3Q7VA

Beta-lactam-sensor domain of blar1 (apo) from staphylococcus aureus with carboxylated lys392
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
252
structure length
252
Chain Sequence
b'QSITDYNYKKPLHNDYQILDKSKIFGSNSGSFVMYSMAADAYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase regulatory protein BlaR1
publication title Lysine Nzeta-decarboxylation switch and activation of the beta-lactam sensor domain of BlaR1 protein of methicillin-resistant Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase regulator
total genus 88
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q7vA00
2ZM2A 2ZM8A 3IXGA 2WKIA 3RJUA 1BLPA 2EXAA 5HX9A 1PYYA 3RXXA 4LENA 3VFFA 2ZD8A 1CEGA 3IF5A 2V2FF 3GMWA 4ZBEA 3M2JA 4MBKA 5F1FA 2XQZA 1ES2A 1L0DA 3BFFA 4OOYA 2E8IA 1SDNA 5JYOA 4LCLA 4OONA 4PM6A 3VOYA 1K56D 3UE3A 5CHJA 3IXHA 2ZQAA 4FH2A 3W4QA 1YLTA 3C5AA 3HREA 3PBOA 5E2EA 4BL2A 3UPOA 1K25A 2Z2MB 4E3IA 3C4OA 3VFHA 1TEMA 1RGZA 1K56A 4OQGA 4OPQA 3BFCA 1H8YA 3TOIA 5A92A 2J8YA 4QJGA 1QMFA 1XA1A 4N92A 4OPYA 5DF9A 2VGKA 5HL1A 5FAPA 5U47A 4OQ0A 4GZBA 5GHXA 5FASA 2RL3A 4R1GA 4LCMA 1M40A 1KGGA 1MXOA 1ONHA 5E43A 3ZGAB 3LCEA 4DXCA 3NCKA 4OOLA 2DCFA 5FQJA 4DE3A 5AQBA 1N4OA 4WBGA 3MBZA 2PBYA 2WGWB 2OV5A 1RCJA 3VSKA 3ZG5A 5GLDA 4L0LA 3HL9A 2G2WA 4ZJ2A 4PPRA 3TG9A 5EVIC 4GKUA 3IXDA 3M6BA 3HLEA 4RX3A 1IEMA 1SCWA 3EQUA 1L2SA 1L0FA 4OPZA 5EVIA 1KDSA 4X53A 3PAEA 3HLGA 3SS5A 3BEBA 3OPRA 5FI2A 4X55A 4PM7A 3QNCA 1Y54A 1HD8A 2QPNA 4OP5A 1MWTA 2H5SA 4NETA 1WYCA 5CGXA 3UPNA 1L0EA 4E3LA 3G31A 1E4DA 4M3KA 3C4PA 4S2NC 1TDLA 2HP6A 4KZAA 1L0GA 2HP5A 2HDUA 4HESA 1YQSA 1IKIA 2WUQA 1E3UD 4ID4A 3G35A 2XLNA 4MEZA 4E6XA 3BFGA 1SKFA 2Y2HA 3UDXA 1YM1A 2Y2OA 4S2MA 4OVDA 4UA7A 5M18A 2WGIA 4ZJ3A 4IVIA 1BLCA 3SH7A 5FDHA 4KZBA 5EE8A 3HLBA 4UA6A 2X01A 4Y7PA 2WGVA 4S2JA 2ZC6B 1YLJA 4X68A 1I5QA 2EXBA 1PWGA 4WYYA 1G6AA 4OQHA 4JXSA 2BLSA 4X56A 3WRTA 2IWBA 3E2LA 4FCFA 3ZNYA 5DTKA 5EOOA 4Y0TA 4PM9A 3OPHA 4EUZA 1YLYA 3O86A 2J9PA 4DDYA 2RCXA 1LLBA 4OKPA 5EOEA 3FKVA 5CHMA 5DF7A 3SH8A 3UNWA 4C75A 4QD4A 3WS2A 2Y2PA 1KVMA 3O3VA 5FQ9A 1GHIA 4BQMA 3A3FA 4KZ7A 5F1GA 3WS5A 1FR1A 4WZ5C 5GLBA 4KQQA 1FSWA 4OQIA 1ZG6A 1YMSA 1FSYA 2Y2MA 4DF6A 5FA7A 3JYIA 3OPLA 1K54C 4R23A 3M2KA 4GNUA 3LO7A 4S2IA 1IYPA 1K54A 1FCOA 4CPKA 5CHUA 2Y4AA 3N4IA 4GD8A 1BSGA 2WKEA 4C6YA 3HUNA 1C3BA 5EVIB 4X6TA 3LY3A 1PZPA 1O7EA 4KG6A 1K57C 1XA7A 1BT5A 1PI5A 3OCLA 3FV7A 2DRWA 5HAQA 2ZJ9A 4IBXA 1PW1A 4O7DA 5M1AA 4PMAA 2PU4A 2HDSA 2XFTA 5D3OA 3CG5A 2P9VA 4IBRA 4DKIA 5CGSA 2EX2A 5FQMA 2Q9NA 3MKFA 1IKGA 2FFFB 1DJCA 4WMCD 4GN2A 4U0TA 3LEZA 2JC7A 2X02A 5CTNA 3A3DA 3VMAA 4PM5A 3MFDA 1PZOA 2Y2IA 5FI7A 4BLMA 2C6WB 1BLHA 3N8LA 3PBNA 3ZDJA 4WMCA 2I72A 3IQAA 2Y2KA 1ESUA 1EWZA 5CERA 3G2YA 1KGEA 4JXGA 3UDIA 5I94A 1NZOA 1DJBA 3HUOA 2WKHA 4OOMA 1CI8A 2DNSA 3C7UA 1JWZA 1K4FA 3GQZA 4MLLA 1IYOA 3EQVA 4RA7A 1MWUA 3ZVTA 1KE3A 5FI6A 2A49A 2XD5A 1NY0A 3P09A 5FATA 4JXVA 3OCNA 1MWSA 3N7WA 5DTTA 3ZG8B 5EUAA 3W4OA 1BLSA 2ZQ7A 4KZ8A 3ZG7B 5L2FA 5KSHA 3N8SA 4P87A 3Q1FA 4IVKA 1S0WA 2JCHA 3VP1A 2WK0A 4N1XA 4R0QA 4QY6A 1RP5A 3ZNTA 4BJPA 3C7VA 3IF6A 4HEFA 5CECA 3O88A 3GRJA 5DF8A 4EBPA 2OLVA 1K55A 4JF5A 3W8KA 2ZC3B 3I7JA 1U60A 3IWQA 3PBRA 2IWCA 1Q2PA 4HBUA 3SS4A 4WEKA 3UY6A 3UN7A 3G32A 3MZEA 4BD0A 2ZC7A 4BL3A 1H8ZA 4DRTA 4P6BA 3IT9A 3PAGA 5AQ7A 5KZHA 5BOHA 3BYDA 4OP8A 5HARA 2WADA 4CJNA 3BECA 1MBLA 1KDWA 1KGFA 1W8QA 3BRMA 1AXBA 3SOIA 4EBLA 4ZDXA 3NDEA 3ZVWA 4KZ6A 2P9VB 4OPRA 3N6IA 1GHPA 1GA9A 1MKIA 3NDGA 3VOZA 1FCMA 3V39A 2HPBA 1LI0A 5GHYA 3GTCA 1E3UA 1SDEA 1PWDA 1ZG4A 4DE2A 4KZ4A 3UE1A 1W5DA 1KE0A 3FWLA 3OZHA 4D2OA 5GL9A 3CMZA 4WM9A 4FH4A 1G68A 1PW8A 3TSGA 3PBQA 3BLSA 3FKWA 3ZG9B 5TFQA 1NJ4A 3DWZA 4GB7A 5CTMA 3UDFA 3WWXA 3GSGA 4KQOA 1XKZA 2XEPA 3PBTA 4B88A 3G30A 5FSRA 1QMEA 3V3SA 4MBFA 4RVAA 2R9XA 3S1YA 4DE0A 4P0MA 3V5MA 3NI9A 3WS0A 1KE4A 1IELA 3SS3A 1VM1A 4R3BA 3UO9A 3BLMA 3G2ZA 2WZXA 4E3MA 2PU2A 1HTZA 4ZAMA 5FQIA 1ALQA 2VGJA 1JTGA 2WAFA 2ZQCA 3IF6B 4YFMA 3D4FA 1K6RA 2G2UA 4E3OA 1H5XA 3NBLA 5A90A 3VSLA 5CEBA 1S6RA 3Q7ZA 5IHVA 2QMIA 1N9BA 1TVFA 4K0WA 1FQGA 4WZ4A 3HVFA 3OPPA 3ITBA 3NIAA 5E2FA 3IH8A 3G34A 5FQKA 3CJMA 4XUXA 3QNBA 4DDSA 4A5RA 4KZ5A 4JBFA 1W8YA 3HLFA 4JXWA 3DWKA 2WZZA 3HLDA 5AQ9A 1BZAA 4JF4A 3ZFZA 4IEDA 2EFUA 3Q81A 4OLGA 1ERMA 5KMWA 4ZTKA 3HLCA 2C5WB 2XDMA 5DVAA 5A91A 2ZMAA 2EX9A 2ZQDA 4JPMA 1ES3A 3O87A 3ZHHA 4N9KA 1NYMA 3ZG0A 3LY4A 2ZC4B 5KSCA 2A3UA 4KZ3A 4LV2A 4BENA 1ERQA 4EWFA 3AGDA 4P85A 5HFOA 3VP4A 3FZCA 2Y2LA 1J9MA 3B3XA 4GD6A 2H10A 1I2WA 4KG5A 3FYZA 4Z9QA 1TDGA 3HUMA 2XFSA 1OMEA 4GDBA 4EBNA 1HVBA 4RYEA 3S4XA 1LI9A 2FFYA 1FCNA 1K4EA 5TGFA 1FOFA 1XXMA 4EQIA 1NZUA 5EECA 4DXBA 4B4XA 2XK1A 3A3JA 3UPPA 3VP3A 3Q82A 1DJAA 2BG1A 4OLDA 3Q7VA 2HDRA 1JTDA 1XPBA 3IF6C 4E3NA 4JKTA 2WAEA 4Y0OA 3W4PA 4DE1A 1K55C 4X69A 5FQQA 3BM6A 2XD1A 2JBFA 1LHYA 1O07A 1XX2A 2IWDA 5HW3A 1LL5A 4UAAA 4KG2A 3BFEA 4UHUA 3E2KA 1CK3A 3IWOA 1IYSA 3MKEA 2EX6A 3VP0A 1YMXA 5GLAA 1NYYA 2ZQ8A 3RXWA 1ES4A 3S22A 2Y2NA 4B4ZA 4WELA 3GV9A 3MXSA 1M6KA 5EVID 3SH9A 4Y0UA 4K91A 1MY8A 4C3QA 3WS1A 4E6WA 5AQAA 5GHZA 2J7VA 4Q8IA 4N9LA 5HAIA 1ESIA 3OC2A 4FD8A 1JWVA 2CC1A 5EPHA 5DTSA 4MBHA 1BTLA 1YLWA 4YINA 1LL9A 2H0YA 2Y2JA 1I2SA 3CZDA 4QB8A 4U0XA 1HZOA 3GVBA 3DTMA 4KENB 5A93A 1BUEA 2JE5A 1K38A 5HAPA 3UE0A 4S2PA 1ZKJA 3G4PA 1GCEA 1XP4A 5CRFA 2EFXA 3Q07A 1Q2QA 1JVJA 4QHCA 1BULA 2B5RA 4LV3A 4KQRA 3DW0A 1VQQA 2Y55A 5F82A 4N1HA 5M19A 2HP9A 4S2NA 2V1ZA 3V3RA 5GLCA 3GR2A 2V20A 4R3JA 3AGFA 2EX8A 4FSFA 3MZDA 3ISGA 1JWPA 4KZ9A 2ZQ9A 1EROA 2Q9MA 5F83A 4OH0A 2QZ6A 3AGEA 2H0TA 2GDNA 1MPLA 1ES5A 4ZJ1A 3V50A 4K0XA 1ZC2A 1PI4A 3NY4A 1YLPA 1YLZA 4GOGA 3WS4A 1CI9A 1KVLA 2Y59A 4WEJA 4F94A 4XXRA 4NK3A 1W79A 4PM8A 5TR7A 2OLUA 5E2HA 3Q7VB 4JLFA 1GA0A 1W7FA 4QU3A 1WYBA 3MXRA 4U3TA 1FR6A 3N8RA 4MNRA 4E3KA 4EV4A 4XUZA 3NC8A 1PIOA 2XF3A 3BFDA 1K6SA 4RX2A 2Z2LB 2X71A 4BD1A 2Y91A 5G18A 4S2KA 1DY6A 5CGWA 4S2OA 3MZFA 3VP2A 3IXBA 1GHMA 2OSUA 2XH9A 3PTEA 3WRZA 5JYPA 3A3EA 2HDQA 2WGWA 3HLWA 1CEFA 4QY5A 3IWIA 1NRFA 5E2GA 3QHYA 2J9OA 1RGYA 4JF6A 3IHBA 4E3JA 1XGIA 3A3IA 4WZ5A 1XGJA 3IH9A 1IYQA 4UA9A 5FAQA 5CEDA 1ONGA 3ZCZA 3IHAA 3M6HA 4HBTA 4S2LA 4GDNA 2XR0A 1SHVA 2Y2GA 2ZC5B 3P98A 2ZLYA 2ZM0A 4H8RA 1EI5A 4LV0A 1E25A 2P74A 2Y2QA 5J8XA 4R4SA 3PBSA 3ITAA 1YT4A 2R9WA 2XGNA 5EVLA 1MWRA 1Z6FA 1NXYA 4LV1A 4R4RA 5CXWA 1K57A 2WYXA 1PWCA 1WE4A 5FAOA 3HBRA 2UWXA
chains in the Genus database with same CATH superfamily
4EEUA 5HX9A 1ES2A 4OOYA 5JYOA 4PM6A 3MR0A 3CUEC 1K56D 3IXHA 2ZL1A 3PBOA 3RTYA 3F1PA 4E04A 1RGZA 1K56A 1H8YA 4Y17A 4QJGA 4L9GA 2P08A 5DF9A 1MZUA 3K3CA 4OQ0A 4GZBA 4I38A 3FPWA 4LRYC 1M40A 5E43A 5CX7A 1YSPA 3PHYA 4L0LA 3LR4A 3ICYA 2PR6A 5IS1A 4GKUA 3M6BA 3W2ZA 1S66L 1L2SA 4OPZA 2W1RA 5EVIA 2J3WA 1KDSA 4LRZE 4HNBA 4WUJA 4ETZA 2QPNA 1VETB 4OP5A 2H5SA 1WYCA 3E4PA 1L0EA 1E4DA 4S2NC 2HDUA 3MMHA 1E3UD 4ID4A 3G35A 3BFGA 1SKFA 2Y2HA 4NKPA 1YM1A 4S2MA 3NULA 5FDHA 5EE8A 3HLBA 2X01A 5DKKA 2WGVA 1PWGA 1OPXA 3ZNYA 4PM9A 4EUZA 5FEGA 3O86A 5DFYA 3EEAA 4OKPA 5CHMA 5DF7A 3UNWA 3WS2A 3UB5P 3A0VA 4KZ7A 5F1GA 3E98A 3SW1A 1ZG6A 4QPRA 4LLOB 1K54A 3UB6A 4HP9A 4L9FA 3BY9A 2PYRA 4X6TA 3LY3A 5HWTA 1XA7A 1Y28A 1BT5A 1PI5A 2QWSA 4PKYA 4IBXA 4O7DA 3NOTC 4R3AA 2K2NA 3H7WA 2EWWA 1DJCA 4I3IA 4JGQA 3LEZA 2HV1A 3IS2B 5CTNA 1XJ2A 1BLHA 3PBNA 5CERA 1KOUA 2OOLA 4FOFA 1DJBA 2WKHA 4MLLA 1P0ZA 5FI6A 3D9YA 1N9LA 1MWSA 2ZQ7A 3KSIA 4KZ8A 3ZG7B 5L2FA 4H6JB 3C38A 4P87A 3L7HA 3Q1FA 1CF0A 3KYQA 5J3WA 3QP2A 3T4LA 1RP5A 4NXFA 3MJQA 1K55A 4JF5A 4Q0JA 3IWQA 4WEKA 3UY6A 4X25A 3MZEA 3T1XA 5F6AA 3SOIA 3EGXC 2INWA 2D01A 4GHIB 3N6IA 2VX8A 1MKIA 3VOZA 1FCMA 3V39A 4ZRRA 3T1RA 3GTCA 4KZ4A 3UE1A 3OZHA 2ZL1B 4FH4A 1PW8A 4LFUA 3BLSA 3FKWA 3ZG9B 3F1PB 4G3KA 4GB7A 3UDFA 1XKZA 3TRCA 3G30A 3LI9A 2D02A 4MBFA 4RVAA 3V5MA 3KSHA 3WS0A 3UO9A 1GSWA 2B95A 1JNUA 4Y15A 3IF6B 4E3OA 5G4ZA 1H5XA 3OOVA 5CEBA 4Q0IA 2J3TC 2NUTC 5HWWA 3HVFA 3OPPA 3NIAA 3G34A 5FQKA 1K0KA 1OJGA 3CJMA 4KZ5A 3IX4A 5AQ9A 4JF4A 2JKGA 4IEDA 1D7EA 1SKOB 4BMWA 4I3JA 2EX9A 2B02A 2MJ6A 2V1AA 2VV6A 1OT6A 4KZ3A 5HD5A 5KSCA 4DMZA 3AGDA 3FZCA 2H10A 4IHQA 4Z9QA 4RYEA 4DXBA 3CUEA 2BG1A 3Q7VA 2HDRA 4CLCE 1JTDA 1XPBA 3IF6C 1UWPX 2M1CA 4WF0A 5FQQA 2Z6CA 2JBFA 1O07A 1X0OA 4CLCA 3LIAA 3U2AA 1YMXA 4HY8A 2W27A 1TF1A 1UWNX 2Z6DA 2QKPA 2J7VA 4Q8IA 1ESIA 2KOIA 3OC2A 3FC7A 3F1NB 3LFVA 1YLWA 2H0YA 1I2SA 3NJAA 5L10A 4KENB 1K38A 5HAPA 4S2PA 1ZKJA 3Q07A 4LV3A 4KQRA 1VQQA 4S2NA 2V1ZA 5GLCA 3AGFA 2EX8A 4FSFA 3MZDA 2O99A 1JWPA 5F83A 4OH0A 2H0TA 2VGLM 1ES5A 1ZC2A 1KVLA 4WEJA 4II7A 4PM8A 4P6ZM 2OLUA 5TJJA 3N8RA 3MQ0A 4MNRA 4E3KA 4EV4A 3NC8A 2X71A 2Y91A 1DY6A 5CGWA 2XH9A 1P9RA 2QHKA 3HLWA 2J9OA 5EV0A 5FAQA 1FIKA 1ONGA 3IHAA 4GDNA 1SHVA 3P98A 1VETA 4LV0A 4WN5A 1A0KA 2Y2QA 4R4SA 5FL3A 3ITAA 4D60A 3ZQ5A 3T4SA 4R4RA 4K08A 1CQAA 2WKPA 3FWLA 5HZHA 3HBRA 2UWXA 3S22A 2ZM8A 3IXGA 3RJUA 1BLPA 4GCZA 1OTAA 3PYPA 4LENA 3VFFA 3IF5A 1CEGA 3M2JA 2XQZA 2ZOHA 3VOYA 2ZMFA 3UE3A 4WL9A 4Y3IA 4HH2A 3HREA 1CJFA 2Z2MB 2W3FA 5EVEA 3VFHA 1S1YA 4OQGA 4OPQA 2J8YA 5HL1A 5FAPA 5U47A 3NOUC 2LB9A 3S7PA 2RL3A 1MXOA 1ONHA 3NCKA 4OOLA 2DCFA 4R70A 4LPZA 4XT2B 4DE3A 4WBGA 2OV5A 1RCJA 1LSXA 5GLDA 2G2WA 1F98A 4ZJ2A 3LIFA 4RX3A 4X53A 3PAEA 3SS5A 3BEBA 1TS8A 4PM7A 3QNCA 1MWTA 3CAXA 4NETA 2AVXA 3G31A 2I9VA 3C4PA 3OLOA 2HP5A 2WUQA 2XLNA 3IS2A 3UDXA 2BASA 5M18A 4ZJ3A 3SH7A 4I5SA 4HJ6A 4Y7PA 1I5QA 2EXBA 4JXSA 2BLSA 3WRTA 2IWBA 3E2LA 1WA9A 3R7WA 4NG2A 4UEYA 1PNEA 3U4LP 2J9PA 4DDYA 5MC7A 2CMNA 2PBDP 3SH8A 4H6JA 3O3VA 5FQ9A 3LR3A 1F5MA 3E0YA 1FSYA 3FG8A 3OPLA 4R23A 3LO7A 2J3TD 4ETXA 2W3HA 2Y4AA 1S4RA 2WKEA 1C3BA 3EWKA 3LR5A 3OCLA 3LI8A 4UQIS 1PW1A 2HDSA 2DMWA 3JPUA 4GHIA 4BWIA 1OJ5A 5CGSA 1T19A 1IKGA 3A3DA 3EOIA 3VOLA 2JKTI 3ZDJA 2I72A 2Y2KA 4EETB 1NZOA 2DNSA 1K4FA 2K31A 3EQVA 2KLIA 3HJIA 4RA7A 1KE3A 5AVFA 2A49A 2XD5A 1NY0A 2ZMVA 3P09A 4JXVA 3OCNA 5FATA 5EUAA 3SZTA 1BLSA 2B18A 4HH3A 2GZAA 5KSHA 4IVKA 2JCHA 4HQAA 2HJEA 4QWOA 2WK0A 1MKMA 4QY6A 4HEFA 3IF6A 3W8KA 3I7JA 4HBUA 3PBRA 3SS4A 1Q2PA 3UN7A 3G32A 4BD0A 2ZC7A 3UB7A 4BL3A 1ZTUA 4DRTA 5G4YA 3IT9A 3PAGA 5BOHA 2P04A 3UMEA 1H0MA 1XFNA 1KDWA 1KGFA 1AXBA 1SKOA 1XJ3A 3NDEA 2XA7S 4OPRA 2P9VB 3NDGA 3UB9A 2HPBA 5GHYA 1E3UA 4KUKA 2QYBA 2JHEA 5GL9A 4EQ1A 3CMZA 4WM9A 4IUKA 2QJ5A 4KUOA 3TSGA 2QJ7A 5TFQA 1NJ4A 5CTMA 1LL8A 3GSGA 4KQOA 3PBTA 3T4OA 5FSRA 3V3SA 1IELA 1VM1A 1P9WA 1N9NA 3BLMA 1VHMA 1HTZA 1TS0A 3D4FA 2G2UA 2EA9A 1S6RA 3Q7ZA 2QMIA 3MQQA 4K0WA 1FQGA 3ITBA 4EESA 4XUXA 4DDSA 4WLAA 1W8YA 3P7NA 2WZZA 3HLDA 3ZFZA 1W63M 3Q81A 4OLGA 1ERMA 5KMWA 2ZBBA 3F1NA 3HLCA 4GLQA 5DVAA 2ZMAA 3O87A 1NYMA 3ZG0A 2A3UA 4LV2A 5FDSA 1ERQA 3R7WB 5HFOA 3VP4A 4GD6A 3B3XA 4HJ4A 1I2WA 3FYZA 1EW0A 2XFSA 4GDBA 3KSFA 1LI9A 2FFYA 1K4EA 2NUPC 5TGFA 1DP9A 3Q82A 1DJAA 4DE1A 2XRNA 1D06A 1ZHHB 1XJ4A 1CK3A 3F1OB 1IYSA 5GLAA 1NYYA 2Y2NA 3GV9A 3UB8A 3SH9A 1H8MA 3WS1A 4E6WA 5AQAA 3B42A 3L9KA 5HAIA 2IA2A 1JWVA 1BYWA 4YINA 3S7OA 2Y2JA 1IFQA 3CZDA 4U0XA 1HZOA 3DTMA 5A93A 2JE5A 2KX6A 5CRFA 2PD7A 3DW0A 5F82A 5M19A 1Y4OA 2HP9A 2WKRA 3V3RA 2V20A 4MN7A 2JKTM 2JKRI 3EGDC 4KZ9A 2ZQ9A 4JGRA 2QZ6A 3AGEA 2GDNA 4ZJ1A 3V50A 4K0XA 1UGUA 3B33A 1YLZA 1CI9A 2Y59A 4XXRA 4NK3A 4JGOA 4MMNA 4NXGA 5E2HA 2VK3A 1WYBA 3MXRA 3BFDA 4RX2A 2O0YA 3MXQA 5G18A 2W1TB 3IXBA 4XT2A 3A3EA 3K2NA 3IWIA 1NRFA 3QHYA 3B47A 1XGIA 1XGJA 3ZCZA 3CITA 3M6HA 3C8CA 3JVUA 2ZLYA 2ZM0A 3EEHA 1J3WA 3HJKA 3PBSA 4EUVA 5EVLA 1Z6FA 2LB5A 1NXYA 4LV1A 4ARZB 2WYXA 5FAOA 1PWCA 4B88A 1PFLA 4Y13A 1V9YA 2ZD8A 4Q0HA 3GMWA 4ZBEA 4MBKA 4LRXC 4LCLA 4OONA 3NHQA 3QP4A 3W4QA 1MC0A 4BL2A 4E3IA 3H82B 3C4OA 2GJ3A 1TEMA 4F3LB 3TOIA 5A92A 2V1BA 1XA1A 1XFQA 4N92A 2VGKA 4R6LA 4EXOA 1LSWA 4R1GA 4LCMA 3ZGAB 3LCEA 2O9BA 3A0RA 3RFBA 4DXCA 3MSHA 1LSVA 5FQJA 3MBZA 2PBYA 2WGWB 3FPVA 4FTXA 5HWVA 5DFXA 5EVIC 3IXDA 5FEFA 1IEMA 1L0FA 3HLGA 3OPRA 5FI2A 4X55A 1Y54A 4ME4A 2V8CA 3LICA 5CGXA 2W3EA 1TS6A 1TDLA 1N9OA 2A24B 2HP6A 1L0GA 3BQAA 2UV0E 1XJ6A 4HESA 1IKIA 1OT9A 1DP6A 4E6XA 2W3DA 2Y2OA 3BJNA 4UA7A 2WGIA 4IVIA 3K3DA 1YLJA 4WYYA 2OWJA 1NLZA 2PRFA 4X56A 4L9EA 4FCFA 4Y0TA 3OPHA 1YLYA 2BTFP 3E4OA 2OAP1 2RCXA 4O0PA 3FKVA 4C75A 4QD4A 3GDIA 4M4XA 1KVMA 3TE8A 4EU0A 4EERA 2W0NA 3WS5A 4WZ5C 1FSWA 4OQIA 4DF6A 2Y2MA 3JYIA 1K54C 3M2KA 4GNUA 4BBTA 2L1MA 1GSVA 5CHUA 3N4IA 4C6YA 3HUNA 1F9IA 1PZPA 1O7EA 4KG6A 1G5UA 2DRWA 5F5YA 2A2LA 2PU4A 4YOFA 5D3OA 2P9VA 4IBRA 4EW7A 5FQMA 2Q9NA 2FFFB 2JC7A 5K5BA 3VMAA 2V0UA 4BLMA 1PZOA 2Y2IA 4NXEA 1HLUP 5FI7A 2C6WB 3IQAA 1ESUA 3UDIA 3G2YA 1KGEA 4JXGA 3T1SA 5EM0A 3HUOA 2JKRM 1CI8A 1JWZA 2HF6A 1G6OA 4GS9B 1IYOA 2H28A 1MWUA 2HGVA 3LUQA 5DTTA 3N7WA 5HL6A 5L8MA 4GW9A 2W3GA 1S0WA 3VP1A 3IX8A 4R0QA 3ZNTA 5IT5A 4G3VA 5DJUA 3DTEA 5DF8A 4EBPA 2ZC3B 4AFIA 3QP6A 4YWZA 1P97A 5HDDA 4P6BA 5J4EA 5AQ7A 4OP8A 4CJNA 4IUHA 1YSQA 4KZ6A 1LI0A 4NEED 4DE2A 1PWDA 2Q0OA 1KE0A 2VV7A 4B9OA 3PBQA 2XROA 5HPFA 2XEPA 2R9XA 3SS3A 2V0WA 3T4KA 4R3BA 2WZXA 4E3MA 4ZAMA 5FQIA 2EWVA 2VGJA 1JTGA 1K6RA 3F1OA 3NBLA 4YNRA 5IHVA 3GECA 1TVFA 4WZ4A 1SZVA 3JVVA 3QNBA 3LIDA 3HLFA 3DWKA 1BZAA 3MQOA 2XDMA 5A91A 2VKSA 3ZHHA 3LY4A 2ZC4B 4BENA 3T12B 2Y2LA 1F2KA 4KG5A 3LIEA 1FOFA 4EQIA 5EECA 4B4XA 2XK1A 2O9CA 3UPPA 4E3NA 5HDCA 1VB6A 2WAEA 3G6OA 4X69A 3KO6A 4CLCC 2XD1A 5HW3A 2IWDA 1LL5A 4UAAA 3BY8A 2W1TA 1T1BA 1VEUB 3E2KA 1LT0A 3IWOA 1S4SA 2EX6A 2PD8A 2ZQ8A 4B4ZA 4ESPA 2Y79A 1ODVA 5EVID 4K91A 4C3QA 3KX0X 3QP1A 2ACGA 4FD8A 3DBAA 1DRMA 2CC1A 1BTLA 4QB8A 4ARZA 3UE0A 3S7QA 1GCEA 4QHCA 2B5RA 4N1HA 3GR2A 3TJZC 4R3JA 1D1JA 3C2WA 5F68A 1MPLA 4GOGA 3H82A 4F3LA 1W79A 2V9AA 3LEQA 5TR7A 4JLFA 1GA0A 1W7FA 4QU3A 3D72A 4Y2FA 1PIOA 3MS6A 2Z2LB 4BD1A 4S2OA 3MZFA 4X1LA 3D3OA 2HDQA 2WGWA 4QY5A 5TBMB 5E2GA 4E3JA 4WZ5A 3A3IA 3IH9A 4UA9A 2J80A 4NXBA 2VGLS 4S2LA 3V67A 5J7EA 4HIAA 3QP5A 4EEPA 3NOPC 2XGNA 4P6ZS 3PR6A 2A24A 1MWRA 2ZM2A 2WKIA 3LYXA 1DP8A 2EXAA 1PYYA 3RXXA 5EM1A 2V2FF 3KSGA 5F1FA 3BFFA 1L0DA 2E8IA 1SDNA 3KYZA 4MN6A 5CHJA 2ZQAA 4FH2A 1YLTA 3C5AA 4DN0A 5E2EA 3UPOA 1K25A 3QP8A 4B93A 5A8BA 2VA0A 3BFCA 4MN5A 1QMFA 4OPYA 3IX3A 5GHXA 1OTEA 5FASA 3CPTB 1T1CA 2P7JA 1KGGA 2L0WA 5AQBA 1N4OA 3PXPA 3VSKA 3ZG5A 3HL9A 3T4QA 4PPRA 3TG9A 3DTIA 3HLEA 1SCWA 3EQUA 3MF0A 2YKHA 2VLGA 3IBRA 3P01A 4PAUA 1HD8A 1L3LA 3UPNA 4E3LA 1H3QA 4M3KA 2PR5A 4KZAA 4LGWA 1YQSA 4I3AA 4MEZA 5KIZA 4OVDA 1BLCA 5L07A 4KZBA 5F69A 4UA6A 4S2JA 2ZC6B 4X68A 1G6AA 4OQHA 5HD3A 1FILA 1OTIA 2M7UA 5DTKA 5EOOA 5IU1A 4GS9A 3TW8A 4UQIM 1LLBA 5EOEA 3CHWP 1IOUA 2Y2PA 3IBJA 5AJGA 3BW6A 4BQMA 1GHIA 1NRJA 3A3FA 1NLYA 1FR1A 4Z1WA 5GLBA 4KQQA 1YMSA 5FA7A 4O01A 4HI4A 2G7UA 4S2IA 1IYPA 1FCOA 4CPKA 4GD8A 1BSGA 3HCYA 5EVIB 1K57C 4MCWA 3FV7A 5HAQA 2ZJ9A 5M1AA 4PMAA 2XFTA 3CG5A 4DKIA 2EX2A 3ZYTA 3MKFA 4WMCD 4GN2A 4U0TA 3H9WA 2X02A 2V8FA 1TD5A 4MDZA 3MFDA 4DJ3A 4PM5A 1AWIA 1S1ZA 2VZWA 1G28A 3N8LA 5HPIA 4WMCA 1EWZA 5I94A 2PDRA 4OOMA 3C7UA 3LIBA 5EFWA 3GQZA 3DTKA 4HHDA 3ZVTA 4BBUA 3ZG8B 1T1AA 3W4OA 2XA7M 3N8SA 4G3WA 2Y8HA 4N1XA 4CLCD 4BJPA 2GNXA 3C7VA 5CECA 3O88A 3GRJA 2OLVA 1U60A 2IWCA 3CWFA 3MFXA 1H8ZA 5KZHA 3BYDA 5HARA 2WADA 3BECA 1MBLA 1W8QA 3A0SA 3BRMA 4EBLA 4ZDXA 3ZVWA 3H7WB 1GHPA 1GA9A 5I5LA 1SDEA 1ZG4A 3O5YA 1W5DA 4D2OA 2GX5A 1G68A 5DJTA 4X1MA 2R78A 3DWZA 3LGOA 3WWXA 1QMEA 3S7NA 3S1YA 4DE0A 4P0MA 3NI9A 2FZ0A 1GSXA 3UMDA 1KE4A 2HJ9C 2O9AA 3G2ZA 3RH8B 2PU2A 1W63Q 2PAVP 1YKDA 1ALQA 1Z09A 2WAFA 4YFMA 2ZQCA 4RQ9A 1VEUA 3T50A 2OWHA 3VSLA 5A90A 1PRQA 4I39A 1N9BA 4CQHA 5E2FA 3IH8A 1V9ZA 3VE4A 4A5RA 4JBFA 1T18A 4JXWA 3CI6A 2K7SA 2WKQA 3VV4A 5L09A 2EFUA 4ZTKA 5LBRA 2C5WB 2PT7A 2ZQDA 3NECA 4JPMA 1ES3A 4N9KA 4R38A 2ZOIA 4EWFA 4P85A 4GJ4A 1J9MA 3R4KA 1NWZA 1TDGA 3HUMA 1OMEA 4EBNA 1HVBA 2JKFA 3S4XA 1FCNA 1XXMA 1NZUA 3LR0A 3A3JA 3VP3A 4OLDA 1YPRA 4JKTA 4Y0OA 3W4PA 2VJWA 1K55C 1STZA 3T4JA 4Y5FA 5C5KA 3BM6A 2HZ5A 1LHYA 1XX2A 3VE3A 4KG2A 3BFEA 4UHUA 4PHTA 3OBFA 3BQ8A 3MKEA 3VP0A 5TBMA 2PHYA 3RXWA 2E8JA 1ES4A 5HSQA 4WELA 1ACFA 3MXSA 1M6KA 4FUWA 4Y0UA 1MY8A 5GHZA 3DAVA 3UE6A 4N9LA 5DKLA 5HDSA 5EPHA 5DTSA 4PKYG 4MBHA 1LL9A 3GVBA 1OTBA 1BUEA 3G4PA 1XP4A 3T4TA 2EFXA 1Q2QA 1JVJA 1BULA 2JN7A 2KDKA 2Y55A 4HOIA 4KQDA 2OAQ1 2XSSA 2L4RA 3BWLA 3ISGA 4DJ2A 1EROA 2Q9MA 3ULFA 3NY4A 1PI4A 1YAXA 1YLPA 4HP4A 3KYEA 3WS4A 2YKFA 3T1QB 4F94A 1OTDA 4JGPA 3Q7VB 4U3TA 1FR6A 3CPTA 3E4QA 4XUZA 2VV8A 2XF3A 1K6SA 3CLOA 4S2KA 1TS7A 4CLCB 2VEAA 3VP2A 3WRZA 1GHMA 2FH5A 2OSUA 3PTEA 5JYPA 4BBVA 1CEFA 3C30A 4JF6A 1RGYA 3IHBA 4O8GA 1S67L 5CEDA 1IYQA 4HBTA 2XR0A 2Y2GA 2ZC5B 4H8RA 1EI5A 5AVEA 1E25A 2P74A 5J8XA 4HJ3A 1YT4A 2R9WA 2PYPA 5CXWA 1K57A 1WE4A 4IJGA 2M7VA
chains in the Genus database with same CATH topology
2ZM2A 2ZM8A 3IXGA 2WKIA 3RJUA 1BLPA 2EXAA 5HX9A 1PYYA 3RXXA 4LENA 3VFFA 2ZD8A 1CEGA 3IF5A 2V2FF 3GMWA 4ZBEA 3M2JA 4MBKA 5F1FA 2XQZA 1ES2A 1L0DA 3BFFA 4OOYA 2E8IA 1SDNA 5JYOA 4LCLA 4OONA 4PM6A 3VOYA 1K56D 3UE3A 5CHJA 3IXHA 2ZQAA 4FH2A 3W4QA 1YLTA 3C5AA 3HREA 3PBOA 5E2EA 4BL2A 3UPOA 1K25A 2Z2MB 4E3IA 3C4OA 3VFHA 1TEMA 1RGZA 1K56A 4OQGA 4OPQA 3BFCA 1H8YA 3TOIA 5A92A 2J8YA 4QJGA 1QMFA 1XA1A 4N92A 4OPYA 5DF9A 2VGKA 5HL1A 5FAPA 5U47A 4OQ0A 4GZBA 5GHXA 5FASA 2RL3A 4R1GA 4LCMA 1M40A 1KGGA 1MXOA 1ONHA 5E43A 3ZGAB 3LCEA 4DXCA 3NCKA 4OOLA 2DCFA 5FQJA 4DE3A 5AQBA 1N4OA 4WBGA 3MBZA 2PBYA 2WGWB 2OV5A 1RCJA 3VSKA 3ZG5A 5GLDA 4L0LA 3HL9A 2G2WA 4ZJ2A 4PPRA 3TG9A 5EVIC 4GKUA 3IXDA 3M6BA 3HLEA 4RX3A 1IEMA 1SCWA 3EQUA 1L2SA 1L0FA 4OPZA 5EVIA 1KDSA 4X53A 3PAEA 3HLGA 3SS5A 3BEBA 3OPRA 5FI2A 4X55A 4PM7A 3QNCA 1Y54A 1HD8A 2QPNA 4OP5A 1MWTA 2H5SA 4NETA 1WYCA 5CGXA 3UPNA 1L0EA 4E3LA 3G31A 1E4DA 4M3KA 3C4PA 4S2NC 1TDLA 2HP6A 4KZAA 1L0GA 2HP5A 2HDUA 4HESA 1YQSA 1IKIA 2WUQA 1E3UD 4ID4A 3G35A 2XLNA 4MEZA 4E6XA 3BFGA 1SKFA 2Y2HA 3UDXA 1YM1A 2Y2OA 4S2MA 4OVDA 4UA7A 5M18A 2WGIA 4ZJ3A 4IVIA 1BLCA 3SH7A 5FDHA 4KZBA 5EE8A 3HLBA 4UA6A 2X01A 4Y7PA 2WGVA 4S2JA 2ZC6B 1YLJA 4X68A 1I5QA 2EXBA 1PWGA 4WYYA 1G6AA 4OQHA 4JXSA 2BLSA 4X56A 3WRTA 2IWBA 3E2LA 4FCFA 3ZNYA 5DTKA 5EOOA 4Y0TA 4PM9A 3OPHA 4EUZA 1YLYA 3O86A 2J9PA 4DDYA 2RCXA 1LLBA 4OKPA 5EOEA 3FKVA 5CHMA 5DF7A 3SH8A 3UNWA 4C75A 4QD4A 3WS2A 2Y2PA 1KVMA 3O3VA 5FQ9A 1GHIA 4BQMA 3A3FA 4KZ7A 5F1GA 3WS5A 1FR1A 4WZ5C 5GLBA 4KQQA 1FSWA 4OQIA 1ZG6A 1YMSA 1FSYA 2Y2MA 4DF6A 5FA7A 3JYIA 3OPLA 1K54C 4R23A 3M2KA 4GNUA 3LO7A 4S2IA 1IYPA 1K54A 1FCOA 4CPKA 5CHUA 2Y4AA 3N4IA 4GD8A 1BSGA 2WKEA 4C6YA 3HUNA 1C3BA 5EVIB 4X6TA 3LY3A 1PZPA 1O7EA 4KG6A 1K57C 1XA7A 1BT5A 1PI5A 3OCLA 3FV7A 2DRWA 5HAQA 2ZJ9A 4IBXA 1PW1A 4O7DA 5M1AA 4PMAA 2PU4A 2HDSA 2XFTA 5D3OA 3CG5A 2P9VA 4IBRA 4DKIA 5CGSA 2EX2A 5FQMA 2Q9NA 3MKFA 1IKGA 2FFFB 1DJCA 4WMCD 4GN2A 4U0TA 3LEZA 2JC7A 2X02A 5CTNA 3A3DA 3VMAA 4PM5A 3MFDA 1PZOA 2Y2IA 5FI7A 4BLMA 2C6WB 1BLHA 3N8LA 3PBNA 3ZDJA 4WMCA 2I72A 3IQAA 2Y2KA 1ESUA 1EWZA 5CERA 3G2YA 1KGEA 4JXGA 3UDIA 5I94A 1NZOA 1DJBA 3HUOA 2WKHA 4OOMA 1CI8A 2DNSA 3C7UA 1JWZA 1K4FA 3GQZA 4MLLA 1IYOA 3EQVA 4RA7A 1MWUA 3ZVTA 1KE3A 5FI6A 2A49A 2XD5A 1NY0A 3P09A 5FATA 4JXVA 3OCNA 1MWSA 3N7WA 5DTTA 3ZG8B 5EUAA 3W4OA 1BLSA 2ZQ7A 4KZ8A 3ZG7B 5L2FA 5KSHA 3N8SA 4P87A 3Q1FA 4IVKA 1S0WA 2JCHA 3VP1A 2WK0A 4N1XA 4R0QA 4QY6A 1RP5A 3ZNTA 4BJPA 3C7VA 3IF6A 4HEFA 5CECA 3O88A 3GRJA 5DF8A 4EBPA 2OLVA 1K55A 4JF5A 3W8KA 2ZC3B 3I7JA 1U60A 3IWQA 3PBRA 2IWCA 1Q2PA 4HBUA 3SS4A 4WEKA 3UY6A 3UN7A 3G32A 3MZEA 4BD0A 2ZC7A 4BL3A 1H8ZA 4DRTA 4P6BA 3IT9A 3PAGA 5AQ7A 5KZHA 5BOHA 3BYDA 4OP8A 5HARA 2WADA 4CJNA 3BECA 1MBLA 1KDWA 1KGFA 1W8QA 3BRMA 1AXBA 3SOIA 4EBLA 4ZDXA 3NDEA 3ZVWA 4KZ6A 2P9VB 4OPRA 3N6IA 1GHPA 1GA9A 1MKIA 3NDGA 3VOZA 1FCMA 3V39A 2HPBA 1LI0A 5GHYA 3GTCA 1E3UA 1SDEA 1PWDA 1ZG4A 4DE2A 4KZ4A 3UE1A 1W5DA 1KE0A 3FWLA 3OZHA 4D2OA 5GL9A 3CMZA 4WM9A 4FH4A 1G68A 1PW8A 3TSGA 3PBQA 3BLSA 3FKWA 3ZG9B 5TFQA 1NJ4A 3DWZA 4GB7A 5CTMA 3UDFA 3WWXA 3GSGA 4KQOA 1XKZA 2XEPA 3PBTA 4B88A 3G30A 5FSRA 1QMEA 3V3SA 4MBFA 4RVAA 2R9XA 3S1YA 4DE0A 4P0MA 3V5MA 3NI9A 3WS0A 1KE4A 1IELA 3SS3A 1VM1A 4R3BA 3UO9A 3BLMA 3G2ZA 2WZXA 4E3MA 2PU2A 1HTZA 4ZAMA 5FQIA 1ALQA 2VGJA 1JTGA 2WAFA 2ZQCA 3IF6B 4YFMA 3D4FA 1K6RA 2G2UA 4E3OA 1H5XA 3NBLA 5A90A 3VSLA 5CEBA 1S6RA 3Q7ZA 5IHVA 2QMIA 1N9BA 1TVFA 4K0WA 1FQGA 4WZ4A 3HVFA 3OPPA 3ITBA 3NIAA 5E2FA 3IH8A 3G34A 5FQKA 3CJMA 4XUXA 3QNBA 4DDSA 4A5RA 4KZ5A 4JBFA 1W8YA 3HLFA 4JXWA 3DWKA 2WZZA 3HLDA 5AQ9A 1BZAA 4JF4A 3ZFZA 4IEDA 2EFUA 3Q81A 4OLGA 1ERMA 5KMWA 4ZTKA 3HLCA 2C5WB 2XDMA 5DVAA 5A91A 2ZMAA 2EX9A 2ZQDA 4JPMA 1ES3A 3O87A 3ZHHA 4N9KA 1NYMA 3ZG0A 3LY4A 2ZC4B 5KSCA 2A3UA 4KZ3A 4LV2A 4BENA 1ERQA 4EWFA 3AGDA 4P85A 5HFOA 3VP4A 3FZCA 2Y2LA 1J9MA 3B3XA 4GD6A 2H10A 1I2WA 4KG5A 3FYZA 4Z9QA 1TDGA 3HUMA 2XFSA 1OMEA 4GDBA 4EBNA 1HVBA 4RYEA 3S4XA 1LI9A 2FFYA 1FCNA 1K4EA 5TGFA 1FOFA 1XXMA 4EQIA 1NZUA 5EECA 4DXBA 4B4XA 2XK1A 3A3JA 3UPPA 3VP3A 3Q82A 1DJAA 2BG1A 4OLDA 3Q7VA 2HDRA 1JTDA 1XPBA 3IF6C 4E3NA 4JKTA 2WAEA 4Y0OA 3W4PA 4DE1A 1K55C 4X69A 5FQQA 3BM6A 2XD1A 2JBFA 1LHYA 1O07A 1XX2A 2IWDA 5HW3A 1LL5A 4UAAA 4KG2A 3BFEA 4UHUA 3E2KA 1CK3A 3IWOA 1IYSA 3MKEA 2EX6A 3VP0A 1YMXA 5GLAA 1NYYA 2ZQ8A 3RXWA 1ES4A 3S22A 2Y2NA 4B4ZA 4WELA 3GV9A 3MXSA 1M6KA 5EVID 3SH9A 4Y0UA 4K91A 1MY8A 4C3QA 3WS1A 4E6WA 5AQAA 5GHZA 2J7VA 4Q8IA 4N9LA 5HAIA 1ESIA 3OC2A 4FD8A 1JWVA 2CC1A 5EPHA 5DTSA 4MBHA 1BTLA 1YLWA 4YINA 1LL9A 2H0YA 2Y2JA 1I2SA 3CZDA 4QB8A 4U0XA 1HZOA 3GVBA 3DTMA 4KENB 5A93A 1BUEA 2JE5A 1K38A 5HAPA 3UE0A 4S2PA 1ZKJA 3G4PA 1GCEA 1XP4A 5CRFA 2EFXA 3Q07A 1Q2QA 1JVJA 4QHCA 1BULA 2B5RA 4LV3A 4KQRA 3DW0A 1VQQA 2Y55A 5F82A 4N1HA 5M19A 2HP9A 4S2NA 2V1ZA 3V3RA 5GLCA 3GR2A 2V20A 4R3JA 3AGFA 2EX8A 4FSFA 3MZDA 3ISGA 1JWPA 4KZ9A 2ZQ9A 1EROA 2Q9MA 5F83A 4OH0A 2QZ6A 3AGEA 2H0TA 2GDNA 1MPLA 1ES5A 4ZJ1A 3V50A 4K0XA 1ZC2A 1PI4A 3NY4A 1YLPA 1YLZA 4GOGA 3WS4A 1CI9A 1KVLA 2Y59A 4WEJA 4F94A 4XXRA 4NK3A 1W79A 4PM8A 5TR7A 2OLUA 5E2HA 3Q7VB 4JLFA 1GA0A 1W7FA 4QU3A 1WYBA 3MXRA 4U3TA 1FR6A 3N8RA 4MNRA 4E3KA 4EV4A 4XUZA 3NC8A 1PIOA 2XF3A 3BFDA 1K6SA 4RX2A 2Z2LB 2X71A 4BD1A 2Y91A 5G18A 4S2KA 1DY6A 5CGWA 4S2OA 3MZFA 3VP2A 3IXBA 1GHMA 2OSUA 2XH9A 3PTEA 3WRZA 5JYPA 3A3EA 2HDQA 2WGWA 3HLWA 1CEFA 4QY5A 3IWIA 1NRFA 5E2GA 3QHYA 2J9OA 1RGYA 4JF6A 3IHBA 4E3JA 1XGIA 3A3IA 4WZ5A 1XGJA 3IH9A 1IYQA 4UA9A 5FAQA 5CEDA 1ONGA 3ZCZA 3IHAA 3M6HA 4HBTA 4S2LA 4GDNA 2XR0A 1SHVA 2Y2GA 2ZC5B 3P98A 2ZLYA 2ZM0A 4H8RA 1EI5A 4LV0A 1E25A 2P74A 2Y2QA 5J8XA 4R4SA 3PBSA 3ITAA 1YT4A 2R9WA 2XGNA 5EVLA 1MWRA 1Z6FA 1NXYA 4LV1A 4R4RA 5CXWA 1K57A 2WYXA 1PWCA 1WE4A 5FAOA 3HBRA 2UWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM2 A;  2ZM8 A;  3IXG A;  2WKI A;  3RJU A;  1BLP A;  2EXA A;  5HX9 A;  1PYY A;  3RXX A;  4LEN A;  3VFF A;  2ZD8 A;  1CEG A;  3IF5 A;  2V2F F;  3GMW A;  4ZBE A;  3M2J A;  4MBK A;  5F1F A;  2XQZ A;  1ES2 A;  1L0D A;  3BFF A;  4OOY A;  2E8I A;  1SDN A;  5JYO A;  4LCL A;  4OON A;  4PM6 A;  3VOY A;  1K56 D;  3UE3 A;  5CHJ A;  3IXH A;  2ZQA A;  4FH2 A;  3W4Q A;  1YLT A;  3C5A A;  3HRE A;  3PBO A;  5E2E A;  4BL2 A;  3UPO A;  1K25 A;  2Z2M B;  4E3I A;  3C4O A;  3VFH A;  1TEM A;  1RGZ A;  1K56 A;  4OQG A;  4OPQ A;  3BFC A;  1H8Y A;  3TOI A;  5A92 A;  2J8Y A;  4QJG A;  1QMF A;  1XA1 A;  4N92 A;  4OPY A;  5DF9 A;  2VGK A;  5HL1 A;  5FAP A;  5U47 A;  4OQ0 A;  4GZB A;  5GHX A;  5FAS A;  2RL3 A;  4R1G A;  4LCM A;  1M40 A;  1KGG A;  1MXO A;  1ONH A;  5E43 A;  3ZGA B;  3LCE A;  4DXC A;  3NCK A;  4OOL A;  2DCF A;  5FQJ A;  4DE3 A;  5AQB A;  1N4O A;  4WBG A;  3MBZ A;  2PBY A;  2WGW B;  2OV5 A;  1RCJ A;  3VSK A;  3ZG5 A;  5GLD A;  4L0L A;  3HL9 A;  2G2W A;  4ZJ2 A;  4PPR A;  3TG9 A;  5EVI C;  4GKU A;  3IXD A;  3M6B A;  3HLE A;  4RX3 A;  1IEM A;  1SCW A;  3EQU A;  1L2S A;  1L0F A;  4OPZ A;  5EVI A;  1KDS A;  4X53 A;  3PAE A;  3HLG A;  3SS5 A;  3BEB A;  3OPR A;  5FI2 A;  4X55 A;  4PM7 A;  3QNC A;  1Y54 A;  1HD8 A;  2QPN A;  4OP5 A;  1MWT A;  2H5S A;  4NET A;  1WYC A;  5CGX A;  3UPN A;  1L0E A;  4E3L A;  3G31 A;  1E4D A;  4M3K A;  3C4P A;  4S2N C;  1TDL A;  2HP6 A;  4KZA A;  1L0G A;  2HP5 A;  2HDU A;  4HES A;  1YQS A;  1IKI A;  2WUQ A;  1E3U D;  4ID4 A;  3G35 A;  2XLN A;  4MEZ A;  4E6X A;  3BFG A;  1SKF A;  2Y2H A;  3UDX A;  1YM1 A;  2Y2O A;  4S2M A;  4OVD A;  4UA7 A;  5M18 A;  2WGI A;  4ZJ3 A;  4IVI A;  1BLC A;  3SH7 A;  5FDH A;  4KZB A;  5EE8 A;  3HLB A;  4UA6 A;  2X01 A;  4Y7P A;  2WGV A;  4S2J A;  2ZC6 B;  1YLJ A;  4X68 A;  1I5Q A;  2EXB A;  1PWG A;  4WYY A;  1G6A A;  4OQH A;  4JXS A;  2BLS A;  4X56 A;  3WRT A;  2IWB A;  3E2L A;  4FCF A;  3ZNY A;  5DTK A;  5EOO A;  4Y0T A;  4PM9 A;  3OPH A;  4EUZ A;  1YLY A;  3O86 A;  2J9P A;  4DDY A;  2RCX A;  1LLB A;  4OKP A;  5EOE A;  3FKV A;  5CHM A;  5DF7 A;  3SH8 A;  3UNW A;  4C75 A;  4QD4 A;  3WS2 A;  2Y2P A;  1KVM A;  3O3V A;  5FQ9 A;  1GHI A;  4BQM A;  3A3F A;  4KZ7 A;  5F1G A;  3WS5 A;  1FR1 A;  4WZ5 C;  5GLB A;  4KQQ A;  1FSW A;  4OQI A;  1ZG6 A;  1YMS A;  1FSY A;  2Y2M A;  4DF6 A;  5FA7 A;  3JYI A;  3OPL A;  1K54 C;  4R23 A;  3M2K A;  4GNU A;  3LO7 A;  4S2I A;  1IYP A;  1K54 A;  1FCO A;  4CPK A;  5CHU A;  2Y4A A;  3N4I A;  4GD8 A;  1BSG A;  2WKE A;  4C6Y A;  3HUN A;  1C3B A;  5EVI B;  4X6T A;  3LY3 A;  1PZP A;  1O7E A;  4KG6 A;  1K57 C;  1XA7 A;  1BT5 A;  1PI5 A;  3OCL A;  3FV7 A;  2DRW A;  5HAQ A;  2ZJ9 A;  4IBX A;  1PW1 A;  4O7D A;  5M1A A;  4PMA A;  2PU4 A;  2HDS A;  2XFT A;  5D3O A;  3CG5 A;  2P9V A;  4IBR A;  4DKI A;  5CGS A;  2EX2 A;  5FQM A;  2Q9N A;  3MKF A;  1IKG A;  2FFF B;  1DJC A;  4WMC D;  4GN2 A;  4U0T A;  3LEZ A;  2JC7 A;  2X02 A;  5CTN A;  3A3D A;  3VMA A;  4PM5 A;  3MFD A;  1PZO A;  2Y2I A;  5FI7 A;  4BLM A;  2C6W B;  1BLH A;  3N8L A;  3PBN A;  3ZDJ A;  4WMC A;  2I72 A;  3IQA A;  2Y2K A;  1ESU A;  1EWZ A;  5CER A;  3G2Y A;  1KGE A;  4JXG A;  3UDI A;  5I94 A;  1NZO A;  1DJB A;  3HUO A;  2WKH A;  4OOM A;  1CI8 A;  2DNS A;  3C7U A;  1JWZ A;  1K4F A;  3GQZ A;  4MLL A;  1IYO A;  3EQV A;  4RA7 A;  1MWU A;  3ZVT A;  1KE3 A;  5FI6 A;  2A49 A;  2XD5 A;  1NY0 A;  3P09 A;  5FAT A;  4JXV A;  3OCN A;  1MWS A;  3N7W A;  5DTT A;  3ZG8 B;  5EUA A;  3W4O A;  1BLS A;  2ZQ7 A;  4KZ8 A;  3ZG7 B;  5L2F A;  5KSH A;  3N8S A;  4P87 A;  3Q1F A;  4IVK A;  1S0W A;  2JCH A;  3VP1 A;  2WK0 A;  4N1X A;  4R0Q A;  4QY6 A;  1RP5 A;  3ZNT A;  4BJP A;  3C7V A;  3IF6 A;  4HEF A;  5CEC A;  3O88 A;  3GRJ A;  5DF8 A;  4EBP A;  2OLV A;  1K55 A;  4JF5 A;  3W8K A;  2ZC3 B;  3I7J A;  1U60 A;  3IWQ A;  3PBR A;  2IWC A;  1Q2P A;  4HBU A;  3SS4 A;  4WEK A;  3UY6 A;  3UN7 A;  3G32 A;  3MZE A;  4BD0 A;  2ZC7 A;  4BL3 A;  1H8Z A;  4DRT A;  4P6B A;  3IT9 A;  3PAG A;  5AQ7 A;  5KZH A;  5BOH A;  3BYD A;  4OP8 A;  5HAR A;  2WAD A;  4CJN A;  3BEC A;  1MBL A;  1KDW A;  1KGF A;  1W8Q A;  3BRM A;  1AXB A;  3SOI A;  4EBL A;  4ZDX A;  3NDE A;  3ZVW A;  4KZ6 A;  2P9V B;  4OPR A;  3N6I A;  1GHP A;  1GA9 A;  1MKI A;  3NDG A;  3VOZ A;  1FCM A;  3V39 A;  2HPB A;  1LI0 A;  5GHY A;  3GTC A;  1E3U A;  1SDE A;  1PWD A;  1ZG4 A;  4DE2 A;  4KZ4 A;  3UE1 A;  1W5D A;  1KE0 A;  3FWL A;  3OZH A;  4D2O A;  5GL9 A;  3CMZ A;  4WM9 A;  4FH4 A;  1G68 A;  1PW8 A;  3TSG A;  3PBQ A;  3BLS A;  3FKW A;  3ZG9 B;  5TFQ A;  1NJ4 A;  3DWZ A;  4GB7 A;  5CTM A;  3UDF A;  3WWX A;  3GSG A;  4KQO A;  1XKZ A;  2XEP A;  3PBT A;  4B88 A;  3G30 A;  5FSR A;  1QME A;  3V3S A;  4MBF A;  4RVA A;  2R9X A;  3S1Y A;  4DE0 A;  4P0M A;  3V5M A;  3NI9 A;  3WS0 A;  1KE4 A;  1IEL A;  3SS3 A;  1VM1 A;  4R3B A;  3UO9 A;  3BLM A;  3G2Z A;  2WZX A;  4E3M A;  2PU2 A;  1HTZ A;  4ZAM A;  5FQI A;  1ALQ A;  2VGJ A;  1JTG A;  2WAF A;  2ZQC A;  3IF6 B;  4YFM A;  3D4F A;  1K6R A;  2G2U A;  4E3O A;  1H5X A;  3NBL A;  5A90 A;  3VSL A;  5CEB A;  1S6R A;  3Q7Z A;  5IHV A;  2QMI A;  1N9B A;  1TVF A;  4K0W A;  1FQG A;  4WZ4 A;  3HVF A;  3OPP A;  3ITB A;  3NIA A;  5E2F A;  3IH8 A;  3G34 A;  5FQK A;  3CJM A;  4XUX A;  3QNB A;  4DDS A;  4A5R A;  4KZ5 A;  4JBF A;  1W8Y A;  3HLF A;  4JXW A;  3DWK A;  2WZZ A;  3HLD A;  5AQ9 A;  1BZA A;  4JF4 A;  3ZFZ A;  4IED A;  2EFU A;  3Q81 A;  4OLG A;  1ERM A;  5KMW A;  4ZTK A;  3HLC A;  2C5W B;  2XDM A;  5DVA A;  5A91 A;  2ZMA A;  2EX9 A;  2ZQD A;  4JPM A;  1ES3 A;  3O87 A;  3ZHH A;  4N9K A;  1NYM A;  3ZG0 A;  3LY4 A;  2ZC4 B;  5KSC A;  2A3U A;  4KZ3 A;  4LV2 A;  4BEN A;  1ERQ A;  4EWF A;  3AGD A;  4P85 A;  5HFO A;  3VP4 A;  3FZC A;  2Y2L A;  1J9M A;  3B3X A;  4GD6 A;  2H10 A;  1I2W A;  4KG5 A;  3FYZ A;  4Z9Q A;  1TDG A;  3HUM A;  2XFS A;  1OME A;  4GDB A;  4EBN A;  1HVB A;  4RYE A;  3S4X A;  1LI9 A;  2FFY A;  1FCN A;  1K4E A;  5TGF A;  1FOF A;  1XXM A;  4EQI A;  1NZU A;  5EEC A;  4DXB A;  4B4X A;  2XK1 A;  3A3J A;  3UPP A;  3VP3 A;  3Q82 A;  1DJA A;  2BG1 A;  4OLD A;  3Q7V A;  2HDR A;  1JTD A;  1XPB A;  3IF6 C;  4E3N A;  4JKT A;  2WAE A;  4Y0O A;  3W4P A;  4DE1 A;  1K55 C;  4X69 A;  5FQQ A;  3BM6 A;  2XD1 A;  2JBF A;  1LHY A;  1O07 A;  1XX2 A;  2IWD A;  5HW3 A;  1LL5 A;  4UAA A;  4KG2 A;  3BFE A;  4UHU A;  3E2K A;  1CK3 A;  3IWO A;  1IYS A;  3MKE A;  2EX6 A;  3VP0 A;  1YMX A;  5GLA A;  1NYY A;  2ZQ8 A;  3RXW A;  1ES4 A;  3S22 A;  2Y2N A;  4B4Z A;  4WEL A;  3GV9 A;  3MXS A;  1M6K A;  5EVI D;  3SH9 A;  4Y0U A;  4K91 A;  1MY8 A;  4C3Q A;  3WS1 A;  4E6W A;  5AQA A;  5GHZ A;  2J7V A;  4Q8I A;  4N9L A;  5HAI A;  1ESI A;  3OC2 A;  4FD8 A;  1JWV A;  2CC1 A;  5EPH A;  5DTS A;  4MBH A;  1BTL A;  1YLW A;  4YIN A;  1LL9 A;  2H0Y A;  2Y2J A;  1I2S A;  3CZD A;  4QB8 A;  4U0X A;  1HZO A;  3GVB A;  3DTM A;  4KEN B;  5A93 A;  1BUE A;  2JE5 A;  1K38 A;  5HAP A;  3UE0 A;  4S2P A;  1ZKJ A;  3G4P A;  1GCE A;  1XP4 A;  5CRF A;  2EFX A;  3Q07 A;  1Q2Q A;  1JVJ A;  4QHC A;  1BUL A;  2B5R A;  4LV3 A;  4KQR A;  3DW0 A;  1VQQ A;  2Y55 A;  5F82 A;  4N1H A;  5M19 A;  2HP9 A;  4S2N A;  2V1Z A;  3V3R A;  5GLC A;  3GR2 A;  2V20 A;  4R3J A;  3AGF A;  2EX8 A;  4FSF A;  3MZD A;  3ISG A;  1JWP A;  4KZ9 A;  2ZQ9 A;  1ERO A;  2Q9M A;  5F83 A;  4OH0 A;  2QZ6 A;  3AGE A;  2H0T A;  2GDN A;  1MPL A;  1ES5 A;  4ZJ1 A;  3V50 A;  4K0X A;  1ZC2 A;  1PI4 A;  3NY4 A;  1YLP A;  1YLZ A;  4GOG A;  3WS4 A;  1CI9 A;  1KVL A;  2Y59 A;  4WEJ A;  4F94 A;  4XXR A;  4NK3 A;  1W79 A;  4PM8 A;  5TR7 A;  2OLU A;  5E2H A;  3Q7V B;  4JLF A;  1GA0 A;  1W7F A;  4QU3 A;  1WYB A;  3MXR A;  4U3T A;  1FR6 A;  3N8R A;  4MNR A;  4E3K A;  4EV4 A;  4XUZ A;  3NC8 A;  1PIO A;  2XF3 A;  3BFD A;  1K6S A;  4RX2 A;  2Z2L B;  2X71 A;  4BD1 A;  2Y91 A;  5G18 A;  4S2K A;  1DY6 A;  5CGW A;  4S2O A;  3MZF A;  3VP2 A;  3IXB A;  1GHM A;  2OSU A;  2XH9 A;  3PTE A;  3WRZ A;  5JYP A;  3A3E A;  2HDQ A;  2WGW A;  3HLW A;  1CEF A;  4QY5 A;  3IWI A;  1NRF A;  5E2G A;  3QHY A;  2J9O A;  1RGY A;  4JF6 A;  3IHB A;  4E3J A;  1XGI A;  3A3I A;  4WZ5 A;  1XGJ A;  3IH9 A;  1IYQ A;  4UA9 A;  5FAQ A;  5CED A;  1ONG A;  3ZCZ A;  3IHA A;  3M6H A;  4HBT A;  4S2L A;  4GDN A;  2XR0 A;  1SHV A;  2Y2G A;  2ZC5 B;  3P98 A;  2ZLY A;  2ZM0 A;  4H8R A;  1EI5 A;  4LV0 A;  1E25 A;  2P74 A;  2Y2Q A;  5J8X A;  4R4S A;  3PBS A;  3ITA A;  1YT4 A;  2R9W A;  2XGN A;  5EVL A;  1MWR A;  1Z6F A;  1NXY A;  4LV1 A;  4R4R A;  5CXW A;  1K57 A;  2WYX A;  1PWC A;  1WE4 A;  5FAO A;  3HBR A;  2UWX A; 
#chains in the Genus database with same CATH topology
 4EEU A;  5HX9 A;  1ES2 A;  4OOY A;  5JYO A;  4PM6 A;  3MR0 A;  3CUE C;  1K56 D;  3IXH A;  2ZL1 A;  3PBO A;  3RTY A;  3F1P A;  4E04 A;  1RGZ A;  1K56 A;  1H8Y A;  4Y17 A;  4QJG A;  4L9G A;  2P08 A;  5DF9 A;  1MZU A;  3K3C A;  4OQ0 A;  4GZB A;  4I38 A;  3FPW A;  4LRY C;  1M40 A;  5E43 A;  5CX7 A;  1YSP A;  3PHY A;  4L0L A;  3LR4 A;  3ICY A;  2PR6 A;  5IS1 A;  4GKU A;  3M6B A;  3W2Z A;  1S66 L;  1L2S A;  4OPZ A;  2W1R A;  5EVI A;  2J3W A;  1KDS A;  4LRZ E;  4HNB A;  4WUJ A;  4ETZ A;  2QPN A;  1VET B;  4OP5 A;  2H5S A;  1WYC A;  3E4P A;  1L0E A;  1E4D A;  4S2N C;  2HDU A;  3MMH A;  1E3U D;  4ID4 A;  3G35 A;  3BFG A;  1SKF A;  2Y2H A;  4NKP A;  1YM1 A;  4S2M A;  3NUL A;  5FDH A;  5EE8 A;  3HLB A;  2X01 A;  5DKK A;  2WGV A;  1PWG A;  1OPX A;  3ZNY A;  4PM9 A;  4EUZ A;  5FEG A;  3O86 A;  5DFY A;  3EEA A;  4OKP A;  5CHM A;  5DF7 A;  3UNW A;  3WS2 A;  3UB5 P;  3A0V A;  4KZ7 A;  5F1G A;  3E98 A;  3SW1 A;  1ZG6 A;  4QPR A;  4LLO B;  1K54 A;  3UB6 A;  4HP9 A;  4L9F A;  3BY9 A;  2PYR A;  4X6T A;  3LY3 A;  5HWT A;  1XA7 A;  1Y28 A;  1BT5 A;  1PI5 A;  2QWS A;  4PKY A;  4IBX A;  4O7D A;  3NOT C;  4R3A A;  2K2N A;  3H7W A;  2EWW A;  1DJC A;  4I3I A;  4JGQ A;  3LEZ A;  2HV1 A;  3IS2 B;  5CTN A;  1XJ2 A;  1BLH A;  3PBN A;  5CER A;  1KOU A;  2OOL A;  4FOF A;  1DJB A;  2WKH A;  4MLL A;  1P0Z A;  5FI6 A;  3D9Y A;  1N9L A;  1MWS A;  2ZQ7 A;  3KSI A;  4KZ8 A;  3ZG7 B;  5L2F A;  4H6J B;  3C38 A;  4P87 A;  3L7H A;  3Q1F A;  1CF0 A;  3KYQ A;  5J3W A;  3QP2 A;  3T4L A;  1RP5 A;  4NXF A;  3MJQ A;  1K55 A;  4JF5 A;  4Q0J A;  3IWQ A;  4WEK A;  3UY6 A;  4X25 A;  3MZE A;  3T1X A;  5F6A A;  3SOI A;  3EGX C;  2INW A;  2D01 A;  4GHI B;  3N6I A;  2VX8 A;  1MKI A;  3VOZ A;  1FCM A;  3V39 A;  4ZRR A;  3T1R A;  3GTC A;  4KZ4 A;  3UE1 A;  3OZH A;  2ZL1 B;  4FH4 A;  1PW8 A;  4LFU A;  3BLS A;  3FKW A;  3ZG9 B;  3F1P B;  4G3K A;  4GB7 A;  3UDF A;  1XKZ A;  3TRC A;  3G30 A;  3LI9 A;  2D02 A;  4MBF A;  4RVA A;  3V5M A;  3KSH A;  3WS0 A;  3UO9 A;  1GSW A;  2B95 A;  1JNU A;  4Y15 A;  3IF6 B;  4E3O A;  5G4Z A;  1H5X A;  3OOV A;  5CEB A;  4Q0I A;  2J3T C;  2NUT C;  5HWW A;  3HVF A;  3OPP A;  3NIA A;  3G34 A;  5FQK A;  1K0K A;  1OJG A;  3CJM A;  4KZ5 A;  3IX4 A;  5AQ9 A;  4JF4 A;  2JKG A;  4IED A;  1D7E A;  1SKO B;  4BMW A;  4I3J A;  2EX9 A;  2B02 A;  2MJ6 A;  2V1A A;  2VV6 A;  1OT6 A;  4KZ3 A;  5HD5 A;  5KSC A;  4DMZ A;  3AGD A;  3FZC A;  2H10 A;  4IHQ A;  4Z9Q A;  4RYE A;  4DXB A;  3CUE A;  2BG1 A;  3Q7V A;  2HDR A;  4CLC E;  1JTD A;  1XPB A;  3IF6 C;  1UWP X;  2M1C A;  4WF0 A;  5FQQ A;  2Z6C A;  2JBF A;  1O07 A;  1X0O A;  4CLC A;  3LIA A;  3U2A A;  1YMX A;  4HY8 A;  2W27 A;  1TF1 A;  1UWN X;  2Z6D A;  2QKP A;  2J7V A;  4Q8I A;  1ESI A;  2KOI A;  3OC2 A;  3FC7 A;  3F1N B;  3LFV A;  1YLW A;  2H0Y A;  1I2S A;  3NJA A;  5L10 A;  4KEN B;  1K38 A;  5HAP A;  4S2P A;  1ZKJ A;  3Q07 A;  4LV3 A;  4KQR A;  1VQQ A;  4S2N A;  2V1Z A;  5GLC A;  3AGF A;  2EX8 A;  4FSF A;  3MZD A;  2O99 A;  1JWP A;  5F83 A;  4OH0 A;  2H0T A;  2VGL M;  1ES5 A;  1ZC2 A;  1KVL A;  4WEJ A;  4II7 A;  4PM8 A;  4P6Z M;  2OLU A;  5TJJ A;  3N8R A;  3MQ0 A;  4MNR A;  4E3K A;  4EV4 A;  3NC8 A;  2X71 A;  2Y91 A;  1DY6 A;  5CGW A;  2XH9 A;  1P9R A;  2QHK A;  3HLW A;  2J9O A;  5EV0 A;  5FAQ A;  1FIK A;  1ONG A;  3IHA A;  4GDN A;  1SHV A;  3P98 A;  1VET A;  4LV0 A;  4WN5 A;  1A0K A;  2Y2Q A;  4R4S A;  5FL3 A;  3ITA A;  4D60 A;  3ZQ5 A;  3T4S A;  4R4R A;  4K08 A;  1CQA A;  2WKP A;  3FWL A;  5HZH A;  3HBR A;  2UWX A;  3S22 A;  2ZM8 A;  3IXG A;  3RJU A;  1BLP A;  4GCZ A;  1OTA A;  3PYP A;  4LEN A;  3VFF A;  3IF5 A;  1CEG A;  3M2J A;  2XQZ A;  2ZOH A;  3VOY A;  2ZMF A;  3UE3 A;  4WL9 A;  4Y3I A;  4HH2 A;  3HRE A;  1CJF A;  2Z2M B;  2W3F A;  5EVE A;  3VFH A;  1S1Y A;  4OQG A;  4OPQ A;  2J8Y A;  5HL1 A;  5FAP A;  5U47 A;  3NOU C;  2LB9 A;  3S7P A;  2RL3 A;  1MXO A;  1ONH A;  3NCK A;  4OOL A;  2DCF A;  4R70 A;  4LPZ A;  4XT2 B;  4DE3 A;  4WBG A;  2OV5 A;  1RCJ A;  1LSX A;  5GLD A;  2G2W A;  1F98 A;  4ZJ2 A;  3LIF A;  4RX3 A;  4X53 A;  3PAE A;  3SS5 A;  3BEB A;  1TS8 A;  4PM7 A;  3QNC A;  1MWT A;  3CAX A;  4NET A;  2AVX A;  3G31 A;  2I9V A;  3C4P A;  3OLO A;  2HP5 A;  2WUQ A;  2XLN A;  3IS2 A;  3UDX A;  2BAS A;  5M18 A;  4ZJ3 A;  3SH7 A;  4I5S A;  4HJ6 A;  4Y7P A;  1I5Q A;  2EXB A;  4JXS A;  2BLS A;  3WRT A;  2IWB A;  3E2L A;  1WA9 A;  3R7W A;  4NG2 A;  4UEY A;  1PNE A;  3U4L P;  2J9P A;  4DDY A;  5MC7 A;  2CMN A;  2PBD P;  3SH8 A;  4H6J A;  3O3V A;  5FQ9 A;  3LR3 A;  1F5M A;  3E0Y A;  1FSY A;  3FG8 A;  3OPL A;  4R23 A;  3LO7 A;  2J3T D;  4ETX A;  2W3H A;  2Y4A A;  1S4R A;  2WKE A;  1C3B A;  3EWK A;  3LR5 A;  3OCL A;  3LI8 A;  4UQI S;  1PW1 A;  2HDS A;  2DMW A;  3JPU A;  4GHI A;  4BWI A;  1OJ5 A;  5CGS A;  1T19 A;  1IKG A;  3A3D A;  3EOI A;  3VOL A;  2JKT I;  3ZDJ A;  2I72 A;  2Y2K A;  4EET B;  1NZO A;  2DNS A;  1K4F A;  2K31 A;  3EQV A;  2KLI A;  3HJI A;  4RA7 A;  1KE3 A;  5AVF A;  2A49 A;  2XD5 A;  1NY0 A;  2ZMV A;  3P09 A;  4JXV A;  3OCN A;  5FAT A;  5EUA A;  3SZT A;  1BLS A;  2B18 A;  4HH3 A;  2GZA A;  5KSH A;  4IVK A;  2JCH A;  4HQA A;  2HJE A;  4QWO A;  2WK0 A;  1MKM A;  4QY6 A;  4HEF A;  3IF6 A;  3W8K A;  3I7J A;  4HBU A;  3PBR A;  3SS4 A;  1Q2P A;  3UN7 A;  3G32 A;  4BD0 A;  2ZC7 A;  3UB7 A;  4BL3 A;  1ZTU A;  4DRT A;  5G4Y A;  3IT9 A;  3PAG A;  5BOH A;  2P04 A;  3UME A;  1H0M A;  1XFN A;  1KDW A;  1KGF A;  1AXB A;  1SKO A;  1XJ3 A;  3NDE A;  2XA7 S;  4OPR A;  2P9V B;  3NDG A;  3UB9 A;  2HPB A;  5GHY A;  1E3U A;  4KUK A;  2QYB A;  2JHE A;  5GL9 A;  4EQ1 A;  3CMZ A;  4WM9 A;  4IUK A;  2QJ5 A;  4KUO A;  3TSG A;  2QJ7 A;  5TFQ A;  1NJ4 A;  5CTM A;  1LL8 A;  3GSG A;  4KQO A;  3PBT A;  3T4O A;  5FSR A;  3V3S A;  1IEL A;  1VM1 A;  1P9W A;  1N9N A;  3BLM A;  1VHM A;  1HTZ A;  1TS0 A;  3D4F A;  2G2U A;  2EA9 A;  1S6R A;  3Q7Z A;  2QMI A;  3MQQ A;  4K0W A;  1FQG A;  3ITB A;  4EES A;  4XUX A;  4DDS A;  4WLA A;  1W8Y A;  3P7N A;  2WZZ A;  3HLD A;  3ZFZ A;  1W63 M;  3Q81 A;  4OLG A;  1ERM A;  5KMW A;  2ZBB A;  3F1N A;  3HLC A;  4GLQ A;  5DVA A;  2ZMA A;  3O87 A;  1NYM A;  3ZG0 A;  2A3U A;  4LV2 A;  5FDS A;  1ERQ A;  3R7W B;  5HFO A;  3VP4 A;  4GD6 A;  3B3X A;  4HJ4 A;  1I2W A;  3FYZ A;  1EW0 A;  2XFS A;  4GDB A;  3KSF A;  1LI9 A;  2FFY A;  1K4E A;  2NUP C;  5TGF A;  1DP9 A;  3Q82 A;  1DJA A;  4DE1 A;  2XRN A;  1D06 A;  1ZHH B;  1XJ4 A;  1CK3 A;  3F1O B;  1IYS A;  5GLA A;  1NYY A;  2Y2N A;  3GV9 A;  3UB8 A;  3SH9 A;  1H8M A;  3WS1 A;  4E6W A;  5AQA A;  3B42 A;  3L9K A;  5HAI A;  2IA2 A;  1JWV A;  1BYW A;  4YIN A;  3S7O A;  2Y2J A;  1IFQ A;  3CZD A;  4U0X A;  1HZO A;  3DTM A;  5A93 A;  2JE5 A;  2KX6 A;  5CRF A;  2PD7 A;  3DW0 A;  5F82 A;  5M19 A;  1Y4O A;  2HP9 A;  2WKR A;  3V3R A;  2V20 A;  4MN7 A;  2JKT M;  2JKR I;  3EGD C;  4KZ9 A;  2ZQ9 A;  4JGR A;  2QZ6 A;  3AGE A;  2GDN A;  4ZJ1 A;  3V50 A;  4K0X A;  1UGU A;  3B33 A;  1YLZ A;  1CI9 A;  2Y59 A;  4XXR A;  4NK3 A;  4JGO A;  4MMN A;  4NXG A;  5E2H A;  2VK3 A;  1WYB A;  3MXR A;  3BFD A;  4RX2 A;  2O0Y A;  3MXQ A;  5G18 A;  2W1T B;  3IXB A;  4XT2 A;  3A3E A;  3K2N A;  3IWI A;  1NRF A;  3QHY A;  3B47 A;  1XGI A;  1XGJ A;  3ZCZ A;  3CIT A;  3M6H A;  3C8C A;  3JVU A;  2ZLY A;  2ZM0 A;  3EEH A;  1J3W A;  3HJK A;  3PBS A;  4EUV A;  5EVL A;  1Z6F A;  2LB5 A;  1NXY A;  4LV1 A;  4ARZ B;  2WYX A;  5FAO A;  1PWC A;  4B88 A;  1PFL A;  4Y13 A;  1V9Y A;  2ZD8 A;  4Q0H A;  3GMW A;  4ZBE A;  4MBK A;  4LRX C;  4LCL A;  4OON A;  3NHQ A;  3QP4 A;  3W4Q A;  1MC0 A;  4BL2 A;  4E3I A;  3H82 B;  3C4O A;  2GJ3 A;  1TEM A;  4F3L B;  3TOI A;  5A92 A;  2V1B A;  1XA1 A;  1XFQ A;  4N92 A;  2VGK A;  4R6L A;  4EXO A;  1LSW A;  4R1G A;  4LCM A;  3ZGA B;  3LCE A;  2O9B A;  3A0R A;  3RFB A;  4DXC A;  3MSH A;  1LSV A;  5FQJ A;  3MBZ A;  2PBY A;  2WGW B;  3FPV A;  4FTX A;  5HWV A;  5DFX A;  5EVI C;  3IXD A;  5FEF A;  1IEM A;  1L0F A;  3HLG A;  3OPR A;  5FI2 A;  4X55 A;  1Y54 A;  4ME4 A;  2V8C A;  3LIC A;  5CGX A;  2W3E A;  1TS6 A;  1TDL A;  1N9O A;  2A24 B;  2HP6 A;  1L0G A;  3BQA A;  2UV0 E;  1XJ6 A;  4HES A;  1IKI A;  1OT9 A;  1DP6 A;  4E6X A;  2W3D A;  2Y2O A;  3BJN A;  4UA7 A;  2WGI A;  4IVI A;  3K3D A;  1YLJ A;  4WYY A;  2OWJ A;  1NLZ A;  2PRF A;  4X56 A;  4L9E A;  4FCF A;  4Y0T A;  3OPH A;  1YLY A;  2BTF P;  3E4O A;  2OAP 1;  2RCX A;  4O0P A;  3FKV A;  4C75 A;  4QD4 A;  3GDI A;  4M4X A;  1KVM A;  3TE8 A;  4EU0 A;  4EER A;  2W0N A;  3WS5 A;  4WZ5 C;  1FSW A;  4OQI A;  4DF6 A;  2Y2M A;  3JYI A;  1K54 C;  3M2K A;  4GNU A;  4BBT A;  2L1M A;  1GSV A;  5CHU A;  3N4I A;  4C6Y A;  3HUN A;  1F9I A;  1PZP A;  1O7E A;  4KG6 A;  1G5U A;  2DRW A;  5F5Y A;  2A2L A;  2PU4 A;  4YOF A;  5D3O A;  2P9V A;  4IBR A;  4EW7 A;  5FQM A;  2Q9N A;  2FFF B;  2JC7 A;  5K5B A;  3VMA A;  2V0U A;  4BLM A;  1PZO A;  2Y2I A;  4NXE A;  1HLU P;  5FI7 A;  2C6W B;  3IQA A;  1ESU A;  3UDI A;  3G2Y A;  1KGE A;  4JXG A;  3T1S A;  5EM0 A;  3HUO A;  2JKR M;  1CI8 A;  1JWZ A;  2HF6 A;  1G6O A;  4GS9 B;  1IYO A;  2H28 A;  1MWU A;  2HGV A;  3LUQ A;  5DTT A;  3N7W A;  5HL6 A;  5L8M A;  4GW9 A;  2W3G A;  1S0W A;  3VP1 A;  3IX8 A;  4R0Q A;  3ZNT A;  5IT5 A;  4G3V A;  5DJU A;  3DTE A;  5DF8 A;  4EBP A;  2ZC3 B;  4AFI A;  3QP6 A;  4YWZ A;  1P97 A;  5HDD A;  4P6B A;  5J4E A;  5AQ7 A;  4OP8 A;  4CJN A;  4IUH A;  1YSQ A;  4KZ6 A;  1LI0 A;  4NEE D;  4DE2 A;  1PWD A;  2Q0O A;  1KE0 A;  2VV7 A;  4B9O A;  3PBQ A;  2XRO A;  5HPF A;  2XEP A;  2R9X A;  3SS3 A;  2V0W A;  3T4K A;  4R3B A;  2WZX A;  4E3M A;  4ZAM A;  5FQI A;  2EWV A;  2VGJ A;  1JTG A;  1K6R A;  3F1O A;  3NBL A;  4YNR A;  5IHV A;  3GEC A;  1TVF A;  4WZ4 A;  1SZV A;  3JVV A;  3QNB A;  3LID A;  3HLF A;  3DWK A;  1BZA A;  3MQO A;  2XDM A;  5A91 A;  2VKS A;  3ZHH A;  3LY4 A;  2ZC4 B;  4BEN A;  3T12 B;  2Y2L A;  1F2K A;  4KG5 A;  3LIE A;  1FOF A;  4EQI A;  5EEC A;  4B4X A;  2XK1 A;  2O9C A;  3UPP A;  4E3N A;  5HDC A;  1VB6 A;  2WAE A;  3G6O A;  4X69 A;  3KO6 A;  4CLC C;  2XD1 A;  5HW3 A;  2IWD A;  1LL5 A;  4UAA A;  3BY8 A;  2W1T A;  1T1B A;  1VEU B;  3E2K A;  1LT0 A;  3IWO A;  1S4S A;  2EX6 A;  2PD8 A;  2ZQ8 A;  4B4Z A;  4ESP A;  2Y79 A;  1ODV A;  5EVI D;  4K91 A;  4C3Q A;  3KX0 X;  3QP1 A;  2ACG A;  4FD8 A;  3DBA A;  1DRM A;  2CC1 A;  1BTL A;  4QB8 A;  4ARZ A;  3UE0 A;  3S7Q A;  1GCE A;  4QHC A;  2B5R A;  4N1H A;  3GR2 A;  3TJZ C;  4R3J A;  1D1J A;  3C2W A;  5F68 A;  1MPL A;  4GOG A;  3H82 A;  4F3L A;  1W79 A;  2V9A A;  3LEQ A;  5TR7 A;  4JLF A;  1GA0 A;  1W7F A;  4QU3 A;  3D72 A;  4Y2F A;  1PIO A;  3MS6 A;  2Z2L B;  4BD1 A;  4S2O A;  3MZF A;  4X1L A;  3D3O A;  2HDQ A;  2WGW A;  4QY5 A;  5TBM B;  5E2G A;  4E3J A;  4WZ5 A;  3A3I A;  3IH9 A;  4UA9 A;  2J80 A;  4NXB A;  2VGL S;  4S2L A;  3V67 A;  5J7E A;  4HIA A;  3QP5 A;  4EEP A;  3NOP C;  2XGN A;  4P6Z S;  3PR6 A;  2A24 A;  1MWR A;  2ZM2 A;  2WKI A;  3LYX A;  1DP8 A;  2EXA A;  1PYY A;  3RXX A;  5EM1 A;  2V2F F;  3KSG A;  5F1F A;  3BFF A;  1L0D A;  2E8I A;  1SDN A;  3KYZ A;  4MN6 A;  5CHJ A;  2ZQA A;  4FH2 A;  1YLT A;  3C5A A;  4DN0 A;  5E2E A;  3UPO A;  1K25 A;  3QP8 A;  4B93 A;  5A8B A;  2VA0 A;  3BFC A;  4MN5 A;  1QMF A;  4OPY A;  3IX3 A;  5GHX A;  1OTE A;  5FAS A;  3CPT B;  1T1C A;  2P7J A;  1KGG A;  2L0W A;  5AQB A;  1N4O A;  3PXP A;  3VSK A;  3ZG5 A;  3HL9 A;  3T4Q A;  4PPR A;  3TG9 A;  3DTI A;  3HLE A;  1SCW A;  3EQU A;  3MF0 A;  2YKH A;  2VLG A;  3IBR A;  3P01 A;  4PAU A;  1HD8 A;  1L3L A;  3UPN A;  4E3L A;  1H3Q A;  4M3K A;  2PR5 A;  4KZA A;  4LGW A;  1YQS A;  4I3A A;  4MEZ A;  5KIZ A;  4OVD A;  1BLC A;  5L07 A;  4KZB A;  5F69 A;  4UA6 A;  4S2J A;  2ZC6 B;  4X68 A;  1G6A A;  4OQH A;  5HD3 A;  1FIL A;  1OTI A;  2M7U A;  5DTK A;  5EOO A;  5IU1 A;  4GS9 A;  3TW8 A;  4UQI M;  1LLB A;  5EOE A;  3CHW P;  1IOU A;  2Y2P A;  3IBJ A;  5AJG A;  3BW6 A;  4BQM A;  1GHI A;  1NRJ A;  3A3F A;  1NLY A;  1FR1 A;  4Z1W A;  5GLB A;  4KQQ A;  1YMS A;  5FA7 A;  4O01 A;  4HI4 A;  2G7U A;  4S2I A;  1IYP A;  1FCO A;  4CPK A;  4GD8 A;  1BSG A;  3HCY A;  5EVI B;  1K57 C;  4MCW A;  3FV7 A;  5HAQ A;  2ZJ9 A;  5M1A A;  4PMA A;  2XFT A;  3CG5 A;  4DKI A;  2EX2 A;  3ZYT A;  3MKF A;  4WMC D;  4GN2 A;  4U0T A;  3H9W A;  2X02 A;  2V8F A;  1TD5 A;  4MDZ A;  3MFD A;  4DJ3 A;  4PM5 A;  1AWI A;  1S1Z A;  2VZW A;  1G28 A;  3N8L A;  5HPI A;  4WMC A;  1EWZ A;  5I94 A;  2PDR A;  4OOM A;  3C7U A;  3LIB A;  5EFW A;  3GQZ A;  3DTK A;  4HHD A;  3ZVT A;  4BBU A;  3ZG8 B;  1T1A A;  3W4O A;  2XA7 M;  3N8S A;  4G3W A;  2Y8H A;  4N1X A;  4CLC D;  4BJP A;  2GNX A;  3C7V A;  5CEC A;  3O88 A;  3GRJ A;  2OLV A;  1U60 A;  2IWC A;  3CWF A;  3MFX A;  1H8Z A;  5KZH A;  3BYD A;  5HAR A;  2WAD A;  3BEC A;  1MBL A;  1W8Q A;  3A0S A;  3BRM A;  4EBL A;  4ZDX A;  3ZVW A;  3H7W B;  1GHP A;  1GA9 A;  5I5L A;  1SDE A;  1ZG4 A;  3O5Y A;  1W5D A;  4D2O A;  2GX5 A;  1G68 A;  5DJT A;  4X1M A;  2R78 A;  3DWZ A;  3LGO A;  3WWX A;  1QME A;  3S7N A;  3S1Y A;  4DE0 A;  4P0M A;  3NI9 A;  2FZ0 A;  1GSX A;  3UMD A;  1KE4 A;  2HJ9 C;  2O9A A;  3G2Z A;  3RH8 B;  2PU2 A;  1W63 Q;  2PAV P;  1YKD A;  1ALQ A;  1Z09 A;  2WAF A;  4YFM A;  2ZQC A;  4RQ9 A;  1VEU A;  3T50 A;  2OWH A;  3VSL A;  5A90 A;  1PRQ A;  4I39 A;  1N9B A;  4CQH A;  5E2F A;  3IH8 A;  1V9Z A;  3VE4 A;  4A5R A;  4JBF A;  1T18 A;  4JXW A;  3CI6 A;  2K7S A;  2WKQ A;  3VV4 A;  5L09 A;  2EFU A;  4ZTK A;  5LBR A;  2C5W B;  2PT7 A;  2ZQD A;  3NEC A;  4JPM A;  1ES3 A;  4N9K A;  4R38 A;  2ZOI A;  4EWF A;  4P85 A;  4GJ4 A;  1J9M A;  3R4K A;  1NWZ A;  1TDG A;  3HUM A;  1OME A;  4EBN A;  1HVB A;  2JKF A;  3S4X A;  1FCN A;  1XXM A;  1NZU A;  3LR0 A;  3A3J A;  3VP3 A;  4OLD A;  1YPR A;  4JKT A;  4Y0O A;  3W4P A;  2VJW A;  1K55 C;  1STZ A;  3T4J A;  4Y5F A;  5C5K A;  3BM6 A;  2HZ5 A;  1LHY A;  1XX2 A;  3VE3 A;  4KG2 A;  3BFE A;  4UHU A;  4PHT A;  3OBF A;  3BQ8 A;  3MKE A;  3VP0 A;  5TBM A;  2PHY A;  3RXW A;  2E8J A;  1ES4 A;  5HSQ A;  4WEL A;  1ACF A;  3MXS A;  1M6K A;  4FUW A;  4Y0U A;  1MY8 A;  5GHZ A;  3DAV A;  3UE6 A;  4N9L A;  5DKL A;  5HDS A;  5EPH A;  5DTS A;  4PKY G;  4MBH A;  1LL9 A;  3GVB A;  1OTB A;  1BUE A;  3G4P A;  1XP4 A;  3T4T A;  2EFX A;  1Q2Q A;  1JVJ A;  1BUL A;  2JN7 A;  2KDK A;  2Y55 A;  4HOI A;  4KQD A;  2OAQ 1;  2XSS A;  2L4R A;  3BWL A;  3ISG A;  4DJ2 A;  1ERO A;  2Q9M A;  3ULF A;  3NY4 A;  1PI4 A;  1YAX A;  1YLP A;  4HP4 A;  3KYE A;  3WS4 A;  2YKF A;  3T1Q B;  4F94 A;  1OTD A;  4JGP A;  3Q7V B;  4U3T A;  1FR6 A;  3CPT A;  3E4Q A;  4XUZ A;  2VV8 A;  2XF3 A;  1K6S A;  3CLO A;  4S2K A;  1TS7 A;  4CLC B;  2VEA A;  3VP2 A;  3WRZ A;  1GHM A;  2FH5 A;  2OSU A;  3PTE A;  5JYP A;  4BBV A;  1CEF A;  3C30 A;  4JF6 A;  1RGY A;  3IHB A;  4O8G A;  1S67 L;  5CED A;  1IYQ A;  4HBT A;  2XR0 A;  2Y2G A;  2ZC5 B;  4H8R A;  1EI5 A;  5AVE A;  1E25 A;  2P74 A;  5J8X A;  4HJ3 A;  1YT4 A;  2R9W A;  2PYP A;  5CXW A;  1K57 A;  1WE4 A;  4IJG A;  2M7V A; 
#chains in the Genus database with same CATH homology
 2ZM2 A;  2ZM8 A;  3IXG A;  2WKI A;  3RJU A;  1BLP A;  2EXA A;  5HX9 A;  1PYY A;  3RXX A;  4LEN A;  3VFF A;  2ZD8 A;  1CEG A;  3IF5 A;  2V2F F;  3GMW A;  4ZBE A;  3M2J A;  4MBK A;  5F1F A;  2XQZ A;  1ES2 A;  1L0D A;  3BFF A;  4OOY A;  2E8I A;  1SDN A;  5JYO A;  4LCL A;  4OON A;  4PM6 A;  3VOY A;  1K56 D;  3UE3 A;  5CHJ A;  3IXH A;  2ZQA A;  4FH2 A;  3W4Q A;  1YLT A;  3C5A A;  3HRE A;  3PBO A;  5E2E A;  4BL2 A;  3UPO A;  1K25 A;  2Z2M B;  4E3I A;  3C4O A;  3VFH A;  1TEM A;  1RGZ A;  1K56 A;  4OQG A;  4OPQ A;  3BFC A;  1H8Y A;  3TOI A;  5A92 A;  2J8Y A;  4QJG A;  1QMF A;  1XA1 A;  4N92 A;  4OPY A;  5DF9 A;  2VGK A;  5HL1 A;  5FAP A;  5U47 A;  4OQ0 A;  4GZB A;  5GHX A;  5FAS A;  2RL3 A;  4R1G A;  4LCM A;  1M40 A;  1KGG A;  1MXO A;  1ONH A;  5E43 A;  3ZGA B;  3LCE A;  4DXC A;  3NCK A;  4OOL A;  2DCF A;  5FQJ A;  4DE3 A;  5AQB A;  1N4O A;  4WBG A;  3MBZ A;  2PBY A;  2WGW B;  2OV5 A;  1RCJ A;  3VSK A;  3ZG5 A;  5GLD A;  4L0L A;  3HL9 A;  2G2W A;  4ZJ2 A;  4PPR A;  3TG9 A;  5EVI C;  4GKU A;  3IXD A;  3M6B A;  3HLE A;  4RX3 A;  1IEM A;  1SCW A;  3EQU A;  1L2S A;  1L0F A;  4OPZ A;  5EVI A;  1KDS A;  4X53 A;  3PAE A;  3HLG A;  3SS5 A;  3BEB A;  3OPR A;  5FI2 A;  4X55 A;  4PM7 A;  3QNC A;  1Y54 A;  1HD8 A;  2QPN A;  4OP5 A;  1MWT A;  2H5S A;  4NET A;  1WYC A;  5CGX A;  3UPN A;  1L0E A;  4E3L A;  3G31 A;  1E4D A;  4M3K A;  3C4P A;  4S2N C;  1TDL A;  2HP6 A;  4KZA A;  1L0G A;  2HP5 A;  2HDU A;  4HES A;  1YQS A;  1IKI A;  2WUQ A;  1E3U D;  4ID4 A;  3G35 A;  2XLN A;  4MEZ A;  4E6X A;  3BFG A;  1SKF A;  2Y2H A;  3UDX A;  1YM1 A;  2Y2O A;  4S2M A;  4OVD A;  4UA7 A;  5M18 A;  2WGI A;  4ZJ3 A;  4IVI A;  1BLC A;  3SH7 A;  5FDH A;  4KZB A;  5EE8 A;  3HLB A;  4UA6 A;  2X01 A;  4Y7P A;  2WGV A;  4S2J A;  2ZC6 B;  1YLJ A;  4X68 A;  1I5Q A;  2EXB A;  1PWG A;  4WYY A;  1G6A A;  4OQH A;  4JXS A;  2BLS A;  4X56 A;  3WRT A;  2IWB A;  3E2L A;  4FCF A;  3ZNY A;  5DTK A;  5EOO A;  4Y0T A;  4PM9 A;  3OPH A;  4EUZ A;  1YLY A;  3O86 A;  2J9P A;  4DDY A;  2RCX A;  1LLB A;  4OKP A;  5EOE A;  3FKV A;  5CHM A;  5DF7 A;  3SH8 A;  3UNW A;  4C75 A;  4QD4 A;  3WS2 A;  2Y2P A;  1KVM A;  3O3V A;  5FQ9 A;  1GHI A;  4BQM A;  3A3F A;  4KZ7 A;  5F1G A;  3WS5 A;  1FR1 A;  4WZ5 C;  5GLB A;  4KQQ A;  1FSW A;  4OQI A;  1ZG6 A;  1YMS A;  1FSY A;  2Y2M A;  4DF6 A;  5FA7 A;  3JYI A;  3OPL A;  1K54 C;  4R23 A;  3M2K A;  4GNU A;  3LO7 A;  4S2I A;  1IYP A;  1K54 A;  1FCO A;  4CPK A;  5CHU A;  2Y4A A;  3N4I A;  4GD8 A;  1BSG A;  2WKE A;  4C6Y A;  3HUN A;  1C3B A;  5EVI B;  4X6T A;  3LY3 A;  1PZP A;  1O7E A;  4KG6 A;  1K57 C;  1XA7 A;  1BT5 A;  1PI5 A;  3OCL A;  3FV7 A;  2DRW A;  5HAQ A;  2ZJ9 A;  4IBX A;  1PW1 A;  4O7D A;  5M1A A;  4PMA A;  2PU4 A;  2HDS A;  2XFT A;  5D3O A;  3CG5 A;  2P9V A;  4IBR A;  4DKI A;  5CGS A;  2EX2 A;  5FQM A;  2Q9N A;  3MKF A;  1IKG A;  2FFF B;  1DJC A;  4WMC D;  4GN2 A;  4U0T A;  3LEZ A;  2JC7 A;  2X02 A;  5CTN A;  3A3D A;  3VMA A;  4PM5 A;  3MFD A;  1PZO A;  2Y2I A;  5FI7 A;  4BLM A;  2C6W B;  1BLH A;  3N8L A;  3PBN A;  3ZDJ A;  4WMC A;  2I72 A;  3IQA A;  2Y2K A;  1ESU A;  1EWZ A;  5CER A;  3G2Y A;  1KGE A;  4JXG A;  3UDI A;  5I94 A;  1NZO A;  1DJB A;  3HUO A;  2WKH A;  4OOM A;  1CI8 A;  2DNS A;  3C7U A;  1JWZ A;  1K4F A;  3GQZ A;  4MLL A;  1IYO A;  3EQV A;  4RA7 A;  1MWU A;  3ZVT A;  1KE3 A;  5FI6 A;  2A49 A;  2XD5 A;  1NY0 A;  3P09 A;  5FAT A;  4JXV A;  3OCN A;  1MWS A;  3N7W A;  5DTT A;  3ZG8 B;  5EUA A;  3W4O A;  1BLS A;  2ZQ7 A;  4KZ8 A;  3ZG7 B;  5L2F A;  5KSH A;  3N8S A;  4P87 A;  3Q1F A;  4IVK A;  1S0W A;  2JCH A;  3VP1 A;  2WK0 A;  4N1X A;  4R0Q A;  4QY6 A;  1RP5 A;  3ZNT A;  4BJP A;  3C7V A;  3IF6 A;  4HEF A;  5CEC A;  3O88 A;  3GRJ A;  5DF8 A;  4EBP A;  2OLV A;  1K55 A;  4JF5 A;  3W8K A;  2ZC3 B;  3I7J A;  1U60 A;  3IWQ A;  3PBR A;  2IWC A;  1Q2P A;  4HBU A;  3SS4 A;  4WEK A;  3UY6 A;  3UN7 A;  3G32 A;  3MZE A;  4BD0 A;  2ZC7 A;  4BL3 A;  1H8Z A;  4DRT A;  4P6B A;  3IT9 A;  3PAG A;  5AQ7 A;  5KZH A;  5BOH A;  3BYD A;  4OP8 A;  5HAR A;  2WAD A;  4CJN A;  3BEC A;  1MBL A;  1KDW A;  1KGF A;  1W8Q A;  3BRM A;  1AXB A;  3SOI A;  4EBL A;  4ZDX A;  3NDE A;  3ZVW A;  4KZ6 A;  2P9V B;  4OPR A;  3N6I A;  1GHP A;  1GA9 A;  1MKI A;  3NDG A;  3VOZ A;  1FCM A;  3V39 A;  2HPB A;  1LI0 A;  5GHY A;  3GTC A;  1E3U A;  1SDE A;  1PWD A;  1ZG4 A;  4DE2 A;  4KZ4 A;  3UE1 A;  1W5D A;  1KE0 A;  3FWL A;  3OZH A;  4D2O A;  5GL9 A;  3CMZ A;  4WM9 A;  4FH4 A;  1G68 A;  1PW8 A;  3TSG A;  3PBQ A;  3BLS A;  3FKW A;  3ZG9 B;  5TFQ A;  1NJ4 A;  3DWZ A;  4GB7 A;  5CTM A;  3UDF A;  3WWX A;  3GSG A;  4KQO A;  1XKZ A;  2XEP A;  3PBT A;  4B88 A;  3G30 A;  5FSR A;  1QME A;  3V3S A;  4MBF A;  4RVA A;  2R9X A;  3S1Y A;  4DE0 A;  4P0M A;  3V5M A;  3NI9 A;  3WS0 A;  1KE4 A;  1IEL A;  3SS3 A;  1VM1 A;  4R3B A;  3UO9 A;  3BLM A;  3G2Z A;  2WZX A;  4E3M A;  2PU2 A;  1HTZ A;  4ZAM A;  5FQI A;  1ALQ A;  2VGJ A;  1JTG A;  2WAF A;  2ZQC A;  3IF6 B;  4YFM A;  3D4F A;  1K6R A;  2G2U A;  4E3O A;  1H5X A;  3NBL A;  5A90 A;  3VSL A;  5CEB A;  1S6R A;  3Q7Z A;  5IHV A;  2QMI A;  1N9B A;  1TVF A;  4K0W A;  1FQG A;  4WZ4 A;  3HVF A;  3OPP A;  3ITB A;  3NIA A;  5E2F A;  3IH8 A;  3G34 A;  5FQK A;  3CJM A;  4XUX A;  3QNB A;  4DDS A;  4A5R A;  4KZ5 A;  4JBF A;  1W8Y A;  3HLF A;  4JXW A;  3DWK A;  2WZZ A;  3HLD A;  5AQ9 A;  1BZA A;  4JF4 A;  3ZFZ A;  4IED A;  2EFU A;  3Q81 A;  4OLG A;  1ERM A;  5KMW A;  4ZTK A;  3HLC A;  2C5W B;  2XDM A;  5DVA A;  5A91 A;  2ZMA A;  2EX9 A;  2ZQD A;  4JPM A;  1ES3 A;  3O87 A;  3ZHH A;  4N9K A;  1NYM A;  3ZG0 A;  3LY4 A;  2ZC4 B;  5KSC A;  2A3U A;  4KZ3 A;  4LV2 A;  4BEN A;  1ERQ A;  4EWF A;  3AGD A;  4P85 A;  5HFO A;  3VP4 A;  3FZC A;  2Y2L A;  1J9M A;  3B3X A;  4GD6 A;  2H10 A;  1I2W A;  4KG5 A;  3FYZ A;  4Z9Q A;  1TDG A;  3HUM A;  2XFS A;  1OME A;  4GDB A;  4EBN A;  1HVB A;  4RYE A;  3S4X A;  1LI9 A;  2FFY A;  1FCN A;  1K4E A;  5TGF A;  1FOF A;  1XXM A;  4EQI A;  1NZU A;  5EEC A;  4DXB A;  4B4X A;  2XK1 A;  3A3J A;  3UPP A;  3VP3 A;  3Q82 A;  1DJA A;  2BG1 A;  4OLD A;  3Q7V A;  2HDR A;  1JTD A;  1XPB A;  3IF6 C;  4E3N A;  4JKT A;  2WAE A;  4Y0O A;  3W4P A;  4DE1 A;  1K55 C;  4X69 A;  5FQQ A;  3BM6 A;  2XD1 A;  2JBF A;  1LHY A;  1O07 A;  1XX2 A;  2IWD A;  5HW3 A;  1LL5 A;  4UAA A;  4KG2 A;  3BFE A;  4UHU A;  3E2K A;  1CK3 A;  3IWO A;  1IYS A;  3MKE A;  2EX6 A;  3VP0 A;  1YMX A;  5GLA A;  1NYY A;  2ZQ8 A;  3RXW A;  1ES4 A;  3S22 A;  2Y2N A;  4B4Z A;  4WEL A;  3GV9 A;  3MXS A;  1M6K A;  5EVI D;  3SH9 A;  4Y0U A;  4K91 A;  1MY8 A;  4C3Q A;  3WS1 A;  4E6W A;  5AQA A;  5GHZ A;  2J7V A;  4Q8I A;  4N9L A;  5HAI A;  1ESI A;  3OC2 A;  4FD8 A;  1JWV A;  2CC1 A;  5EPH A;  5DTS A;  4MBH A;  1BTL A;  1YLW A;  4YIN A;  1LL9 A;  2H0Y A;  2Y2J A;  1I2S A;  3CZD A;  4QB8 A;  4U0X A;  1HZO A;  3GVB A;  3DTM A;  4KEN B;  5A93 A;  1BUE A;  2JE5 A;  1K38 A;  5HAP A;  3UE0 A;  4S2P A;  1ZKJ A;  3G4P A;  1GCE A;  1XP4 A;  5CRF A;  2EFX A;  3Q07 A;  1Q2Q A;  1JVJ A;  4QHC A;  1BUL A;  2B5R A;  4LV3 A;  4KQR A;  3DW0 A;  1VQQ A;  2Y55 A;  5F82 A;  4N1H A;  5M19 A;  2HP9 A;  4S2N A;  2V1Z A;  3V3R A;  5GLC A;  3GR2 A;  2V20 A;  4R3J A;  3AGF A;  2EX8 A;  4FSF A;  3MZD A;  3ISG A;  1JWP A;  4KZ9 A;  2ZQ9 A;  1ERO A;  2Q9M A;  5F83 A;  4OH0 A;  2QZ6 A;  3AGE A;  2H0T A;  2GDN A;  1MPL A;  1ES5 A;  4ZJ1 A;  3V50 A;  4K0X A;  1ZC2 A;  1PI4 A;  3NY4 A;  1YLP A;  1YLZ A;  4GOG A;  3WS4 A;  1CI9 A;  1KVL A;  2Y59 A;  4WEJ A;  4F94 A;  4XXR A;  4NK3 A;  1W79 A;  4PM8 A;  5TR7 A;  2OLU A;  5E2H A;  3Q7V B;  4JLF A;  1GA0 A;  1W7F A;  4QU3 A;  1WYB A;  3MXR A;  4U3T A;  1FR6 A;  3N8R A;  4MNR A;  4E3K A;  4EV4 A;  4XUZ A;  3NC8 A;  1PIO A;  2XF3 A;  3BFD A;  1K6S A;  4RX2 A;  2Z2L B;  2X71 A;  4BD1 A;  2Y91 A;  5G18 A;  4S2K A;  1DY6 A;  5CGW A;  4S2O A;  3MZF A;  3VP2 A;  3IXB A;  1GHM A;  2OSU A;  2XH9 A;  3PTE A;  3WRZ A;  5JYP A;  3A3E A;  2HDQ A;  2WGW A;  3HLW A;  1CEF A;  4QY5 A;  3IWI A;  1NRF A;  5E2G A;  3QHY A;  2J9O A;  1RGY A;  4JF6 A;  3IHB A;  4E3J A;  1XGI A;  3A3I A;  4WZ5 A;  1XGJ A;  3IH9 A;  1IYQ A;  4UA9 A;  5FAQ A;  5CED A;  1ONG A;  3ZCZ A;  3IHA A;  3M6H A;  4HBT A;  4S2L A;  4GDN A;  2XR0 A;  1SHV A;  2Y2G A;  2ZC5 B;  3P98 A;  2ZLY A;  2ZM0 A;  4H8R A;  1EI5 A;  4LV0 A;  1E25 A;  2P74 A;  2Y2Q A;  5J8X A;  4R4S A;  3PBS A;  3ITA A;  1YT4 A;  2R9W A;  2XGN A;  5EVL A;  1MWR A;  1Z6F A;  1NXY A;  4LV1 A;  4R4R A;  5CXW A;  1K57 A;  2WYX A;  1PWC A;  1WE4 A;  5FAO A;  3HBR A;  2UWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...