 1U04A 4NCBA 1JX6A 3ILHA 3UK0A 2I6FA 3LUHA 1CHNA 5D2CA 1PNTA 4F06A 4H60A 1RZRD 1NXSA 3LKVA 3HUUA 2NT3A 1D4ZA 4RKQA 4YR7A 3N0RA 4MQFA 7ABPA 1LK0A 1USIA 3A10A 3OO1A 2R47A 4MR8B 4ZYLA 3FFXA 4GPAA 3RVJA 5HSGA 2QVCA 1HEYA 2MYTA 3LUFA 5FWYB 3MMNA 3LMKA 2JVIA 4YS6A 4LDZA 1C4WA 4Z4HA 2IPLA 4IF4A 1Y1LA 3KSMA 5T3YA 2FSPA 4L85A 1M5UA 1JFTA 3OQNA 2W42A 4KQCA 4G97A 3QLVC 4EYKA 1IIBA 3KYJB 2X7XA 3RVNA 1F4VA 4G0QA 2NZUG 5TQJA 4JB0A 4D6XA 4KREA 5JS1A 1KRXA 1Z25A 3CS3A 5KWSA 3T38A 3OLYA 3OLZA 1MVOA 2MSWA 2PL1A 4ZMSA 1QO0A 5PNTA 2CD7A 3O1IC 4YRZA 4Z4CA 3LKBA 1B00A 3OMXA 5DGCA 1TJYA 4RXMA 3OQOA 3KTOA 1YIOA 1ISRA 4Z9BA 4LZLA 2LP4Y 1YK1A 2CWDA 4HNQA 3F7NA 2PAFA 4JP1A 5C5EA 1QQAA 4IMJB 5I4CA 2PKXA 1USGA 2NUBA 2A9OA 3H5VA 3CTPA 4KMRA 3EULA 1BAPA 2IPNA 3OO0A 2WJAA 5DTEA 5EWMB 2KYRA 2VUHB 3M6MD 3CNBA 4Z4GA 2QU7A 4RWEA 3SY8A 4RDCA 2PUBA 3Q7TA 3GT7A 1UDRA 3EODA 4XXHA 5IC5A 3IP7A 2QXYA 1XHFA 3FFTA 1W9HA 1Z16A 3CG4A 3IP6A 4HNSA 3S99A 4KFCA 4NCAA 4KNYA 1A04A 1K66A 4W5NA 1KRWA 2FLWA 5TPWA 2LBPA 4UHKA 5E3JA 3T95A 1U2QA 4FE4A 1U8TA 3HK2A 1JFVA 2ID7A 2PMCA 1YMVA 3NNNA 4H3HB 2GKGA 2PUEA 1DC7A 3I09A 5ED4A 1GUDA 1DBPA 1EHCA 1PEYA 1I3CA 3HDGA 3MQ4A 1EAYA 4KQ9A 4MS4A 3NNDA 5FWXB 2NT4A 3DLHA 3HS3A 4F8JA 5BQ3A 4XARA 3T8YA 2FMFA 1GCAA 2PUDA 3C3WA 1TVMA 4KVFA 4MRMB 1WETA 4IMIB 1QP7A 2FKAA 3QLVA 1ZGGA 4F3TA 4PYRA 9ABPA 1EFAA 3MM4A 1E6KA 3B2NA 3IPCA 3N8IA 4ML3A 4FE7A 5EWLA 3BILA 2MSLA 5HQJA 2FLKA 5TPWB 4PICA 4WUTA 3RVSA 2E4UA 1EWKA 4Z4EA 1NXOA 2IPMA 3Q41A 5TE9A 1RPJA 4F11A 3JY6A 1QNLA 5KQMA 1TLFA 3D02A 4D74A 3MA0A 3NNSA 3O1JC 4LRQA 4WZZA 4YWHA 1NATA 4XFKA 3MIZA 1MAVA 1MB0A 2M98A 3HM9A 2HJ9A 3CZCA 5KC8A 1QMPA 1VKRA 2BGGA 3JPWA 3HXMA 2MYUA 3H1FA 4MR9A 4RXUA 4MPTA 4WWHA 4H3KB 2L17A 3KHTA 4MR8A 1GLGA 5EWLB 1FSPA 3HUTA 2PUGA 3QX8A 1MB3A 3JVIA 4RZSA 3H1EA 8ABPA 1ZAYA 3O75A 1P6QA 3O2SB 2VK2A 1D5WA 3TO5A 4G0XA 1LJUA 4HNRA 2E4WA 4Z4FA 2QVGA 3IP5A 3G85A 4LDAA 1ZH2A 2WRZA 1E2BA 4QPJC 3EAFA 3P9YA 3HO1A 3MYYA 1ZESA 2FMKA 3BBLA 1R8JA 1QKKA 3CLKA 3RVPA 3KKEA 3BRSA 1U0SY 3URMA 1W25A 4LE0A 3I5AA 4MR9B 1DBQA 2F8TA 3LUDA 1F51E 3RVLA 3VNAA 2FMIA 3ROTA 3H5LA 3G1WA 2JRLA 1ZH4A 3GBPA 3CG0A 4G0ZA 2ZAYA 3GV0A 3KG2A 2M1ZA 1TM2A 3NBMA 4YP9A 2E4VA 2PUFA 2TMYA 4Z4IA 1CEYA 3SQNA 3N0WA 2ZWMA 1FFGA 2JBAB 4Q6WA 5JNRA 1YK0A 4O5AA 1L5YA 3IDOA 1GUBA 1SXHA 4FB4A 3Q15C 3HCWA 4Z99A 1YS6A 1QP0A 4TLLB 4L4UA 3EDCA 1NXXA 5EWMA 1NY5A 3RVRA 1P8AA 2WY2D 1YTUA 1A2OA 1DCMA 1Z15A 4RKRA 1Z12A 4S04A 3W9SA 1PNRA 2GWRA 2MSKA 2RJOA 4YGXB 2E4ZA 4O1IA 3Q7RA 1KMIY 4MS1B 5CNJA 1JDPA 5FBKA 4N47A 1VRVA 3KLOA 1BVHA 4EYGA 3RVKA 1D1QA 3R0JA 5KI6A 2AYXA 2Q5CA 5TPZA 3NHMA 2PUCA 2H3HA 4Z9AA 4OG2A 4NQRA 5FWXA 5JNSA 4YO7A 3Q7SA 3C6QA 3F6PA 4RSMA 4MRMA 3IP9A 1BA2A 1E6MA 1JF8A 1URPA 2A9QA 3C3KA 3C3MA 4WXEA 1RZRA 1T34A 5JS2A 1PHRA 4EYOA 2IKSA 4P98A 1MIHA 3KYIB 1K68A 3N6VA 4RV5A 3CU5A 2J48A 1D2AA 3M9XA 1QQBA 3L6UA 3HZHA 2IYNA 3FGZA 4NICA 1ISSA 2FVYA 2E4YA 4W5QA 1ZDMA 5GOTA 4KRFA 3A0RB 4IRXA 2WWVD 2XDYA 2RDMA 4KPYA 4ZPJA 3JTEA 3IPAA 4EVQA 4Y9TA 2PE5A 1M2FA 3RVQA 2MYPA 3O2QB 4B09A 2FXIA 3O2JA 1DG9A 1DP4A 2RJNA 4MGEA 5TQ2B 1XHEA 4RK6A 2QV0A 5T7BA 4ETMA 4G0YA 4YLEA 1DBWA 1NTRA 1OXBB 2LPMA 1Z2DA 3DZDA 1PUXA 3I45A 4MS3A 2GX6A 3O1HB 2JK1A 5DKFA 2HSGA 4EUKA 3M9WA 2IDMA 1ZHHA 2NZVG 2P9HA 3HV2A 3H5TA 3H6HA 5HKOA 2CHEA 1Z26A 5BRJA 3QLTA 5KC9A 1DC8A 2FTKE 4KV7A 4RK5A 4RY8A 5JNWA 1QP4A 5DLEA 1JLKA 4EY3A 1ZGZA 2VYCA 2L19A 4IILA 4DN6A 5KQGA 2PLNA 5B3JC 2JVKA 4LE2A 3CFYA 4MS3B 1RNLA 5KQPA 1JWLA 3RQIA 1NXWA 1S8NA 1U2PA 3D8UA 3UKJA 2GI4A 4DADA 4EYQA 3GRCA 1ZN2A 4TLMB 2A9PA 3QEKA 1M5TA 3OLXA 2JBAA 3TMYA 1FQWA 4QYWA 4MAAA 5IEJA 1JH9A 2FN9A 3LFTA 4MQEB 4ZJPA
chains in the Genus database with same CATH superfamily
3ESZA 1OI2A 1LX7A 2VTDA 5K05A 3CJQA 1DCTA 3A31A 3IEPA 3IMEA 1FXWA 1BKYA 1WHSB 4PC3A 2WU8A 4B43A 2R751 2HWUA 2GPSA 3U5TA 4DB2A 4YDRA 2CZCA 2HHAA 1N8KA 5AHRA 3ESAA 5BPFA 4YP6A 5K51A 2W00A 1F0PA 1Q0SA 1G3RA 3GJ4A 3AF2A 3EA5A 3HH8A 4TTPA 1YE8A 2XQKA 3UJ7A 5IT5A 1CIJA 1V39A 2I78A 4CIWA 4FYMA 4W7SA 4LXHA 4X94A 4DNXA 2PGOA 2XMCA 3KLBA 4OHRA 2D1SA 1KP3A 2IYVA 3FX2A 1DUSA 3PWTA 4TM8A 3TI9A 3LOUA 3ER8A 2BKAA 1SGWA 5EMLA 3VOAA 1HT1E 2VKQA 4E5SA 1CC1S 7MHTA 2C8VA 2OAQ1 4LC0A 4M98A 1POWA 5KYYB 3HCPA 4JB3A 3FHTA 2HZBA 5EQDA 1KDZA 1WD5A 1NUHA 3HBJA 4HH4A 4KWTA 4AZTA 4FX5A 5J4VA 4AXXA 1PJRA 4JLKA 3FY4A 3LSYA 2D62A 2DSNA 1N6OA 1E3SA 1QSGA 3ZKWA 1L1EA 4EF4A 1J07A 4WZAE 2WYWA 1I3MA 4K2HA 2JGKA 3MGCA 3FCAA 1EX6A 3JQ8A 3PXDA 3QMPA 4K28A 5CPBA 3UYLA 4FGWA 2VNIA 3PV0A 3VR3A 2IDJA 1PUIA 4TMVA 2VDNB 3IMCA 1SELA 1P9WA 3JZDA 4IIHA 4KQ1A 2BCGY 2YHAA 3QITA 5DCLA 4GX5A 1ISPA 5ENZA 3V1MA 5MDHA 5DCUA 3K53A 3DPSA 2JLYA 2DTEA 1O3YA 2VO1A 3I04A 3JQ9A 2HSJA 4AZWA 1Y6RA 2O8EB 4J0JA 1BHQ1 2YY5A 1JHZA 4OUKX 5CLGA 5CBPB 3QXHA 1S9HA 5DHTA 1VXOA 1JG3A 3WLMA 3HKCB 1P6UA 4TXMA 4ZKDA 1JMVA 3KBOA 3T6KA 4CUZA 2ON6A 1OZ0A 3FTDA 4ZV7A 4MV8A 2XKJE 4MLDA 1YZUA 4K0RA 4ND2A 1M74A 5ALFA 4DJJA 2OSVA 5CM9C 3TLEA 4IOLA 2C31A 1SBTA 1V2HE 6REQB 2L2QA 1L5HA 5DM1A 4H31A 2QNBA 4ARSA 3DMFA 3DDUA 4DLWA 5CLFA 3U4HA 4RY9A 2VUUA 4F1JA 4E11A 2HN9A 2F1HA 2R6AA 1BU5A 1M6VB 2ZEJA 4HLUA 4JJFA 4XJSA 4EDHA 4BYGA 1PZMA 1HMYA 4D0RA 4NH0A 4KO1S 3DE3X 2FPUA 4BX8A 4CM9D 1RWVA 2UZ3A 5EIBD 2GMWA 5DZSA 4E4RA 3U0BA 3IAS1 1KZYC 3R3HA 2NSHA 3T5TA 3O73A 1ZVVA 5BR1A 4RIGA 2I4MA 4DC1A 2ECKA 5IKMA 4GNKA 1WV1A 1FVFA 2YBEA 3JVDA 4BLPA 2EATA 4GP9A 5AJXA 2D3WA 4QLOA 4X8LA 2HXSA 2W6NA 3BD8A 3CN7A 3WVNA 4R8KA 1X39A 3P45A 3E0XA 5HVNA 3PJRA 2Z0MA 4ZCIA 4CI0B 4NNPA 5FHRA 3H6GA 4HG2A 4ZDJA 1E4VA 4AMYA 2GJSA 3V1UA 4I9FA 2PX0A 3KZXA 3NYQA 1G8GA 5IAGA 2DSTA 2EFEB 2XTMA 3INTA 1I6WA 4IDDA 3FWHA 5CVEA 3UHAA 3TF5A 4L50A 1JDUA 4X6LA 1E9EA 2EWMA 3CX7A 1BGXT 4BMVA 2PS3A 1IONA 1MX3A 2HDNB 4NZYA 3TSZA 4LDPA 1AA9A 3NEJA 5BNIA 3DE2X 1EDZA 5FPQA 1G5QA 1RFLA 4WXMA 1U5AA 4DDMA 1NL3A 2VJBA 4AWXA 3B5IA 3UAYA 5JNLA 1AV6A 4O4HB 3VSCA 1A9ZA 4NZNA 2QVLA 3ZH9B 3A2NA 4R7GA 4C3UA 4YUAA 1O95C 1IUKA 3DWGA 3KHUA 2DPHA 3ADCA 4MW6A 3I8OA 1YQTA 3EJWA 4IEIA 4AKEA 2E3JA 1MOPA 2B37A 2WC1A 5DSXA 2CDNA 1D7AA 1GFZA 1AGXA 1TM7E 4LGYA 1JI0A 2GYUA 2JW5A 3Q9SA 3NX4A 1NC1A 1ZUNB 4TQAA 1HE3A 1N2CB 4HBGA 4EG1A 4IX9A 1B23P 4Y6OA 5NULA 2E4AA 1WVGA 2Q46A 3U3XA 4I6JA 1L5ZA 3FPAA 3Q0EA 3Q10A 3JWEA 4CKEA 4DANA 2Q27A 3WB9A 2DQKA 1UR5A 2UZ4A 1WA5A 1CD5A 2FP3A 2V98A 4DMHA 1BH2A 5ABPA 4OJKA 3ENVA 4YR9A 5ILGA 3QQ5A 1ZJWA 3TBFA 1AQYA 4Y6RA 2Z5GA 3ETNA 2DR3A 5KO2A 6PFKA 4MP8A 5EA2A 1XZJA 1YAHA 1DLJA 1TFUA 2OK7A 3B6KA 3QEMA 2ENUA 3C3BA 1ZONA 3Q98A 4I6GA 4QLBA 2G67A 1N0UA 2PIDA 5EIEA 4XPIB 3PNOA 5HYVA 3H5RA 3HNPA 4PR3A 3GGSA 3T3IA 3MPUA 4J9VA 2EQBA 1ZN7A 1HDXA 2E89A 1XJ5A 4DV5B 2EFDB 3S5UA 3MJTA 2HNKA 1SY7A 1AX9A 4TL8A 1SVKA 1W96A 3T61A 2E6KA 4D4HA 1XXLA 2HA2A 1GKUB 5C8YF 1EFRD 4KUEA 1AZLA 5CEEA 3P9RA 4AURA 3N0RA 4MQFA 1N2JA 3IJEB 4PY2A 3Q0IA 2EX0A 2TMGA 1M2WA 5D87A 4BVKA 1WB9A 2CF6A 1QFYA 5K0ZA 4GPAA 4EKIA 4YXWD 4RVCA 1QGOA 3FYUA 1U7TA 4M37A 1NURA 4MVJE 1JAYA 4N12A 4Q9IA 5BV1A 3ZKAA 1JFFA 4HX9A 4NU0A 1X92A 5FNVF 1ZIYA 2O8FA 4JHLA 2JDIA 4XQGA 1R8XA 3CTMA 3VZSA 2I6UA 2HV9A 4BWYA 1WE2A 1SCDA 1A1SA 2CXPA 2PSSA 2UV8A 5M3BA 1Z6GA 1ZA2A 2VEOA 4HHEA 5AVXA 5LXTB 4B9EA 4D6XA 2A2ZA 3PHCA 2WVHA 4QHYA 3AEUA 3TH5A 5A06A 2AOWA 1BH6A 4WKNA 1VKJA 2WK1A 2KHZA 1HG0A 4BKQA 1XTQA 5B58T 3DFKA 4AX8A 2Q0HA 2H4HA 2JHFA 5JSFA 1BCRA 4G84A 1T0BA 3LYLA 3UG6A 3HCEA 2G9QA 2PT5A 3II6X 3NWEA 3Q3VA 3WB1A 4TWAA 1NG9A 2AI1A 3FYTA 4QOFA 5DGCA 2X1LA 4HD8A 4F71A 4I9NA 1KAHA 4I4NA 1FSGA 4ACAA 2OG2A 4H1UA 3V4RA 1IYZA 4XIYA 2PN1A 4DRXA 3EVZA 3K2QA 3GDFA 4HB4A 4HTFA 1UFQA 2RKWA 2X15A 3KVRA 2C84A 2WUFA 1PW5A 3R5FA 1AY0A 1HOTA 1SHJA 2I33A 5E7MA 4ZXPA 4D8TA 4EW1A 4PW0A 1E79D 3BWDD 1XK7A 1FLAA 1WB4A 3CTPA 3OO0A 2HK6A 1E5LA 2QDKA 4AAYA 3OZSA 2KYRA 2VKTA 4AY6A 2KBFA 1CQIA 2IQ5A 4EG5A 1VMKA 2WA2A 4XLZA 1XMQB 3A9CA 1QRUA 4I8DA 3B6JA 3RYTC 3MJCA 4N7JA 1QTNA 4XXHA 5AIAA 3TQRA 3CKYA 4KSCA 5IJAA 3OPYI 4OVKA 1C5KA 1YWGO 1CS0B 1W5BA 2Q9CA 3FFTA 3NUQA 4FUTA 4BQEA 1J8VA 4PX2A 1KMQA 4Q0MA 3WLNA 3KQUA 5JTTA 1LTHR 4YUWA 4NPAA 2J6CA 2NG1A 3D6MA 4Q4HB 1JXOA 3CLUD 2J09A 2ZSIA 3DOUA 4TUYF 5BN1A 2P40A 1OC4A 3MQ4A 3EOAI 1FS4A 4M4SA 2YDYA 3G8CA 4B6EA 4F9TA 3MTQA 2ZDQA 1CDDA 1E7RA 4ZO8A 3DLHA 1VIAA 3GY0A 3BXFA 2D5LA 3USCS 4FBMA 1XCLA 2IZ5A 2MT9A 3OPXA 4EPTA 1CUBA 3IDAA 3SQXA 1OC2A 4GLFA 4Y6GB 1PR5A 3R7LA 1P19A 3IRUA 5LQRA 1E6KA 1WDKA 5AQEA 5EHXA 2VQ3A 3DAFA 4FWBA 1RRFA 2FX2A 3NPMA 4KGZA 5HIIA 3UJ3X 2FG5A 3TEJA 1PIWA 3FZEA 3NGMA 4OB7A 3S2UA 3VQTA 1V8DA 2E4UA 1RAAA 1WW2A 2FWAA 3QFCA 4YAJA 2QTRA 1NXOA 3FOCA 5CPFA 3SHQA 4A73A 4DDVA 2P11A 2W2MA 3RUAA 4NU6A 2DBRA 4XVCA 2FF5A 4D74A 3CVJA 5JD6A 3MA0A 3SC3A 3KJEA 3VBEA 4BP8A 2F9LA 5H3HA 1RZ3A 3QBVA 1M7GA 4N7MA 3AH8A 4F4UA 3MIZA 4JLDA 4O4LA 5JCPA 5A05A 4TVBA 1QH9A 1MR3F 2HJ9A 3CRW1 3ZJ5A 4LF5B 2P65A 1DBIA 5C8DA 4ES6A 1RWQA 2FPIB 3MRVA 3X1WA 5BXYA 4BMSA 4KXUA 2A78A 3AUTA 3LX5A 4DRYA 2RK4A 4QJ5A 4QGBA 3G59A 3OTGA 5DRTA 4TYQA 4MA5A 5K03A 3ZHQA 1U3FA 2PV0A 1ZNZA 3DL2A 4BNNA 2YIDA 4GOKA 2RBGA 2X8LA 2A6PA 1YO6A 2ZB2A 3GG9A 1UT6A 1DIBA 2QK4A 4N7RA 1MKYA 2IUUA 4H6PA 4UTZA 5L51A 3KZ1E 2JJ1D 4CDNA 4FZJA 3E2PA 5KQSA 5JSQA 2VS1A 3OF2A 2AZTA 2O9JA 2ZPTX 1NI4B 1Z5OA 3QE3A 5JPDA 1N6IA 2AJCA 3ESRA 4H6WA 5DYNA 3URMA 1L8LA 3HB5X 2XX3A 3UJ8A 3ORYA 4CF4A 2BGNA 2VDWB 3DZ8A 3ROTA 1U8UA 2ZE7A 1CUIA 2FZ5A 2AFRA 1VI5A 1ZK3A 3B3AA 3B1JA 4JB8A 3WGJA 2WILA 2VNAA 1MA3A 2W2LA 1Z0ZA 2GARA 1Z08A 2BKVA 2PD6A 1J8MF 2Y0CA 3E2IA 2BMFA 4ZT5A 4BMPB 2CNDA 1CY8A 3K8OE 5KU7A 4OJTA 4PYQA 1US8B 5JO9A 2GOYA 3JWHA 1EE9A 4GVXA 4L8YA 5AOCA 2QD4A 5LP6C 5HZKA 5K99A 4TSKA 1QFJA 3L7OA 1UDCA 1Y3CE 4INAA 1UJNA 3IDOA 3N0VA 3PNYA 1CF9A 1CX9B 5AM0A 3LL7A 1NVBA 1QP0A 4EKNB 3F4BA 4OHBA 4OX9B 1NZJA 3AO0B 4KNWA 2FQ1A 2G36A 4EGAA 2C7QA 3IEIA 5KTSA 3I9V1 1XCOA 2H5LA 2ZE8A 3HCBA 4HDQB 1RPAA 1D4AA 3DDCA 4P7JA 4ENVA 4S04A 2ZRFA 1G6Q1 3EY9A 4G4GA 5ALEA 2ZWAA 3Q72A 4OMDA 4KE9A 4QRIA 3WGIA 1KP2A 2DTXA 4N5DA 2IV2X 4UCXA 1A72A 3ZGXA 4DIKA 1NVKA 2VHZA 3ICOA 2HRCA 3EQ9A 1COZA 4YP0A 3AR7A 4IGIA 1XZDA 4P84A 4Y0AA 3JV7A 1NNSA 5CLHA 1K9VF 5TC4A 1Q0RA 4FZ5A 4BNXA 2NUPB 3PLRA 1E1QD 5CCBA 3ZDAA 5TF4A 3H9GA 1Q7CA 1P4JA 2RHDA 3CYFA 4XGKA 2HSWA 4ACBA 5B4UA 5KYGA 1LLCA 2Q2OA 2YXBA 3B8HA 4MRMA 4QXPA 3SIPA 2OXFA 3CIFA 2JIRA 3O8NA 4INZA 2ZZMA 1VJ5A 3AF4A 2EW1A 2PA3A 1SVOA 1BN6A 3DB1A 5K3DA 3VFDA 2PQ0A 1X8XA 3GEMA 1H5NA 2FVYA 2ECQA 3DE6X 3L05A 1YFKA 4ZVPA 2QRQA 4MW7A 1HYHA 5EJMA 1B6GA 1MC8A 1XELA 3IX7A 1LI7A 1QHHA 1VC2A 4ZAXA 3H65A 2LCIA 4DLBA 1RRGA 4C03A 2PE5A 4YRBA 4EG3A 4FGSA 3GDWA 1UJ6A 4NK5A 1CYDA 1J2YA 2WQZA 5GGYA 2FXIA 3O2JA 1OX4A 3OA0A 3RC7A 3P2KA 5EXSA 1QYIA 1N5LA 2OXRA 5LYJB 4Q9LA 2GEVA 1XZ8A 3M34A 3ZNPA 1N3BA 4A0SA 3KB1A 1KARA 1JDZA 3CVOA 2W2QA 3OEWA 4BP3A 1OFVA 3D6FA 4CR8A 5G0TA 3LCVB 1W44A 3L18A 3VX3A 2BUAA 1PU2A 5ALKA 1IWPB 2HHJA 1USWA 2JK1A 4LQ4A 5HFNA 3ZLVA 3SMQA 5JC1A 1EFUA 3KZKA 2A1UA 5CDFA 5B3LA 3C45A 3MK31 4Y9RA 1RXVA 3LIIA 4KMSA 2C1EA 1REQA 3DT6A 4DMUB 1WUIS 1ZN9A 1Y4DE 2GF0A 1TTQB 3H5TA 2QRUA 3ETHA 1RPNA 4PAOA 4TRNA 3Q88A 1NQWA 1CNMA 4BQPA 5FTWA 1W73A 1XMVA 4ZAZA 3N28A 5KC9A 3CR8A 4ZEXA 3F7OA 1TX4B 3R7AA 5F23A 3L7DA 1E79A 3UM9A 1ZGZA 2ZRGA 3ZV5A 1P0CA 1TF5A 2B4YA 1HWYA 2Y0DA 1YRWA 3FPGA 2V6FA 3QVGA 4JP2A 1LF0A 1MMFB 2GJ4A 4QUKA 1K6XA 3OE1A 4KW7A 2XCIA 1EDDA 2ZUEA 3K1AB 3GR6A 1RWWA 4L4ZA 2OO5A 4ZFNA 3QMMA 3OC0A 4NCJA 4AI6A 4BGVA 2V54A 1KAMA 4WNCA 3ECAA 4EY8A 1QC5A 2YMLA 3NTUA 5A5GA 1BXGA 2C2KA 2WWRA 3E3OA 3DL4A 5IC6A 3WYFA 3OCUA 3NATA 2D2EA 4MVJI 3BDVA 3L0ZA 1XDWA 3GGJA 4UBMA 2BSXA 3F6BX 3Q9NA 4KUGA 4M55A 4AJHA 3HSYA 2W37A 4UVIA 3RU7A 1YDEA 3JQAD 4HMQA 4F3NA 1PX0A 4KWIA 3VSEA 4BC0A 2P9JA 4OA5A 3OFVA 3X44A 2AXNA 1J49A 1DXQA 1GFSA 1HTBA 1I5OA 1GUZA 1KFKB 1VFNA 2AJBA 3EXHA 3R9XA 3UJCA 4RKYA 4OGKA 1VSBA 4NBRA 3EC1A 1HDEA 4BQOA 3DVAA 3GL9A 5CA0A 1UWVA 4TS9A 3LP8A 1P45A 4BWVA 4RSGA 5U4XA 2FCAA 4U9IS 3V8QA 1R5BA 4CKEB 5TT0A 2QMOA 2PKQO 1E1DA 3B20A 4POOA 2EWWA 3BERA 3E9ZA 4JD5A 3ZC3A 5LNK1 2XOKA 4GVLA 4GE3A 3TKAA 2W6OA 1PTJC 3KRTA 1I13A 1QP8A 1XZCA 1KFEB 1P7ZA 2O3UA 3KDSE 4YRQA 5A03A 1SZJG 2QN8A 3TLAA 4U7HA 2YXLA 4IIYA 3LXXA 4K6GA 4J1SA 3PCRB 3QEMB 5A4AA 5LJLA 2QT1A 1T2EA 2CXHA 2QP9X 1N3YA 1USKA 4XTCS 1YC5A 2B5WA 1RWKA 1Y7IA 5AM5A 1VQ1A 1ZQ1A 4OHXA 5D85A 3QKSA 3CXRA 4JH0A 2OV2A 5THKA 1R0CA 2PBRA 5J58A 5JXIA 1OBVA 1Z13A 2I54A 4NYJR 4J8PA 3T1OA 2QE7D 3L04A 4PINA 4D8UA 3RHZA 2J3HA 4EA7A 4WERA 4DV1B 2DB3A 2EKDA 1VKOA 1U5BA 2C8JA 4TSFD 4DAEA 1TTTA 4FB5A 3W5AA 5DYWA 1K5HA 2CXRA 3LDGA 3PVSA 3EG9B 3IQEA 4MQFB 1P5FA 3ELWA 4O2AA 4ENRA 3E9YA 2Y2VA 4O1HA 4B8ZA 3IUNA 3NIBA 3FYUB 3Q1KA 3W7VA 4AO7A 2P0EA 3S8EA 2BGWA 2E87A 2PFKA 3AR4A 3ENWA 4HNHA 4C4OA 2X0RA 1F5SA 3LRTA 2SKDA 3OCCA 1C9EA 3LQ4A 2V4ZA 1O03A 2VCYA 3NRCA 1J5EB 4LK3A 4JFAA 5BYKA 1PGQA 1DRWA 4HJXA 1JDTA 4R81A 4XEHA 2XWBF 2HF8A 1DMSA 1H8HA 2BEUA 1TK2A 1FK8A 4OHFA 1FP1D 1K4MA 4V0LA 3EEQA 5H80A 3RIGA 1JT9A 3RJZA 4ZGGA 4JYAB 4LE1A 1P91A 4OY3A 1R10A 3O83A 4WCFA 3GJYA 1XZGA 2I7TA 1KHTA 1E77A 2XHEA 3AEUB 3WXMA 3F5DA 5G3YA 5EMHA 3U4CA 3K0CA 4TTTS 1Q1QA 2WTBA 2ZYRA 4V0ME 1ECGA 3U7FB 1BCRB 3C87A 3HLYA 4FJ0A 3G0OA 3U61B 1SOWA 3ACCA 1JJIA 2PZBA 2IF0A 3GD7A 4XWKA 2A0FA 4MWGA 1KQGA 3BFVA 2AMVA 2QV7A 2G8NA 1XMSA 4NAVA 2X8BA 4FR5A 3B1YA 2PM8A 4M9SA 4B5LA 3ZDEA 3VTZA 4DRXB 5A9RA 5C7YA 4WT7A 4HTFB 4Y2UA 1KBQA 1Y9ZA 3E7PA 4RX1A 4RGBA 3TX6A 4D80A 2F1IA 2RGEA 3F96A 1XVUA 1HX7A 4XFDA 2YH2A 4TLDA 4ESHA 1JR2A 4MDYA 2W6ID 5AK6A 2OXIA 2PGAA 2Q5LA 3S2YA 1JR4A 2BFCA 4DR6B 3BRQA 2PJDA 3R75A 5KZMB 3IALA 1YT5A 5A9SA 1E1QA 3WGZA 1NE2A 2IU6A 2OV8A 3VJKA 4HZUA 3GMIA 1SUAA 2ZBUA 4O4IB 1L5KA 3TMKA 5FPKA 1OXMA 1SUCA 1DC6A 1GGMA 2ISQA 2FEOA 1QG6A 1PYOA 3FROA 5A2GA 3IUQA 3K1JA 3UJ6A 4BQNA 3A0UA 4JBHA 1LA2A 4LJ5A 1LFAA 2IIQA 2ZUCA 2ZRKA 2YNMA 2N3ZA 2GZHA 2PSJA 4N03A 2DFNA 3AHJA 2R62A 4JWKA 4PQFA 3UPTA 2M32A 5CXXA 3RASA 5KPDA 1T43A 4NMLA 1QB8A 5LBIA 3NWPA 4IXNA 4LF8B 3CE6A 3AP1A 3EVBA 2AC7A 2GEUA 3C39A 3NW9A 3OJOA 5LZ4A 1JKFA 4KSBA 1VHWA 3L8EA 4R1MA 5DO9A 1YRHA 4HFJA 5G0UA 2QQEA 2GM9A 4KDCA 4GQBA 4EMSA 1UPBA 2HEIA 1JG1A 1MRSA 4W7HA 2O59A 4DR2B 5BSWA 2IL1A 3KE9A 2OLKA 1NRJB 2Q1TA 5EVJA 2NV6A 4G0OA 1VXRA 4ROTA 2ATIA 3T1QA 2ZJ4A 3O74A 2C2MA 3W8FA 1EXMA 4CMHA 3AVUA 1GZ3A 2ZRIA 2C7OA 3K09A 2FEWB 5E6RA 1JN0A 3K30A 1TZCA 4EG8A 4YXFA 1CLEA 3CO0S 1IEWA 2HWKA 3SLGA 5CT6A 2VI5A 4ZCRA 2ACWA 4AZVA 2P5TB 4HNVA 3KOUA 4Y6LA 5IJWA 2D5AA 4RDHA 2AV6A 3NO4A 4E5VA 1II8B 5DNUA 3A9UA 4Q1DA 1OBOA 1Q50A 1E3DA 2HPVA 2VF7A 3DE4X 1TO6A 4LNAA 4FT4A 5BUZA 1LK0A 3KWMA 2AQHA 3MWLA 5I7UA 6ADHA 1POXA 1V26A 1QIIA 1E0SA 1YL6A 3GN2A 2D7JA 5IFLA 2BR5A 2MYTA 5BSGA 3HJTA 1UZNA 2EKLA 1WOMA 2R8BA 3ND5A 2IUEA 3WLIA 1V47A 1QWOA 5T3YA 1XU4A 1IN4A 2HWYA 3G68A 3NALA 3NT4A 4MKXA 4MARA 3AZOA 4PQYA 3AK4A 1SVIA 3IO5A 2WHPB 2R96A 2ADOA 3OIYA 4RESA 3W0LB 2ZIXB 1XF1A 3BHIA 3O93A 4GFDA 3S1AB 1BWSA 4S3MA 2VJPA 1TD1A 2AW3A 1J1UA 1JMKC 2C82A 1T6BY 3JQAA 2R8OA 3O1IC 1A9RA 4JP3A 5IMBA 1ORTA 1JJBA 1RQ7A 3H4VA 4BO8A 3NU1A 3FIUA 2IHBA 2R4UA 3H42B 1QM5A 4WFQA 2C4WA 4U7GA 2P3OA 4TOIA 3DHYA 4W9MC 1NN0A 1TQ6A 1JEJA 5IHPA 1M2VB 1RS0A 1KJJA 3VZBA 4D8VA 2JZOA 4OM8A 3DAPA 4YGYA 5HF6A 5C5EA 4GPBA 1HDRA 4C30A 4UFOA 1L5VA 1VPTA 4FE3A 1YQUA 2DX7A 3ZLTA 1FNCA 1BIFA 1K4KA 2AFIE 2IPNA 2J3MA 2NYVA 3EULA 3LGSA 5AXCA 4AXBA 4QXMA 4CKZA 2G83A 3HDJA 2O2CA 2VAWA 4S1OA 3MWEA 3FNFA 3OQIA 3QTTA 4DJDC 2QRNA 1MG5A 2Q3MA 3PUHA 1AC5A 5FTKA 5E1OA 2PUBA 2ENWA 3G8AA 4I2VA 1PJ2A 5BW4A 1GL3A 3U3RA 3GDHA 4Q03A 3ONVA 5HIJA 4FPXA 2RGAA 1GAXA 5ICEA 7ADHA 1GT91 1ZJYA 4U2EA 2F8MA 1FDRA 3MSCA 4PVDA 1IU9A 3ZDQA 3QV2A 2AJ8A 3C3CA 3DB2A 3HYCA 1KSGA 1RYNA 1U8AA 2W6QA 2XNJA 2FGJA 4HRXA 1MFPA 4MMZB 4RWZA 4DLVA 4E22A 3D8HA 1MC5A 5E95A 4D3ZA 4DY4A 1YR2A 3F4LA 2QAGA 3U37A 5JJBA 2FMFA 5T4FA 4B3XA 4K6KA 4MRMB 1QGYA 4G4IA 1JKXA 3F3YA 4IJQA 4HVCA 4TSFA 4EGCB 1UWCA 3DKIA 3PCTA 4JYZA 4IVRA 3NHJA 1GNPA 5CG2A 3GQVA 2AEJA 3M4YA 3T7JA 1M83A 3B2NA 4ZVVA 1N2XA 2QVBA 3ZCQA 3HI4A 5JNWA 3C4VA 3OLCX 3LX8A 1L7EA 2F3PA 4TT3A 1QIKA 1BW9A 3FUWA 5HOQA 4PZLA 1YASA 2A0XA 4TWBA 3IA7A 4ZCQA 2QTGA 3UT6A 1R6DA 2B9VA 4LEIA 2HO4A 3RUIA 1PZEA 5KVSA 2FNAA 4IGEA 1QHHB 4HN2A 3OHSX 3VJRA 4LRQA 3CB4A 1BGVA 3PJEA 4LMPA 1UEJA 4ETWA 1YCGA 2B21A 3ZDYB 3B3JA 2KE5A 2HUNA 4JCCA 3A2LA 3GGGA 2I1WA 5JD3A 5FUVA 2OBFA 3KJQA 2EX4A 4K87A 1SVNA 1J33A 2X5XA 4UQPA 3SU8A 5EXDA 4JQYA 2IYUA 1T5TA 1M9NA 1PN3A 3QYFA 5CITA 4EG7A 4YQFA 2I62A 1M0SA 2FR8A 3O75A 1I01A 3FUCA 2A1UB 4S1VA 5JR3A 2JLQA 3ZZMA 2Q3BA 3EARA 1REQB 3TOVA 2E2WA 5DM0A 1ZM4A 2VYVD 3LNTA 3HO1A 5JU6A 2XF8A 1ZESA 2QOEA 3ADPA 4CTNA 3COJA 1CUEA 5B3AA 5TJ9A 4Z9FA 4I1IA 3RO7A 5FFNA 2HA5A 2W6IA 1VA5A 4URYR 2GBGA 2NPOA 4N5IX 1JXMA 5B6PA 2XT0A 2Y1KA 3BX1A 4I4CA 4FFBA 1GA1A 4OB8A 2UVDA 4RHTA 1SC1A 1VLQA 3VPFA 5CVTA 1IOWA 2WSYB 4G8CA 3MMZA 2C7VA 5DT9A 2M1ZA 4PBSA 5F1YA 4U7TB 1HI9A 4HSEA 4N3AA 2VT7A 4BLWA 2OHGA 4JKOA 1FFGA 3QU7A 1FNBA 2I2FA 2QT9A 2ZB8A 5EE3A 1MC4A 3BQ9A 4NENB 2JA2A 4TXNA 3M81A 1E9SA 2O4UX 3ME5A 4JX8A 3OG9A 5AM3A 3DUFA 3EDCA 3I4CA 4PVCA 1IHYA 2A0WA 3ANSA 1YI0A 3HR4A 4URVR 1EBUA 4A10A 4NE9A 1M7BA 4Y1FA 5K6RA 1M66A 2C78A 4YV1A 4IHJF 1DCMA 3I76A 1HFKA 3VR5D 3ZQ4A 1NLYA 1ZN8A 1O8CA 2UYGA 1D09A 4N4AA 1XNHA 1T9ZA 1ORIA 1TA0A 3M33A 4J0KA 4O1IA 4Y2PA 3G82C 3QENA 2V74B 3DVAB 2JIDA 2P41A 2F48A 5DEIA 1G5PA 3FETA 1BVHA 4KGXA 1UAYA 5DNYB 3ZQ6A 1FYFA 1F6WA 1K63A 4HX2A 3L0OA 3OM8A 4B73A 2BBWA 2QVZX 4MRVA 3IOYA 1WL8A 5JH7B 3UBTA 4NAHA 2XIJA 1VHDA 121PA 2XY4A 3AVOA 2GN4A 3D3JA 3OPVA 5IDVA 4BYMA 3Q7SA 4P31A 3RSCA 3SR3A 1PR1A 1Q77A 2AFVA 5DYGA 1IAQA 2IV7A 1MVNA 3DYBA 4K9RA 1LDEA 1E0DA 4GMHA 4RSMA 4ZT2A 5HTKA 3U0VA 2QTHA 2A9QA 2Y3IA 4WPGA 3VDMA 1I1NA 3I52A 3KDPA 4PSDA 3GCDA 3TPZA 3CBGA 4DWWA 1L4BA 1OXVA 2PXXA 2RSLA 4QDUA 3WL3A 5HKAA 1NBIA 5HRAA 4GL2A 1QHYA 3EUEA 3F47A 1HGXA 4IHQA 3SR0A 3R4CA 3GJ7A 3VDRA 3U56A 1GQOA 3I5XA 2HK7A 3QKSB 3M89A 4FUQA 3VKVA 2XUOA 3KQTA 1BEZA 4YRAA 3TTSA 4JVNA 1ES9A 1CJKC 1WG8A 1E4EA 2Z2XA 4BU0A 2OCPA 2HCTA 2H2WA 2JH8A 3JZIA 4HAOA 4ZPJA 2ASVA 3DAOA 2NYRA 3AGQA 4ZV9A 2QTVA 1ISFA 3E7DA 3ZD9A 4LIPD 4CG3A 4PNPA 4O2AB 5I7VA 3TTYA 4MGEA 5JCZA 5EFOA 4PGFA 1XHEA 2J9ZB 4HLNA 2I6XA 4HWPA 4O63O 1L7AA 2MCFA 1Q0TA 2P7HA 5DGIA 4W1SA 1SUIA 1FYVA 2F90A 4QNNA 5DI3A 4G5YA 5IKOA 2OBLA 1Q3KA 4TKLA 3PWSA 4AIIA 4C4RA 4MKIA 1Z2DA 3OCZA 5I4BA 3I45A 3GH3A 3OPYA 4KBYA 1HETA 3KJHA 2BMJA 1U99A 1NR7A 3M9WA 2QJFA 1AU9A 2Z6VA 1ZHHA 4YT2A 1RP1A 1X6VA 3QX7A 2DPXA 4N8SA 4R7TA 2PGIA 1WPRA 5EKXA 3ZV7A 3F6SA 4WCFB 3L3BA 4MVJD 1Y37A 1YZVA 3GJSA 3ZDRA 4I4TB 3JVUA 2LV8A 1G3MA 4OMCA 4QNRA 4DRZA 1SCAA 4DVGA 5FEUA 4DR7B 1YBVA 1AJEA 3GLHB 2X0FA 1X7ZB 4TTRA 1L4MA 2H2DA 4ISCA 4B1FA 3OJWA 4YBZA 1I7LA 5JIBA 3OICA 4DGSA 3AR6A 3C16C 5DDIP 1ZKDA 1I4OA 2OUKA 4P0TA 1OWLA 1RQNA 5COBA 3OHPA 4KZPA 1XEAA 3BXGA 3ZWBA 2HUPA 3KQPA 3BE5A 3MAGA 4FEYA 3DCNA 3VH4A 4LJSA 3I8XA 3VHXA 1FQKA 2PX8A 3DM5A 3ND6A 3SLKA 4X85A 4FHCA 3BL8A 4N18A 3VNVA 1SXJA 1EGVB 2XKBA 5JSHA 5BSMA 5C0OE 3COZA 5C9ZA 2R4QA 5H1YA 2FPMA 3I83A 1VP9A 1PGNA 1Q5PA 2HCBA 3INRA 4KAXA 4MIEA 1K7YA 5F52A 3TLGA 2C9OA 2WAYA 2W8ZA 3EYAA 4HZUB 4GKVA 1EFLA 1IEQA 3CF2A 3FLAA 3MTJA 5A5EA 4FMCB 3IV6A 3UW1A 3HPQA 3H2HA 1HQKA 4TTJA 4TLEA 3PEWA 1KR5A 1N2HA 4K86A 1Y4ZA 3WK5A 2CZGA 4C0XA 5H9WA 1VL0A 4ETNA 3WY9A 2H2IA 3MUFA 2XD4A 4BNKA 4A2CA 3VSBA 5FAKA 3GLRA 2YYYA 3HDVA 4EHBA 4FYXA 3GRUA 4QO7A 4J0HA 4BZXA 3L4JA 4Y30A 2P9YA 3G9QA 1I9GA 3E6AA 2OHVA 3PFHA 1AQIA 3NYRA 3K0FB 3CZ5A 4EJSC 5TMPA 3EPRA 2C96A 2OQRA 3E4CA 4N5MA 3UO8B 3LUKA 1RJGA 2DT5A 3P5BA 2UUPA 4N76A 4MYRA 1KYQA 3ICCA 1UKEA 4JC8A 5KMGA 1KVRA 1P29A 2WJYA 5J1TB 3U4AA 3ZIAD 2JLCA 3KOMA 4B46A 2XXBA 3KEQA 3PHIA 4B6FA 5E6RB 3BS4A 1ECPA 3NVDA 2P90A 1Y34E 4Q7LA 5K0BA 3K70C 1EFKA 2A94A 2J08A 3JS5A 5BNWA 1W4AA 1YZHA 2QR5A 1NFRA 5A3VA 1YF3A 3LZCA 2W90A 4X63A 1EP2B 2B4TO 1C8LA 2O1SA 5DGHA 5LZ5A 3VR2D 3BRCA 3WO1A 1DQYA 2IXDA 3SICE 4RCYA 1JR3E 3CPJB 1JILA 4C21A 5L3VA 3THXB 1PSWA 2BP7A 4LHEA 3ZCXA 2UYHA 4HWOA 4M54A 4LJ6A 3CONA 4KLRA 4D4JA 1EB8A 1T36A 4D7AA 2NNWB 4WUVA 3TW4A 1JHUA 1GNSA 3HA5A 2HJWA 4LZAA 5K1ZA 4R5HA 4D8WA 1XDSA 2BBTA 3IQGX 3UBMA 2BEWB 2CSUA 1GSAA 2VSOA 4WW0A 2UYOA 3IELA 2VT6A 2RHHA 1FB5A 4HEA1 4KIJA 3B1XA 3QXXA 4GR9A 4WA7A 3C97A 3BXPA 3EAGA 1XZIA 3P4UA 4TMYA 3EZ2A 3SHTA 3VVLA 2ZBRA 3DGEC 4EEXA 4IQFA 2PRJA 4YMIA 4M0LA 2PS9A 1JG6A 2HK9A 5A3QA 2EW2A 2MWMA 2PZMA 4B5KA 3V97A 1PFKA 4RELA 1P72A 4B79A 3HEAA 5JFOA 1PP4A 1NWHA 5TSDA 1Q57A 4U2BA 4EHHA 5DNVA 5EPOA 1VZ2A 4ME6A 5C4IA 3KO8A 4V0RA 3S27A 3VISA 4W8OA 1Z2AA 4V24A 2H2AA 4C87A 2MDTA 3E22A 1IL0A 1QPZA 3JQAB 3WBFA 1OFTA 1RE0A 1DRVA 2F1JA 2G0NA 2V7GA 3BA1A 4QEKA 1VE3A 3LHFA 1SBZA 3WXBA 3VVCA 4R2WA 4Q1VA 2BFAA 4L8VA 2ZJAA 4QUJA 4YRRA 3TAHA 3IEKA 3R6TA 4OLBA 3K73O 5KHOC 1R4MB 2VXCA 4EFNA 2QQGA 5HCUA 1FTQA 1NF3A 3RFFA 3LUBA 3PYXA 5D5HA 4L76A 3WNQA 2I2BA 2EG9A 1VHLA 2C5EA 4L07A 4QPZA 5J2UB 4DM4A 5FOQA 2OA0A 4FLEA 5EMJA 4HWTA 5IH7A 1Z22A 1T5IA 3EMDA 3V2HA 3TIVA 5EAIA 3EB9A 1C8BA 1E2NA 3TX2A 2ZUSA 4EB0A 4RJLA 4Y2JA 4RHFA 4CHTA 3USES 5LP6F 4HX5A 1GO2A 1GDHA 2A58A 4REOA 4L2IA 1DAPA 1XFAA 2ZJOA 1UXHA 2HV8A 3M8KA 4OQFA 4PNHA 3TQQA 4C89A 3KYDA 3V8VA 1Y6GA 5CAEA 1QTIA 4GXRA 3TG8A 2RHBA 1D6SA 1YCHA 4CBVA 3F73A 4PO3X 3OLWA 1L7NA 4CLXA 3SZ3A 5CA1F 4I55A 3IAFA 4YMSA 4HGRA 1GKLA 3LTEA 3VKWA 2D0DA 2VAPA 4DSUA 4NYIQ 1KJYA 3WV4A 2OKCA 1KI8A 2VTVA 3FH0A 1CY7A 2RGUA 3EMVA 4Q24A 4UZSA 1NULA 3O9ZA 1NXVA 4QDXA 1JR6A 2PZEA 3I28A 2AD1A 1W4BA 1X1BA 1ONSA 1T0PA 3C6ZA 4JYPA 2A35A 2C9BA 1COWA 1SEPA 1DJNA 1U8EA 3DAHA 4CKBA 1YRQA 2GB4A 3B6MA 2C29D 4AVYA 3C8UA 5CB4A 5TGZA 4GR4A 3NYWA 1DAOA 2W4MA 5CB0A 4UVHA 4G9GA 5DU2A 4UTRA 1JVNA 4LRYA 3ZHZA 1KU6A 1DL5A 3KZCA 4RK0A 5EKDA 3Q2OA 2AX3A 4NOJA 3P9QA 1JU3A 4UJ5A 4BMYA 2DUUA 4JEUA 3I2YX 4RD3A 4UBKA 5CK5A 1I1QB 5LQNA 2K5UA 1YDWA 1YSCA 3R5SA 3G5TA 1JE0A 1VG1A 2C99A 3RABA 5UKDA 2IEAA 3NJ8A 1CFJA 1USIA 2VWQA 3RANA 3QNUA 4X45A 5JG7A 3WLRA 1JPJA 1U7DA 1LCIA 1Z5NA 3RVJA 4PNZA 3GGOA 4L51A 4K1XA 2GS9A 3LUFA 3QU2A 4IGKA 3RS2A 1W47A 1E5VA 3SBOA 3H3XA 5EZYF 3I58A 2Z56A 3SP1A 3RU2A 3U44A 4PPFA 3QKWA 4F4JA 1SXQA 1OH7A 4G9EA 4IF4A 2FN7A 1ATIA 3FYSA 3KSMA 3JZAA 3SJUA 4L85A 1D3AA 5LQDA 4PZEA 3TINA 4JI1B 4JNCA 4UM9B 4YJFA 3HO6A 3UXEA 4DBVO 1IIBA 2HGSA 1CJTC 3ZDXB 3P8ZA 3PC7A 3Q7EA 3U48A 1QFMA 3MGGA 2GEFA 3JQDA 4B3DA 1CG6A 1QLJA 2AR0A 4CUKA 1MORA 5B1DA 1ZMRA 1ZCZA 1N36B 2JATA 3DE1X 5REQA 5JTUA 3QYJA 5BOSB 3DTVD 4BZPA 5AJVB 3SX0A 3TLYA 4EITA 1B00A 1MG0A 3DKPA 5THXA 3U13A 2G70A 3V6LA 4Q16A 4BNUA 3KTAA 3IJPA 2WTNA 3C43A 4PONA 1P1IA 4OQ4A 2XV1A 1X13A 5TNXA 2C07A 3OU6A 4GI2A 1ELOA 2BGIA 3E58A 3LA8A 1P7VA 5I9LA 4KYIB 3SM3A 4RANA 2NUBA 3TTUA 3WLTA 2A9OA 1P81A 3DUFB 3M6UA 4MW5A 1XYVA 1NJ8A 2Q21A 3BXXA 4OOEA 1MQSA 1C3OA 1JG7A 2ZU0C 4XJXA 3E7WA 2QU7A 1TAGA 2BKEA 2I4NA 3A1EA 3MW8A 4E31A 1ZOPA 2AF3C 4L5CA 1WVIA 2JCBA 1KZ4A 2PQ2A 1TCAA 3O9VA 5L7YA 5ES3A 2JFQA 3WICA 2GTIA 1DQRA 5E1DA 3FSJX 3CWZA 5AR1A 1QGED 2B7LA 1VB3A 1Y3BE 4I4LA 1U2QA 4FE4A 3F67A 2HQ1A 3DC7A 1F4PA 2GUWA 3NNNA 1UBLS 4K05A 1XPRA 1T1IA 3NOQA 3GAZA 2WAAA 1EHCA 4L02A 3PJFA 3PPVA 3MEQA 3P2JA 2A9FA 5DM2A 3E23A 1X74A 2OAGA 4G1BA 4RVNA 1T24A 2JFOA 3MCAA 4PF1A 2W6JD 5KAMA 3C3WA 3UPDA 3KXLA 4IMIB 1X1CA 2XGSA 4EFMA 3DOFA 1P0FA 1N5KA 3G9ZA 5HM8A 3OJEA 3REGA 4R1QA 4EHAA 2GHQA 3GFVA 4DPKA 1PJZA 3MRTA 1T9CA 1E2KA 5AOBA 2BGMA 1PQ4A 3NT5A 3WLHA 3I6YA 1X0XA 2EGUA 4MW1A 2JFYA 4WACA 2WF9A 4GICA 4IPTA 3TECE 2IZOA 4KVAA 1ORDA 5FR1A 2QG6A 4X8HA 5EN4A 2BI8A 4OI4A 2ZSAA 3ZE7A 4EVIA 3PUZA 4HPWA 2INGX 2QM0A 5DNCA 5AW1A 5IZCC 5GV8A 4EJMA 3VYSB 3OE7A 2QTVB 3THWA 4DJTA 3ACDA 1O94A 1PVDA 5HW0A 2VTBA 2ZTLA 4JIMA 5JISA 3LGXA 3O47A 4CCYA 5JAUA 2BJWA 2WM8A 4GD3Q 4P2GA 1RHRA 4K9OA 1GN8A 4WOPA 2RHCA 3NHRA 2OL4A 1VBFA 1AURA 3HTXA 2EFGA 1ZKMA 4ITUA 4EJ0A 2O8CA 2ZTVA 3SHWA 4GOXA 4ADSG 3OPYB 2EJUA 2C92A 2H1IA 4C4YA 5KOJA 2JEYA 3CIOA 1N2IA 3H1EA 4JLWA 4UREA 1K5PA 1J99A 3FTPA 2WTXA 5ALWA 3IP5A 4MQ4A 3ZHUA 3PT5A 1P4RA 3V5NA 2OBBA 2X2OA 3BEDA 4TS3A 3COSA 3D8TA 4QU0A 4M3NA 1FVHA 1YONA 1ULBA 3ZZ0A 5BN4A 1EDBA 1IM2A 1QKKA 1TUIA 5AI6A 4Q1AA 4X91A 2F9FA 5HS4A 1PSZA 2XBMA 4L16A 1OI7A 2CLOB 1ZW1A 1OBCA 2GEKA 4PYLA 3ZH2A 4UDNA 4R0VA 1DKRA 2FE4A 4Q3BA 4YA6A 4YWJA 3LRPA 5A5FA 4CKWA 2DQ4A 3UFBA 1HK7A 5AW6A 3IPRA 3OWOA 5F3DA 3ASYA 3H2YA 3SQNA 3BCRA 4DBLC 4ER3A 5T3UA 3E5HA 3WNVA 1U3UA 2VQSA 4J0FA 4Q6WA 4UU7A 4A0GA 3S2ZA 2OZVA 1GRQA 3OIUA 4GGMX 5LB4A 2JLVA 3AB3A 8ADHA 4WASA 4G8JA 1R4ZA 1B3BA 1KIMA 2O0LA 4FXPA 5DN6A 4MP6A 2ZTMA 5E9JA 1KDOA 2Q5EA 4URHA 2EDCA 3DZFA 3LBAA 3Q3CA 4YT4A 4ZI7F 3P9IA 4KIGA 1ZGAA 4IF6A 2I29A 4JSRA 1U1CA 2ZRBA 1NY5A 3RVRA 3TLZA 3VC1A 3G79A 1FJGB 4FIZA 4FYIA 1ZEMA 3FMIA 5J4KA 4G81A 5J59A 4GPZA 1JSLA 2X9NA 2O4CA 3A1TA 3NAZA 5SZKB 3ZCTA 1R74A 5KTTA 4AO6A 2IX9A 4EECA 4CL0A 2BZGA 2OCAA 2NVUB 4OK5A 2QZPA 3NDBB 1F8UA 5JBIA 1UP4A 2X1HA 4WZAB 4X7RA 3F8WA 5FULA 4E2ZA 4IR7A 1JT2A 1G9TA 2XYQA 1P80A 4KXFB 1TAQA 4P5EA 5EYPA 5EMNA 1EESA 4MVJG 3H9JA 1UXKA 2FZVA 3CUTA 3GEDA 3UH0A 1XTTA 2NYAA 2G77B 2QORA 1F9EA 5HFAA 1VIVA 1M1NB 4DMCA 2XXAA 3UMBA 3NMUF 3LP5A 3W2TA 4EATA 1FNSA 1JF8A 2QPAA 1TYCA 3H9EO 3NAQA 4RH0A 1EFPA 3DBVO 2JFWA 3AIKA 1GPUA 3ZCPA 3RRZA 2BFBA 3FJ1A 4NI5A 1E60A 2FEMA 4UDYX 1FTNA 1TVKB 3TDKA 4Z1MD 1QQBA 3HZHA 3IBGA 3WK8A 2AYYA 3U7JA 1ISSA 3FZGA 2CL7X 1ZPDA 2FK7A 4Q37A 1N3LA 1VIMA 4W1QA 1JS1X 1T0IA 1QG0A 1TGVA 2OHIA 4Q48A 1Z4MA 1U2DA 2HF2A 2ZJ5A 4MW4A 2R6FA 4IHAA 2SNIE 2XECA 3V4OA 3WLSA 4D8XA 5B58C 5KNCD 3M1YA 3VYVA 3X2FA 5AHKA 3DQZA 4FFSA 3WMGA 3RVQA 4YRTA 3MD9A 4JFRA 3UGKA 2G4LA 2BP7B 3ADDA 4NNOA 2D1YA 4HUJA 2F9MA 4U1RA 2ZE5A 1T36B 4EIWA 4ENUA 1QHFA 4CWAA 1GTRA 2KI5A 1NMEA 2YOGA 2YXEA 3BL5A 4HAVA 1NNUA 3RYIA 2I3AA 4RJ2A 3T9BA 1Z0UA 4Q12A 3WLQA 4C0KA 1KKLA 2IEYA 4ZGWA 3QSGA 1AGRA 1AGNA 1B74A 4U6QA 3DZDA 4A92A 2WJ3A 3ESCA 1F8FA 5J5AA 4JGBA 4ARUA 2J3EA 3DTVA 3LWNA 5JVDB 2PCJA 2HSGA 1U9IC 3VYUB 4AG5A 3ZZ1A 4AMVA 4B35A 2IBMA 4QYTA 3TXYA 4GVPA 1JIKA 1RDFA 4FTWA 4NESA 5CDSA 5C37A 4EENA 4AMBA 3ZCUA 5F98A 2AT1A 4FDLA 3WSWA 1SKYE 2XWPA 1YFZA 4EI2A 4LXIA 2VF2A 2HU7A 3AZQA 3B48A 1KH1A 4QVIA 3T3MB 5KYNA 1DHTA 4GKKB 2Y77A 3OZCA 1OA1A 4D9HA 3RIYA 3E22B 4RE5A 2H1RA 2RH8A 4GC9A 5HEKA 2AH5A 4KOEC 2PJZA 3GAFA 4ZU3A 4CI9A 4S0XA 2G1JA 1H4TA 4IILA 1XZFA 4KFUA 2PLNA 3QTBA 3G8DA 2RKOA 1QNFA 4F5YA 1RYBA 2JAHA 2B2NA 3G2JA 1CE8A 3OWXA 4GWKA 1E9BA 2GBIA 4DA6A 1YZLA 4ENPA 4QFDA 5BT9A 4X84A 3A1UA 1M5TA 1SWVA 3CPHA 4KR9A 2XEDA 3KU1A 4MAAA 3TMYA 3U3MA 4B3BA 3OZIA 4DNQA 1R4NA 3DMYA 3BFPA 4INJA 5D1HA 3SF8A 5IBCA 3LKZA 4EI8A 3HBMA 1WM1A 5KJFA 4M53A 1VPEA 1TCVA 2OEPA 3VHLB 3J81k 3EQ8A 5CIQA 1R9JA 1DQNA 2PX6A 3KHSA 1KNXA 4IJVA 2P3QA 3GARA 2VJDA 1TTHA 4ZT4A 3VGPA 4CZ2A 1TJ5A 4H0CA 4LVUA 2VQDA 4JL5A 1K6JA 1TKRA 4HYEA 1K86A 2Q6VA 4MVCA 2Q99A 1MEOA 3H8WA 1PLKA 4IOMA 1Z2EA 1XAIA 2C77A 3PFCA 1KYYA 3EXFB 4KPEC 3DTNA 1FTWA 4LKOA 2G5GX 5LQSA 1K88A 3I5YA 5FUMA 3UAVA 1BDIA 3JARA 2OHJA 3OI7A 1AKRA 4I55B 1QGZA 4LMAA 4XAQA 3DE5X 4W8GA 4ATNA 1T10A 7YASA 1WCXA 5HJ5A 1AQJA 4CUJA 4YUYA 3OZ7A 4M8SA 1WXIA 2G6BA 4UVGA 2PUAA 1Z18A 2O20A 3I92A 3R40A 3F3MA 5CNKA 4ZIRA 2OOKA 5CNMA 5HM6A 1JB1A 2VIIA 3BYZA 4NP6A 3EC2A 4CKBB 2AG8A 4GYKA 2B1GA 2VXOA 4LA4A 4AJ9A 2CYBA 3CUSA 4QXAA 3N2EA 1IQUA 1I4DD 3EH2A 3GLIE 3O8CA 4BCBA 1KS9A 2VOJA 2GZSA 3OFKA 5CHYA 4ZAWA 5F21A 1HURA 4TYNA 2W0SA 5IF3A 2CDCA 2JASA 2Y4OA 2BH2A 1KQNA 1UH5A 4TL6A 2CFSA 1AKWA 1TUGA 5IYZB 4A15A 1NW4A 4AD8A 2IXBA 2JCSA 5J1SB 1BKDR 1P1CA 4JLUA 4EB3A 4F4DA 3IQHX 4QNMA 2WIAA 2XOXA 4R41A 4AUKA 1PBNA 1FDOA 1RI4A 1N32B 3RJ5A 4BB0A 1WZNA 2HBZA 5C4MA 4FOLA 3VH2A 1UZMA 4WEQA 1WZUA 3GMDA 1VL5A 3L40A 3WKDA 3DLBA 3N53A 2VQ6A 3OA2A 2GPBA 4X8OA 2WZQA 2H11A 3A4MA 1Z6ZA 1BVRA 1K6IA 2FRXA 4JOCA 1NBAA 4QRDA 4UAUA 1XD8A 2OXTA 1GQQA 4C0SA 5KNDD 1SBYA 2H1VA 2ZYWX 3JAKB 3QBDA 1S2OA 5IVIA 3U9TA 4HVLA 1J1ZA 3AHFA 3MF4A 3U44B 1TJNA 1TK9A 1YE5A 2PX3A 2Y68A 3ZS8A 4PO1A 4D9BA 1FY2A 4UU8A 1L5FA 1ZD8A 3IBFA 1ODIA 4ARVA 2DFKB 4BNFA 2PTGA 2JJ2A 4AP6A 3SYRA 2RGYA 1GGFA 1RBMA 3G7SA 4QATA 5FOUA 2XITA 1VGQA 1Z9BA 2FOLA 2V0NA 1GCOA 3QEOA 4QECA 4V0MA 4Y2HA 5KOHA 5MN6A 4Q4JA 1E2FA 4WTOA 3D59A 5HA5A 1Y5LA 1Y6JA 1JHQA 1FMJA 2XZOA 2BEKA 4M9QA 1X1SA 1SIOA 4JBYA 3ODGA 1N3IA 1NOIA 5REQB 3UGTA 2VNSA 3N8HA 1VGRA 2E18A 2OZLA 3W5VA 2XWJI 1J90A 3BWXA 1K4YA 2ZIGA 2JB9A 4FHGA 4MUKA 4ZREA 2J3IA 5EVCA 4HFRA 1PZGA 1KMHA 3E3MA 4JELA 4C2BA 5AIBA 2G3YA 3L1JA 1DTWA 3YASA 4R6WA 4RAQA 1VMIA 3DPIA 1H0SA 3KAQA 4J1TA 3SHFA 4D41A 3V8EA 1BC5A 1VYTA 2RG1A 2BISA 3IPLA 2CUKA 3OMWA 3PUXA 4PGAA 2QTCA 1H2WA 4N01A 1QRRA 5TARA 3STXA 2ZAOA 3A28A 1MV8A 4B7UA 5KDOA 1LX6A 1KQ3A 1XQ1A 2ORIA 1AZWA 1F2VA 3NTXA 3A6DA 2V6IA 4BO5A 3KD2A 4QYSA 4WN3A 3MILA 3U80A 3IKMB 5B2EA 3NP7A 4DREA 1L9XA 4G0VA 3R3UA 1J06A 2WIKA 3PK0A 1PEAA 4WESB 1ZSYA 5F5LA 3RSOA 1ID8A 5A7HA 5CURA 5CLJA 1O2DA 1UF9A 4KB5A 1XD9A 2IBTA 3E9RA 3RS4A 4BIIA 2R2AA 1HDYA 2AL7A 5HGJA 1XNJA 4IDFA 3I2FA 4IDAA 3O21A 3LW7A 2BBOA 4DQUA 4XCVA 1GPWB 4R4JA 3ZVKA 5AJUA 1D9XA 1E6CA 1SD5A 1Z6AA 4BUJA 3BSSA 4CIXA 4LX0A 3E2MA 3QWBA 2VNHA 5LZ7A 3F74A 4FDAA 1ZCAA 3K9GA 4RDIA 1YD7A 2ZROA 4F12A 3FRJA 1ICEA 2XCQA 1XKQA 2H63A 2Z1DA 1C8VB 1E9CA 4JC0A 4OLJA 5AI8A 5E6UA 5FOXA 3TZLA 3IVGA 1E1MA 3MWKA 1GTG1 2LIVA 3PZBA 4I1VA 4M8IA 4P86A 3I9KA 3DO5A 3IFSA 2FFAA 3RYHB 1OFHA 3LQQA 1WS6A 4XD7D 4ZAFA 3UHOA 2HDOA 3NASA 2HSDA 1CETA 3BWYA 4YRLA 2O2GA 1H69A 1KA9H 1YQXA 2ZAGA 4NABA 1E8NA 5CIWA 4ONEA 4NCBA 1SCUA 4B4DA 2KLHA 1DEKA 1R0SA 3HWSA 4O33A 1F6DA 2VTBB 2I6FA 2WQ6A 2P5YA 4Y6QA 1YA6A 1P33A 4U2CA 2X76A 3OVMA 4JU9A 3I9V6 4UNSA 3V3KA 4AFNA 4PXSA 3NT2A 3RF7A 1E3IA 3H7IA 3KL2A 4WKPA 4DIMA 4F06A 4RKQA 1GZSA 5JXGA 4GKBA 3IKLA 5T4HA 3P0EA 5THQA 1IY0A 2DJ5A 3DAGA 3WYDA 1W36D 2FUKA 4IYJA 4ZYLA 1ZZEA 3AI1A 1NN3A 3D1VA 5KOJB 3EPHA 4PTLA 4KP7A 2AOVA 1HYBA 3B6EA 3NDPA 2FOIA 5FV4A 1ZCBA 3I6IA 2QRZA 2R8RA 1VMDA 1S2LA 4GP7A 4CRWB 1SN7A 4LDZA 1N2EA 4B47A 1R0LA 1Z47A 3TIXB 3WO0A 3KQSA 1KJZA 1JFTA 3ZE9A 1KYZA 2OVBA 5LQKA 2W42A 1WZIA 5G4LA 3DHWC 4CT4B 3CUWA 1E96A 1G8FA 3PIDA 4XE5A 2IY8A 3GEGA 2JD0A 3CH7A 4RADA 2XGJA 2XE7A 4Y9SA 1V8FA 2GDZA 4ON9A 1VHTA 4WCVA 1CRZA 3NEYA 1KBZA 4N7BA 2QUBA 2IOQA 1OASA 5CP8A 1AD2A 1ZCFA 3D3WB 3IQZA 3G8YA 4WHMA 3C5CA 4R1SA 2IELA 4KXMA 2RHMA 5LDGA 2HA7A 3A37A 3F9RA 2NVBA 1UQTA 4FOOA 3OCXA 4HNQA 2J5KA 4NONA 2I1QA 5ILQA 3RS3A 5ALUA 1QU2A 2PAFA 4OQYA 1U7HA 3R7DA 2ZBVA 2J7PD 4LFCB 4IMJB 3ES9A 3ZU4A 1SIUA 1M3SA 1IXKA 2XGOA 3T5MA 4QE3A 3H5VA 3R23A 3FDIA 4RACA 1UBSB 5FQNA 3HMKA 4CLRB 1T13A 4AN4A 3UJNA 2QY6A 3AUFA 3W5BA 1O58A 4UHFA 4L9RA 2YQ5A 4U7WA 2QPTA 3G0BA 2OYCA 3ITEA 3K1ZA 1XPJA 4UDOA 4QUDA 4D42A 5L3QA 1QX3A 1DJLA 1KGDA 3L43A 3IV9A 3H9QA 4I50F 2C03A 3QBEA 1GZ7A 1U31A 4M99A 3IUBA 2X4LA 3FFBA 3AHCA 4UHKA 3LI2A 5ALGA 4HVAA 4D79A 1JFVA 1DIAA 4BJ1A 5EZSA 1RPZA 4D9CA 1H0HA 2ID4A 4H7KA 4UJ3A 5D5QA 3ZE8A 4CDRA 1TYBE 3OOEA 2OMKA 4P3NA 4PRZA 4P53A 4RIEA 2E37A 2VHXA 4R68A 5H16A 2C0QA 5LBTA 3KQNA 1RTTA 3G0IA 3NNDA 1XRQA 3P9ZA 4OMUA 5LA6A 2SCUA 2YQZA 1SCBA 3BGOS 4DCUA 2YWFA 4V0NA 3CZ4A 4NBTA 1N4DA 3DFUA 3G13A 3BKXA 1TEXA 4F38A 4EH1A 1PJCA 4HNAA 2BFBB 4RTJA 2GN8A 4B3FX 2P27A 2DUJA 2FLKA 1CVLA 5JWHA 1NDUA 3GAAA 4C4AA 4QYIA 1QQ6A 2IYTA 2IC5A 5CM2Z 1ECCA 2XF2A 1QFXA 4Z4EA 3ANMA 2L0XA 3MTEA 4J0GA 2RONA 3EGEA 2R8ZA 2AVNA 3C7CB 3T5CA 3S4YA 4BO4A 4C0HA 4Y18A 2DLDA 1OYOA 5AFSA 4GC5A 1CDZA 1IAVA 1LPOA 3HXTA 2X8AA 4MQBA 3RC3A 2YWDA 4UNNA 4BX2A 2JIZD 4F5DA 4Q4LA 5JALA 4ARZA 2QY9A 5HZGA 4AJEA 4HT3B 1JEQB 1VKRA 2CXNA 1HM5A 4OB6A 5JPCA 1GIAA 3RYIB 1OWOA 2GJAA 2QL5A 3DFZA 4H3KB 4ZVUA 2DQYA 4QDTA 2H31A 3KQHA 4O2BF 4QU8A 3E9CA 1TQHA 4F9EA 1FSPA 1IQRA 3KYCA 3DTVB 5JATA 2RGDA 4TRJA 3BJEA 3IB6A 4HWRA 4JR1A 2NAFA 4CKXA 5T41A 3AL0C 1JR3D 1D5WA 1CBUA 2QVGA 2QX7A 3SI7A 4HGQA 4LZWA 3T9CA 2WRZA 2Y1GA 1A9YA 3CLHA 2O0KA 3RBXA 3ZI4A 1DTEA 4R01A 1BOFA 4TRRA 1PQPA 1GPYA 2G5CA 1W0CA 2ZJ8A 1TAHA 1YJQA 1QX4A 1QR6A 4OH1A 3W77A 1E66A 4JLJA 4A36A 2EC5A 4X65B 1YJXA 2X0IA 2QXUA 4O4JF 4QXRA 4D26A 2CNKA 2AQIA 1JFLA 1KXJA 3KQQA 3SZUA 4B6JA 2WYOA 5JROA 2CY0A 3UK7A 2QNIA 3I5AA 1DBQA 2WP8J 3RTGA 5IKPA 3LUDA 4OQQA 1RM3A 2BM0A 4WBNB 1CPYA 1E2HA 4DARA 2I7XA 4FNOA 1TZJA 1RLMA 5EXTA 1CE8B 1P7CA 2GA9A 1F60A 1XV5A 3GROA 4UBNA 2X86A 2A5JA 4CT0A 5A4JA 4YAKA 2B4RO 1LBEA 2XDAA 5ITWA 1L5GB 3JAWA 1JZSA 2C4HA 1VRWA 1YK0A 4O5AA 1LPBB 3OECA 1L5YA 2FMXA 4AMZA 4NIMA 3SF8B 2ZJ7A 4YJ2F 4EHFA 1GDTA 2QMEA 1W29A 1GL7A 2PYDA 2YRXA 3PD7A 1UBUS 1V1RA 2O5RA 2NXEA 2N1BA 2FF7A 4O8CA 5ELLA 1KZ9A 4JSTA 4ZOLA 3KHKA 4GEKA 3DA8A 4EKGA 3RTCA 4CG0A 4HEHA 4PU0A 4EG6A 1N1MA 2F8LA 3IP3A 3LVQE 2O3TA 3B1FA 3E9EA 4GUAA 1OSNA 1JLHA 4AECA 1VSUA 2C3PA 4LZJA 5CB6A 3L06A 2A5YB 1DQPA 2RJOA 3JQFC 1NBME 3OZEA 2NU8A 1TPZA 1XTIA 2QLTA 3SJAA 4Y1RA 1J5XA 3AETB 2LKDA 1DOAA 1Q0PA 1YI8A 1JIQA 1KYVA 1O6BA 1Z8DA 4FSHA 4DCCA 2FE1A 4NMHA 4LF4B 2Q3LA 1YQWA 2BDUA 3KZOA 4KMOA 3WRVA 1RAEA 2HD4A 3REOA 2ODQA 1R4AA 1JSXA 3WSTA 4BV8A 3L0SA 3U4QB 4PHTA 2LDXA 1C7ZA 3CRQA 3ZI7A 3THYA 2HA3A 3QA3E 2N46A 2RHGB 2VDPB 2JL1A 5JARA 1XP5A 3C3MA 3FOBA 3M6XA 4WXEA 3MAJA 3MWYW 5BSEA 2J85A 3IP1A 1XZNA 2JLWA 3CEJA 4BKUA 1T3TA 2J45A 1GKKA 2HHCA 3E03A 1JWBB 1LRKA 3EAQA 3VR6D 4TV8A 3U1TA 3MGAA 2IYNA 5ESRA 1FUYB 1GPMA 3FGZA 3I3SR 2OT3B 3L0CA 4HQLA 5JZ9A 3FTFA 4W5QA 2FSUA 1K8XB 3TAXA 4J2OA 5ICCA 3NWOA 4BCDA 2NYUA 4L0DA 2R6DA 3ZHVA 1L8OA 1IVYA 1M1XB 4HQFA 3PX7A 1T2NA 4FFWA 4P5PA 3GU3A 3FPBA 1TLLA 1G7TA 1Y1RA 1G21E 1PKXA 3CX8A 3IO3A 3M1IA 3NETA 3O2QB 2QG4A 2AOUB 1FQJA 3PGJA 3GJ8A 5I6DA 1KQFA 2GM3A 1S4MA 2HCFA 3BCHA 3LDUA 4MGHA 2EL7A 4UNQA 4DUYB 2VWHA 1HYEA 4J1NA 1C1HA 4Z7JA 1FVXA 1AIPA 5LD2C 1XJWA 2OXEA 1WDWB 3K3PA 4YMWA 5GJCA 5HDBB 1EM8A 5FFMA 2ET6A 3HLKA 4F8YA 3KJIA 1RIFA 5LZ2A 5J9FA 1W88A 4DZRA 2YZNA 4BVLA 1B8NA 4B17A 1E3QA 2AE2A 2Y92A 2XUZA 1R6TA 4V2UA 4UTVA 2RI0A 4PX9A 1CWUA 1WWKA 5KOHB 1Z26A 3NBAA 4Q4JB 1F2UA 5BN4B 1WO8A 2J9FB 3LDFA 1BD3A 4G4JA 2EHDA 4LWPA 5KNBD 4NS1A 2FTKE 4KV7A 1JLKA 2J6IA 1V6AA 3CF4G 4JT8A 3JQ9C 2VJCA 3AF1A 4MKHA 1JQLB 4G24A 4F2PA 3ET4A 5EUBA 4RIIA 4CM7A 1LPNA 1XL1A 4D3XA 3P0RA 1EE2A 3AKYA 4IWXA 4KLNA 3GP5A 3W79A 3X1DA 2BJVA 2HZ7A 5LYYA 2B25A 2I3DA 1P2GA 4BL5A 3SD7A 1ZR4A 3NTVA 2WNIA 4XWGA 3HXQA 3NH6A 2VDJA 3PQDA 1K2VN 1JQ3A 4NCKA 3I64A 3KUUA 3R3ZA 4OI1A 3T9EA 2Z30A 2ORVA 4FQ8A 1GPBA 3HBFA 1MAAA 4BE7B 3CKMA 4G37A 2HSZA 1K8RA 3IYLW 4EDFA 2WD7A 3AR5A 2R66A 4HLUC 1VPWA 1AB6A 4FYPA 1TKAA 1V9SA 3DBIA 1H2ZA 3CLTC 1XMJA 4HDNA 4EY5A 2JLAA 3SZOA 1YS4A 5CYPA 4DT1A 5JXJA 1I5EA 1A8UA 5AW8A 3LUAA 3TNDA 2Q07A 3ZHCA 5KQLA 3GQBA 5DH9A 2IXFA 4ZVSA 2B0CA 1JAIA 3QF7A 1GFIA 5B1IA 1EFVB 4M86A 2O2XA 3GRPA 1B3RA 4RVDA 4D97A 3WK9A 4B2IA 4KXNA 5IDXA 5KX5F 2GBFA 4OIFA 4ZHQF 3AJEA 1FF9A 1ND6A 5EWJA 5AVWA 2FQXA 1W49A 4O6VA 5A7FA 3MTDA 5E6UB 4GZ6A 5KCZA 4GNRA 4WLVA 1Z4IA 3TSOA 2DOKA 3NORA 4DZZA 4G5QA 1JALA 1KY5A 1CY4A 4MR7B 4EW2A 3GRZA 1ZK0A 1GYQA 1DMRA 2VTEA 1P2TA 1TJ4A 4LOKA 1DWOA 1MJGM 3RODA 2AHRA 3DLPX 5ER6A 5SY6A 1EM6A 2XAUA 1RZVA 3RFUA 5I7HA 3SSAA 3MS4A 3SHOA 1OE0A 4J4HA 5C31A 3V33A 4AKHA 4L0CA 2ZRPA 4I5DA 3O03A 2WZCA 2AUTA 2PLWA 3DOIA 4U0KA 5K0CA 1UWKA 2UZ1A 1DIHA 3IJRA 2PPVA 2A0UA 3N87A 2RC6A 4CFYA 4RZQA 4H7FA 1G18A 3JD3A 4BFCA 3HBNA 2ATEA 3PF8A 4S1NA 2EP5A 4QBHA 1M0WA 5ELMA 2ZREA 3S68A 1C29B 2ZAIA 4R2MA 4CGYA 4DIUA 4C4XA 4M0UA 1KI9A 2ZRDA 1PS0A 1H8EA 4Q4DA 3CMMA 3D4BA 1K2WA 4MV3A 3BIXA 4CQLA 4QTUB 3W5SA 2V7WA 2GQ0A 2RGNA 1LS6A 1VLZA 3AKDA 4Y2GA 3EWSA 1JZTA 2HNAA 2DUWA 1WW8A 2YY7A 4L9AA 5FL7D 2PH1A 1ATZA 1NPYA 3V7YA 1OF1A 1T9GS 4B3CA 4XEUA 5KS2A 4LDJA 3CR7A 1C3JA 3WADA 1KO8A 3PPYA 1EVKA 3DLIA 3SX4A 1SOUA 1J25A 3HZOA 3Q3JB 4JROA 2NUTA 2K7FA 4CCAA 1FDIA 1UBJS 3ZJYA 4K8RB 3V8MA 1PE0A 2FJ0A 3E27A 3BWCA 1L5SA 1TCUA 3RROA 3O7MA 2I4IA 4OKIA 1XZEA 4WY8A 3VGJA 1D1PA 1EGQA 4BNTA 1ZITA 4GL4A 3D2LA 4AG3A 3JATA 5CT4A 2RHRA 4GZ5A 3KT8A 3BB3A 1KI6B 1QCDA 4LHXA 2AFIB 1LPPA 2C9ZA 2Y66A 3KSZO 4PGGA 3OLQA 2ZJ0A 5AVQA 2WV9A 1L2TA 4MKZA 3FYUC 1UL1X 4IV0A 2C3OA 4NAUA 2CJXA 5ALQA 4PZPA 1IQ0A 3EZ9A 4YEDA 2WOOA 1ZJ5A 4NTZA 3RUEA 1ETUA 5A1JA 1KH2A 2HADA 3TSYA 1K7SN 2QZ4A 4Q4AA 4FFLA 2B6HA 4R8LA 3ZQKA 3IT3A 2AYZA 2NZ8A 4ZAVA 3OIVA 3QLUA 3V48A 1S89A 2HJHA 2J31A 1G3QA 2N9UA 3L8CA 5SY4A 4AB1A 4YT8A 5CU7A 1CEEA 1M8KA 3DAYA 3D1JA 4RENA 3ZE1B 1K8QA 3LXMA 2YXDA 4JZYA 4Q7MB 1KGSA 3GPIA 3IURA 2VQEB 1BEEA 1J5PA 1GGNA 2VJOA 3OHMA 4Q02A 3SC2A 3ZY2A 1QO7A 1QE3A 1TCCA 3N7AA 4AM8A 3UCXA 2R1VB 5JJIA 1K92A 3B2EA 5FTNA 1I2DA 3C5EA 4XYEA 1PFVA 2I9PA 4G2NA 3NHKA 2C00A 3V2IA 2OM6A 3WQQA 3IDFA 3RIHA 4ZRNA 1BXRB 3DNFA 5AJYA 3HB9A 2R1ZA 3CNOA 3F6YA 1E18A 1ABFA 2YIVX 1N1DA 3H99A 1EXDA 2CFOA 3PQ3A 1OKKD 3QVUA 4HO1X 4NATA 5A4FS 4P1ZA 3MLBA 2Y67A 5JCXA 2CF5A 3UG7A 2RC5A 1EKXA 1X9IA 3FD8A 2I2WA 4C2TA 1T15A 4M46A 1C7JA 1OIXA 4ZA2A 4RD0A 1UEIA 3V1KA 3WL5A 2AZ4A 1G4UR 4G9BA 5AW9A 3CLSC 1QJ4A 5AM2A 3ZJUA 1JIXA 4JLSA 3TSWA 1OV6A 1K1EA 2H29A 2V6JA 3FFAA 4U8HA 4ZMBA 4GS5A 4FHEA 3UWDA 4WNAA 2H4JA 1F3LA 4GI7A 3JQBA 4MGKR 5J5CA 2A1TS 2IIPA 3HUUA 5GPBA 5TGDA 4ZCLA 2Y99A 1AK2A 1OGYA 2CLLB 1QH1B 2IYWA 2OILA 4BNGA 4LXXA 4ZI5A 1VCMA 3ZW9A 2XCUA 4C6SA 1T1JA 1Z5UA 2Z3WA 3QXGA 3RAJA 2JCXA 2JFGA 3HABA 3SBDA 1J8YF 2NACA 3PDWA 4CM6A 2H51A 3CT6A 5CLIA 5I51A 4GPIB 5LDDC 2XMBA 3NGLA 1OTXA 4I08A 2WJ4A 4PPQA 5I7EA 4P3OA 4TQ9A 5L45A 2V7UA 1R6BX 4YRGA 1J2UA 2X0NA 2DAPA 1C0IA 1ZJ4A 2DM6A 3DKVA 1Z88A 4KREA 4Q9NA 3KSUA 1NM5A 4KODA 3KETA 1K9SA 1QQTA 4OXXA 4E4YA 4CF3A 1N4AA 1FNNA 4LBVA 3JR7A 4C04A 2R87A 3IP8A 3IHKA 1KZ6A 1UPXA 5CCEA 1EIZA 2OP1A 2P1RA 3CO5A 3UMMA 2UYQA 3ZY4A 1IY1A 3X1JA 3LVBA 4NXNB 2LWIA 4G1FA 4DPLA 4K03A 3KKZA 4Y2TA 1CF4A 2JLBA 3JAWB 5FHQA 1IM5A 1HSOA 1LDMA 1M33A 5EIBC 1E4OA 3A2KA 1OAKA 1UZUA 4N3BA 3KQKA 1ZEJA 5DTQA 3T3OA 2H08A 2YFYA 4KG7A 3QZUA 5E0OA 1MQ8B 2OP0A 3ZGVA 4CDMA 4LHWA 5EUCA 1NBHA 1D5CA 2VH2A 4BNWA 2W2XA 4BMCA 3EZFA 3OX3A 4KO3S 2M9MA 3JWJA 4EJ2A 1IBKB 1DXYA 1X7GA 5D01A 3ZD8A 3IUMA 3AEYA 4AJ1A 3Q12A 3GCXA 1RQGA 1RYEA 1Z4NA 1VTKA 5K8IA 2YXPX 4WY5A 5IK2A 1SIBE 2HW8A 5I8PA 3WGUA 2NU8B 1IY8A 2YV2A 3DNPA 2FLWA 4IIUA 3UWSA 2V65A 5ED0A 1RHUA 2ID7A 5JT1A 2XE6A 5AKZA 3RTBA 4LJ8A 3R5XA 5BQFA 1IG0A 1J22A 1RC0A 2TYSB 5CRIA 2DFVA 1EAYA 2REQA 2R11A 4I1SA 4ZZ0A 1OFIA 4YAOA 2QGFA 4Y2QA 2YRFA 2ZT7A 1AQNA 3THYB 3KK0A 1C0PA 1VJ1A 3CISA 4RHXA 4R2XA 4JI0B