3Q7VA

Beta-lactam-sensor domain of blar1 (apo) from staphylococcus aureus with carboxylated lys392
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
252
structure length
252
Chain Sequence
QSITDYNYKKPLHNDYQILDKSKIFGSNSGSFVMYSMAADAYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase regulatory protein BlaR1
publication title Lysine Nzeta-decarboxylation switch and activation of the beta-lactam sensor domain of BlaR1 protein of methicillin-resistant Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase regulator
total genus 88
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q7vA00
4KQQA 1BUEA 1N4OA 1NXYA 3OZHA 4FD8A 4IVIA 3TOIA 5FATA 1BLPA 1ONHA 2FFFB 3GQZA 1GHIA 5KMWA 1K55C 1K54A 1MBLA 3HBRA 2ZC3B 4E3NA 2ZQ8A 4WELA 5CECA 3GSGA 4OQ0A 3MBZA 5A93A 2P9VB 4QD4A 1YM1A 4EBPA 1ES3A 3A3EA 2ZQAA 3O3VA 3EQUA 1O07A 4JBFA 3BFFA 4QY6A 2XDMA 4BQMA 3RJUA 3VP1A 3MZFA 3ZCZA 4C75A 1YLPA 4GNUA 2H0YA 4Y0UA 5F1GA 2EXAA 2IWBA 3Q07A 4S2OA 4XUZA 4EQIA 5CXWA 3P09A 1FCMA 3GRJA 4F94A 3GVBA 3VFHA 2ZD8A 1ZC2A 1W79A 2Y2LA 3ZDJA 4KZ5A 5F83A 3A3DA 1RGZA 4E3LA 4WBGA 1ES4A 4ZDXA 5CEDA 1JWPA 4Z9QA 3G35A 4KZBA 4H8RA 1KGEA 2C5WB 3NDEA 3SH8A 1YT4A 2QZ6A 2H5SA 3UDXA 5JYOA 2ZM2A 3PBOA 3UPNA 3ZG7B 1KGFA 4EV4A 3RXWA 5TFQA 1IKIA 4OP5A 4KZ6A 1YLYA 2Z2LB 3HUMA 4RX3A 4N92A 5FDHA 4Y7PA 3SH7A 5M19A 5U47A 3Q1FA 3IWQA 3I7JA 5GLDA 2R9XA 2X02A 5KZHA 5EECA 3G2YA 4WYYA 1PWGA 3WS1A 5EVIB 3UO9A 4X69A 1JWZA 4WMCD 1L0GA 3SS3A 1L0DA 2VGJA 3E2KA 3W8KA 1IYSA 4B4ZA 2HP5A 3GMWA 3PTEA 4OKPA 1TEMA 3G34A 4GZBA 1HVBA 4FH2A 3EQVA 2V2FF 1CI8A 1FR1A 3N4IA 3LY3A 4BENA 5HAQA 4LV2A 5L2FA 3IHAA 2BLSA 1GA9A 3FWLA 2Y55A 4R23A 4S2NA 1DJCA 2OSUA 3JYIA 2ZM8A 4S2NC 1BTLA 1TDGA 1JTDA 1E3UA 1ALQA 2Y2JA 4GKUA 1CI9A 4LV3A 4MBFA 4XUXA 3UDIA 3C5AA 2ZC4B 3PAEA 4WZ5A 4CJNA 5GHYA 3IH9A 1PW8A 4P0MA 1W7FA 5HW3A 3CMZA 1ES5A 3NDGA 2Z2MB 3RXXA 3ZFZA 4DRTA 4RX2A 3Q7ZA 3MKFA 1LLBA 4BL3A 1XA1A 5EPHA 1BLSA 2WUQA 3PBRA 4GN2A 1DJAA 4UA9A 1SCWA 4QB8A 5F1FA 1S0WA 4S2PA 5HAIA 4CPKA 4P87A 4PPRA 1RP5A 4WZ4A 3IF6B 1M6KA 3CZDA 2P9VA 1NRFA 4GB7A 4JF6A 3QNBA 4BJPA 5FI7A 1E4DA 1E3UD 1ESUA 2WGIA 3QHYA 5D3OA 5CTNA 5GL9A 2WKHA 1JWVA 1XGJA 3ITBA 1KDSA 4LV0A 1CEFA 3TG9A 2WGWB 1I2SA 3WS0A 1IYPA 2J7VA 2XFTA 3IXDA 3DWKA 3V50A 5CRFA 2WKIA 1SDNA 1SHVA 1FR6A 2X01A 2R9WA 3BYDA 3LO7A 3PBTA 3BFGA 2P74A 4U3TA 3S4XA 2J8YA 2WZXA 3HREA 5CTMA 4E3IA 5EUAA 4FH4A 5FQKA 2JC7A 4WM9A 3IWIA 5G18A 3UY6A 2HDRA 1K55A 4QJGA 1PYYA 4JF5A 4WEKA 1ES2A 1K25A 1XGIA 3ISGA 2XD1A 2BG1A 1CK3A 3HLGA 5KSCA 1H8YA 4R4SA 3WRTA 5CHJA 4KZAA 1YLJA 1G68A 4JXSA 5AQ9A 2G2WA 2Y2OA 2EFUA 4X56A 2IWCA 1XA7A 1XKZA 3OCNA 5GHXA 5J8XA 2XF3A 2XH9A 4OONA 4OOYA 3WS4A 4ZJ2A 4M3KA 5EVIC 3TSGA 4DE0A 3FKVA 1DY6A 1YQSA 4OPZA 1BSGA 2EX8A 4BL2A 3BM6A 4X68A 4DDSA 2JE5A 1FSWA 1IKGA 4PM5A 2PU4A 4Y0TA 2UWXA 4K91A 4WMCA 5E2FA 4K0WA 3V5MA 3ZNTA 3UPOA 3PBSA 4UA7A 3WRZA 4MEZA 1Y54A 3C4OA 2WZZA 3LCEA 1RCJA 3GTCA 4KG6A 5FSRA 2OV5A 2OLUA 5CERA 4OLDA 3ZG8B 3OPPA 2EX2A 5CHUA 2Y2MA 5GLCA 3UE0A 1WE4A 3ZHHA 5BOHA 3Q7VA 3ITAA 4RA7A 3FZCA 3N8LA 5EVID 5KSHA 1HTZA 5DTSA 5DTTA 4FCFA 2E8IA 3VP3A 2VGKA 3IXBA 5FA7A 3MXRA 4UHUA 5DVAA 4KZ4A 3HLFA 3M2JA 1FQGA 4EUZA 1IYQA 2ZQ7A 3UE1A 3WS5A 3O88A 4NK3A 3AGDA 1E25A 3A3FA 4E6XA 2HP6A 1MWUA 1RGYA 1W8QA 2Y91A 2HDUA 2WGVA 1H5XA 4LV1A 1MPLA 5EOOA 4DXCA 3DTMA 4GDBA 1BZAA 1LL9A 2A49A 3IF6C 4E6WA 4RVAA 1TVFA 3M6HA 4L0LA 1VQQA 4A5RA 1SKFA 1K57C 5GLAA 4KQRA 4FSFA 4E3MA 3MZDA 4N9KA 4E3OA 4O7DA 1Q2PA 5AQBA 4IEDA 3O87A 1KVLA 5FASA 3IH8A 1PWCA 2H10A 5FAQA 5HAPA 1DJBA 2WGWA 1PWDA 3VMAA 1K4EA 4HBTA 5CGWA 2Y4AA 4BD1A 1PI5A 3SS5A 3CJMA 3ZG0A 1XPBA 3Q81A 1K56A 1LI0A 4KG2A 4N9LA 2I72A 3IHBA 4OOLA 5FAOA 4JPMA 1BLCA 1O7EA 4UAAA 3BRMA 3BEBA 3HUNA 3O86A 3UN7A 3BECA 4OQIA 1FCOA 2ZQCA 3IF5A 4HBUA 4OP8A 5IHVA 4R4RA 1IELA 4DE2A 2ZC6B 4OLGA 1GA0A 1NYYA 3ZVTA 3FKWA 4JKTA 2Q9MA 3ZNYA 2PU2A 4JXGA 5M1AA 4Y0OA 5A91A 4LENA 3HLCA 3ZGAB 2Y2QA 2HPBA 5A92A 3N6IA 2G2UA 5CGXA 1GHPA 1WYBA 4MNRA 5DTKA 4DDYA 3ZG9B 5FI2A 1KE4A 1EI5A 1K56D 4KZ8A 3SS4A 1FOFA 3MXSA 1LHYA 5GHZA 1NJ4A 1YMSA 5EVLA 3AGFA 3NY4A 2WKEA 3HUOA 2ZQDA 5FQ9A 5GLBA 4KQOA 3CG5A 5HX9A 5DF9A 1J9MA 1NZUA 1KE3A 2DRWA 3SH9A 2DNSA 3ZG5A 2EFXA 3G4PA 1Q2QA 4IBRA 4ZAMA 5FQJA 3UE3A 1K4FA 2XQZA 5FI6A 4YFMA 3HLWA 4KZ3A 4BD0A 4KZ9A 3MFDA 4C6YA 1NY0A 2Y2PA 1XX2A 4S2JA 4GD8A 3P98A 5FQMA 1QMEA 1BLHA 3DW0A 4EWFA 1OMEA 2XFSA 4E3KA 1LI9A 2ZM0A 1MWRA 2RL3A 4K0XA 3WS2A 4R1GA 3OCLA 2QMIA 3VSKA 4ZTKA 3VP2A 5EVIA 3W4PA 4EBLA 1NYMA 2HDSA 1L0FA 4ZJ3A 3S1YA 3N8RA 1L2SA 4JXVA 3A3JA 4OQHA 4QHCA 1QMFA 1G6AA 4WEJA 4HESA 1YLWA 3NIAA 2Q9NA 3IXHA 3IWOA 2B5RA 3WWXA 2V1ZA 4GDNA 1W8YA 3C4PA 2Y2NA 4ZBEA 1YLZA 4B4XA 1K54C 3NBLA 3A3IA 2XLNA 4NETA 4JLFA 3VSLA 4DE3A 1S6RA 5DF8A 5TGFA 1K6RA 1C3BA 2Y2IA 2QPNA 5EOEA 2WAEA 4Q8IA 3C7VA 1I5QA 3BLMA 5E2GA 1KGGA 4OOMA 3W4QA 5M18A 1WYCA 3FV7A 1IEMA 3S22A 5I94A 1NZOA 3W4OA 4UA6A 2PBYA 5FAPA 1BT5A 3PAGA 2ZQ9A 4GD6A 4BLMA 1KE0A 4N1XA 2Y2HA 3OPLA 4N1HA 3SOIA 1AXBA 3MZEA 1N9BA 1SDEA 2ZC7A 1ERQA 1PI4A 1IYOA 4ZJ1A 4U0TA 1H8ZA 4QU3A 1FCNA 3AGEA 2C6WB 4ID4A 4S2LA 5AQAA 3HVFA 3IT9A 3IQAA 1JVJA 4OVDA 3IF6A 4PMAA 5FQQA 3UPPA 4R0QA 4KENB 4KG5A 1VM1A 1K57A 4IBXA 4R3BA 3G31A 4OPRA 5A90A 5CHMA 5TR7A 4LCLA 3NC8A 4MBHA 5CEBA 1PW1A 3Q82A 5CGSA 2XEPA 2JBFA 2V20A 4JXWA 3VOZA 3N8SA 4QY5A 5AQ7A 3G2ZA 1PZOA 2ZMAA 2EX6A 3BFDA 2Y59A 3G30A 5HFOA 2OLVA 4KZ7A 4E3JA 3QNCA 2HP9A 3G32A 3BFEA 3NCKA 1HD8A 4DE1A 4GOGA 3IXGA 4YINA 5E43A 1YLTA 3V3SA 1M40A 2Y2KA 3BLSA 4C3QA 3GV9A 1LL5A 2JCHA 5E2HA 5DF7A 3C7UA 5JYPA 1ESIA 1K38A 5EE8A 4PM8A 4PM6A 1ONGA 3D4FA 3LY4A 1FSYA 4R3JA 2CC1A 4MLLA 1L0EA 1ERMA 2H0TA 1Z6FA 4XXRA 3HL9A 4X55A 4PM7A 1XXMA 1MWSA 3Q7VB 2WK0A 1TDLA 3PBNA 4WZ5C 3VFFA 4MBKA 3V3RA 5E2EA 1GCEA 2HDQA 5HL1A 1PIOA 3HLBA 4OQGA 4EBNA 3M2KA 3UDFA 3N7WA 1MXOA 1XP4A 3PBQA 4OH0A 3DWZA 1K6SA 2FFYA 1JTGA 1W5DA 1EROA 1CEGA 1I2WA 1YMXA 1ZG6A 1KVMA 2RCXA 2XD5A 1GHMA 4B88A 3V39A 3BFCA 4LCMA 1U60A 2XGNA 3HLDA 2GDNA 4DXBA 1MY8A 1HZOA 2WAFA 2IWDA 3HLEA 3VP0A 2WADA 2J9OA 1ZG4A 3E2LA 4S2KA 4DF6A 3OPRA 3UNWA 3M6BA 5FQIA 3OPHA 2WYXA 2Y2GA 4JF4A 1MKIA 4OPYA 2XK1A 2EXBA 3NI9A 4S2IA 5F82A 1ZKJA 2ZC5B 2EX9A 4IVKA 1KDWA 4U0XA 4OPQA 3FYZA 3GR2A 3VP4A 3ZVWA 4DKIA 2XR0A 1EWZA 2DCFA 4S2MA 4RYEA 2J9PA 3LEZA 3VOYA 3OC2A 2ZJ9A 5HARA 4P85A 2ZLYA 2X71A 4D2OA 4X53A 1MWTA 4X6TA 4P6BA 2A3UA 4HEFA 4PM9A 1PZPA 3B3XA 1BULA 3MKEA
chains in the Genus database with same CATH superfamily
4KQQA 3TOIA 1BLPA 3GQZA 1GHIA 5KMWA 1K55C 4E3NA 4WELA 3GSGA 3NOUC 4WF0A 5A93A 2P9VB 4R6LA 5L10A 1ES3A 2ZQAA 2L4RA 2JKRM 3EQUA 4BQMA 3ZCZA 4C75A 3C30A 2IWBA 4S2OA 1FCMA 4F94A 5G4ZA 3VFHA 1ZC2A 1W79A 4HH3A 2HZ5A 3A3DA 4E3LA 1ES4A 3HJIA 2C5WB 5JYOA 4LFUA 4KZ6A 5FDHA 4Y7PA 2JN7A 4KUKA 2R9XA 3NOPC 5EECA 4WYYA 3B33A 4JGOA 2OWJA 1L0GA 3SS3A 1D06A 3W8KA 2HP5A 2VA0A 1OJGA 1CQAA 3PTEA 5HD5A 2V0WA 1TEMA 1HVBA 4BENA 4LV2A 5L2FA 3IHAA 2BLSA 1Y28A 4R23A 1S1YA 2OSUA 5J3WA 1BTLA 3EGDC 2Y2JA 4XUXA 3C8CA 4HHDA 5EV0A 3C5AA 5FL3A 3PAEA 2CMNA 4R70A 3IH9A 4P0MA 3CMZA 4EEUA 1S1ZA 3Q7ZA 3MKFA 1BLSA 1DJAA 4UA9A 2KDKA 1CF0A 3O5YA 1M6KA 1NRFA 4GB7A 3T12B 2J3TD 4LPZA 1E4DA 1E3UD 4WL9A 4B9OA 2KLIA 5CTNA 1XGJA 3ITBA 4FOFA 1OJ5A 1YSPA 5HPFA 2VV6A 4QPRA 3TRCA 3TG9A 5TBMB 3WS0A 1IYPA 2XFTA 3IXDA 5CRFA 2X01A 3PBTA 2P74A 4WM9A 2HDRA 4JF5A 1K25A 2XD1A 2BG1A 3HLGA 3VV4A 3IBJA 4WLAA 3CPTB 5GHXA 3IBRA 5J8XA 3B42A 2PT7A 3DTIA 2XH9A 4OONA 2M1CA 4ZJ2A 4M3KA 4DE0A 4II7A 3FKVA 4OPZA 1BSGA 1OTIA 3BM6A 4X68A 1IKGA 4O8GA 3V5MA 3L9KA 1Y54A 2OV5A 3PYPA 3OPPA 2AVXA 5GLCA 5BOHA 1D1JA 3D72A 3ITAA 4RA7A 1DRMA 5DTSA 5DTTA 4FCFA 4RQ9A 2YKFA 4UHUA 5DVAA 3HLFA 4NXEA 4EUZA 3O88A 4GW9A 3AGDA 3A3FA 1MWUA 2W1TB 1W8QA 3MQ0A 2L0WA 3IF6C 1UWNX 4RVAA 1A0KA 3MQQA 1SKFA 1K57C 3MZDA 4N9KA 2QWSA 1P0ZA 1DJBA 1PWDA 3DTEA 1PI5A 3CJMA 1XPBA 4KG2A 3CUEA 2DMWA 4JPMA 4JGQA 3UN7A 2ZQCA 4I5SA 1IELA 2K7SA 3ZVTA 3NHQA 3ZNYA 2BASA 5M1AA 2Y2QA 5DFYA 5A92A 2G2UA 5CGXA 1EI5A 4I3AA 3S7PA 4GS9A 3NJAA 2WKEA 5FQ9A 5GLBA 2GX5A 3CG5A 5HX9A 5DF9A 1J9MA 4ME4A 3ZG5A 2EFXA 2IA2A 4IBRA 5FQJA 2XQZA 4S2JA 3P98A 3CLOA 2H28A 4E3KA 4LGWA 4JGRA 1YSQA 2XSSA 3OCLA 2QMIA 4NXBA 1IFQA 3S1YA 3N8RA 1L2SA 4JXVA 1QMFA 2Q9NA 3WWXA 1W8YA 4ZBEA 1K54C 3A3IA 2WAEA 4Q8IA 3C7VA 3T1SA 2O9BA 4OOMA 1NWZA 3LI8A 3W4QA 5M18A 1IEMA 5DKKA 3S22A 2PBYA 1BT5A 1ODVA 2I9VA 2ZQ9A 1N9BA 1IYOA 4Y13A 5FEGA 1P97A 3HVFA 3G31A 4OPRA 5TR7A 3IX8A 4MBHA 5CEBA 3Q82A 2JBFA 4JXWA 3VOZA 4QY5A 3G2ZA 2EX6A 2Y59A 3G30A 1L3LA 3F1OB 1YKDA 4KZ7A 5HPIA 3QNCA 2V8FA 3BFEA 3IXGA 4YINA 2PR6A 2VZWA 3F1NA 5E2HA 5JYPA 4FUWA 3KSGA 1ESIA 1K38A 3LY4A 4R3JA 3A0RA 2CC1A 1L0EA 1S66L 3LR0A 5F5YA 4UQIS 3Q7VB 3U4LP 2WK0A 4WZ5C 4EW7A 2YKHA 5E2EA 2HDQA 2W3GA 2Z6DA 3PBQA 1JTGA 2P08A 2RCXA 1GHMA 2XGNA 3S7QA 3E98A 3HLDA 3NULA 1X0OA 3VP0A 2WADA 2FZ0A 1XJ4A 4S2KA 5FQIA 2WYXA 2Y2GA 2JKRI 1KDWA 4OPQA 5HDSA 4MDZA 2PDRA 2V8CA 4D60A 2VV8A 1EWZA 4S2MA 3OC2A 4X53A 4X6TA 3H82B 4P6BA 2A3UA 1PZPA 3B3XA 3MKEA 1N4OA 5HL6A 4EUVA 5CECA 4OQ0A 1OT9A 3EGXC 4QD4A 1BYWA 3A3EA 3BFFA 3RJUA 3MZFA 1YLPA 4GNUA 2H0YA 2P04A 4Y0UA 2EXAA 3Q07A 4XUZA 3P09A 3GRJA 4GHIB 2M7UA 3UB6A 5F83A 5CEDA 3E4OA 4ARZA 3G35A 4KZBA 1KGEA 5AVEA 1DP6A 1YT4A 2H5SA 2QZ6A 3LEQA 3UDXA 4Y5FA 4EV4A 1IKIA 4OP5A 2Z2LB 2ZBBA 1VETB 3MQOA 2X02A 1W63Q 5KZHA 1XJ2A 2D01A 3G2YA 1PWGA 4HJ6A 5EVIB 1CJFA 4DMZA 2VGJA 4E04A 1CI8A 1W63M 3LY3A 5HAQA 3MJQA 1GA9A 3FWLA 1TDGA 1E3UA 1H3QA 4GKUA 4LV3A 4MBFA 2ZC4B 2XROA 3LUQA 2VK3A 1PW8A 3UB8A 3NDGA 3RXXA 5EPHA 2WUQA 3R7WA 4QB8A 1D7EA 3CITA 1H0MA 4P87A 4Y17A 2P9VA 4QWOA 3NOTC 3QNBA 2QHKA 1ESUA 4EESA 3QHYA 2OAP1 1YAXA 4LV0A 2VX8A 4NG2A 2WGWB 3DWKA 2WKIA 1SDNA 1VHMA 1TS0A 1FR6A 3LO7A 3P7NA 1HLUP 3H9WA 4U3TA 4E3IA 2JC7A 4O01A 1PFLA 1K55A 3LGOA 4QJGA 5HDDA 1CK3A 5KSCA 3LIEA 3CHWP 3QP1A 1H8YA 3WRTA 5CHJA 3EOIA 3LICA 1GSXA 1YLJA 2Y2OA 2EFUA 2IWCA 1XA7A 4JGPA 1XKZA 2PYPA 3WS4A 4PHTA 5HSQA 4DDSA 1FSWA 4PM5A 3KSIA 4Y0TA 1DP8A 4K91A 4WMCA 5A8BA 3ZNTA 3PBSA 2OLUA 3OLOA 3ZG8B 1P9WA 2EX2A 2Y2MA 1WE4A 5EVID 3N8LA 5KSHA 1VEUB 3IXBA 4BBTA 4YWZA 1IYQA 3UE1A 3L7HA 4LRZE 3WS5A 2XA7S 2O99A 4E6XA 2Y91A 2WGVA 1NRJA 2UV0E 3KYZA 4DXCA 1LL9A 4E6WA 3UMDA 5GLAA 4KQRA 4E3MA 4O7DA 2PD7A 1KVLA 5FASA 2H10A 3QP5A 5F6AA 5TBMA 1XJ6A 3VOLA 4PKYA 2WKPA 1LI0A 1BLCA 3BEBA 4OQIA 4OP8A 4HNBA 4R3AA 1GA0A 2A24A 2LB5A 4I3IA 1XJ3A 1F2KA 3LI9A 4MMNA 3IX3A 2VLGA 2HPBA 2B02A 3CAXA 2JKTM 1GHPA 4MNRA 5FI2A 4KZ8A 4L9FA 1LHYA 4I38A 5EVLA 1SKOB 4HJ4A 1NZUA 2G7UA 2W3FA 4ZAMA 3UE3A 1Q2QA 2Y79A 2FH5A 2KX6A 2V1BA 3QP8A 4C6YA 1NY0A 2EWVA 2Z6CA 2ZMVA 2JKGA 4IHQA 1V9YA 4EWFA 1OMEA 4ETZA 5IS1A 4CQHA 2GNXA 1ZHHB 2RL3A 4K0XA 2JKFA 3WS2A 3PXPA 3UB5P 4XT2A 1NYMA 2HDSA 5IU1A 4ZJ3A 2W1TA 3IXHA 3IWOA 4PKYG 3C4PA 2Y2NA 1YLZA 1F98A 2VGLS 4AFIA 1G6OA 2XLNA 4JLFA 3BW6A 3CWFA 5DF8A 3VE4A 3F1PA 2QPNA 4Y2FA 1I5QA 5E2GA 1KGGA 1WYCA 3EEHA 1NZOA 5DJTA 3PAGA 3MSHA 1WA9A 5CX7A 1KE0A 4BBUA 2K2NA 4N1HA 1SDEA 3G6OA 3LIFA 4QU3A 3IT9A 3IQAA 1J3WA 2PRFA 3IF6A 3H7WA 5FQQA 3UPPA 4R0QA 1K57A 4IBXA 5CHMA 3NC8A 1PW1A 5CGSA 4BWIA 5DKLA 4HH2A 3N8SA 1PZOA 1YPRA 5HFOA 4GOGA 5E43A 1K0KA 2Y2KA 3GV9A 1LL5A 1OTBA 2JCHA 5EE8A 4PM8A 4PM6A 1ONGA 3QP6A 3BY8A 4MLLA 2H0TA 1Z6FA 4XXRA 1FILA 4WN5A 4PM7A 2W3HA 4LLOB 5C5KA 1N9LA 3V3RA 1GCEA 1PIOA 4OQGA 3UDFA 3N7WA 5K5BA 2HGVA 1EROA 1CEGA 1I2WA 1YMXA 3BJNA 5EM0A 3V39A 4B88A 2PBDP 3BFCA 4LCMA 4DXBA 1MY8A 3V67A 2J9OA 3E2LA 4DF6A 3M6BA 4JF4A 1MKIA 2VGLM 5F82A 2ZC5B 2EX9A 4Y3IA 3FYZA 3VP4A 4ESPA 4F3LA 4RYEA 2ZLYA 4HOIA 2WKQA 4H6JA 4HEFA 4PM9A 5L8MA 1BULA 5CTMA 5F68A 1BUEA 1NXYA 3OZHA 4FD8A 4IVIA 1K54A 1MBLA 3HBRA 2ZC3B 3K3CA 2ZQ8A 4O0PA 4NKPA 4EBPA 1O07A 3VP1A 3E4QA 3F1OA 5J7EA 1TS8A 5F1GA 5CXWA 4GS9B 5DJUA 4HP4A 4CLCB 2ZD8A 3HCYA 2OOLA 5KIZA 1RGZA 4WBGA 4ZDXA 1JWPA 4H8RA 3NDEA 2Q0OA 3SH8A 2W3DA 1KGFA 3RXWA 5TFQA 4NXFA 4P6ZS 4N92A 5U47A 3PHYA 2VV7A 3IWQA 5GLDA 3SZTA 4BMWA 3UO9A 1JWZA 3A0VA 1L0DA 1S4RA 1IYSA 4B4ZA 3GMWA 2BTFP 4Q0HA 3G34A 2W3EA 4FH2A 2V2FF 1FR1A 3N4IA 1OT6A 2QJ5A 2ZM8A 1CI9A 3UDIA 4WZ5A 4CJNA 5GHYA 3H82A 2LB9A 1ES5A 2Z2MB 3A0SA 2GZAA 3PBRA 3CI6A 4GN2A 5F1FA 1S0WA 4S2PA 5HAIA 2PD8A 4CPKA 1RP5A 4WZ4A 2OAQ1 4HY8A 1GSWA 4JF6A 3IS2B 4BJPA 5FI7A 5D3OA 2HJEA 2WKHA 1JWVA 1KDSA 1CEFA 1I2SA 1T19A 4GHIA 3T4SA 3BFGA 2J8YA 2WZXA 3HREA 4FH4A 5FQKA 3UY6A 1PYYA 3F1NB 4WEKA 3KYQA 1STZA 3UB7A 3C38A 2WKRA 2J80A 4KZAA 5HD3A 4EQ1A 1VETA 1G68A 2V1AA 4JXSA 5AQ9A 3K2NA 2G2WA 3UMEA 5IT5A 2XF3A 4CLCD 5EVIC 3TSGA 1DY6A 1YQSA 4BL2A 3BY9A 2JE5A 1DP9A 2UWXA 5E2FA 4K0WA 3UPOA 3WRZA 4MEZA 1MKMA 3T4OA 3LCEA 1RCJA 3GTCA 4KG6A 5DFXA 1ACFA 3LR3A 3UE0A 3FZCA 3U2AA 2E8IA 4MN5A 2PHYA 2VGKA 3MXRA 3LR4A 4KZ4A 1VB6A 1FQGA 2QYBA 4UQIM 4NK3A 1E25A 1RGYA 2HDUA 1H5XA 4LV1A 5MC7A 4GDBA 1BZAA 2A49A 4L9EA 3M6HA 1VQQA 4GLQA 4E3OA 5AQBA 4HQAA 1PWCA 2WGWA 2A2LA 1FIKA 3VMAA 1K4EA 5J4EA 4HBTA 5CGWA 4BBVA 2Y4AA 4BD1A 3SS5A 2JHEA 2O0YA 4HIAA 3ZG0A 3RTYA 3VE3A 3IHBA 4Q0IA 5FAOA 1F5MA 1S4SA 1O7EA 4UAAA 3BRMA 2ZOHA 3BECA 1FCOA 5IHVA 3W2ZA 3HJKA 1LSXA 2ZC6B 4DE2A 4R38A 1IOUA 1NYYA 4IUKA 2Q9MA 2PU2A 4Y0OA 5A91A 4LENA 3HLCA 3ZGAB 3N6IA 1LL8A 4CLCE 1WYBA 5DTKA 4DDYA 3T50A 1K56D 1FOFA 3S7OA 1NJ4A 2ZL1B 3E4PA 3AGFA 3NY4A 2ZQDA 2R78A 3FG8A 2DRWA 5F69A 3SH9A 2DNSA 1K4FA 5FI6A 4YFMA 1MZUA 3KYEA 3MFDA 4G3VA 2Y2PA 4L9GA 2M7VA 1XX2A 3NECA 2EA9A 1BLHA 3DW0A 2XFSA 1LI9A 1MWRA 3TW8A 4R1GA 3VSKA 1F9IA 4ZTKA 3FPVA 4EBLA 1G6AA 4WEJA 3NIAA 3ZYTA 3R7WB 3RFBA 2MJ6A 1S6RA 1OTDA 5EOEA 1P9RA 3BLMA 1G5UA 2GJ3A 5I94A 4UA6A 5FAPA 4BLMA 4N1XA 3OPLA 3SOIA 1AXBA 3MZEA 2ZC7A 1ERQA 4ZJ1A 4U0TA 1H8ZA 4S2LA 1FCNA 2C6WB 3AGEA 4ID4A 5AQAA 5FDSA 4EERA 1JVJA 1T1BA 4KENB 3MXQA 4KG5A 4R3BA 4LCLA 3LR5A 3BQAA 2Y8HA 1SKOA 4E3JA 3NCKA 1HD8A 3IX4A 4DE1A 3ICYA 3V3SA 3BLSA 4Z1WA 5DF7A 3C7UA 3D4FA 5HWTA 4KUOA 3CPTA 4ZRRA 1TDLA 3PBNA 3VFFA 4MBKA 4EBNA 4X1MA 1K6SA 1W5DA 1ZG6A 1KVMA 4HP9A 3FC7A 2PR5A 4DJ2A 3HLEA 2O9CA 4IJGA 3GDIA 2D02A 3OPRA 4FTXA 3OPHA 2XK1A 3NI9A 4NXGA 1ZKJA 4IVKA 4YNRA 3GR2A 3VOYA 1PNEA 3LEZA 2ZJ9A 1JNUA 5HARA 4P85A 4D2OA 4UEYA 5FATA 1ONHA 2FFFB 2PAVP 2XA7M 1TF1A 2A24B 3MBZA 1YM1A 2VKSA 3KO6A 3O3VA 4JBFA 4QY6A 2XDMA 5EVEA 3T4QA 1TD5A 4MN7A 1OPXA 4EQIA 1G28A 4EXOA 3GVBA 2Y2LA 3ZDJA 4KZ5A 4Z9QA 2ZM2A 3PBOA 3PR6A 3UPNA 3ZG7B 4NEED 1YLYA 3HUMA 4RX3A 3SH7A 3Q1FA 3I7JA 4XT2B 4Q0JA 3WS1A 3LIDA 2PYRA 1GSVA 4X69A 4WMCD 1MC0A 3E2KA 1OTAA 4OKPA 4GZBA 3EQVA 3DBAA 3MR0A 1PRQA 3T4TA 3DTKA 3SW1A 2Y55A 4S2NA 3QP2A 1DJCA 3F1PB 3JYIA 2INWA 4S2NC 1T18A 1JTDA 2ZMFA 1ALQA 1KOUA 3S7NA 1NLYA 1W7FA 5HW3A 3D9YA 3EWKA 1EW0A 5L09A 3ZFZA 4DRTA 3CUEC 4RX2A 2E8JA 1LLBA 4BL3A 1XA1A 3LIAA 1SCWA 5G4YA 1LSWA 4PPRA 2NUTC 4K08A 3IF6B 3H7WB 1XFNA 3CZDA 4HI4A 1AWIA 3D3OA 5TJJA 2WGIA 3QP4A 4X1LA 5GL9A 2B95A 1SZVA 2W0NA 4EETB 2KOIA 2J7VA 3V50A 4CLCA 1SHVA 2R9WA 3BYDA 4CLCC 3S4XA 5EUAA 2W1RA 3IWIA 5G18A 1ES2A 1XGIA 4DJ3A 3ISGA 4LRYC 4R4SA 3MF0A 4X25A 4B93A 4X56A 2NUPC 3DAVA 3OCNA 3OBFA 2V9AA 3GECA 4OOYA 2VJWA 2EX8A 2PU4A 4UA7A 2HJ9C 3C4OA 2WZZA 3RH8B 3KX0X 5FSRA 5CERA 4OLDA 1N9OA 5CHUA 3ZHHA 3Q7VA 3LFVA 1HTZA 4F3LB 3VP3A 5FA7A 3M2JA 2ACGA 2O9AA 2ZQ7A 4H6JB 2HP6A 3E0YA 3KSFA 1MPLA 5EOOA 3DTMA 3BWLA 3IS2A 1TVFA 4L0LA 4A5RA 5EFWA 2J3WA 4FSFA 4MCWA 1Q2PA 5FEFA 4IEDA 3O87A 3IH8A 4I39A 4Y15A 5FAQA 5HAPA 5L07A 3TE8A 1TS6A 2W27A 1Y4OA 3EEAA 2HF6A 4N9LA 3Q81A 1K56A 4DN0A 2I72A 4OOLA 3K3DA 3T4JA 2B18A 3HUNA 3O86A 3IF5A 4HBUA 4R4RA 4OLGA 3FKWA 4JKTA 4G3KA 5AJGA 4JXGA 4EEPA 5I5LA 5LBRA 4GJ4A 3FPWA 3ZG9B 1KE4A 3JVVA 2K31A 3SS4A 3MXSA 5GHZA 1YMSA 3HUOA 4KQOA 3T1XA 1S67L 1KE3A 3G4PA 2V0UA 5HWVA 4HJ3A 1LT0A 3JVUA 3HLWA 4KZ3A 4BD0A 4KZ9A 4GD8A 5FQMA 1QMEA 2ZM0A 3MFXA 4P6ZM 3VP2A 3P01A 5EVIA 3W4PA 1L0FA 4OQHA 3A3JA 4QHCA 3KSHA 4HESA 1YLWA 3MMHA 2B5RA 2V1ZA 4GDNA 3T1QB 4B4XA 3UB9A 4ETXA 3NBLA 3VSLA 4NETA 4DE3A 5TGFA 1K6RA 1C3BA 2Y2IA 2P7JA 3LYXA 3FV7A 3W4OA 1UWPX 4YOFA 3T4LA 1V9ZA 4GD6A 3T1RA 2Y2HA 1PI4A 4LRXC 2ZOIA 2QJ7A 4EU0A 4KQDA 2QKPA 4OVDA 4PMAA 1H8MA 1VM1A 3JPUA 5A90A 4PAUA 1XFQA 4IUHA 2XEPA 2V20A 3UE6A 4M4XA 4I3JA 5AQ7A 3TJZC 2ZMAA 3BFDA 2JKTI 3B47A 2ZL1A 5EM1A 2HV1A 2OLVA 3ULFA 2HP9A 3G32A 2L1MA 1YLTA 1M40A 4C3QA 1LSVA 3R4KA 4ARZB 5HDCA 4MN6A 3OOVA 1FSYA 3ZQ5A 1ERMA 3T4KA 2J3TC 3HL9A 4X55A 1XXMA 3MS6A 1MWSA 5HL1A 3HLBA 1N9NA 3M2KA 2EWWA 1MXOA 1XP4A 4OH0A 3DWZA 2FFYA 4GCZA 2XD5A 3C2WA 1OTEA 1U60A 1T1AA 2GDNA 3LIBA 1HZOA 1ZTUA 1UGUA 2IWDA 2VEAA 2WAFA 2XRNA 3BQ8A 1T1CA 1ZG4A 2OWHA 3UNWA 4WUJA 4OPYA 2EXBA 4S2IA 5HZHA 1TS7A 3ZVWA 4U0XA 1NLZA 4DKIA 2XR0A 4G3WA 2DCFA 1VEUA 2J9PA 5HWWA 5AVFA 1Z09A 2X71A 1MWTA 5M19A
chains in the Genus database with same CATH topology
4KQQA 1BUEA 1N4OA 1NXYA 3OZHA 4FD8A 4IVIA 3TOIA 5FATA 1BLPA 1ONHA 2FFFB 3GQZA 1GHIA 5KMWA 1K55C 1K54A 1MBLA 3HBRA 2ZC3B 4E3NA 2ZQ8A 4WELA 5CECA 3GSGA 4OQ0A 3MBZA 5A93A 2P9VB 4QD4A 1YM1A 4EBPA 1ES3A 3A3EA 2ZQAA 3O3VA 3EQUA 1O07A 4JBFA 3BFFA 4QY6A 2XDMA 4BQMA 3RJUA 3VP1A 3MZFA 3ZCZA 4C75A 1YLPA 4GNUA 2H0YA 4Y0UA 5F1GA 2EXAA 2IWBA 3Q07A 4S2OA 4XUZA 4EQIA 5CXWA 3P09A 1FCMA 3GRJA 4F94A 3GVBA 3VFHA 2ZD8A 1ZC2A 1W79A 2Y2LA 3ZDJA 4KZ5A 5F83A 3A3DA 1RGZA 4E3LA 4WBGA 1ES4A 4ZDXA 5CEDA 1JWPA 4Z9QA 3G35A 4KZBA 4H8RA 1KGEA 2C5WB 3NDEA 3SH8A 1YT4A 2QZ6A 2H5SA 3UDXA 5JYOA 2ZM2A 3PBOA 3UPNA 3ZG7B 1KGFA 4EV4A 3RXWA 5TFQA 1IKIA 4OP5A 4KZ6A 1YLYA 2Z2LB 3HUMA 4RX3A 4N92A 5FDHA 4Y7PA 3SH7A 5M19A 5U47A 3Q1FA 3IWQA 3I7JA 5GLDA 2R9XA 2X02A 5KZHA 5EECA 3G2YA 4WYYA 1PWGA 3WS1A 5EVIB 3UO9A 4X69A 1JWZA 4WMCD 1L0GA 3SS3A 1L0DA 2VGJA 3E2KA 3W8KA 1IYSA 4B4ZA 2HP5A 3GMWA 3PTEA 4OKPA 1TEMA 3G34A 4GZBA 1HVBA 4FH2A 3EQVA 2V2FF 1CI8A 1FR1A 3N4IA 3LY3A 4BENA 5HAQA 4LV2A 5L2FA 3IHAA 2BLSA 1GA9A 3FWLA 2Y55A 4R23A 4S2NA 1DJCA 2OSUA 3JYIA 2ZM8A 4S2NC 1BTLA 1TDGA 1JTDA 1E3UA 1ALQA 2Y2JA 4GKUA 1CI9A 4LV3A 4MBFA 4XUXA 3UDIA 3C5AA 2ZC4B 3PAEA 4WZ5A 4CJNA 5GHYA 3IH9A 1PW8A 4P0MA 1W7FA 5HW3A 3CMZA 1ES5A 3NDGA 2Z2MB 3RXXA 3ZFZA 4DRTA 4RX2A 3Q7ZA 3MKFA 1LLBA 4BL3A 1XA1A 5EPHA 1BLSA 2WUQA 3PBRA 4GN2A 1DJAA 4UA9A 1SCWA 4QB8A 5F1FA 1S0WA 4S2PA 5HAIA 4CPKA 4P87A 4PPRA 1RP5A 4WZ4A 3IF6B 1M6KA 3CZDA 2P9VA 1NRFA 4GB7A 4JF6A 3QNBA 4BJPA 5FI7A 1E4DA 1E3UD 1ESUA 2WGIA 3QHYA 5D3OA 5CTNA 5GL9A 2WKHA 1JWVA 1XGJA 3ITBA 1KDSA 4LV0A 1CEFA 3TG9A 2WGWB 1I2SA 3WS0A 1IYPA 2J7VA 2XFTA 3IXDA 3DWKA 3V50A 5CRFA 2WKIA 1SDNA 1SHVA 1FR6A 2X01A 2R9WA 3BYDA 3LO7A 3PBTA 3BFGA 2P74A 4U3TA 3S4XA 2J8YA 2WZXA 3HREA 5CTMA 4E3IA 5EUAA 4FH4A 5FQKA 2JC7A 4WM9A 3IWIA 5G18A 3UY6A 2HDRA 1K55A 4QJGA 1PYYA 4JF5A 4WEKA 1ES2A 1K25A 1XGIA 3ISGA 2XD1A 2BG1A 1CK3A 3HLGA 5KSCA 1H8YA 4R4SA 3WRTA 5CHJA 4KZAA 1YLJA 1G68A 4JXSA 5AQ9A 2G2WA 2Y2OA 2EFUA 4X56A 2IWCA 1XA7A 1XKZA 3OCNA 5GHXA 5J8XA 2XF3A 2XH9A 4OONA 4OOYA 3WS4A 4ZJ2A 4M3KA 5EVIC 3TSGA 4DE0A 3FKVA 1DY6A 1YQSA 4OPZA 1BSGA 2EX8A 4BL2A 3BM6A 4X68A 4DDSA 2JE5A 1FSWA 1IKGA 4PM5A 2PU4A 4Y0TA 2UWXA 4K91A 4WMCA 5E2FA 4K0WA 3V5MA 3ZNTA 3UPOA 3PBSA 4UA7A 3WRZA 4MEZA 1Y54A 3C4OA 2WZZA 3LCEA 1RCJA 3GTCA 4KG6A 5FSRA 2OV5A 2OLUA 5CERA 4OLDA 3ZG8B 3OPPA 2EX2A 5CHUA 2Y2MA 5GLCA 3UE0A 1WE4A 3ZHHA 5BOHA 3Q7VA 3ITAA 4RA7A 3FZCA 3N8LA 5EVID 5KSHA 1HTZA 5DTSA 5DTTA 4FCFA 2E8IA 3VP3A 2VGKA 3IXBA 5FA7A 3MXRA 4UHUA 5DVAA 4KZ4A 3HLFA 3M2JA 1FQGA 4EUZA 1IYQA 2ZQ7A 3UE1A 3WS5A 3O88A 4NK3A 3AGDA 1E25A 3A3FA 4E6XA 2HP6A 1MWUA 1RGYA 1W8QA 2Y91A 2HDUA 2WGVA 1H5XA 4LV1A 1MPLA 5EOOA 4DXCA 3DTMA 4GDBA 1BZAA 1LL9A 2A49A 3IF6C 4E6WA 4RVAA 1TVFA 3M6HA 4L0LA 1VQQA 4A5RA 1SKFA 1K57C 5GLAA 4KQRA 4FSFA 4E3MA 3MZDA 4N9KA 4E3OA 4O7DA 1Q2PA 5AQBA 4IEDA 3O87A 1KVLA 5FASA 3IH8A 1PWCA 2H10A 5FAQA 5HAPA 1DJBA 2WGWA 1PWDA 3VMAA 1K4EA 4HBTA 5CGWA 2Y4AA 4BD1A 1PI5A 3SS5A 3CJMA 3ZG0A 1XPBA 3Q81A 1K56A 1LI0A 4KG2A 4N9LA 2I72A 3IHBA 4OOLA 5FAOA 4JPMA 1BLCA 1O7EA 4UAAA 3BRMA 3BEBA 3HUNA 3O86A 3UN7A 3BECA 4OQIA 1FCOA 2ZQCA 3IF5A 4HBUA 4OP8A 5IHVA 4R4RA 1IELA 4DE2A 2ZC6B 4OLGA 1GA0A 1NYYA 3ZVTA 3FKWA 4JKTA 2Q9MA 3ZNYA 2PU2A 4JXGA 5M1AA 4Y0OA 5A91A 4LENA 3HLCA 3ZGAB 2Y2QA 2HPBA 5A92A 3N6IA 2G2UA 5CGXA 1GHPA 1WYBA 4MNRA 5DTKA 4DDYA 3ZG9B 5FI2A 1KE4A 1EI5A 1K56D 4KZ8A 3SS4A 1FOFA 3MXSA 1LHYA 5GHZA 1NJ4A 1YMSA 5EVLA 3AGFA 3NY4A 2WKEA 3HUOA 2ZQDA 5FQ9A 5GLBA 4KQOA 3CG5A 5HX9A 5DF9A 1J9MA 1NZUA 1KE3A 2DRWA 3SH9A 2DNSA 3ZG5A 2EFXA 3G4PA 1Q2QA 4IBRA 4ZAMA 5FQJA 3UE3A 1K4FA 2XQZA 5FI6A 4YFMA 3HLWA 4KZ3A 4BD0A 4KZ9A 3MFDA 4C6YA 1NY0A 2Y2PA 1XX2A 4S2JA 4GD8A 3P98A 5FQMA 1QMEA 1BLHA 3DW0A 4EWFA 1OMEA 2XFSA 4E3KA 1LI9A 2ZM0A 1MWRA 2RL3A 4K0XA 3WS2A 4R1GA 3OCLA 2QMIA 3VSKA 4ZTKA 3VP2A 5EVIA 3W4PA 4EBLA 1NYMA 2HDSA 1L0FA 4ZJ3A 3S1YA 3N8RA 1L2SA 4JXVA 3A3JA 4OQHA 4QHCA 1QMFA 1G6AA 4WEJA 4HESA 1YLWA 3NIAA 2Q9NA 3IXHA 3IWOA 2B5RA 3WWXA 2V1ZA 4GDNA 1W8YA 3C4PA 2Y2NA 4ZBEA 1YLZA 4B4XA 1K54C 3NBLA 3A3IA 2XLNA 4NETA 4JLFA 3VSLA 4DE3A 1S6RA 5DF8A 5TGFA 1K6RA 1C3BA 2Y2IA 2QPNA 5EOEA 2WAEA 4Q8IA 3C7VA 1I5QA 3BLMA 5E2GA 1KGGA 4OOMA 3W4QA 5M18A 1WYCA 3FV7A 1IEMA 3S22A 5I94A 1NZOA 3W4OA 4UA6A 2PBYA 5FAPA 1BT5A 3PAGA 2ZQ9A 4GD6A 4BLMA 1KE0A 4N1XA 2Y2HA 3OPLA 4N1HA 3SOIA 1AXBA 3MZEA 1N9BA 1SDEA 2ZC7A 1ERQA 1PI4A 1IYOA 4ZJ1A 4U0TA 1H8ZA 4QU3A 1FCNA 3AGEA 2C6WB 4ID4A 4S2LA 5AQAA 3HVFA 3IT9A 3IQAA 1JVJA 4OVDA 3IF6A 4PMAA 5FQQA 3UPPA 4R0QA 4KENB 4KG5A 1VM1A 1K57A 4IBXA 4R3BA 3G31A 4OPRA 5A90A 5CHMA 5TR7A 4LCLA 3NC8A 4MBHA 5CEBA 1PW1A 3Q82A 5CGSA 2XEPA 2JBFA 2V20A 4JXWA 3VOZA 3N8SA 4QY5A 5AQ7A 3G2ZA 1PZOA 2ZMAA 2EX6A 3BFDA 2Y59A 3G30A 5HFOA 2OLVA 4KZ7A 4E3JA 3QNCA 2HP9A 3G32A 3BFEA 3NCKA 1HD8A 4DE1A 4GOGA 3IXGA 4YINA 5E43A 1YLTA 3V3SA 1M40A 2Y2KA 3BLSA 4C3QA 3GV9A 1LL5A 2JCHA 5E2HA 5DF7A 3C7UA 5JYPA 1ESIA 1K38A 5EE8A 4PM8A 4PM6A 1ONGA 3D4FA 3LY4A 1FSYA 4R3JA 2CC1A 4MLLA 1L0EA 1ERMA 2H0TA 1Z6FA 4XXRA 3HL9A 4X55A 4PM7A 1XXMA 1MWSA 3Q7VB 2WK0A 1TDLA 3PBNA 4WZ5C 3VFFA 4MBKA 3V3RA 5E2EA 1GCEA 2HDQA 5HL1A 1PIOA 3HLBA 4OQGA 4EBNA 3M2KA 3UDFA 3N7WA 1MXOA 1XP4A 3PBQA 4OH0A 3DWZA 1K6SA 2FFYA 1JTGA 1W5DA 1EROA 1CEGA 1I2WA 1YMXA 1ZG6A 1KVMA 2RCXA 2XD5A 1GHMA 4B88A 3V39A 3BFCA 4LCMA 1U60A 2XGNA 3HLDA 2GDNA 4DXBA 1MY8A 1HZOA 2WAFA 2IWDA 3HLEA 3VP0A 2WADA 2J9OA 1ZG4A 3E2LA 4S2KA 4DF6A 3OPRA 3UNWA 3M6BA 5FQIA 3OPHA 2WYXA 2Y2GA 4JF4A 1MKIA 4OPYA 2XK1A 2EXBA 3NI9A 4S2IA 5F82A 1ZKJA 2ZC5B 2EX9A 4IVKA 1KDWA 4U0XA 4OPQA 3FYZA 3GR2A 3VP4A 3ZVWA 4DKIA 2XR0A 1EWZA 2DCFA 4S2MA 4RYEA 2J9PA 3LEZA 3VOYA 3OC2A 2ZJ9A 5HARA 4P85A 2ZLYA 2X71A 4D2OA 4X53A 1MWTA 4X6TA 4P6BA 2A3UA 4HEFA 4PM9A 1PZPA 3B3XA 1BULA 3MKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KQQ A;  1BUE A;  1N4O A;  1NXY A;  3OZH A;  4FD8 A;  4IVI A;  3TOI A;  5FAT A;  1BLP A;  1ONH A;  2FFF B;  3GQZ A;  1GHI A;  5KMW A;  1K55 C;  1K54 A;  1MBL A;  3HBR A;  2ZC3 B;  4E3N A;  2ZQ8 A;  4WEL A;  5CEC A;  3GSG A;  4OQ0 A;  3MBZ A;  5A93 A;  2P9V B;  4QD4 A;  1YM1 A;  4EBP A;  1ES3 A;  3A3E A;  2ZQA A;  3O3V A;  3EQU A;  1O07 A;  4JBF A;  3BFF A;  4QY6 A;  2XDM A;  4BQM A;  3RJU A;  3VP1 A;  3MZF A;  3ZCZ A;  4C75 A;  1YLP A;  4GNU A;  2H0Y A;  4Y0U A;  5F1G A;  2EXA A;  2IWB A;  3Q07 A;  4S2O A;  4XUZ A;  4EQI A;  5CXW A;  3P09 A;  1FCM A;  3GRJ A;  4F94 A;  3GVB A;  3VFH A;  2ZD8 A;  1ZC2 A;  1W79 A;  2Y2L A;  3ZDJ A;  4KZ5 A;  5F83 A;  3A3D A;  1RGZ A;  4E3L A;  4WBG A;  1ES4 A;  4ZDX A;  5CED A;  1JWP A;  4Z9Q A;  3G35 A;  4KZB A;  4H8R A;  1KGE A;  2C5W B;  3NDE A;  3SH8 A;  1YT4 A;  2QZ6 A;  2H5S A;  3UDX A;  5JYO A;  2ZM2 A;  3PBO A;  3UPN A;  3ZG7 B;  1KGF A;  4EV4 A;  3RXW A;  5TFQ A;  1IKI A;  4OP5 A;  4KZ6 A;  1YLY A;  2Z2L B;  3HUM A;  4RX3 A;  4N92 A;  5FDH A;  4Y7P A;  3SH7 A;  5M19 A;  5U47 A;  3Q1F A;  3IWQ A;  3I7J A;  5GLD A;  2R9X A;  2X02 A;  5KZH A;  5EEC A;  3G2Y A;  4WYY A;  1PWG A;  3WS1 A;  5EVI B;  3UO9 A;  4X69 A;  1JWZ A;  4WMC D;  1L0G A;  3SS3 A;  1L0D A;  2VGJ A;  3E2K A;  3W8K A;  1IYS A;  4B4Z A;  2HP5 A;  3GMW A;  3PTE A;  4OKP A;  1TEM A;  3G34 A;  4GZB A;  1HVB A;  4FH2 A;  3EQV A;  2V2F F;  1CI8 A;  1FR1 A;  3N4I A;  3LY3 A;  4BEN A;  5HAQ A;  4LV2 A;  5L2F A;  3IHA A;  2BLS A;  1GA9 A;  3FWL A;  2Y55 A;  4R23 A;  4S2N A;  1DJC A;  2OSU A;  3JYI A;  2ZM8 A;  4S2N C;  1BTL A;  1TDG A;  1JTD A;  1E3U A;  1ALQ A;  2Y2J A;  4GKU A;  1CI9 A;  4LV3 A;  4MBF A;  4XUX A;  3UDI A;  3C5A A;  2ZC4 B;  3PAE A;  4WZ5 A;  4CJN A;  5GHY A;  3IH9 A;  1PW8 A;  4P0M A;  1W7F A;  5HW3 A;  3CMZ A;  1ES5 A;  3NDG A;  2Z2M B;  3RXX A;  3ZFZ A;  4DRT A;  4RX2 A;  3Q7Z A;  3MKF A;  1LLB A;  4BL3 A;  1XA1 A;  5EPH A;  1BLS A;  2WUQ A;  3PBR A;  4GN2 A;  1DJA A;  4UA9 A;  1SCW A;  4QB8 A;  5F1F A;  1S0W A;  4S2P A;  5HAI A;  4CPK A;  4P87 A;  4PPR A;  1RP5 A;  4WZ4 A;  3IF6 B;  1M6K A;  3CZD A;  2P9V A;  1NRF A;  4GB7 A;  4JF6 A;  3QNB A;  4BJP A;  5FI7 A;  1E4D A;  1E3U D;  1ESU A;  2WGI A;  3QHY A;  5D3O A;  5CTN A;  5GL9 A;  2WKH A;  1JWV A;  1XGJ A;  3ITB A;  1KDS A;  4LV0 A;  1CEF A;  3TG9 A;  2WGW B;  1I2S A;  3WS0 A;  1IYP A;  2J7V A;  2XFT A;  3IXD A;  3DWK A;  3V50 A;  5CRF A;  2WKI A;  1SDN A;  1SHV A;  1FR6 A;  2X01 A;  2R9W A;  3BYD A;  3LO7 A;  3PBT A;  3BFG A;  2P74 A;  4U3T A;  3S4X A;  2J8Y A;  2WZX A;  3HRE A;  5CTM A;  4E3I A;  5EUA A;  4FH4 A;  5FQK A;  2JC7 A;  4WM9 A;  3IWI A;  5G18 A;  3UY6 A;  2HDR A;  1K55 A;  4QJG A;  1PYY A;  4JF5 A;  4WEK A;  1ES2 A;  1K25 A;  1XGI A;  3ISG A;  2XD1 A;  2BG1 A;  1CK3 A;  3HLG A;  5KSC A;  1H8Y A;  4R4S A;  3WRT A;  5CHJ A;  4KZA A;  1YLJ A;  1G68 A;  4JXS A;  5AQ9 A;  2G2W A;  2Y2O A;  2EFU A;  4X56 A;  2IWC A;  1XA7 A;  1XKZ A;  3OCN A;  5GHX A;  5J8X A;  2XF3 A;  2XH9 A;  4OON A;  4OOY A;  3WS4 A;  4ZJ2 A;  4M3K A;  5EVI C;  3TSG A;  4DE0 A;  3FKV A;  1DY6 A;  1YQS A;  4OPZ A;  1BSG A;  2EX8 A;  4BL2 A;  3BM6 A;  4X68 A;  4DDS A;  2JE5 A;  1FSW A;  1IKG A;  4PM5 A;  2PU4 A;  4Y0T A;  2UWX A;  4K91 A;  4WMC A;  5E2F A;  4K0W A;  3V5M A;  3ZNT A;  3UPO A;  3PBS A;  4UA7 A;  3WRZ A;  4MEZ A;  1Y54 A;  3C4O A;  2WZZ A;  3LCE A;  1RCJ A;  3GTC A;  4KG6 A;  5FSR A;  2OV5 A;  2OLU A;  5CER A;  4OLD A;  3ZG8 B;  3OPP A;  2EX2 A;  5CHU A;  2Y2M A;  5GLC A;  3UE0 A;  1WE4 A;  3ZHH A;  5BOH A;  3Q7V A;  3ITA A;  4RA7 A;  3FZC A;  3N8L A;  5EVI D;  5KSH A;  1HTZ A;  5DTS A;  5DTT A;  4FCF A;  2E8I A;  3VP3 A;  2VGK A;  3IXB A;  5FA7 A;  3MXR A;  4UHU A;  5DVA A;  4KZ4 A;  3HLF A;  3M2J A;  1FQG A;  4EUZ A;  1IYQ A;  2ZQ7 A;  3UE1 A;  3WS5 A;  3O88 A;  4NK3 A;  3AGD A;  1E25 A;  3A3F A;  4E6X A;  2HP6 A;  1MWU A;  1RGY A;  1W8Q A;  2Y91 A;  2HDU A;  2WGV A;  1H5X A;  4LV1 A;  1MPL A;  5EOO A;  4DXC A;  3DTM A;  4GDB A;  1BZA A;  1LL9 A;  2A49 A;  3IF6 C;  4E6W A;  4RVA A;  1TVF A;  3M6H A;  4L0L A;  1VQQ A;  4A5R A;  1SKF A;  1K57 C;  5GLA A;  4KQR A;  4FSF A;  4E3M A;  3MZD A;  4N9K A;  4E3O A;  4O7D A;  1Q2P A;  5AQB A;  4IED A;  3O87 A;  1KVL A;  5FAS A;  3IH8 A;  1PWC A;  2H10 A;  5FAQ A;  5HAP A;  1DJB A;  2WGW A;  1PWD A;  3VMA A;  1K4E A;  4HBT A;  5CGW A;  2Y4A A;  4BD1 A;  1PI5 A;  3SS5 A;  3CJM A;  3ZG0 A;  1XPB A;  3Q81 A;  1K56 A;  1LI0 A;  4KG2 A;  4N9L A;  2I72 A;  3IHB A;  4OOL A;  5FAO A;  4JPM A;  1BLC A;  1O7E A;  4UAA A;  3BRM A;  3BEB A;  3HUN A;  3O86 A;  3UN7 A;  3BEC A;  4OQI A;  1FCO A;  2ZQC A;  3IF5 A;  4HBU A;  4OP8 A;  5IHV A;  4R4R A;  1IEL A;  4DE2 A;  2ZC6 B;  4OLG A;  1GA0 A;  1NYY A;  3ZVT A;  3FKW A;  4JKT A;  2Q9M A;  3ZNY A;  2PU2 A;  4JXG A;  5M1A A;  4Y0O A;  5A91 A;  4LEN A;  3HLC A;  3ZGA B;  2Y2Q A;  2HPB A;  5A92 A;  3N6I A;  2G2U A;  5CGX A;  1GHP A;  1WYB A;  4MNR A;  5DTK A;  4DDY A;  3ZG9 B;  5FI2 A;  1KE4 A;  1EI5 A;  1K56 D;  4KZ8 A;  3SS4 A;  1FOF A;  3MXS A;  1LHY A;  5GHZ A;  1NJ4 A;  1YMS A;  5EVL A;  3AGF A;  3NY4 A;  2WKE A;  3HUO A;  2ZQD A;  5FQ9 A;  5GLB A;  4KQO A;  3CG5 A;  5HX9 A;  5DF9 A;  1J9M A;  1NZU A;  1KE3 A;  2DRW A;  3SH9 A;  2DNS A;  3ZG5 A;  2EFX A;  3G4P A;  1Q2Q A;  4IBR A;  4ZAM A;  5FQJ A;  3UE3 A;  1K4F A;  2XQZ A;  5FI6 A;  4YFM A;  3HLW A;  4KZ3 A;  4BD0 A;  4KZ9 A;  3MFD A;  4C6Y A;  1NY0 A;  2Y2P A;  1XX2 A;  4S2J A;  4GD8 A;  3P98 A;  5FQM A;  1QME A;  1BLH A;  3DW0 A;  4EWF A;  1OME A;  2XFS A;  4E3K A;  1LI9 A;  2ZM0 A;  1MWR A;  2RL3 A;  4K0X A;  3WS2 A;  4R1G A;  3OCL A;  2QMI A;  3VSK A;  4ZTK A;  3VP2 A;  5EVI A;  3W4P A;  4EBL A;  1NYM A;  2HDS A;  1L0F A;  4ZJ3 A;  3S1Y A;  3N8R A;  1L2S A;  4JXV A;  3A3J A;  4OQH A;  4QHC A;  1QMF A;  1G6A A;  4WEJ A;  4HES A;  1YLW A;  3NIA A;  2Q9N A;  3IXH A;  3IWO A;  2B5R A;  3WWX A;  2V1Z A;  4GDN A;  1W8Y A;  3C4P A;  2Y2N A;  4ZBE A;  1YLZ A;  4B4X A;  1K54 C;  3NBL A;  3A3I A;  2XLN A;  4NET A;  4JLF A;  3VSL A;  4DE3 A;  1S6R A;  5DF8 A;  5TGF A;  1K6R A;  1C3B A;  2Y2I A;  2QPN A;  5EOE A;  2WAE A;  4Q8I A;  3C7V A;  1I5Q A;  3BLM A;  5E2G A;  1KGG A;  4OOM A;  3W4Q A;  5M18 A;  1WYC A;  3FV7 A;  1IEM A;  3S22 A;  5I94 A;  1NZO A;  3W4O A;  4UA6 A;  2PBY A;  5FAP A;  1BT5 A;  3PAG A;  2ZQ9 A;  4GD6 A;  4BLM A;  1KE0 A;  4N1X A;  2Y2H A;  3OPL A;  4N1H A;  3SOI A;  1AXB A;  3MZE A;  1N9B A;  1SDE A;  2ZC7 A;  1ERQ A;  1PI4 A;  1IYO A;  4ZJ1 A;  4U0T A;  1H8Z A;  4QU3 A;  1FCN A;  3AGE A;  2C6W B;  4ID4 A;  4S2L A;  5AQA A;  3HVF A;  3IT9 A;  3IQA A;  1JVJ A;  4OVD A;  3IF6 A;  4PMA A;  5FQQ A;  3UPP A;  4R0Q A;  4KEN B;  4KG5 A;  1VM1 A;  1K57 A;  4IBX A;  4R3B A;  3G31 A;  4OPR A;  5A90 A;  5CHM A;  5TR7 A;  4LCL A;  3NC8 A;  4MBH A;  5CEB A;  1PW1 A;  3Q82 A;  5CGS A;  2XEP A;  2JBF A;  2V20 A;  4JXW A;  3VOZ A;  3N8S A;  4QY5 A;  5AQ7 A;  3G2Z A;  1PZO A;  2ZMA A;  2EX6 A;  3BFD A;  2Y59 A;  3G30 A;  5HFO A;  2OLV A;  4KZ7 A;  4E3J A;  3QNC A;  2HP9 A;  3G32 A;  3BFE A;  3NCK A;  1HD8 A;  4DE1 A;  4GOG A;  3IXG A;  4YIN A;  5E43 A;  1YLT A;  3V3S A;  1M40 A;  2Y2K A;  3BLS A;  4C3Q A;  3GV9 A;  1LL5 A;  2JCH A;  5E2H A;  5DF7 A;  3C7U A;  5JYP A;  1ESI A;  1K38 A;  5EE8 A;  4PM8 A;  4PM6 A;  1ONG A;  3D4F A;  3LY4 A;  1FSY A;  4R3J A;  2CC1 A;  4MLL A;  1L0E A;  1ERM A;  2H0T A;  1Z6F A;  4XXR A;  3HL9 A;  4X55 A;  4PM7 A;  1XXM A;  1MWS A;  3Q7V B;  2WK0 A;  1TDL A;  3PBN A;  4WZ5 C;  3VFF A;  4MBK A;  3V3R A;  5E2E A;  1GCE A;  2HDQ A;  5HL1 A;  1PIO A;  3HLB A;  4OQG A;  4EBN A;  3M2K A;  3UDF A;  3N7W A;  1MXO A;  1XP4 A;  3PBQ A;  4OH0 A;  3DWZ A;  1K6S A;  2FFY A;  1JTG A;  1W5D A;  1ERO A;  1CEG A;  1I2W A;  1YMX A;  1ZG6 A;  1KVM A;  2RCX A;  2XD5 A;  1GHM A;  4B88 A;  3V39 A;  3BFC A;  4LCM A;  1U60 A;  2XGN A;  3HLD A;  2GDN A;  4DXB A;  1MY8 A;  1HZO A;  2WAF A;  2IWD A;  3HLE A;  3VP0 A;  2WAD A;  2J9O A;  1ZG4 A;  3E2L A;  4S2K A;  4DF6 A;  3OPR A;  3UNW A;  3M6B A;  5FQI A;  3OPH A;  2WYX A;  2Y2G A;  4JF4 A;  1MKI A;  4OPY A;  2XK1 A;  2EXB A;  3NI9 A;  4S2I A;  5F82 A;  1ZKJ A;  2ZC5 B;  2EX9 A;  4IVK A;  1KDW A;  4U0X A;  4OPQ A;  3FYZ A;  3GR2 A;  3VP4 A;  3ZVW A;  4DKI A;  2XR0 A;  1EWZ A;  2DCF A;  4S2M A;  4RYE A;  2J9P A;  3LEZ A;  3VOY A;  3OC2 A;  2ZJ9 A;  5HAR A;  4P85 A;  2ZLY A;  2X71 A;  4D2O A;  4X53 A;  1MWT A;  4X6T A;  4P6B A;  2A3U A;  4HEF A;  4PM9 A;  1PZP A;  3B3X A;  1BUL A;  3MKE A; 
#chains in the Genus database with same CATH topology
 4KQQ A;  3TOI A;  1BLP A;  3GQZ A;  1GHI A;  5KMW A;  1K55 C;  4E3N A;  4WEL A;  3GSG A;  3NOU C;  4WF0 A;  5A93 A;  2P9V B;  4R6L A;  5L10 A;  1ES3 A;  2ZQA A;  2L4R A;  2JKR M;  3EQU A;  4BQM A;  3ZCZ A;  4C75 A;  3C30 A;  2IWB A;  4S2O A;  1FCM A;  4F94 A;  5G4Z A;  3VFH A;  1ZC2 A;  1W79 A;  4HH3 A;  2HZ5 A;  3A3D A;  4E3L A;  1ES4 A;  3HJI A;  2C5W B;  5JYO A;  4LFU A;  4KZ6 A;  5FDH A;  4Y7P A;  2JN7 A;  4KUK A;  2R9X A;  3NOP C;  5EEC A;  4WYY A;  3B33 A;  4JGO A;  2OWJ A;  1L0G A;  3SS3 A;  1D06 A;  3W8K A;  2HP5 A;  2VA0 A;  1OJG A;  1CQA A;  3PTE A;  5HD5 A;  2V0W A;  1TEM A;  1HVB A;  4BEN A;  4LV2 A;  5L2F A;  3IHA A;  2BLS A;  1Y28 A;  4R23 A;  1S1Y A;  2OSU A;  5J3W A;  1BTL A;  3EGD C;  2Y2J A;  4XUX A;  3C8C A;  4HHD A;  5EV0 A;  3C5A A;  5FL3 A;  3PAE A;  2CMN A;  4R70 A;  3IH9 A;  4P0M A;  3CMZ A;  4EEU A;  1S1Z A;  3Q7Z A;  3MKF A;  1BLS A;  1DJA A;  4UA9 A;  2KDK A;  1CF0 A;  3O5Y A;  1M6K A;  1NRF A;  4GB7 A;  3T12 B;  2J3T D;  4LPZ A;  1E4D A;  1E3U D;  4WL9 A;  4B9O A;  2KLI A;  5CTN A;  1XGJ A;  3ITB A;  4FOF A;  1OJ5 A;  1YSP A;  5HPF A;  2VV6 A;  4QPR A;  3TRC A;  3TG9 A;  5TBM B;  3WS0 A;  1IYP A;  2XFT A;  3IXD A;  5CRF A;  2X01 A;  3PBT A;  2P74 A;  4WM9 A;  2HDR A;  4JF5 A;  1K25 A;  2XD1 A;  2BG1 A;  3HLG A;  3VV4 A;  3IBJ A;  4WLA A;  3CPT B;  5GHX A;  3IBR A;  5J8X A;  3B42 A;  2PT7 A;  3DTI A;  2XH9 A;  4OON A;  2M1C A;  4ZJ2 A;  4M3K A;  4DE0 A;  4II7 A;  3FKV A;  4OPZ A;  1BSG A;  1OTI A;  3BM6 A;  4X68 A;  1IKG A;  4O8G A;  3V5M A;  3L9K A;  1Y54 A;  2OV5 A;  3PYP A;  3OPP A;  2AVX A;  5GLC A;  5BOH A;  1D1J A;  3D72 A;  3ITA A;  4RA7 A;  1DRM A;  5DTS A;  5DTT A;  4FCF A;  4RQ9 A;  2YKF A;  4UHU A;  5DVA A;  3HLF A;  4NXE A;  4EUZ A;  3O88 A;  4GW9 A;  3AGD A;  3A3F A;  1MWU A;  2W1T B;  1W8Q A;  3MQ0 A;  2L0W A;  3IF6 C;  1UWN X;  4RVA A;  1A0K A;  3MQQ A;  1SKF A;  1K57 C;  3MZD A;  4N9K A;  2QWS A;  1P0Z A;  1DJB A;  1PWD A;  3DTE A;  1PI5 A;  3CJM A;  1XPB A;  4KG2 A;  3CUE A;  2DMW A;  4JPM A;  4JGQ A;  3UN7 A;  2ZQC A;  4I5S A;  1IEL A;  2K7S A;  3ZVT A;  3NHQ A;  3ZNY A;  2BAS A;  5M1A A;  2Y2Q A;  5DFY A;  5A92 A;  2G2U A;  5CGX A;  1EI5 A;  4I3A A;  3S7P A;  4GS9 A;  3NJA A;  2WKE A;  5FQ9 A;  5GLB A;  2GX5 A;  3CG5 A;  5HX9 A;  5DF9 A;  1J9M A;  4ME4 A;  3ZG5 A;  2EFX A;  2IA2 A;  4IBR A;  5FQJ A;  2XQZ A;  4S2J A;  3P98 A;  3CLO A;  2H28 A;  4E3K A;  4LGW A;  4JGR A;  1YSQ A;  2XSS A;  3OCL A;  2QMI A;  4NXB A;  1IFQ A;  3S1Y A;  3N8R A;  1L2S A;  4JXV A;  1QMF A;  2Q9N A;  3WWX A;  1W8Y A;  4ZBE A;  1K54 C;  3A3I A;  2WAE A;  4Q8I A;  3C7V A;  3T1S A;  2O9B A;  4OOM A;  1NWZ A;  3LI8 A;  3W4Q A;  5M18 A;  1IEM A;  5DKK A;  3S22 A;  2PBY A;  1BT5 A;  1ODV A;  2I9V A;  2ZQ9 A;  1N9B A;  1IYO A;  4Y13 A;  5FEG A;  1P97 A;  3HVF A;  3G31 A;  4OPR A;  5TR7 A;  3IX8 A;  4MBH A;  5CEB A;  3Q82 A;  2JBF A;  4JXW A;  3VOZ A;  4QY5 A;  3G2Z A;  2EX6 A;  2Y59 A;  3G30 A;  1L3L A;  3F1O B;  1YKD A;  4KZ7 A;  5HPI A;  3QNC A;  2V8F A;  3BFE A;  3IXG A;  4YIN A;  2PR6 A;  2VZW A;  3F1N A;  5E2H A;  5JYP A;  4FUW A;  3KSG A;  1ESI A;  1K38 A;  3LY4 A;  4R3J A;  3A0R A;  2CC1 A;  1L0E A;  1S66 L;  3LR0 A;  5F5Y A;  4UQI S;  3Q7V B;  3U4L P;  2WK0 A;  4WZ5 C;  4EW7 A;  2YKH A;  5E2E A;  2HDQ A;  2W3G A;  2Z6D A;  3PBQ A;  1JTG A;  2P08 A;  2RCX A;  1GHM A;  2XGN A;  3S7Q A;  3E98 A;  3HLD A;  3NUL A;  1X0O A;  3VP0 A;  2WAD A;  2FZ0 A;  1XJ4 A;  4S2K A;  5FQI A;  2WYX A;  2Y2G A;  2JKR I;  1KDW A;  4OPQ A;  5HDS A;  4MDZ A;  2PDR A;  2V8C A;  4D60 A;  2VV8 A;  1EWZ A;  4S2M A;  3OC2 A;  4X53 A;  4X6T A;  3H82 B;  4P6B A;  2A3U A;  1PZP A;  3B3X A;  3MKE A;  1N4O A;  5HL6 A;  4EUV A;  5CEC A;  4OQ0 A;  1OT9 A;  3EGX C;  4QD4 A;  1BYW A;  3A3E A;  3BFF A;  3RJU A;  3MZF A;  1YLP A;  4GNU A;  2H0Y A;  2P04 A;  4Y0U A;  2EXA A;  3Q07 A;  4XUZ A;  3P09 A;  3GRJ A;  4GHI B;  2M7U A;  3UB6 A;  5F83 A;  5CED A;  3E4O A;  4ARZ A;  3G35 A;  4KZB A;  1KGE A;  5AVE A;  1DP6 A;  1YT4 A;  2H5S A;  2QZ6 A;  3LEQ A;  3UDX A;  4Y5F A;  4EV4 A;  1IKI A;  4OP5 A;  2Z2L B;  2ZBB A;  1VET B;  3MQO A;  2X02 A;  1W63 Q;  5KZH A;  1XJ2 A;  2D01 A;  3G2Y A;  1PWG A;  4HJ6 A;  5EVI B;  1CJF A;  4DMZ A;  2VGJ A;  4E04 A;  1CI8 A;  1W63 M;  3LY3 A;  5HAQ A;  3MJQ A;  1GA9 A;  3FWL A;  1TDG A;  1E3U A;  1H3Q A;  4GKU A;  4LV3 A;  4MBF A;  2ZC4 B;  2XRO A;  3LUQ A;  2VK3 A;  1PW8 A;  3UB8 A;  3NDG A;  3RXX A;  5EPH A;  2WUQ A;  3R7W A;  4QB8 A;  1D7E A;  3CIT A;  1H0M A;  4P87 A;  4Y17 A;  2P9V A;  4QWO A;  3NOT C;  3QNB A;  2QHK A;  1ESU A;  4EES A;  3QHY A;  2OAP 1;  1YAX A;  4LV0 A;  2VX8 A;  4NG2 A;  2WGW B;  3DWK A;  2WKI A;  1SDN A;  1VHM A;  1TS0 A;  1FR6 A;  3LO7 A;  3P7N A;  1HLU P;  3H9W A;  4U3T A;  4E3I A;  2JC7 A;  4O01 A;  1PFL A;  1K55 A;  3LGO A;  4QJG A;  5HDD A;  1CK3 A;  5KSC A;  3LIE A;  3CHW P;  3QP1 A;  1H8Y A;  3WRT A;  5CHJ A;  3EOI A;  3LIC A;  1GSX A;  1YLJ A;  2Y2O A;  2EFU A;  2IWC A;  1XA7 A;  4JGP A;  1XKZ A;  2PYP A;  3WS4 A;  4PHT A;  5HSQ A;  4DDS A;  1FSW A;  4PM5 A;  3KSI A;  4Y0T A;  1DP8 A;  4K91 A;  4WMC A;  5A8B A;  3ZNT A;  3PBS A;  2OLU A;  3OLO A;  3ZG8 B;  1P9W A;  2EX2 A;  2Y2M A;  1WE4 A;  5EVI D;  3N8L A;  5KSH A;  1VEU B;  3IXB A;  4BBT A;  4YWZ A;  1IYQ A;  3UE1 A;  3L7H A;  4LRZ E;  3WS5 A;  2XA7 S;  2O99 A;  4E6X A;  2Y91 A;  2WGV A;  1NRJ A;  2UV0 E;  3KYZ A;  4DXC A;  1LL9 A;  4E6W A;  3UMD A;  5GLA A;  4KQR A;  4E3M A;  4O7D A;  2PD7 A;  1KVL A;  5FAS A;  2H10 A;  3QP5 A;  5F6A A;  5TBM A;  1XJ6 A;  3VOL A;  4PKY A;  2WKP A;  1LI0 A;  1BLC A;  3BEB A;  4OQI A;  4OP8 A;  4HNB A;  4R3A A;  1GA0 A;  2A24 A;  2LB5 A;  4I3I A;  1XJ3 A;  1F2K A;  3LI9 A;  4MMN A;  3IX3 A;  2VLG A;  2HPB A;  2B02 A;  3CAX A;  2JKT M;  1GHP A;  4MNR A;  5FI2 A;  4KZ8 A;  4L9F A;  1LHY A;  4I38 A;  5EVL A;  1SKO B;  4HJ4 A;  1NZU A;  2G7U A;  2W3F A;  4ZAM A;  3UE3 A;  1Q2Q A;  2Y79 A;  2FH5 A;  2KX6 A;  2V1B A;  3QP8 A;  4C6Y A;  1NY0 A;  2EWV A;  2Z6C A;  2ZMV A;  2JKG A;  4IHQ A;  1V9Y A;  4EWF A;  1OME A;  4ETZ A;  5IS1 A;  4CQH A;  2GNX A;  1ZHH B;  2RL3 A;  4K0X A;  2JKF A;  3WS2 A;  3PXP A;  3UB5 P;  4XT2 A;  1NYM A;  2HDS A;  5IU1 A;  4ZJ3 A;  2W1T A;  3IXH A;  3IWO A;  4PKY G;  3C4P A;  2Y2N A;  1YLZ A;  1F98 A;  2VGL S;  4AFI A;  1G6O A;  2XLN A;  4JLF A;  3BW6 A;  3CWF A;  5DF8 A;  3VE4 A;  3F1P A;  2QPN A;  4Y2F A;  1I5Q A;  5E2G A;  1KGG A;  1WYC A;  3EEH A;  1NZO A;  5DJT A;  3PAG A;  3MSH A;  1WA9 A;  5CX7 A;  1KE0 A;  4BBU A;  2K2N A;  4N1H A;  1SDE A;  3G6O A;  3LIF A;  4QU3 A;  3IT9 A;  3IQA A;  1J3W A;  2PRF A;  3IF6 A;  3H7W A;  5FQQ A;  3UPP A;  4R0Q A;  1K57 A;  4IBX A;  5CHM A;  3NC8 A;  1PW1 A;  5CGS A;  4BWI A;  5DKL A;  4HH2 A;  3N8S A;  1PZO A;  1YPR A;  5HFO A;  4GOG A;  5E43 A;  1K0K A;  2Y2K A;  3GV9 A;  1LL5 A;  1OTB A;  2JCH A;  5EE8 A;  4PM8 A;  4PM6 A;  1ONG A;  3QP6 A;  3BY8 A;  4MLL A;  2H0T A;  1Z6F A;  4XXR A;  1FIL A;  4WN5 A;  4PM7 A;  2W3H A;  4LLO B;  5C5K A;  1N9L A;  3V3R A;  1GCE A;  1PIO A;  4OQG A;  3UDF A;  3N7W A;  5K5B A;  2HGV A;  1ERO A;  1CEG A;  1I2W A;  1YMX A;  3BJN A;  5EM0 A;  3V39 A;  4B88 A;  2PBD P;  3BFC A;  4LCM A;  4DXB A;  1MY8 A;  3V67 A;  2J9O A;  3E2L A;  4DF6 A;  3M6B A;  4JF4 A;  1MKI A;  2VGL M;  5F82 A;  2ZC5 B;  2EX9 A;  4Y3I A;  3FYZ A;  3VP4 A;  4ESP A;  4F3L A;  4RYE A;  2ZLY A;  4HOI A;  2WKQ A;  4H6J A;  4HEF A;  4PM9 A;  5L8M A;  1BUL A;  5CTM A;  5F68 A;  1BUE A;  1NXY A;  3OZH A;  4FD8 A;  4IVI A;  1K54 A;  1MBL A;  3HBR A;  2ZC3 B;  3K3C A;  2ZQ8 A;  4O0P A;  4NKP A;  4EBP A;  1O07 A;  3VP1 A;  3E4Q A;  3F1O A;  5J7E A;  1TS8 A;  5F1G A;  5CXW A;  4GS9 B;  5DJU A;  4HP4 A;  4CLC B;  2ZD8 A;  3HCY A;  2OOL A;  5KIZ A;  1RGZ A;  4WBG A;  4ZDX A;  1JWP A;  4H8R A;  3NDE A;  2Q0O A;  3SH8 A;  2W3D A;  1KGF A;  3RXW A;  5TFQ A;  4NXF A;  4P6Z S;  4N92 A;  5U47 A;  3PHY A;  2VV7 A;  3IWQ A;  5GLD A;  3SZT A;  4BMW A;  3UO9 A;  1JWZ A;  3A0V A;  1L0D A;  1S4R A;  1IYS A;  4B4Z A;  3GMW A;  2BTF P;  4Q0H A;  3G34 A;  2W3E A;  4FH2 A;  2V2F F;  1FR1 A;  3N4I A;  1OT6 A;  2QJ5 A;  2ZM8 A;  1CI9 A;  3UDI A;  4WZ5 A;  4CJN A;  5GHY A;  3H82 A;  2LB9 A;  1ES5 A;  2Z2M B;  3A0S A;  2GZA A;  3PBR A;  3CI6 A;  4GN2 A;  5F1F A;  1S0W A;  4S2P A;  5HAI A;  2PD8 A;  4CPK A;  1RP5 A;  4WZ4 A;  2OAQ 1;  4HY8 A;  1GSW A;  4JF6 A;  3IS2 B;  4BJP A;  5FI7 A;  5D3O A;  2HJE A;  2WKH A;  1JWV A;  1KDS A;  1CEF A;  1I2S A;  1T19 A;  4GHI A;  3T4S A;  3BFG A;  2J8Y A;  2WZX A;  3HRE A;  4FH4 A;  5FQK A;  3UY6 A;  1PYY A;  3F1N B;  4WEK A;  3KYQ A;  1STZ A;  3UB7 A;  3C38 A;  2WKR A;  2J80 A;  4KZA A;  5HD3 A;  4EQ1 A;  1VET A;  1G68 A;  2V1A A;  4JXS A;  5AQ9 A;  3K2N A;  2G2W A;  3UME A;  5IT5 A;  2XF3 A;  4CLC D;  5EVI C;  3TSG A;  1DY6 A;  1YQS A;  4BL2 A;  3BY9 A;  2JE5 A;  1DP9 A;  2UWX A;  5E2F A;  4K0W A;  3UPO A;  3WRZ A;  4MEZ A;  1MKM A;  3T4O A;  3LCE A;  1RCJ A;  3GTC A;  4KG6 A;  5DFX A;  1ACF A;  3LR3 A;  3UE0 A;  3FZC A;  3U2A A;  2E8I A;  4MN5 A;  2PHY A;  2VGK A;  3MXR A;  3LR4 A;  4KZ4 A;  1VB6 A;  1FQG A;  2QYB A;  4UQI M;  4NK3 A;  1E25 A;  1RGY A;  2HDU A;  1H5X A;  4LV1 A;  5MC7 A;  4GDB A;  1BZA A;  2A49 A;  4L9E A;  3M6H A;  1VQQ A;  4GLQ A;  4E3O A;  5AQB A;  4HQA A;  1PWC A;  2WGW A;  2A2L A;  1FIK A;  3VMA A;  1K4E A;  5J4E A;  4HBT A;  5CGW A;  4BBV A;  2Y4A A;  4BD1 A;  3SS5 A;  2JHE A;  2O0Y A;  4HIA A;  3ZG0 A;  3RTY A;  3VE3 A;  3IHB A;  4Q0I A;  5FAO A;  1F5M A;  1S4S A;  1O7E A;  4UAA A;  3BRM A;  2ZOH A;  3BEC A;  1FCO A;  5IHV A;  3W2Z A;  3HJK A;  1LSX A;  2ZC6 B;  4DE2 A;  4R38 A;  1IOU A;  1NYY A;  4IUK A;  2Q9M A;  2PU2 A;  4Y0O A;  5A91 A;  4LEN A;  3HLC A;  3ZGA B;  3N6I A;  1LL8 A;  4CLC E;  1WYB A;  5DTK A;  4DDY A;  3T50 A;  1K56 D;  1FOF A;  3S7O A;  1NJ4 A;  2ZL1 B;  3E4P A;  3AGF A;  3NY4 A;  2ZQD A;  2R78 A;  3FG8 A;  2DRW A;  5F69 A;  3SH9 A;  2DNS A;  1K4F A;  5FI6 A;  4YFM A;  1MZU A;  3KYE A;  3MFD A;  4G3V A;  2Y2P A;  4L9G A;  2M7V A;  1XX2 A;  3NEC A;  2EA9 A;  1BLH A;  3DW0 A;  2XFS A;  1LI9 A;  1MWR A;  3TW8 A;  4R1G A;  3VSK A;  1F9I A;  4ZTK A;  3FPV A;  4EBL A;  1G6A A;  4WEJ A;  3NIA A;  3ZYT A;  3R7W B;  3RFB A;  2MJ6 A;  1S6R A;  1OTD A;  5EOE A;  1P9R A;  3BLM A;  1G5U A;  2GJ3 A;  5I94 A;  4UA6 A;  5FAP A;  4BLM A;  4N1X A;  3OPL A;  3SOI A;  1AXB A;  3MZE A;  2ZC7 A;  1ERQ A;  4ZJ1 A;  4U0T A;  1H8Z A;  4S2L A;  1FCN A;  2C6W B;  3AGE A;  4ID4 A;  5AQA A;  5FDS A;  4EER A;  1JVJ A;  1T1B A;  4KEN B;  3MXQ A;  4KG5 A;  4R3B A;  4LCL A;  3LR5 A;  3BQA A;  2Y8H A;  1SKO A;  4E3J A;  3NCK A;  1HD8 A;  3IX4 A;  4DE1 A;  3ICY A;  3V3S A;  3BLS A;  4Z1W A;  5DF7 A;  3C7U A;  3D4F A;  5HWT A;  4KUO A;  3CPT A;  4ZRR A;  1TDL A;  3PBN A;  3VFF A;  4MBK A;  4EBN A;  4X1M A;  1K6S A;  1W5D A;  1ZG6 A;  1KVM A;  4HP9 A;  3FC7 A;  2PR5 A;  4DJ2 A;  3HLE A;  2O9C A;  4IJG A;  3GDI A;  2D02 A;  3OPR A;  4FTX A;  3OPH A;  2XK1 A;  3NI9 A;  4NXG A;  1ZKJ A;  4IVK A;  4YNR A;  3GR2 A;  3VOY A;  1PNE A;  3LEZ A;  2ZJ9 A;  1JNU A;  5HAR A;  4P85 A;  4D2O A;  4UEY A;  5FAT A;  1ONH A;  2FFF B;  2PAV P;  2XA7 M;  1TF1 A;  2A24 B;  3MBZ A;  1YM1 A;  2VKS A;  3KO6 A;  3O3V A;  4JBF A;  4QY6 A;  2XDM A;  5EVE A;  3T4Q A;  1TD5 A;  4MN7 A;  1OPX A;  4EQI A;  1G28 A;  4EXO A;  3GVB A;  2Y2L A;  3ZDJ A;  4KZ5 A;  4Z9Q A;  2ZM2 A;  3PBO A;  3PR6 A;  3UPN A;  3ZG7 B;  4NEE D;  1YLY A;  3HUM A;  4RX3 A;  3SH7 A;  3Q1F A;  3I7J A;  4XT2 B;  4Q0J A;  3WS1 A;  3LID A;  2PYR A;  1GSV A;  4X69 A;  4WMC D;  1MC0 A;  3E2K A;  1OTA A;  4OKP A;  4GZB A;  3EQV A;  3DBA A;  3MR0 A;  1PRQ A;  3T4T A;  3DTK A;  3SW1 A;  2Y55 A;  4S2N A;  3QP2 A;  1DJC A;  3F1P B;  3JYI A;  2INW A;  4S2N C;  1T18 A;  1JTD A;  2ZMF A;  1ALQ A;  1KOU A;  3S7N A;  1NLY A;  1W7F A;  5HW3 A;  3D9Y A;  3EWK A;  1EW0 A;  5L09 A;  3ZFZ A;  4DRT A;  3CUE C;  4RX2 A;  2E8J A;  1LLB A;  4BL3 A;  1XA1 A;  3LIA A;  1SCW A;  5G4Y A;  1LSW A;  4PPR A;  2NUT C;  4K08 A;  3IF6 B;  3H7W B;  1XFN A;  3CZD A;  4HI4 A;  1AWI A;  3D3O A;  5TJJ A;  2WGI A;  3QP4 A;  4X1L A;  5GL9 A;  2B95 A;  1SZV A;  2W0N A;  4EET B;  2KOI A;  2J7V A;  3V50 A;  4CLC A;  1SHV A;  2R9W A;  3BYD A;  4CLC C;  3S4X A;  5EUA A;  2W1R A;  3IWI A;  5G18 A;  1ES2 A;  1XGI A;  4DJ3 A;  3ISG A;  4LRY C;  4R4S A;  3MF0 A;  4X25 A;  4B93 A;  4X56 A;  2NUP C;  3DAV A;  3OCN A;  3OBF A;  2V9A A;  3GEC A;  4OOY A;  2VJW A;  2EX8 A;  2PU4 A;  4UA7 A;  2HJ9 C;  3C4O A;  2WZZ A;  3RH8 B;  3KX0 X;  5FSR A;  5CER A;  4OLD A;  1N9O A;  5CHU A;  3ZHH A;  3Q7V A;  3LFV A;  1HTZ A;  4F3L B;  3VP3 A;  5FA7 A;  3M2J A;  2ACG A;  2O9A A;  2ZQ7 A;  4H6J B;  2HP6 A;  3E0Y A;  3KSF A;  1MPL A;  5EOO A;  3DTM A;  3BWL A;  3IS2 A;  1TVF A;  4L0L A;  4A5R A;  5EFW A;  2J3W A;  4FSF A;  4MCW A;  1Q2P A;  5FEF A;  4IED A;  3O87 A;  3IH8 A;  4I39 A;  4Y15 A;  5FAQ A;  5HAP A;  5L07 A;  3TE8 A;  1TS6 A;  2W27 A;  1Y4O A;  3EEA A;  2HF6 A;  4N9L A;  3Q81 A;  1K56 A;  4DN0 A;  2I72 A;  4OOL A;  3K3D A;  3T4J A;  2B18 A;  3HUN A;  3O86 A;  3IF5 A;  4HBU A;  4R4R A;  4OLG A;  3FKW A;  4JKT A;  4G3K A;  5AJG A;  4JXG A;  4EEP A;  5I5L A;  5LBR A;  4GJ4 A;  3FPW A;  3ZG9 B;  1KE4 A;  3JVV A;  2K31 A;  3SS4 A;  3MXS A;  5GHZ A;  1YMS A;  3HUO A;  4KQO A;  3T1X A;  1S67 L;  1KE3 A;  3G4P A;  2V0U A;  5HWV A;  4HJ3 A;  1LT0 A;  3JVU A;  3HLW A;  4KZ3 A;  4BD0 A;  4KZ9 A;  4GD8 A;  5FQM A;  1QME A;  2ZM0 A;  3MFX A;  4P6Z M;  3VP2 A;  3P01 A;  5EVI A;  3W4P A;  1L0F A;  4OQH A;  3A3J A;  4QHC A;  3KSH A;  4HES A;  1YLW A;  3MMH A;  2B5R A;  2V1Z A;  4GDN A;  3T1Q B;  4B4X A;  3UB9 A;  4ETX A;  3NBL A;  3VSL A;  4NET A;  4DE3 A;  5TGF A;  1K6R A;  1C3B A;  2Y2I A;  2P7J A;  3LYX A;  3FV7 A;  3W4O A;  1UWP X;  4YOF A;  3T4L A;  1V9Z A;  4GD6 A;  3T1R A;  2Y2H A;  1PI4 A;  4LRX C;  2ZOI A;  2QJ7 A;  4EU0 A;  4KQD A;  2QKP A;  4OVD A;  4PMA A;  1H8M A;  1VM1 A;  3JPU A;  5A90 A;  4PAU A;  1XFQ A;  4IUH A;  2XEP A;  2V20 A;  3UE6 A;  4M4X A;  4I3J A;  5AQ7 A;  3TJZ C;  2ZMA A;  3BFD A;  2JKT I;  3B47 A;  2ZL1 A;  5EM1 A;  2HV1 A;  2OLV A;  3ULF A;  2HP9 A;  3G32 A;  2L1M A;  1YLT A;  1M40 A;  4C3Q A;  1LSV A;  3R4K A;  4ARZ B;  5HDC A;  4MN6 A;  3OOV A;  1FSY A;  3ZQ5 A;  1ERM A;  3T4K A;  2J3T C;  3HL9 A;  4X55 A;  1XXM A;  3MS6 A;  1MWS A;  5HL1 A;  3HLB A;  1N9N A;  3M2K A;  2EWW A;  1MXO A;  1XP4 A;  4OH0 A;  3DWZ A;  2FFY A;  4GCZ A;  2XD5 A;  3C2W A;  1OTE A;  1U60 A;  1T1A A;  2GDN A;  3LIB A;  1HZO A;  1ZTU A;  1UGU A;  2IWD A;  2VEA A;  2WAF A;  2XRN A;  3BQ8 A;  1T1C A;  1ZG4 A;  2OWH A;  3UNW A;  4WUJ A;  4OPY A;  2EXB A;  4S2I A;  5HZH A;  1TS7 A;  3ZVW A;  4U0X A;  1NLZ A;  4DKI A;  2XR0 A;  4G3W A;  2DCF A;  1VEU A;  2J9P A;  5HWW A;  5AVF A;  1Z09 A;  2X71 A;  1MWT A;  5M19 A; 
#chains in the Genus database with same CATH homology
 4KQQ A;  1BUE A;  1N4O A;  1NXY A;  3OZH A;  4FD8 A;  4IVI A;  3TOI A;  5FAT A;  1BLP A;  1ONH A;  2FFF B;  3GQZ A;  1GHI A;  5KMW A;  1K55 C;  1K54 A;  1MBL A;  3HBR A;  2ZC3 B;  4E3N A;  2ZQ8 A;  4WEL A;  5CEC A;  3GSG A;  4OQ0 A;  3MBZ A;  5A93 A;  2P9V B;  4QD4 A;  1YM1 A;  4EBP A;  1ES3 A;  3A3E A;  2ZQA A;  3O3V A;  3EQU A;  1O07 A;  4JBF A;  3BFF A;  4QY6 A;  2XDM A;  4BQM A;  3RJU A;  3VP1 A;  3MZF A;  3ZCZ A;  4C75 A;  1YLP A;  4GNU A;  2H0Y A;  4Y0U A;  5F1G A;  2EXA A;  2IWB A;  3Q07 A;  4S2O A;  4XUZ A;  4EQI A;  5CXW A;  3P09 A;  1FCM A;  3GRJ A;  4F94 A;  3GVB A;  3VFH A;  2ZD8 A;  1ZC2 A;  1W79 A;  2Y2L A;  3ZDJ A;  4KZ5 A;  5F83 A;  3A3D A;  1RGZ A;  4E3L A;  4WBG A;  1ES4 A;  4ZDX A;  5CED A;  1JWP A;  4Z9Q A;  3G35 A;  4KZB A;  4H8R A;  1KGE A;  2C5W B;  3NDE A;  3SH8 A;  1YT4 A;  2QZ6 A;  2H5S A;  3UDX A;  5JYO A;  2ZM2 A;  3PBO A;  3UPN A;  3ZG7 B;  1KGF A;  4EV4 A;  3RXW A;  5TFQ A;  1IKI A;  4OP5 A;  4KZ6 A;  1YLY A;  2Z2L B;  3HUM A;  4RX3 A;  4N92 A;  5FDH A;  4Y7P A;  3SH7 A;  5M19 A;  5U47 A;  3Q1F A;  3IWQ A;  3I7J A;  5GLD A;  2R9X A;  2X02 A;  5KZH A;  5EEC A;  3G2Y A;  4WYY A;  1PWG A;  3WS1 A;  5EVI B;  3UO9 A;  4X69 A;  1JWZ A;  4WMC D;  1L0G A;  3SS3 A;  1L0D A;  2VGJ A;  3E2K A;  3W8K A;  1IYS A;  4B4Z A;  2HP5 A;  3GMW A;  3PTE A;  4OKP A;  1TEM A;  3G34 A;  4GZB A;  1HVB A;  4FH2 A;  3EQV A;  2V2F F;  1CI8 A;  1FR1 A;  3N4I A;  3LY3 A;  4BEN A;  5HAQ A;  4LV2 A;  5L2F A;  3IHA A;  2BLS A;  1GA9 A;  3FWL A;  2Y55 A;  4R23 A;  4S2N A;  1DJC A;  2OSU A;  3JYI A;  2ZM8 A;  4S2N C;  1BTL A;  1TDG A;  1JTD A;  1E3U A;  1ALQ A;  2Y2J A;  4GKU A;  1CI9 A;  4LV3 A;  4MBF A;  4XUX A;  3UDI A;  3C5A A;  2ZC4 B;  3PAE A;  4WZ5 A;  4CJN A;  5GHY A;  3IH9 A;  1PW8 A;  4P0M A;  1W7F A;  5HW3 A;  3CMZ A;  1ES5 A;  3NDG A;  2Z2M B;  3RXX A;  3ZFZ A;  4DRT A;  4RX2 A;  3Q7Z A;  3MKF A;  1LLB A;  4BL3 A;  1XA1 A;  5EPH A;  1BLS A;  2WUQ A;  3PBR A;  4GN2 A;  1DJA A;  4UA9 A;  1SCW A;  4QB8 A;  5F1F A;  1S0W A;  4S2P A;  5HAI A;  4CPK A;  4P87 A;  4PPR A;  1RP5 A;  4WZ4 A;  3IF6 B;  1M6K A;  3CZD A;  2P9V A;  1NRF A;  4GB7 A;  4JF6 A;  3QNB A;  4BJP A;  5FI7 A;  1E4D A;  1E3U D;  1ESU A;  2WGI A;  3QHY A;  5D3O A;  5CTN A;  5GL9 A;  2WKH A;  1JWV A;  1XGJ A;  3ITB A;  1KDS A;  4LV0 A;  1CEF A;  3TG9 A;  2WGW B;  1I2S A;  3WS0 A;  1IYP A;  2J7V A;  2XFT A;  3IXD A;  3DWK A;  3V50 A;  5CRF A;  2WKI A;  1SDN A;  1SHV A;  1FR6 A;  2X01 A;  2R9W A;  3BYD A;  3LO7 A;  3PBT A;  3BFG A;  2P74 A;  4U3T A;  3S4X A;  2J8Y A;  2WZX A;  3HRE A;  5CTM A;  4E3I A;  5EUA A;  4FH4 A;  5FQK A;  2JC7 A;  4WM9 A;  3IWI A;  5G18 A;  3UY6 A;  2HDR A;  1K55 A;  4QJG A;  1PYY A;  4JF5 A;  4WEK A;  1ES2 A;  1K25 A;  1XGI A;  3ISG A;  2XD1 A;  2BG1 A;  1CK3 A;  3HLG A;  5KSC A;  1H8Y A;  4R4S A;  3WRT A;  5CHJ A;  4KZA A;  1YLJ A;  1G68 A;  4JXS A;  5AQ9 A;  2G2W A;  2Y2O A;  2EFU A;  4X56 A;  2IWC A;  1XA7 A;  1XKZ A;  3OCN A;  5GHX A;  5J8X A;  2XF3 A;  2XH9 A;  4OON A;  4OOY A;  3WS4 A;  4ZJ2 A;  4M3K A;  5EVI C;  3TSG A;  4DE0 A;  3FKV A;  1DY6 A;  1YQS A;  4OPZ A;  1BSG A;  2EX8 A;  4BL2 A;  3BM6 A;  4X68 A;  4DDS A;  2JE5 A;  1FSW A;  1IKG A;  4PM5 A;  2PU4 A;  4Y0T A;  2UWX A;  4K91 A;  4WMC A;  5E2F A;  4K0W A;  3V5M A;  3ZNT A;  3UPO A;  3PBS A;  4UA7 A;  3WRZ A;  4MEZ A;  1Y54 A;  3C4O A;  2WZZ A;  3LCE A;  1RCJ A;  3GTC A;  4KG6 A;  5FSR A;  2OV5 A;  2OLU A;  5CER A;  4OLD A;  3ZG8 B;  3OPP A;  2EX2 A;  5CHU A;  2Y2M A;  5GLC A;  3UE0 A;  1WE4 A;  3ZHH A;  5BOH A;  3Q7V A;  3ITA A;  4RA7 A;  3FZC A;  3N8L A;  5EVI D;  5KSH A;  1HTZ A;  5DTS A;  5DTT A;  4FCF A;  2E8I A;  3VP3 A;  2VGK A;  3IXB A;  5FA7 A;  3MXR A;  4UHU A;  5DVA A;  4KZ4 A;  3HLF A;  3M2J A;  1FQG A;  4EUZ A;  1IYQ A;  2ZQ7 A;  3UE1 A;  3WS5 A;  3O88 A;  4NK3 A;  3AGD A;  1E25 A;  3A3F A;  4E6X A;  2HP6 A;  1MWU A;  1RGY A;  1W8Q A;  2Y91 A;  2HDU A;  2WGV A;  1H5X A;  4LV1 A;  1MPL A;  5EOO A;  4DXC A;  3DTM A;  4GDB A;  1BZA A;  1LL9 A;  2A49 A;  3IF6 C;  4E6W A;  4RVA A;  1TVF A;  3M6H A;  4L0L A;  1VQQ A;  4A5R A;  1SKF A;  1K57 C;  5GLA A;  4KQR A;  4FSF A;  4E3M A;  3MZD A;  4N9K A;  4E3O A;  4O7D A;  1Q2P A;  5AQB A;  4IED A;  3O87 A;  1KVL A;  5FAS A;  3IH8 A;  1PWC A;  2H10 A;  5FAQ A;  5HAP A;  1DJB A;  2WGW A;  1PWD A;  3VMA A;  1K4E A;  4HBT A;  5CGW A;  2Y4A A;  4BD1 A;  1PI5 A;  3SS5 A;  3CJM A;  3ZG0 A;  1XPB A;  3Q81 A;  1K56 A;  1LI0 A;  4KG2 A;  4N9L A;  2I72 A;  3IHB A;  4OOL A;  5FAO A;  4JPM A;  1BLC A;  1O7E A;  4UAA A;  3BRM A;  3BEB A;  3HUN A;  3O86 A;  3UN7 A;  3BEC A;  4OQI A;  1FCO A;  2ZQC A;  3IF5 A;  4HBU A;  4OP8 A;  5IHV A;  4R4R A;  1IEL A;  4DE2 A;  2ZC6 B;  4OLG A;  1GA0 A;  1NYY A;  3ZVT A;  3FKW A;  4JKT A;  2Q9M A;  3ZNY A;  2PU2 A;  4JXG A;  5M1A A;  4Y0O A;  5A91 A;  4LEN A;  3HLC A;  3ZGA B;  2Y2Q A;  2HPB A;  5A92 A;  3N6I A;  2G2U A;  5CGX A;  1GHP A;  1WYB A;  4MNR A;  5DTK A;  4DDY A;  3ZG9 B;  5FI2 A;  1KE4 A;  1EI5 A;  1K56 D;  4KZ8 A;  3SS4 A;  1FOF A;  3MXS A;  1LHY A;  5GHZ A;  1NJ4 A;  1YMS A;  5EVL A;  3AGF A;  3NY4 A;  2WKE A;  3HUO A;  2ZQD A;  5FQ9 A;  5GLB A;  4KQO A;  3CG5 A;  5HX9 A;  5DF9 A;  1J9M A;  1NZU A;  1KE3 A;  2DRW A;  3SH9 A;  2DNS A;  3ZG5 A;  2EFX A;  3G4P A;  1Q2Q A;  4IBR A;  4ZAM A;  5FQJ A;  3UE3 A;  1K4F A;  2XQZ A;  5FI6 A;  4YFM A;  3HLW A;  4KZ3 A;  4BD0 A;  4KZ9 A;  3MFD A;  4C6Y A;  1NY0 A;  2Y2P A;  1XX2 A;  4S2J A;  4GD8 A;  3P98 A;  5FQM A;  1QME A;  1BLH A;  3DW0 A;  4EWF A;  1OME A;  2XFS A;  4E3K A;  1LI9 A;  2ZM0 A;  1MWR A;  2RL3 A;  4K0X A;  3WS2 A;  4R1G A;  3OCL A;  2QMI A;  3VSK A;  4ZTK A;  3VP2 A;  5EVI A;  3W4P A;  4EBL A;  1NYM A;  2HDS A;  1L0F A;  4ZJ3 A;  3S1Y A;  3N8R A;  1L2S A;  4JXV A;  3A3J A;  4OQH A;  4QHC A;  1QMF A;  1G6A A;  4WEJ A;  4HES A;  1YLW A;  3NIA A;  2Q9N A;  3IXH A;  3IWO A;  2B5R A;  3WWX A;  2V1Z A;  4GDN A;  1W8Y A;  3C4P A;  2Y2N A;  4ZBE A;  1YLZ A;  4B4X A;  1K54 C;  3NBL A;  3A3I A;  2XLN A;  4NET A;  4JLF A;  3VSL A;  4DE3 A;  1S6R A;  5DF8 A;  5TGF A;  1K6R A;  1C3B A;  2Y2I A;  2QPN A;  5EOE A;  2WAE A;  4Q8I A;  3C7V A;  1I5Q A;  3BLM A;  5E2G A;  1KGG A;  4OOM A;  3W4Q A;  5M18 A;  1WYC A;  3FV7 A;  1IEM A;  3S22 A;  5I94 A;  1NZO A;  3W4O A;  4UA6 A;  2PBY A;  5FAP A;  1BT5 A;  3PAG A;  2ZQ9 A;  4GD6 A;  4BLM A;  1KE0 A;  4N1X A;  2Y2H A;  3OPL A;  4N1H A;  3SOI A;  1AXB A;  3MZE A;  1N9B A;  1SDE A;  2ZC7 A;  1ERQ A;  1PI4 A;  1IYO A;  4ZJ1 A;  4U0T A;  1H8Z A;  4QU3 A;  1FCN A;  3AGE A;  2C6W B;  4ID4 A;  4S2L A;  5AQA A;  3HVF A;  3IT9 A;  3IQA A;  1JVJ A;  4OVD A;  3IF6 A;  4PMA A;  5FQQ A;  3UPP A;  4R0Q A;  4KEN B;  4KG5 A;  1VM1 A;  1K57 A;  4IBX A;  4R3B A;  3G31 A;  4OPR A;  5A90 A;  5CHM A;  5TR7 A;  4LCL A;  3NC8 A;  4MBH A;  5CEB A;  1PW1 A;  3Q82 A;  5CGS A;  2XEP A;  2JBF A;  2V20 A;  4JXW A;  3VOZ A;  3N8S A;  4QY5 A;  5AQ7 A;  3G2Z A;  1PZO A;  2ZMA A;  2EX6 A;  3BFD A;  2Y59 A;  3G30 A;  5HFO A;  2OLV A;  4KZ7 A;  4E3J A;  3QNC A;  2HP9 A;  3G32 A;  3BFE A;  3NCK A;  1HD8 A;  4DE1 A;  4GOG A;  3IXG A;  4YIN A;  5E43 A;  1YLT A;  3V3S A;  1M40 A;  2Y2K A;  3BLS A;  4C3Q A;  3GV9 A;  1LL5 A;  2JCH A;  5E2H A;  5DF7 A;  3C7U A;  5JYP A;  1ESI A;  1K38 A;  5EE8 A;  4PM8 A;  4PM6 A;  1ONG A;  3D4F A;  3LY4 A;  1FSY A;  4R3J A;  2CC1 A;  4MLL A;  1L0E A;  1ERM A;  2H0T A;  1Z6F A;  4XXR A;  3HL9 A;  4X55 A;  4PM7 A;  1XXM A;  1MWS A;  3Q7V B;  2WK0 A;  1TDL A;  3PBN A;  4WZ5 C;  3VFF A;  4MBK A;  3V3R A;  5E2E A;  1GCE A;  2HDQ A;  5HL1 A;  1PIO A;  3HLB A;  4OQG A;  4EBN A;  3M2K A;  3UDF A;  3N7W A;  1MXO A;  1XP4 A;  3PBQ A;  4OH0 A;  3DWZ A;  1K6S A;  2FFY A;  1JTG A;  1W5D A;  1ERO A;  1CEG A;  1I2W A;  1YMX A;  1ZG6 A;  1KVM A;  2RCX A;  2XD5 A;  1GHM A;  4B88 A;  3V39 A;  3BFC A;  4LCM A;  1U60 A;  2XGN A;  3HLD A;  2GDN A;  4DXB A;  1MY8 A;  1HZO A;  2WAF A;  2IWD A;  3HLE A;  3VP0 A;  2WAD A;  2J9O A;  1ZG4 A;  3E2L A;  4S2K A;  4DF6 A;  3OPR A;  3UNW A;  3M6B A;  5FQI A;  3OPH A;  2WYX A;  2Y2G A;  4JF4 A;  1MKI A;  4OPY A;  2XK1 A;  2EXB A;  3NI9 A;  4S2I A;  5F82 A;  1ZKJ A;  2ZC5 B;  2EX9 A;  4IVK A;  1KDW A;  4U0X A;  4OPQ A;  3FYZ A;  3GR2 A;  3VP4 A;  3ZVW A;  4DKI A;  2XR0 A;  1EWZ A;  2DCF A;  4S2M A;  4RYE A;  2J9P A;  3LEZ A;  3VOY A;  3OC2 A;  2ZJ9 A;  5HAR A;  4P85 A;  2ZLY A;  2X71 A;  4D2O A;  4X53 A;  1MWT A;  4X6T A;  4P6B A;  2A3U A;  4HEF A;  4PM9 A;  1PZP A;  3B3X A;  1BUL A;  3MKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...