3Q82A

Meropenem acylated blar1 sensor domain from staphylococcus aureus
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
b'QSITDYNYKKPLHNDYQILDKSKIFGSNSGSFVMYSMAADAYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase regulatory protein BlaR1
publication title Lysine Nzeta-decarboxylation switch and activation of the beta-lactam sensor domain of BlaR1 protein of methicillin-resistant Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase regulator/antibiotic
total genus 85
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q82A00
1SCWA 5DF8A 1W8QA 4S2MA 1SKFA 2BG1A 1MBLA 3HUMA 5EUAA 2WYXA 3W4OA 3ZVTA 4E6WA 5FQJA 1I5QA 3NDEA 4QHCA 3CG5A 5I94A 1DJCA 5G18A 4GZBA 3MZEA 3M2KA 4ZAMA 4F94A 2JCHA 3G34A 3N4IA 4S2OA 4B4XA 5M18A 1IYPA 4UHUA 2Y55A 3FYZA 1KGFA 3ITAA 1BTLA 4HBUA 5FQQA 4BL3A 4WELA 5AQ9A 4GD6A 3Q82A 1W79A 3ZG7B 2X01A 3BFGA 4K0WA 4Y0OA 2X02A 4RYEA 3WS2A 4N1XA 2XD1A 3UE0A 1WYBA 2J8YA 5A91A 4LCMA 3HVFA 4MBFA 1ONGA 4OPZA 3AGEA 4OPRA 3SS5A 1ES4A 3VP0A 4E3NA 2EX9A 3UNWA 1ZC2A 1E3UA 1GHPA 2DNSA 3UE1A 3TOIA 4JF4A 5E2FA 1BUEA 1RGYA 4WZ5C 3ZFZA 4FH4A 1L2SA 1NZUA 2Y2JA 4X6TA 5D3OA 5FA7A 4PM5A 2HP9A 3FZCA 2J9PA 4KQQA 2WGVA 1YLYA 3ZG0A 1XGJA 2XLNA 3ZNYA 2V2FF 1BSGA 1JTDA 1BLCA 2ZQDA 4OOMA 1MXOA 4U0XA 1LHYA 1YLJA 4X69A 2Y2IA 2WGWB 2WKIA 4GKUA 2VGJA 2ZQ7A 1XGIA 4X68A 1KE0A 3PTEA 4DE1A 3VSKA 3O86A 2R9WA 3EQVA 3UPPA 1ES5A 1NRFA 2PU2A 3G2ZA 3Q7VB 5FQ9A 4S2KA 3GTCA 1YLPA 2ZC7A 3SH8A 1XKZA 5HFOA 4OKPA 5DTTA 3ZGAB 3NIAA 3NCKA 4EUZA 4R23A 2J9OA 1G6AA 4KG2A 3SH9A 3V39A 2OLVA 4FH2A 5FASA 4KG6A 2HP5A 2WK0A 4IBRA 2HDRA 3G35A 3G2YA 1W7FA 1XX2A 4S2NC 3OCNA 4UA7A 2WADA 3PBNA 4LCLA 1ES3A 3S4XA 1W8YA 4PM8A 4OLDA 3ZCZA 1K25A 4WEKA 4DKIA 1Z6FA 5GHYA 1DJAA 3P09A 2WGWA 1FOFA 1NZOA 1OMEA 4JF5A 2ZC4B 1L0GA 4KZ3A 1YLTA 4DF6A 3Q07A 4OOYA 4EBLA 1FCOA 5HARA 2OLUA 2XFSA 3N8SA 4KZ9A 4PM7A 5CGSA 4JXSA 1Y54A 5U47A 3Q7VA 1MWRA 3BFFA 1IEMA 1K57C 3SS3A 2ZQCA 1FCNA 4S2JA 5DTKA 5FQIA 4B4ZA 4P0MA 5KZHA 2H0TA 3W4QA 4GN2A 3UDXA 2WKHA 3A3EA 3ZNTA 2FFYA 5CTNA 2PU4A 1K55C 4N1HA 1CI9A 4BLMA 4N9LA 2XF3A 4LV0A 1K6RA 3G30A 4QY6A 3O88A 3MFDA 3PBTA 4LV3A 2C5WB 2JE5A 3IXDA 1DJBA 2FFFB 1I2WA 4S2NA 4DXCA 4EWFA 3ZG5A 4H8RA 1E25A 2C6WB 2ZQ9A 4YFMA 3BFCA 4B88A 1CEGA 3WS0A 5GHZA 1BULA 3BLMA 3IWOA 3NDGA 2BLSA 3ZHHA 2EXAA 1WE4A 3V5MA 5A92A 1KVMA 1K56A 3GR2A 3RJUA 2Y2HA 2ZD8A 2R9XA 4UA6A 2JC7A 1H5XA 3VOYA 5CECA 3C7UA 2VGKA 3S1YA 5HW3A 3HUOA 3NY4A 1GA0A 5EECA 2Z2MB 1PW1A 5M19A 3PAEA 1MPLA 4JXVA 3CMZA 2XR0A 2Y2MA 4RA7A 3MZDA 1YMSA 3ITBA 5HAQA 3VFFA 1EWZA 5GL9A 3LEZA 4XUZA 3IF5A 5CTMA 5E43A 3PBOA 1IYOA 1YLWA 3OC2A 5EVIC 1Q2PA 4WMCA 1IKGA 2QMIA 3GRJA 1NJ4A 2UWXA 4KZ4A 1QMFA 3S22A 1TDGA 2HDUA 3VP4A 3C4OA 3PAGA 2HPBA 2XD5A 1K54C 1JVJA 4Y7PA 3IH9A 4YINA 4KZ5A 1BLHA 3UPNA 3V50A 5HAPA 1FSYA 2H0YA 3M6BA 4P85A 1ESIA 4IEDA 4E3MA 4OH0A 1FQGA 3BEBA 4BJPA 1KVLA 1W5DA 2XQZA 4E6XA 3QHYA 5GLCA 1I2SA 3UPOA 4JXWA 2OSUA 3HREA 1SDEA 4L0LA 1M6KA 2IWCA 4JPMA 1PI4A 3HLCA 3TG9A 4E3OA 3HLFA 4OQ0A 4WM9A 4WYYA 4OQIA 2Q9MA 3IXGA 3IH8A 3OPLA 3OPHA 4P6BA 4LV2A 4E3KA 2ZC3B 1NXYA 3BLSA 2EX6A 3WRTA 4R3JA 2Y2GA 4GOGA 4RX2A 5F1FA 5JYOA 2V20A 4MBHA 4OPQA 3GVBA 1EROA 1K4EA 1K56D 2IWDA 3LY4A 3HLBA 1ALQA 2ZM2A 1H8YA 4IVIA 5EOOA 1KDSA 1CI8A 3WRZA 4C75A 3IF6C 4RVAA 5FI2A 1SHVA 3BFDA 3BRMA 5F82A 1CK3A 3RXWA 3IQAA 5GLBA 3C4PA 1ESUA 3UDIA 3DTMA 3MBZA 3SOIA 3IF6B 4A5RA 4WMCD 1LI0A 1IKIA 3Q1FA 5FAQA 5EPHA 1PWGA 2XFTA 1BT5A 2ZJ9A 3FKVA 3N6IA 1BLPA 2RCXA 3DWZA 3VP2A 2Y59A 2Y2KA 3VFHA 3Q81A 4WZ5A 3O87A 3ZDJA 4JBFA 1YQSA 5DVAA 5FI7A 3UDFA 4R0QA 5CRFA 3MKFA 3ISGA 3UE3A 4PM6A 1MY8A 4OONA 1PYYA 3PBQA 1O07A 4OP5A 1YT4A 3MKEA 4S2IA 5FI6A 4O7DA 1IYSA 4GD8A 4ZDXA 1K6SA 3BFEA 1YLZA 4ZJ3A 3A3FA 3HL9A 2Y91A 3D4FA 5DTSA 4K0XA 3A3JA 3QNBA 4MEZA 4OQGA 3WWXA 2XH9A 4HEFA 3IWIA 4CPKA 2ZQAA 1L0DA 3ZG8B 1G68A 2WGIA 1RP5A 1U60A 3DW0A 4MNRA 2H10A 5L2FA 3HLWA 3W4PA 1C3BA 4MLLA 1KGGA 1IELA 5GHXA 4QD4A 3I7JA 3LY3A 4C6YA 2Y4AA 3HBRA 1RCJA 3JYIA 2WAEA 5CHJA 4KQOA 5E2HA 2WZXA 3ZG9B 1XP4A 2QPNA 3O3VA 2PBYA 4M3KA 5EE8A 1BZAA 2Q9NA 5FQKA 5TFQA 1MKIA 1JTGA 1JWZA 4RX3A 4KZ6A 4JLFA 1VQQA 3MXRA 4PPRA 1K57A 3NBLA 1QMEA 1KDWA 1ZKJA 2XGNA 2DCFA 2Y2PA 4ZJ1A 3GQZA 3C7VA 1TVFA 4FD8A 1LL9A 3GMWA 1E4DA 4HESA 2EX2A 1K55A 1N9BA 2Y2QA 3B3XA 3FV7A 4KZ7A 2ZC6B 1ONHA 3OCLA 4KZ8A 1GCEA 4R4RA 1TEMA 1HTZA 5EVIB 3FKWA 4GDBA 3FWLA 5E2GA 1S6RA 3VP3A 2P9VB 4QU3A 1JWVA 4WZ4A 3VMAA 1FR1A 2G2UA 4DE3A 4PMAA 4E3JA 5BOHA 5J8XA 5M1AA 2WAFA 1Q2QA 4BENA 4S2PA 1K4FA 3IWQA 2XK1A 1L0FA 3OZHA 5CEBA 2EX8A 4ZJ2A 5EOEA 2ZM0A 1RGZA 1NYYA 3UN7A 3PBRA 3BECA 1EI5A 4PM9A 5HAIA 4XXRA 2RL3A 5IHVA 5HX9A 4X53A 5EVLA 4BD0A 3EQUA 2HDQA 2EFUA 4JKTA 5CERA 2CC1A 1ZG4A 2Y2OA 3Q7ZA 4ID4A 3A3IA 3RXXA 4IVKA 4CJNA 3IXBA 2Y2LA 2ZMAA 3G31A 4C3QA 4QJGA 3E2LA 3G4PA 2IWBA 4JF6A 4ZBEA 4OLGA 3HLDA 1IYQA 1DY6A 2EXBA 3MXSA 1WYCA 2ZQ8A 1SDNA 3E2KA 3WS5A 5EVIA 1XXMA 5KSCA 1YM1A 3CJMA 3M6HA 5JYPA 3N8RA 1PW8A 2WZZA 3QNCA 1M40A 2P9VA 4OP8A 5FSRA 5KMWA 4OPYA 1ES2A 4JXGA 4KG5A 3CZDA 1HVBA 2B5RA 4EQIA 1YMXA 2GDNA 5TR7A 1XPBA 1K54A 1N4OA 3HLGA 2G2WA 2XDMA 1O7EA 3N8LA 4U0TA 5FDHA 4LENA 4DRTA 4DXBA 1GA9A 5DF9A 3LO7A 4EBPA 2HDSA 5DF7A 1LI9A 4WEJA 5AQAA 4S2LA 2OV5A 4X55A 4ZTKA 1PWDA 4Q8IA 1PI5A 3HLEA 1KE4A 1CEFA 4KZBA 5CEDA 4OOLA 4EBNA 5KSHA 3UO9A 4E3IA 1L0EA 1PIOA 4IBXA 3V3RA 4MBKA 3GV9A 1KGEA 2EFXA 3A3DA 5E2EA 5GLAA 4BL2A 1GHMA 3P98A 5FQMA 3VP1A 1JWPA 1LL5A 4GNUA 4N92A 4DE0A 2ZC5B 4QB8A 4UA9A 2H5SA 2Z2LB 4R1GA 2XEPA 4NETA 4Z9QA 1TDLA 3W8KA 3ZVWA 5GLDA 1GHIA 2I72A 3VSLA 3BYDA 3G32A 4X56A 1LLBA 2E8IA 3N7WA 1MWSA 4UAAA 4P87A 3SS4A 3WS1A 5F83A 3AGDA 1BLSA 2QZ6A 1NYMA 1KE3A 4U3TA 3IF6A 4LV1A 4DE2A 3AGFA 4N9KA 5CHUA 4R3BA 4E3LA 2Y2NA 3IT9A 3MZFA 1FSWA 2ZM8A 3PBSA 4GDNA 5A93A 4XUXA 3HUNA 1H8ZA 4BD1A 1J9MA 1MWTA 3WS4A 1E3UD 3NC8A 1PZOA 5F1GA 4KZAA 3IHAA 5EVID 3OPRA 4EV4A 4HBTA 3LCEA 2DRWA 3OPPA 1XA7A 2V1ZA 1FCMA 3GSGA 4NK3A 5CHMA 5FATA 2A49A 1NY0A 2P74A 5CGXA 4FSFA 5AQ7A 4OQHA 4DDSA 3UY6A 5FAPA 5AQBA 3IXHA 5A90A 1XA1A 4FCFA 1FR6A 1PZPA 2WKEA 1K38A 2JBFA 3C5AA 2ZLYA 4QY5A 1ZG6A 4R4SA 5FAOA 5CGWA 3VOZA 1VM1A 2WUQA 1MWUA 1PWCA 4WBGA 5CXWA 2J7VA 3BM6A 3TSGA 1HZOA 5HL1A 1AXBA 3M2JA 5TGFA 4DDYA 2X71A 3NI9A 4KQRA 1ERMA 3IHBA 1HD8A 4GB7A 4K91A 4OVDA 4D2OA 4Y0TA 4Y0UA 4BQMA 2HP6A 3DWKA 3V3SA 1S0WA 4KENB 2A3UA 1ERQA 3SH7A
chains in the Genus database with same CATH superfamily
5DF8A 4EESA 1SKFA 5EUAA 1MBLA 3ZVTA 5FQJA 3CG5A 5G18A 3BY8A 4EEPA 4F94A 3G34A 5AVEA 5M18A 1D1JA 3G6OA 3MQ0A 3P7NA 3A0VA 4KUKA 4BL3A 4M4XA 4GD6A 3ZG7B 4LLOB 1SKOA 4HP9A 1WYBA 1VETB 5A91A 4OPZA 5FDSA 3VP0A 2EX9A 5FL3A 4JF4A 5E2FA 4R38A 1RGYA 3EOIA 4FH4A 3DTIA 2PHYA 4KQQA 1YLYA 2ZQDA 1YSPA 3B33A 1EW0A 2VV8A 4U0XA 5HL6A 2Y2IA 2WGWB 4X68A 3CPTA 2VZWA 3VSKA 1NRFA 3G2ZA 3GTCA 4OKPA 2YKHA 4I3AA 3NIAA 2V0WA 2L1MA 4R23A 4LGWA 4G3WA 2G7UA 2WK0A 4IBRA 3G2YA 1XX2A 2NUTC 2QJ5A 2XRNA 3OCNA 4WL9A 1ES3A 1W8YA 4PM8A 5F68A 3ZCZA 2IA2A 4WEKA 4RQ9A 4JF5A 4DF6A 5IU1A 4KZ3A 4XT2A 1FCOA 3N8SA 3MS6A 4PAUA 2VKSA 2J80A 3Q7VA 1MWRA 3SS3A 3LIFA 4HY8A 2H0TA 1OPXA 3VV4A 4CLCA 4GN2A 3QP5A 4GHIA 2M1CA 5CX7A 1MC0A 2E8JA 3B47A 3O88A 3MFDA 4LV3A 2BTFP 1DJBA 2FFFB 1I2WA 4S2NA 2XA7M 4H8RA 1E25A 3BLMA 2ZOHA 3CAXA 1K56A 5DKLA 3RJUA 2JC7A 3VOYA 5CECA 2VGKA 3S1YA 4HIAA 1GSWA 3HUOA 4Q0IA 5HW3A 4II7A 2Z2MB 1XFQA 4JXVA 3CMZA 3MZDA 4L9EA 1YMSA 3VFFA 2VA0A 1IKGA 1TDGA 4EERA 2HPBA 4GLQA 2B02A 1K54C 3IH9A 3UPNA 3M6BA 4IEDA 4OH0A 1FQGA 1KVLA 1W5DA 3IS2A 2O99A 4JXWA 1T1CA 3HREA 2Z6DA 1OTIA 2WKQA 4Y5FA 1PI4A 3HLFA 4OQ0A 4WM9A 3IXGA 1BYWA 4Y3IA 4E3KA 4WLAA 1XJ4A 1JNUA 2L4RA 3T50A 4MBHA 1K4EA 3HLBA 2W3HA 1CI8A 2PYRA 1YAXA 4NXEA 3RXWA 5IS1A 2WKPA 3UDIA 3IF6B 4A5RA 3C38A 3Q1FA 1OTBA 3NOTC 1BT5A 2ZJ9A 3FKVA 3VP2A 1BLPA 3V67A 2Y2KA 4QWOA 3O87A 4WF0A 1STZA 1YQSA 3NOUC 1MY8A 1PYYA 3PBQA 4OP5A 4GD8A 2PD7A 3BFEA 2L0WA 4GS9A 3A3JA 2O9BA 3QNBA 4MEZA 3WWXA 2ZQAA 5HD3A 3ZG8B 1RP5A 4MNRA 2HF6A 4MLLA 1KGGA 1IELA 4LFUA 4HI4A 5GHXA 2W3FA 2Y4AA 3S7QA 5F6AA 4NXBA 5E2HA 2WZXA 3ZG9B 2QPNA 4M3KA 1JWZA 1XFNA 4MDZA 1S67L 3MXRA 1QMEA 1ZKJA 2XGNA 3GQZA 2JKGA 1TVFA 1LL9A 3GMWA 1UWNX 4HESA 2VV7A 2Y2QA 3B3XA 4G3KA 4O0PA 1GCEA 4Y17A 2PRFA 1HTZA 5EVIB 3FWLA 3PR6A 1JWVA 2G2UA 4PMAA 2WAFA 1L0FA 3OZHA 1RGZA 1NYYA 3PBRA 3E4PA 2JKTM 2W1TB 4HJ4A 1YPRA 4CJNA 1P9RA 5HPIA 4IUHA 4KUOA 4JF6A 3LR0A 5LBRA 2ZL1A 1SDNA 1XXMA 4NKPA 1M40A 2GNXA 1YMXA 1K54A 2G2WA 2HJ9C 2KDKA 3IX4A 5DF7A 1TS7A 5AQAA 4WEJA 2OV5A 3F1PA 1D06A 3UMDA 3H82A 5KSHA 1T1BA 3P98A 4JGQA 5F5YA 1LL5A 4GNUA 1ZHHB 4UA9A 3R4KA 2H5SA 4JGOA 4UQIS 3ZVWA 4FTXA 2E8IA 1MWSA 5F83A 1NYMA 1KE3A 5EV0A 4LV1A 3BQAA 4HJ3A 3AGFA 2VX8A 4R3BA 2Y2NA 3MZFA 3SZTA 4XUXA 5G4ZA 3WS4A 3C30A 4KZAA 4QPRA 5C5KA 5CHMA 2A49A 5AQ7A 4FSFA 2HV1A 3IXHA 4FCFA 1CF0A 1PZPA 2V1AA 1ZG6A 4ARZB 5J7EA 2J7VA 2O0YA 3TSGA 2K7SA 5TGFA 4DDYA 2X71A 2JKRM 3GDIA 3IHBA 1CJFA 2GZAA 4OVDA 3H9WA 4D2OA 3EEHA 2HP6A 1XJ6A 2I9VA 4R3AA 1ERQA 1AWIA 1W8QA 2J3TC 3W4OA 1I5QA 1Y4OA 2W3DA 5I94A 3LI9A 4ZAMA 4B4XA 1IYPA 2QKPA 1G6OA 3ITAA 3MFXA 3PHYA 4ETXA 4LPZA 4F3LB 2X02A 3WS2A 3E98A 4CLCD 4OPRA 1ES4A 4E3NA 1E3UA 5K5BA 3KSGA 5D3OA 4PM5A 2HP9A 2J9PA 3L7HA 4EQ1A 1XGJA 3ZNYA 1BSGA 1BLCA 2PDRA 2O9CA 3ICYA 4GKUA 1S4RA 2ZQ7A 2QJ7A 3PTEA 2UV0E 2K2NA 2R9WA 3EQVA 2PU2A 2JN7A 4I5SA 4BBUA 5DJTA 4I3IA 4S2KA 5FQ9A 3SH8A 3ZGAB 3NCKA 3SH9A 3V39A 1H0MA 1DRMA 2M7VA 4KG6A 3G35A 4S2NC 1VHMA 3K3DA 3U2AA 2WGWA 1OMEA 3IBRA 3Q07A 4OOYA 4EBLA 2OLUA 5CGSA 5U47A 3CI6A 1IEMA 4S2JA 3LIBA 2VJWA 4P0MA 5KZHA 1NLZA 3UDXA 2HJEA 3A3EA 3KYZA 3ZNTA 2FFYA 4DMZA 4BLMA 4HHDA 3G30A 4GJ4A 4QY6A 2C5WB 3T12B 4DXCA 4Q0JA 4EWFA 3ZG5A 4YFMA 1CEGA 4Z1WA 3FC7A 4WUJA 5GHZA 3NDGA 3IWOA 2EXAA 3GR2A 2Y2HA 2ZD8A 4LRXC 1GA0A 4BBVA 5M19A 2Y2MA 3ITBA 2QYBA 5GL9A 2P04A 5E43A 2JKTI 1YLWA 5EVIC 1Q2PA 3BW6A 4WMCA 3GRJA 4KZ4A 5AJGA 2HDUA 3VP4A 3C4OA 5FEFA 2PYPA 1FSYA 3LFVA 4HOIA 4BJPA 2XQZA 3QHYA 2P7JA 3UPOA 3T4TA 2OSUA 4UQIM 1OTDA 4E3OA 4WYYA 2Q9MA 4P6BA 1NXYA 2EX6A 2Y2GA 4RX2A 4PKYA 2V20A 3MQQA 1DP8A 3GVBA 3LY4A 3L9KA 5EOOA 3FPVA 3KX0X 3BFDA 3BRMA 3MF0A 3IQAA 1ESUA 2Q0OA 3T4KA 1P0ZA 3JVVA 4DJ3A 1LI0A 1IKIA 1G5UA 5FAQA 1NWZA 2RCXA 3DWZA 1VEUB 4JBFA 5DVAA 3ISGA 4PM6A 4IUKA 1MZUA 4S2IA 3S7PA 4ZJ3A 1MKMA 3D4FA 2CMNA 4HEFA 4HH2A 2WGIA 2V0UA 2H10A 3HLWA 2JKRI 4H6JB 3W4PA 4QD4A 3I7JA 3LY3A 1FILA 1N9LA 3JYIA 5CHJA 4YNRA 1D7EA 1XP4A 3LYXA 5EE8A 5TFQA 3LR3A 3QP2A 1MKIA 4RX3A 3FG8A 4O8GA 2B18A 4ETZA 3ZYTA 5F69A 1SKOB 3FV7A 1ONHA 4R4RA 4KZ8A 3MQOA 3FKWA 4GDBA 5E2GA 1S6RA 3VP3A 2P9VB 2YKFA 4QU3A 4WZ4A 4E3JA 1FR1A 1T19A 5J8XA 5M1AA 1K4FA 3IWQA 3UMEA 2EX8A 2ZM0A 3T4QA 1IFQA 3UN7A 2K31A 5IHVA 4X53A 3KYEA 2HDQA 4JKTA 5CERA 3UB8A 3Q7ZA 4ID4A 3RXXA 1XJ3A 4IVKA 3IXBA 2Y2LA 4HNBA 1UGUA 2OOLA 3E2LA 2IWBA 5L8MA 1IYQA 1WYCA 2ZQ8A 2OWJA 4K08A 5EVIA 4GW9A 5KSCA 3CJMA 5JYPA 2XSSA 4OPYA 1ES2A 4JXGA 3CZDA 2B5RA 3LIAA 3HLGA 5FDHA 4DXBA 4DRTA 2GJ3A 3QP8A 3LO7A 3OOVA 1KOUA 3IBJA 3NOPC 4X55A 3F1OB 4ZTKA 3T1QB 2W1TA 3HJKA 1KE4A 1CEFA 5CEDA 3DTEA 3UO9A 4E3IA 1L0EA 3GECA 4MBKA 3GV9A 1KGEA 4EETB 3A3DA 5GLAA 4BL2A 5G4YA 1GHMA 5FQMA 3QP1A 4D60A 2VLGA 4CLCB 4QB8A 3OBFA 4R1GA 4Z9QA 1TDLA 3OLOA 5L10A 4FOFA 3VSLA 4X56A 1LLBA 3S7OA 1L3LA 3SS4A 4Y15A 4DE2A 4N9KA 3C8CA 3PBSA 4GDNA 1E3UD 3IHAA 2DRWA 3GSGA 3NECA 1NY0A 3UY6A 4WN5A 5FAPA 5AQBA 5A90A 1K38A 2JBFA 3C5AA 5CGWA 1VM1A 1PWCA 3A0RA 1AXBA 2W27A 3VOLA 3NI9A 4KQRA 1HD8A 4GB7A 3NULA 4Y0TA 4HQAA 2AVXA 2BASA 1A0KA 4ME4A 2A3UA 1F2KA 3CUEC 3VE4A 1SCWA 4S2MA 4MN7A 2WYXA 4E6WA 4DJ2A 1DJCA 2HZ5A 2JCHA 1F5MA 4HJ6A 4EEUA 4UHUA 4ARZA 3FYZA 2V8FA 1BTLA 3U4LP 4HBUA 5FQQA 1XJ2A 1OTEA 4WELA 4EUVA 1T18A 3LR4A 3S7NA 4K0WA 4Y0OA 4RYEA 3TW8A 4N1XA 2XD1A 4O01A 2J8YA 1IOUA 4MBFA 1ONGA 1N9OA 3SS5A 4B9OA 2KLIA 3UNWA 1ZC2A 1GHPA 2DNSA 3TOIA 3DTKA 1NZUA 5FA7A 1TF1A 3ZG0A 2V2FF 1Z09A 5DFXA 3PXPA 1MXOA 1YLJA 4X69A 1OTAA 4F3LA 4KQDA 4DE1A 4HH3A 3O86A 3MJQA 1ES5A 2Y79A 2QHKA 2VGLS 1YLPA 2ZC7A 1XKZA 1P9WA 4I38A 1OT9A 4EUZA 2J9OA 2OLVA 4FH2A 3F1NB 1W7FA 4UA7A 2JHEA 3PBNA 3S4XA 4OLDA 1K25A 1ODVA 1Z6FA 5GHYA 3TRCA 1DJAA 3P09A 1FOFA 1NZOA 1L0GA 5HARA 4KZ9A 3T4OA 4PM7A 3LICA 1PFLA 3BFFA 4DN0A 1K57C 3ULFA 2ZQCA 4B4ZA 3BQ8A 2WKHA 2OAQ1 4NXGA 1K55C 2J3TD 4N9LA 2XF3A 4LV0A 3UE6A 5A8BA 2Z6CA 3PBTA 2JE5A 3IXDA 3NJAA 2C6WB 2ZQ9A 3BFCA 2BLSA 4JGRA 1KVMA 5A92A 4UA6A 3C7UA 3NY4A 5EECA 3R7WB 1PW1A 3PAEA 1MPLA 2XR0A 1PNEA 4I39A 2EWVA 4EU0A 3IF5A 1IYOA 3OC2A 1OT6A 1NJ4A 1QMFA 5TBMB 3P01A 3PAGA 2ZL1B 4YINA 3V50A 1BLHA 1F9IA 2H0YA 3SW1A 4P85A 4PHTA 4X25A 2A24B 4L0LA 3QP4A 4ZRRA 1H3QA 4JPMA 3HLCA 3TG9A 4FUWA 3CUEA 4OQIA 5HDSA 3IH8A 3OPLA 1LSXA 4MN5A 3WRTA 2OWHA 4R3JA 4GOGA 1FIKA 1EROA 1K56D 2IWDA 1ALQA 4IVIA 1H8YA 3JPUA 3C2WA 5DKKA 1VETA 3IF6C 5EM0A 4RVAA 5FI2A 1UWPX 5F82A 1ACFA 3C4PA 3DTMA 3FPWA 2WKRA 3LIDA 4LRZE 3MBZA 3SOIA 3KSIA 1PWGA 2PR6A 2XFTA 2Y59A 2D02A 3ZDJA 1OJGA 3UDFA 1S4SA 4R0QA 2V1BA 3UE3A 4OONA 3E4QA 1ZTUA 1YT4A 1HLUP 3MKEA 2W1RA 4O7DA 1IYSA 1K6SA 3A3FA 2P08A 3A0SA 5DTSA 4K0XA 4B93A 3BWLA 1L0DA 1VB6A 1U60A 5L2FA 1VEUA 1C3BA 5HDCA 4IJGA 4E04A 2V9AA 4C6YA 1RCJA 2WAEA 1NLYA 2PBYA 1BZAA 2Q9NA 5FQKA 3EGXC 2EA9A 4JLFA 1GSXA 1K57A 2Y2PA 4FD8A 4X1LA 2EX2A 1K55A 2PBDP 3ZQ5A 4JGPA 3TE8A 4BWIA 4KZ7A 2ZC6B 3OCLA 1TEMA 4AFIA 2VGLM 1DP6A 3RTYA 5BOHA 3TJZC 5IT5A 4BENA 3NHQA 2XK1A 4PM9A 5HAIA 2RL3A 2XROA 2A2LA 5EVLA 3MR0A 1ZG4A 2Y2OA 3MSHA 2ZMAA 3G31A 3T4JA 4ZBEA 4OLGA 3H7WB 1CQAA 1DY6A 1PRQA 3HJIA 2J3WA 1YM1A 3M6HA 3N8RA 5KMWA 2WZZA 2P9VA 4KG5A 4EQIA 1HVBA 2GDNA 5TR7A 2XDMA 1O7EA 4U0TA 2JKFA 5DF9A 4EBPA 3W2ZA 1PWDA 3HLEA 1TS8A 4KZBA 4OOLA 4EBNA 1NRJA 3VP1A 3E0YA 4DE0A 2XEPA 3PYPA 2I72A 2V8CA 3BYDA 3G32A 3N7WA 5HPFA 4BBTA 4UAAA 2W0NA 3WS1A 3AGDA 1BLSA 2QZ6A 4U3TA 1N9NA 1YSQA 3IF6A 3IX8A 4R6LA 3F1OA 5CHUA 4E3LA 3IT9A 1FSWA 2ZM8A 3QP6A 5I5LA 3CITA 4HP4A 1J9MA 4Y2FA 3LUQA 3NC8A 1PZOA 4G3VA 4EV4A 3LCEA 5HDDA 3OPPA 1XA7A 2V1ZA 3KO6A 3UB6A 4MCWA 4NK3A 1F98A 5FATA 4EW7A 2P74A 5CGXA 4OQHA 4DDSA 5L09A 1TS0A 4QY5A 4R4SA 4MN6A 2WUQA 4WBGA 5CXWA 3BM6A 5EFWA 4Y0UA 2VV6A 4BQMA 3DWKA 4KENB 3HUMA 1OJ5A 2BG1A 3NDEA 4QHCA 3B42A 4GZBA 3MZEA 3M2KA 3N4IA 4S2OA 3D3OA 2Y55A 1KGFA 2VEAA 2D01A 5AQ9A 3DAVA 3CPTB 3Q82A 1W79A 2ZMFA 2X01A 3BFGA 4BMWA 3LGOA 3UE0A 4LCMA 4NXFA 3HVFA 3AGEA 2PD8A 2FZ0A 3UE1A 1BUEA 4WZ5C 3ZFZA 1L2SA 2Y2JA 4X6TA 3FZCA 2WGVA 3KSFA 1S1ZA 2XLNA 1JTDA 4OOMA 3DBAA 4NEED 1LHYA 2WKIA 2VGJA 4XT2B 1XGIA 1KE0A 3EEAA 5MC7A 3UPPA 3Q7VB 3LR5A 5TJJA 3UB9A 5HFOA 5DTTA 1G6AA 4KG2A 4GHIB 5FASA 2HP5A 2HDRA 3T4SA 2QWSA 2WADA 4LCLA 2GX5A 2FH5A 4DKIA 5HSQA 5HWVA 2PR5A 2ZC4B 1YLTA 2XFSA 4GCZA 4JXSA 1Y54A 1G28A 3T1XA 2W3GA 5DTKA 1FCNA 5FQIA 3W4QA 5CTNA 2PU4A 4N1HA 1CI9A 3F1NA 2OAP1 3EGDC 1K6RA 5AVFA 3K2NA 5EM1A 3T1SA 3LI8A 4B88A 3WS0A 1BULA 5J4EA 3ZHHA 1WE4A 3V5MA 2R9XA 3IS2B 1H5XA 2H28A 4NG2A 2DMWA 4YOFA 2W3EA 4RA7A 1YKDA 3T1RA 5HAQA 2NUPC 1EWZA 3LEZA 4XUZA 2VK3A 5CTMA 4IHQA 3PBOA 3BJNA 2QMIA 3S22A 2UWXA 3D72A 1W63M 5J3WA 4EXOA 2XD5A 1JVJA 4Y7PA 5HAPA 4KZ5A 2ZOIA 1LSVA 2R78A 4E3MA 1ESIA 5EVEA 3BEBA 4R70A 4P6ZS 4E6XA 5GLCA 1I2SA 3R7WA 3BY9A 1SDEA 2O9AA 2ZBBA 1M6KA 2IWCA 3KYQA 2HGVA 1J3WA 3OPHA 4LV2A 2ZC3B 3BLSA 1Y28A 5TBMA 5F1FA 5JYOA 2PT7A 4Q0HA 4OPQA 2EWWA 2ZM2A 1KDSA 3WRZA 4C75A 5HWTA 1SHVA 2LB5A 4GS9B 1CK3A 2A24A 5GLBA 5DFYA 3KSHA 3K3CA 4WMCD 3RFBA 5EPHA 1P97A 3IX3A 3N6IA 2KX6A 4MMNA 3VFHA 3Q81A 4WZ5A 5FI7A 5CRFA 3MKFA 1H8MA 1O07A 5FI6A 4ZDXA 1LL8A 1V9ZA 1YLZA 3HL9A 4L9FA 2Y91A 1DP9A 4OQGA 2XH9A 3IWIA 4CPKA 2PAVP 5HZHA 3LIEA 1G68A 2INWA 3CWFA 3DW0A 3UB7A 1GSVA 5HD5A 4CQHA 3HBRA 1TS6A 4KQOA 3O3VA 1S1YA 1JTGA 3MXQA 4KZ6A 1VQQA 3T4LA 4ESPA 4PPRA 3CLOA 3NBLA 1KDWA 4L9GA 2DCFA 4ZJ1A 3C7VA 1E4DA 1S66L 1N9BA 1LSWA 2B95A 3UB5P 1LT0A 4LRYC 4QJGA 3VMAA 5DJUA 4YWZA 4DE3A 1Q2QA 2LB9A 1X0OA 4S2PA 5CEBA 2ACGA 4ZJ2A 5EOEA 3BECA 1EI5A 2Y8HA 4XXRA 5HX9A 1WA9A 4BD0A 3F1PB 3EQUA 2EFUA 2XA7S 2CC1A 3H82B 3A3IA 4C3QA 2ZMVA 3G4PA 1TD5A 5HWWA 3HLDA 2EXBA 3MXSA 3E2KA 3WS5A 3QNCA 1PW8A 4OP8A 5FSRA 5L07A 4PKYG 1XPBA 1N4OA 3N8LA 4LENA 1GA9A 2HDSA 1LI9A 4S2LA 4Q8IA 1PI5A 4CLCC 5FEGA 3LEQA 1PIOA 4IBXA 3V3RA 3HCYA 3CHWP 2EFXA 5E2EA 3H7WA 1JWPA 4CLCE 4N92A 2ZC5B 2Z2LB 4NETA 3E4OA 3W8KA 5GLDA 1GHIA 4I3JA 4UEYA 1V9YA 1W63Q 4P87A 1K0KA 3VE3A 1T1AA 3RH8B 4Y13A 5A93A 3HUNA 1H8ZA 4BD1A 1MWTA 3MMHA 5F1GA 2MJ6A 5EVID 3OPRA 5KIZA 4HBTA 4X1MA 1FCMA 1SZVA 2M7UA 4P6ZM 3D9YA 1XA1A 1FR6A 2WKEA 2ZLYA 3JVUA 5FAOA 3EWKA 3VOZA 1MWUA 1HZOA 5HL1A 3M2JA 2KOIA 3O5YA 1ERMA 4K91A 3V3SA 1S0WA 4H6JA 3SH7A
chains in the Genus database with same CATH topology
1SCWA 5DF8A 1W8QA 4S2MA 1SKFA 2BG1A 1MBLA 3HUMA 5EUAA 2WYXA 3W4OA 3ZVTA 4E6WA 5FQJA 1I5QA 3NDEA 4QHCA 3CG5A 5I94A 1DJCA 5G18A 4GZBA 3MZEA 3M2KA 4ZAMA 4F94A 2JCHA 3G34A 3N4IA 4S2OA 4B4XA 5M18A 1IYPA 4UHUA 2Y55A 3FYZA 1KGFA 3ITAA 1BTLA 4HBUA 5FQQA 4BL3A 4WELA 5AQ9A 4GD6A 3Q82A 1W79A 3ZG7B 2X01A 3BFGA 4K0WA 4Y0OA 2X02A 4RYEA 3WS2A 4N1XA 2XD1A 3UE0A 1WYBA 2J8YA 5A91A 4LCMA 3HVFA 4MBFA 1ONGA 4OPZA 3AGEA 4OPRA 3SS5A 1ES4A 3VP0A 4E3NA 2EX9A 3UNWA 1ZC2A 1E3UA 1GHPA 2DNSA 3UE1A 3TOIA 4JF4A 5E2FA 1BUEA 1RGYA 4WZ5C 3ZFZA 4FH4A 1L2SA 1NZUA 2Y2JA 4X6TA 5D3OA 5FA7A 4PM5A 2HP9A 3FZCA 2J9PA 4KQQA 2WGVA 1YLYA 3ZG0A 1XGJA 2XLNA 3ZNYA 2V2FF 1BSGA 1JTDA 1BLCA 2ZQDA 4OOMA 1MXOA 4U0XA 1LHYA 1YLJA 4X69A 2Y2IA 2WGWB 2WKIA 4GKUA 2VGJA 2ZQ7A 1XGIA 4X68A 1KE0A 3PTEA 4DE1A 3VSKA 3O86A 2R9WA 3EQVA 3UPPA 1ES5A 1NRFA 2PU2A 3G2ZA 3Q7VB 5FQ9A 4S2KA 3GTCA 1YLPA 2ZC7A 3SH8A 1XKZA 5HFOA 4OKPA 5DTTA 3ZGAB 3NIAA 3NCKA 4EUZA 4R23A 2J9OA 1G6AA 4KG2A 3SH9A 3V39A 2OLVA 4FH2A 5FASA 4KG6A 2HP5A 2WK0A 4IBRA 2HDRA 3G35A 3G2YA 1W7FA 1XX2A 4S2NC 3OCNA 4UA7A 2WADA 3PBNA 4LCLA 1ES3A 3S4XA 1W8YA 4PM8A 4OLDA 3ZCZA 1K25A 4WEKA 4DKIA 1Z6FA 5GHYA 1DJAA 3P09A 2WGWA 1FOFA 1NZOA 1OMEA 4JF5A 2ZC4B 1L0GA 4KZ3A 1YLTA 4DF6A 3Q07A 4OOYA 4EBLA 1FCOA 5HARA 2OLUA 2XFSA 3N8SA 4KZ9A 4PM7A 5CGSA 4JXSA 1Y54A 5U47A 3Q7VA 1MWRA 3BFFA 1IEMA 1K57C 3SS3A 2ZQCA 1FCNA 4S2JA 5DTKA 5FQIA 4B4ZA 4P0MA 5KZHA 2H0TA 3W4QA 4GN2A 3UDXA 2WKHA 3A3EA 3ZNTA 2FFYA 5CTNA 2PU4A 1K55C 4N1HA 1CI9A 4BLMA 4N9LA 2XF3A 4LV0A 1K6RA 3G30A 4QY6A 3O88A 3MFDA 3PBTA 4LV3A 2C5WB 2JE5A 3IXDA 1DJBA 2FFFB 1I2WA 4S2NA 4DXCA 4EWFA 3ZG5A 4H8RA 1E25A 2C6WB 2ZQ9A 4YFMA 3BFCA 4B88A 1CEGA 3WS0A 5GHZA 1BULA 3BLMA 3IWOA 3NDGA 2BLSA 3ZHHA 2EXAA 1WE4A 3V5MA 5A92A 1KVMA 1K56A 3GR2A 3RJUA 2Y2HA 2ZD8A 2R9XA 4UA6A 2JC7A 1H5XA 3VOYA 5CECA 3C7UA 2VGKA 3S1YA 5HW3A 3HUOA 3NY4A 1GA0A 5EECA 2Z2MB 1PW1A 5M19A 3PAEA 1MPLA 4JXVA 3CMZA 2XR0A 2Y2MA 4RA7A 3MZDA 1YMSA 3ITBA 5HAQA 3VFFA 1EWZA 5GL9A 3LEZA 4XUZA 3IF5A 5CTMA 5E43A 3PBOA 1IYOA 1YLWA 3OC2A 5EVIC 1Q2PA 4WMCA 1IKGA 2QMIA 3GRJA 1NJ4A 2UWXA 4KZ4A 1QMFA 3S22A 1TDGA 2HDUA 3VP4A 3C4OA 3PAGA 2HPBA 2XD5A 1K54C 1JVJA 4Y7PA 3IH9A 4YINA 4KZ5A 1BLHA 3UPNA 3V50A 5HAPA 1FSYA 2H0YA 3M6BA 4P85A 1ESIA 4IEDA 4E3MA 4OH0A 1FQGA 3BEBA 4BJPA 1KVLA 1W5DA 2XQZA 4E6XA 3QHYA 5GLCA 1I2SA 3UPOA 4JXWA 2OSUA 3HREA 1SDEA 4L0LA 1M6KA 2IWCA 4JPMA 1PI4A 3HLCA 3TG9A 4E3OA 3HLFA 4OQ0A 4WM9A 4WYYA 4OQIA 2Q9MA 3IXGA 3IH8A 3OPLA 3OPHA 4P6BA 4LV2A 4E3KA 2ZC3B 1NXYA 3BLSA 2EX6A 3WRTA 4R3JA 2Y2GA 4GOGA 4RX2A 5F1FA 5JYOA 2V20A 4MBHA 4OPQA 3GVBA 1EROA 1K4EA 1K56D 2IWDA 3LY4A 3HLBA 1ALQA 2ZM2A 1H8YA 4IVIA 5EOOA 1KDSA 1CI8A 3WRZA 4C75A 3IF6C 4RVAA 5FI2A 1SHVA 3BFDA 3BRMA 5F82A 1CK3A 3RXWA 3IQAA 5GLBA 3C4PA 1ESUA 3UDIA 3DTMA 3MBZA 3SOIA 3IF6B 4A5RA 4WMCD 1LI0A 1IKIA 3Q1FA 5FAQA 5EPHA 1PWGA 2XFTA 1BT5A 2ZJ9A 3FKVA 3N6IA 1BLPA 2RCXA 3DWZA 3VP2A 2Y59A 2Y2KA 3VFHA 3Q81A 4WZ5A 3O87A 3ZDJA 4JBFA 1YQSA 5DVAA 5FI7A 3UDFA 4R0QA 5CRFA 3MKFA 3ISGA 3UE3A 4PM6A 1MY8A 4OONA 1PYYA 3PBQA 1O07A 4OP5A 1YT4A 3MKEA 4S2IA 5FI6A 4O7DA 1IYSA 4GD8A 4ZDXA 1K6SA 3BFEA 1YLZA 4ZJ3A 3A3FA 3HL9A 2Y91A 3D4FA 5DTSA 4K0XA 3A3JA 3QNBA 4MEZA 4OQGA 3WWXA 2XH9A 4HEFA 3IWIA 4CPKA 2ZQAA 1L0DA 3ZG8B 1G68A 2WGIA 1RP5A 1U60A 3DW0A 4MNRA 2H10A 5L2FA 3HLWA 3W4PA 1C3BA 4MLLA 1KGGA 1IELA 5GHXA 4QD4A 3I7JA 3LY3A 4C6YA 2Y4AA 3HBRA 1RCJA 3JYIA 2WAEA 5CHJA 4KQOA 5E2HA 2WZXA 3ZG9B 1XP4A 2QPNA 3O3VA 2PBYA 4M3KA 5EE8A 1BZAA 2Q9NA 5FQKA 5TFQA 1MKIA 1JTGA 1JWZA 4RX3A 4KZ6A 4JLFA 1VQQA 3MXRA 4PPRA 1K57A 3NBLA 1QMEA 1KDWA 1ZKJA 2XGNA 2DCFA 2Y2PA 4ZJ1A 3GQZA 3C7VA 1TVFA 4FD8A 1LL9A 3GMWA 1E4DA 4HESA 2EX2A 1K55A 1N9BA 2Y2QA 3B3XA 3FV7A 4KZ7A 2ZC6B 1ONHA 3OCLA 4KZ8A 1GCEA 4R4RA 1TEMA 1HTZA 5EVIB 3FKWA 4GDBA 3FWLA 5E2GA 1S6RA 3VP3A 2P9VB 4QU3A 1JWVA 4WZ4A 3VMAA 1FR1A 2G2UA 4DE3A 4PMAA 4E3JA 5BOHA 5J8XA 5M1AA 2WAFA 1Q2QA 4BENA 4S2PA 1K4FA 3IWQA 2XK1A 1L0FA 3OZHA 5CEBA 2EX8A 4ZJ2A 5EOEA 2ZM0A 1RGZA 1NYYA 3UN7A 3PBRA 3BECA 1EI5A 4PM9A 5HAIA 4XXRA 2RL3A 5IHVA 5HX9A 4X53A 5EVLA 4BD0A 3EQUA 2HDQA 2EFUA 4JKTA 5CERA 2CC1A 1ZG4A 2Y2OA 3Q7ZA 4ID4A 3A3IA 3RXXA 4IVKA 4CJNA 3IXBA 2Y2LA 2ZMAA 3G31A 4C3QA 4QJGA 3E2LA 3G4PA 2IWBA 4JF6A 4ZBEA 4OLGA 3HLDA 1IYQA 1DY6A 2EXBA 3MXSA 1WYCA 2ZQ8A 1SDNA 3E2KA 3WS5A 5EVIA 1XXMA 5KSCA 1YM1A 3CJMA 3M6HA 5JYPA 3N8RA 1PW8A 2WZZA 3QNCA 1M40A 2P9VA 4OP8A 5FSRA 5KMWA 4OPYA 1ES2A 4JXGA 4KG5A 3CZDA 1HVBA 2B5RA 4EQIA 1YMXA 2GDNA 5TR7A 1XPBA 1K54A 1N4OA 3HLGA 2G2WA 2XDMA 1O7EA 3N8LA 4U0TA 5FDHA 4LENA 4DRTA 4DXBA 1GA9A 5DF9A 3LO7A 4EBPA 2HDSA 5DF7A 1LI9A 4WEJA 5AQAA 4S2LA 2OV5A 4X55A 4ZTKA 1PWDA 4Q8IA 1PI5A 3HLEA 1KE4A 1CEFA 4KZBA 5CEDA 4OOLA 4EBNA 5KSHA 3UO9A 4E3IA 1L0EA 1PIOA 4IBXA 3V3RA 4MBKA 3GV9A 1KGEA 2EFXA 3A3DA 5E2EA 5GLAA 4BL2A 1GHMA 3P98A 5FQMA 3VP1A 1JWPA 1LL5A 4GNUA 4N92A 4DE0A 2ZC5B 4QB8A 4UA9A 2H5SA 2Z2LB 4R1GA 2XEPA 4NETA 4Z9QA 1TDLA 3W8KA 3ZVWA 5GLDA 1GHIA 2I72A 3VSLA 3BYDA 3G32A 4X56A 1LLBA 2E8IA 3N7WA 1MWSA 4UAAA 4P87A 3SS4A 3WS1A 5F83A 3AGDA 1BLSA 2QZ6A 1NYMA 1KE3A 4U3TA 3IF6A 4LV1A 4DE2A 3AGFA 4N9KA 5CHUA 4R3BA 4E3LA 2Y2NA 3IT9A 3MZFA 1FSWA 2ZM8A 3PBSA 4GDNA 5A93A 4XUXA 3HUNA 1H8ZA 4BD1A 1J9MA 1MWTA 3WS4A 1E3UD 3NC8A 1PZOA 5F1GA 4KZAA 3IHAA 5EVID 3OPRA 4EV4A 4HBTA 3LCEA 2DRWA 3OPPA 1XA7A 2V1ZA 1FCMA 3GSGA 4NK3A 5CHMA 5FATA 2A49A 1NY0A 2P74A 5CGXA 4FSFA 5AQ7A 4OQHA 4DDSA 3UY6A 5FAPA 5AQBA 3IXHA 5A90A 1XA1A 4FCFA 1FR6A 1PZPA 2WKEA 1K38A 2JBFA 3C5AA 2ZLYA 4QY5A 1ZG6A 4R4SA 5FAOA 5CGWA 3VOZA 1VM1A 2WUQA 1MWUA 1PWCA 4WBGA 5CXWA 2J7VA 3BM6A 3TSGA 1HZOA 5HL1A 1AXBA 3M2JA 5TGFA 4DDYA 2X71A 3NI9A 4KQRA 1ERMA 3IHBA 1HD8A 4GB7A 4K91A 4OVDA 4D2OA 4Y0TA 4Y0UA 4BQMA 2HP6A 3DWKA 3V3SA 1S0WA 4KENB 2A3UA 1ERQA 3SH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SCW A;  5DF8 A;  1W8Q A;  4S2M A;  1SKF A;  2BG1 A;  1MBL A;  3HUM A;  5EUA A;  2WYX A;  3W4O A;  3ZVT A;  4E6W A;  5FQJ A;  1I5Q A;  3NDE A;  4QHC A;  3CG5 A;  5I94 A;  1DJC A;  5G18 A;  4GZB A;  3MZE A;  3M2K A;  4ZAM A;  4F94 A;  2JCH A;  3G34 A;  3N4I A;  4S2O A;  4B4X A;  5M18 A;  1IYP A;  4UHU A;  2Y55 A;  3FYZ A;  1KGF A;  3ITA A;  1BTL A;  4HBU A;  5FQQ A;  4BL3 A;  4WEL A;  5AQ9 A;  4GD6 A;  3Q82 A;  1W79 A;  3ZG7 B;  2X01 A;  3BFG A;  4K0W A;  4Y0O A;  2X02 A;  4RYE A;  3WS2 A;  4N1X A;  2XD1 A;  3UE0 A;  1WYB A;  2J8Y A;  5A91 A;  4LCM A;  3HVF A;  4MBF A;  1ONG A;  4OPZ A;  3AGE A;  4OPR A;  3SS5 A;  1ES4 A;  3VP0 A;  4E3N A;  2EX9 A;  3UNW A;  1ZC2 A;  1E3U A;  1GHP A;  2DNS A;  3UE1 A;  3TOI A;  4JF4 A;  5E2F A;  1BUE A;  1RGY A;  4WZ5 C;  3ZFZ A;  4FH4 A;  1L2S A;  1NZU A;  2Y2J A;  4X6T A;  5D3O A;  5FA7 A;  4PM5 A;  2HP9 A;  3FZC A;  2J9P A;  4KQQ A;  2WGV A;  1YLY A;  3ZG0 A;  1XGJ A;  2XLN A;  3ZNY A;  2V2F F;  1BSG A;  1JTD A;  1BLC A;  2ZQD A;  4OOM A;  1MXO A;  4U0X A;  1LHY A;  1YLJ A;  4X69 A;  2Y2I A;  2WGW B;  2WKI A;  4GKU A;  2VGJ A;  2ZQ7 A;  1XGI A;  4X68 A;  1KE0 A;  3PTE A;  4DE1 A;  3VSK A;  3O86 A;  2R9W A;  3EQV A;  3UPP A;  1ES5 A;  1NRF A;  2PU2 A;  3G2Z A;  3Q7V B;  5FQ9 A;  4S2K A;  3GTC A;  1YLP A;  2ZC7 A;  3SH8 A;  1XKZ A;  5HFO A;  4OKP A;  5DTT A;  3ZGA B;  3NIA A;  3NCK A;  4EUZ A;  4R23 A;  2J9O A;  1G6A A;  4KG2 A;  3SH9 A;  3V39 A;  2OLV A;  4FH2 A;  5FAS A;  4KG6 A;  2HP5 A;  2WK0 A;  4IBR A;  2HDR A;  3G35 A;  3G2Y A;  1W7F A;  1XX2 A;  4S2N C;  3OCN A;  4UA7 A;  2WAD A;  3PBN A;  4LCL A;  1ES3 A;  3S4X A;  1W8Y A;  4PM8 A;  4OLD A;  3ZCZ A;  1K25 A;  4WEK A;  4DKI A;  1Z6F A;  5GHY A;  1DJA A;  3P09 A;  2WGW A;  1FOF A;  1NZO A;  1OME A;  4JF5 A;  2ZC4 B;  1L0G A;  4KZ3 A;  1YLT A;  4DF6 A;  3Q07 A;  4OOY A;  4EBL A;  1FCO A;  5HAR A;  2OLU A;  2XFS A;  3N8S A;  4KZ9 A;  4PM7 A;  5CGS A;  4JXS A;  1Y54 A;  5U47 A;  3Q7V A;  1MWR A;  3BFF A;  1IEM A;  1K57 C;  3SS3 A;  2ZQC A;  1FCN A;  4S2J A;  5DTK A;  5FQI A;  4B4Z A;  4P0M A;  5KZH A;  2H0T A;  3W4Q A;  4GN2 A;  3UDX A;  2WKH A;  3A3E A;  3ZNT A;  2FFY A;  5CTN A;  2PU4 A;  1K55 C;  4N1H A;  1CI9 A;  4BLM A;  4N9L A;  2XF3 A;  4LV0 A;  1K6R A;  3G30 A;  4QY6 A;  3O88 A;  3MFD A;  3PBT A;  4LV3 A;  2C5W B;  2JE5 A;  3IXD A;  1DJB A;  2FFF B;  1I2W A;  4S2N A;  4DXC A;  4EWF A;  3ZG5 A;  4H8R A;  1E25 A;  2C6W B;  2ZQ9 A;  4YFM A;  3BFC A;  4B88 A;  1CEG A;  3WS0 A;  5GHZ A;  1BUL A;  3BLM A;  3IWO A;  3NDG A;  2BLS A;  3ZHH A;  2EXA A;  1WE4 A;  3V5M A;  5A92 A;  1KVM A;  1K56 A;  3GR2 A;  3RJU A;  2Y2H A;  2ZD8 A;  2R9X A;  4UA6 A;  2JC7 A;  1H5X A;  3VOY A;  5CEC A;  3C7U A;  2VGK A;  3S1Y A;  5HW3 A;  3HUO A;  3NY4 A;  1GA0 A;  5EEC A;  2Z2M B;  1PW1 A;  5M19 A;  3PAE A;  1MPL A;  4JXV A;  3CMZ A;  2XR0 A;  2Y2M A;  4RA7 A;  3MZD A;  1YMS A;  3ITB A;  5HAQ A;  3VFF A;  1EWZ A;  5GL9 A;  3LEZ A;  4XUZ A;  3IF5 A;  5CTM A;  5E43 A;  3PBO A;  1IYO A;  1YLW A;  3OC2 A;  5EVI C;  1Q2P A;  4WMC A;  1IKG A;  2QMI A;  3GRJ A;  1NJ4 A;  2UWX A;  4KZ4 A;  1QMF A;  3S22 A;  1TDG A;  2HDU A;  3VP4 A;  3C4O A;  3PAG A;  2HPB A;  2XD5 A;  1K54 C;  1JVJ A;  4Y7P A;  3IH9 A;  4YIN A;  4KZ5 A;  1BLH A;  3UPN A;  3V50 A;  5HAP A;  1FSY A;  2H0Y A;  3M6B A;  4P85 A;  1ESI A;  4IED A;  4E3M A;  4OH0 A;  1FQG A;  3BEB A;  4BJP A;  1KVL A;  1W5D A;  2XQZ A;  4E6X A;  3QHY A;  5GLC A;  1I2S A;  3UPO A;  4JXW A;  2OSU A;  3HRE A;  1SDE A;  4L0L A;  1M6K A;  2IWC A;  4JPM A;  1PI4 A;  3HLC A;  3TG9 A;  4E3O A;  3HLF A;  4OQ0 A;  4WM9 A;  4WYY A;  4OQI A;  2Q9M A;  3IXG A;  3IH8 A;  3OPL A;  3OPH A;  4P6B A;  4LV2 A;  4E3K A;  2ZC3 B;  1NXY A;  3BLS A;  2EX6 A;  3WRT A;  4R3J A;  2Y2G A;  4GOG A;  4RX2 A;  5F1F A;  5JYO A;  2V20 A;  4MBH A;  4OPQ A;  3GVB A;  1ERO A;  1K4E A;  1K56 D;  2IWD A;  3LY4 A;  3HLB A;  1ALQ A;  2ZM2 A;  1H8Y A;  4IVI A;  5EOO A;  1KDS A;  1CI8 A;  3WRZ A;  4C75 A;  3IF6 C;  4RVA A;  5FI2 A;  1SHV A;  3BFD A;  3BRM A;  5F82 A;  1CK3 A;  3RXW A;  3IQA A;  5GLB A;  3C4P A;  1ESU A;  3UDI A;  3DTM A;  3MBZ A;  3SOI A;  3IF6 B;  4A5R A;  4WMC D;  1LI0 A;  1IKI A;  3Q1F A;  5FAQ A;  5EPH A;  1PWG A;  2XFT A;  1BT5 A;  2ZJ9 A;  3FKV A;  3N6I A;  1BLP A;  2RCX A;  3DWZ A;  3VP2 A;  2Y59 A;  2Y2K A;  3VFH A;  3Q81 A;  4WZ5 A;  3O87 A;  3ZDJ A;  4JBF A;  1YQS A;  5DVA A;  5FI7 A;  3UDF A;  4R0Q A;  5CRF A;  3MKF A;  3ISG A;  3UE3 A;  4PM6 A;  1MY8 A;  4OON A;  1PYY A;  3PBQ A;  1O07 A;  4OP5 A;  1YT4 A;  3MKE A;  4S2I A;  5FI6 A;  4O7D A;  1IYS A;  4GD8 A;  4ZDX A;  1K6S A;  3BFE A;  1YLZ A;  4ZJ3 A;  3A3F A;  3HL9 A;  2Y91 A;  3D4F A;  5DTS A;  4K0X A;  3A3J A;  3QNB A;  4MEZ A;  4OQG A;  3WWX A;  2XH9 A;  4HEF A;  3IWI A;  4CPK A;  2ZQA A;  1L0D A;  3ZG8 B;  1G68 A;  2WGI A;  1RP5 A;  1U60 A;  3DW0 A;  4MNR A;  2H10 A;  5L2F A;  3HLW A;  3W4P A;  1C3B A;  4MLL A;  1KGG A;  1IEL A;  5GHX A;  4QD4 A;  3I7J A;  3LY3 A;  4C6Y A;  2Y4A A;  3HBR A;  1RCJ A;  3JYI A;  2WAE A;  5CHJ A;  4KQO A;  5E2H A;  2WZX A;  3ZG9 B;  1XP4 A;  2QPN A;  3O3V A;  2PBY A;  4M3K A;  5EE8 A;  1BZA A;  2Q9N A;  5FQK A;  5TFQ A;  1MKI A;  1JTG A;  1JWZ A;  4RX3 A;  4KZ6 A;  4JLF A;  1VQQ A;  3MXR A;  4PPR A;  1K57 A;  3NBL A;  1QME A;  1KDW A;  1ZKJ A;  2XGN A;  2DCF A;  2Y2P A;  4ZJ1 A;  3GQZ A;  3C7V A;  1TVF A;  4FD8 A;  1LL9 A;  3GMW A;  1E4D A;  4HES A;  2EX2 A;  1K55 A;  1N9B A;  2Y2Q A;  3B3X A;  3FV7 A;  4KZ7 A;  2ZC6 B;  1ONH A;  3OCL A;  4KZ8 A;  1GCE A;  4R4R A;  1TEM A;  1HTZ A;  5EVI B;  3FKW A;  4GDB A;  3FWL A;  5E2G A;  1S6R A;  3VP3 A;  2P9V B;  4QU3 A;  1JWV A;  4WZ4 A;  3VMA A;  1FR1 A;  2G2U A;  4DE3 A;  4PMA A;  4E3J A;  5BOH A;  5J8X A;  5M1A A;  2WAF A;  1Q2Q A;  4BEN A;  4S2P A;  1K4F A;  3IWQ A;  2XK1 A;  1L0F A;  3OZH A;  5CEB A;  2EX8 A;  4ZJ2 A;  5EOE A;  2ZM0 A;  1RGZ A;  1NYY A;  3UN7 A;  3PBR A;  3BEC A;  1EI5 A;  4PM9 A;  5HAI A;  4XXR A;  2RL3 A;  5IHV A;  5HX9 A;  4X53 A;  5EVL A;  4BD0 A;  3EQU A;  2HDQ A;  2EFU A;  4JKT A;  5CER A;  2CC1 A;  1ZG4 A;  2Y2O A;  3Q7Z A;  4ID4 A;  3A3I A;  3RXX A;  4IVK A;  4CJN A;  3IXB A;  2Y2L A;  2ZMA A;  3G31 A;  4C3Q A;  4QJG A;  3E2L A;  3G4P A;  2IWB A;  4JF6 A;  4ZBE A;  4OLG A;  3HLD A;  1IYQ A;  1DY6 A;  2EXB A;  3MXS A;  1WYC A;  2ZQ8 A;  1SDN A;  3E2K A;  3WS5 A;  5EVI A;  1XXM A;  5KSC A;  1YM1 A;  3CJM A;  3M6H A;  5JYP A;  3N8R A;  1PW8 A;  2WZZ A;  3QNC A;  1M40 A;  2P9V A;  4OP8 A;  5FSR A;  5KMW A;  4OPY A;  1ES2 A;  4JXG A;  4KG5 A;  3CZD A;  1HVB A;  2B5R A;  4EQI A;  1YMX A;  2GDN A;  5TR7 A;  1XPB A;  1K54 A;  1N4O A;  3HLG A;  2G2W A;  2XDM A;  1O7E A;  3N8L A;  4U0T A;  5FDH A;  4LEN A;  4DRT A;  4DXB A;  1GA9 A;  5DF9 A;  3LO7 A;  4EBP A;  2HDS A;  5DF7 A;  1LI9 A;  4WEJ A;  5AQA A;  4S2L A;  2OV5 A;  4X55 A;  4ZTK A;  1PWD A;  4Q8I A;  1PI5 A;  3HLE A;  1KE4 A;  1CEF A;  4KZB A;  5CED A;  4OOL A;  4EBN A;  5KSH A;  3UO9 A;  4E3I A;  1L0E A;  1PIO A;  4IBX A;  3V3R A;  4MBK A;  3GV9 A;  1KGE A;  2EFX A;  3A3D A;  5E2E A;  5GLA A;  4BL2 A;  1GHM A;  3P98 A;  5FQM A;  3VP1 A;  1JWP A;  1LL5 A;  4GNU A;  4N92 A;  4DE0 A;  2ZC5 B;  4QB8 A;  4UA9 A;  2H5S A;  2Z2L B;  4R1G A;  2XEP A;  4NET A;  4Z9Q A;  1TDL A;  3W8K A;  3ZVW A;  5GLD A;  1GHI A;  2I72 A;  3VSL A;  3BYD A;  3G32 A;  4X56 A;  1LLB A;  2E8I A;  3N7W A;  1MWS A;  4UAA A;  4P87 A;  3SS4 A;  3WS1 A;  5F83 A;  3AGD A;  1BLS A;  2QZ6 A;  1NYM A;  1KE3 A;  4U3T A;  3IF6 A;  4LV1 A;  4DE2 A;  3AGF A;  4N9K A;  5CHU A;  4R3B A;  4E3L A;  2Y2N A;  3IT9 A;  3MZF A;  1FSW A;  2ZM8 A;  3PBS A;  4GDN A;  5A93 A;  4XUX A;  3HUN A;  1H8Z A;  4BD1 A;  1J9M A;  1MWT A;  3WS4 A;  1E3U D;  3NC8 A;  1PZO A;  5F1G A;  4KZA A;  3IHA A;  5EVI D;  3OPR A;  4EV4 A;  4HBT A;  3LCE A;  2DRW A;  3OPP A;  1XA7 A;  2V1Z A;  1FCM A;  3GSG A;  4NK3 A;  5CHM A;  5FAT A;  2A49 A;  1NY0 A;  2P74 A;  5CGX A;  4FSF A;  5AQ7 A;  4OQH A;  4DDS A;  3UY6 A;  5FAP A;  5AQB A;  3IXH A;  5A90 A;  1XA1 A;  4FCF A;  1FR6 A;  1PZP A;  2WKE A;  1K38 A;  2JBF A;  3C5A A;  2ZLY A;  4QY5 A;  1ZG6 A;  4R4S A;  5FAO A;  5CGW A;  3VOZ A;  1VM1 A;  2WUQ A;  1MWU A;  1PWC A;  4WBG A;  5CXW A;  2J7V A;  3BM6 A;  3TSG A;  1HZO A;  5HL1 A;  1AXB A;  3M2J A;  5TGF A;  4DDY A;  2X71 A;  3NI9 A;  4KQR A;  1ERM A;  3IHB A;  1HD8 A;  4GB7 A;  4K91 A;  4OVD A;  4D2O A;  4Y0T A;  4Y0U A;  4BQM A;  2HP6 A;  3DWK A;  3V3S A;  1S0W A;  4KEN B;  2A3U A;  1ERQ A;  3SH7 A; 
#chains in the Genus database with same CATH topology
 5DF8 A;  4EES A;  1SKF A;  5EUA A;  1MBL A;  3ZVT A;  5FQJ A;  3CG5 A;  5G18 A;  3BY8 A;  4EEP A;  4F94 A;  3G34 A;  5AVE A;  5M18 A;  1D1J A;  3G6O A;  3MQ0 A;  3P7N A;  3A0V A;  4KUK A;  4BL3 A;  4M4X A;  4GD6 A;  3ZG7 B;  4LLO B;  1SKO A;  4HP9 A;  1WYB A;  1VET B;  5A91 A;  4OPZ A;  5FDS A;  3VP0 A;  2EX9 A;  5FL3 A;  4JF4 A;  5E2F A;  4R38 A;  1RGY A;  3EOI A;  4FH4 A;  3DTI A;  2PHY A;  4KQQ A;  1YLY A;  2ZQD A;  1YSP A;  3B33 A;  1EW0 A;  2VV8 A;  4U0X A;  5HL6 A;  2Y2I A;  2WGW B;  4X68 A;  3CPT A;  2VZW A;  3VSK A;  1NRF A;  3G2Z A;  3GTC A;  4OKP A;  2YKH A;  4I3A A;  3NIA A;  2V0W A;  2L1M A;  4R23 A;  4LGW A;  4G3W A;  2G7U A;  2WK0 A;  4IBR A;  3G2Y A;  1XX2 A;  2NUT C;  2QJ5 A;  2XRN A;  3OCN A;  4WL9 A;  1ES3 A;  1W8Y A;  4PM8 A;  5F68 A;  3ZCZ A;  2IA2 A;  4WEK A;  4RQ9 A;  4JF5 A;  4DF6 A;  5IU1 A;  4KZ3 A;  4XT2 A;  1FCO A;  3N8S A;  3MS6 A;  4PAU A;  2VKS A;  2J80 A;  3Q7V A;  1MWR A;  3SS3 A;  3LIF A;  4HY8 A;  2H0T A;  1OPX A;  3VV4 A;  4CLC A;  4GN2 A;  3QP5 A;  4GHI A;  2M1C A;  5CX7 A;  1MC0 A;  2E8J A;  3B47 A;  3O88 A;  3MFD A;  4LV3 A;  2BTF P;  1DJB A;  2FFF B;  1I2W A;  4S2N A;  2XA7 M;  4H8R A;  1E25 A;  3BLM A;  2ZOH A;  3CAX A;  1K56 A;  5DKL A;  3RJU A;  2JC7 A;  3VOY A;  5CEC A;  2VGK A;  3S1Y A;  4HIA A;  1GSW A;  3HUO A;  4Q0I A;  5HW3 A;  4II7 A;  2Z2M B;  1XFQ A;  4JXV A;  3CMZ A;  3MZD A;  4L9E A;  1YMS A;  3VFF A;  2VA0 A;  1IKG A;  1TDG A;  4EER A;  2HPB A;  4GLQ A;  2B02 A;  1K54 C;  3IH9 A;  3UPN A;  3M6B A;  4IED A;  4OH0 A;  1FQG A;  1KVL A;  1W5D A;  3IS2 A;  2O99 A;  4JXW A;  1T1C A;  3HRE A;  2Z6D A;  1OTI A;  2WKQ A;  4Y5F A;  1PI4 A;  3HLF A;  4OQ0 A;  4WM9 A;  3IXG A;  1BYW A;  4Y3I A;  4E3K A;  4WLA A;  1XJ4 A;  1JNU A;  2L4R A;  3T50 A;  4MBH A;  1K4E A;  3HLB A;  2W3H A;  1CI8 A;  2PYR A;  1YAX A;  4NXE A;  3RXW A;  5IS1 A;  2WKP A;  3UDI A;  3IF6 B;  4A5R A;  3C38 A;  3Q1F A;  1OTB A;  3NOT C;  1BT5 A;  2ZJ9 A;  3FKV A;  3VP2 A;  1BLP A;  3V67 A;  2Y2K A;  4QWO A;  3O87 A;  4WF0 A;  1STZ A;  1YQS A;  3NOU C;  1MY8 A;  1PYY A;  3PBQ A;  4OP5 A;  4GD8 A;  2PD7 A;  3BFE A;  2L0W A;  4GS9 A;  3A3J A;  2O9B A;  3QNB A;  4MEZ A;  3WWX A;  2ZQA A;  5HD3 A;  3ZG8 B;  1RP5 A;  4MNR A;  2HF6 A;  4MLL A;  1KGG A;  1IEL A;  4LFU A;  4HI4 A;  5GHX A;  2W3F A;  2Y4A A;  3S7Q A;  5F6A A;  4NXB A;  5E2H A;  2WZX A;  3ZG9 B;  2QPN A;  4M3K A;  1JWZ A;  1XFN A;  4MDZ A;  1S67 L;  3MXR A;  1QME A;  1ZKJ A;  2XGN A;  3GQZ A;  2JKG A;  1TVF A;  1LL9 A;  3GMW A;  1UWN X;  4HES A;  2VV7 A;  2Y2Q A;  3B3X A;  4G3K A;  4O0P A;  1GCE A;  4Y17 A;  2PRF A;  1HTZ A;  5EVI B;  3FWL A;  3PR6 A;  1JWV A;  2G2U A;  4PMA A;  2WAF A;  1L0F A;  3OZH A;  1RGZ A;  1NYY A;  3PBR A;  3E4P A;  2JKT M;  2W1T B;  4HJ4 A;  1YPR A;  4CJN A;  1P9R A;  5HPI A;  4IUH A;  4KUO A;  4JF6 A;  3LR0 A;  5LBR A;  2ZL1 A;  1SDN A;  1XXM A;  4NKP A;  1M40 A;  2GNX A;  1YMX A;  1K54 A;  2G2W A;  2HJ9 C;  2KDK A;  3IX4 A;  5DF7 A;  1TS7 A;  5AQA A;  4WEJ A;  2OV5 A;  3F1P A;  1D06 A;  3UMD A;  3H82 A;  5KSH A;  1T1B A;  3P98 A;  4JGQ A;  5F5Y A;  1LL5 A;  4GNU A;  1ZHH B;  4UA9 A;  3R4K A;  2H5S A;  4JGO A;  4UQI S;  3ZVW A;  4FTX A;  2E8I A;  1MWS A;  5F83 A;  1NYM A;  1KE3 A;  5EV0 A;  4LV1 A;  3BQA A;  4HJ3 A;  3AGF A;  2VX8 A;  4R3B A;  2Y2N A;  3MZF A;  3SZT A;  4XUX A;  5G4Z A;  3WS4 A;  3C30 A;  4KZA A;  4QPR A;  5C5K A;  5CHM A;  2A49 A;  5AQ7 A;  4FSF A;  2HV1 A;  3IXH A;  4FCF A;  1CF0 A;  1PZP A;  2V1A A;  1ZG6 A;  4ARZ B;  5J7E A;  2J7V A;  2O0Y A;  3TSG A;  2K7S A;  5TGF A;  4DDY A;  2X71 A;  2JKR M;  3GDI A;  3IHB A;  1CJF A;  2GZA A;  4OVD A;  3H9W A;  4D2O A;  3EEH A;  2HP6 A;  1XJ6 A;  2I9V A;  4R3A A;  1ERQ A;  1AWI A;  1W8Q A;  2J3T C;  3W4O A;  1I5Q A;  1Y4O A;  2W3D A;  5I94 A;  3LI9 A;  4ZAM A;  4B4X A;  1IYP A;  2QKP A;  1G6O A;  3ITA A;  3MFX A;  3PHY A;  4ETX A;  4LPZ A;  4F3L B;  2X02 A;  3WS2 A;  3E98 A;  4CLC D;  4OPR A;  1ES4 A;  4E3N A;  1E3U A;  5K5B A;  3KSG A;  5D3O A;  4PM5 A;  2HP9 A;  2J9P A;  3L7H A;  4EQ1 A;  1XGJ A;  3ZNY A;  1BSG A;  1BLC A;  2PDR A;  2O9C A;  3ICY A;  4GKU A;  1S4R A;  2ZQ7 A;  2QJ7 A;  3PTE A;  2UV0 E;  2K2N A;  2R9W A;  3EQV A;  2PU2 A;  2JN7 A;  4I5S A;  4BBU A;  5DJT A;  4I3I A;  4S2K A;  5FQ9 A;  3SH8 A;  3ZGA B;  3NCK A;  3SH9 A;  3V39 A;  1H0M A;  1DRM A;  2M7V A;  4KG6 A;  3G35 A;  4S2N C;  1VHM A;  3K3D A;  3U2A A;  2WGW A;  1OME A;  3IBR A;  3Q07 A;  4OOY A;  4EBL A;  2OLU A;  5CGS A;  5U47 A;  3CI6 A;  1IEM A;  4S2J A;  3LIB A;  2VJW A;  4P0M A;  5KZH A;  1NLZ A;  3UDX A;  2HJE A;  3A3E A;  3KYZ A;  3ZNT A;  2FFY A;  4DMZ A;  4BLM A;  4HHD A;  3G30 A;  4GJ4 A;  4QY6 A;  2C5W B;  3T12 B;  4DXC A;  4Q0J A;  4EWF A;  3ZG5 A;  4YFM A;  1CEG A;  4Z1W A;  3FC7 A;  4WUJ A;  5GHZ A;  3NDG A;  3IWO A;  2EXA A;  3GR2 A;  2Y2H A;  2ZD8 A;  4LRX C;  1GA0 A;  4BBV A;  5M19 A;  2Y2M A;  3ITB A;  2QYB A;  5GL9 A;  2P04 A;  5E43 A;  2JKT I;  1YLW A;  5EVI C;  1Q2P A;  3BW6 A;  4WMC A;  3GRJ A;  4KZ4 A;  5AJG A;  2HDU A;  3VP4 A;  3C4O A;  5FEF A;  2PYP A;  1FSY A;  3LFV A;  4HOI A;  4BJP A;  2XQZ A;  3QHY A;  2P7J A;  3UPO A;  3T4T A;  2OSU A;  4UQI M;  1OTD A;  4E3O A;  4WYY A;  2Q9M A;  4P6B A;  1NXY A;  2EX6 A;  2Y2G A;  4RX2 A;  4PKY A;  2V20 A;  3MQQ A;  1DP8 A;  3GVB A;  3LY4 A;  3L9K A;  5EOO A;  3FPV A;  3KX0 X;  3BFD A;  3BRM A;  3MF0 A;  3IQA A;  1ESU A;  2Q0O A;  3T4K A;  1P0Z A;  3JVV A;  4DJ3 A;  1LI0 A;  1IKI A;  1G5U A;  5FAQ A;  1NWZ A;  2RCX A;  3DWZ A;  1VEU B;  4JBF A;  5DVA A;  3ISG A;  4PM6 A;  4IUK A;  1MZU A;  4S2I A;  3S7P A;  4ZJ3 A;  1MKM A;  3D4F A;  2CMN A;  4HEF A;  4HH2 A;  2WGI A;  2V0U A;  2H10 A;  3HLW A;  2JKR I;  4H6J B;  3W4P A;  4QD4 A;  3I7J A;  3LY3 A;  1FIL A;  1N9L A;  3JYI A;  5CHJ A;  4YNR A;  1D7E A;  1XP4 A;  3LYX A;  5EE8 A;  5TFQ A;  3LR3 A;  3QP2 A;  1MKI A;  4RX3 A;  3FG8 A;  4O8G A;  2B18 A;  4ETZ A;  3ZYT A;  5F69 A;  1SKO B;  3FV7 A;  1ONH A;  4R4R A;  4KZ8 A;  3MQO A;  3FKW A;  4GDB A;  5E2G A;  1S6R A;  3VP3 A;  2P9V B;  2YKF A;  4QU3 A;  4WZ4 A;  4E3J A;  1FR1 A;  1T19 A;  5J8X A;  5M1A A;  1K4F A;  3IWQ A;  3UME A;  2EX8 A;  2ZM0 A;  3T4Q A;  1IFQ A;  3UN7 A;  2K31 A;  5IHV A;  4X53 A;  3KYE A;  2HDQ A;  4JKT A;  5CER A;  3UB8 A;  3Q7Z A;  4ID4 A;  3RXX A;  1XJ3 A;  4IVK A;  3IXB A;  2Y2L A;  4HNB A;  1UGU A;  2OOL A;  3E2L A;  2IWB A;  5L8M A;  1IYQ A;  1WYC A;  2ZQ8 A;  2OWJ A;  4K08 A;  5EVI A;  4GW9 A;  5KSC A;  3CJM A;  5JYP A;  2XSS A;  4OPY A;  1ES2 A;  4JXG A;  3CZD A;  2B5R A;  3LIA A;  3HLG A;  5FDH A;  4DXB A;  4DRT A;  2GJ3 A;  3QP8 A;  3LO7 A;  3OOV A;  1KOU A;  3IBJ A;  3NOP C;  4X55 A;  3F1O B;  4ZTK A;  3T1Q B;  2W1T A;  3HJK A;  1KE4 A;  1CEF A;  5CED A;  3DTE A;  3UO9 A;  4E3I A;  1L0E A;  3GEC A;  4MBK A;  3GV9 A;  1KGE A;  4EET B;  3A3D A;  5GLA A;  4BL2 A;  5G4Y A;  1GHM A;  5FQM A;  3QP1 A;  4D60 A;  2VLG A;  4CLC B;  4QB8 A;  3OBF A;  4R1G A;  4Z9Q A;  1TDL A;  3OLO A;  5L10 A;  4FOF A;  3VSL A;  4X56 A;  1LLB A;  3S7O A;  1L3L A;  3SS4 A;  4Y15 A;  4DE2 A;  4N9K A;  3C8C A;  3PBS A;  4GDN A;  1E3U D;  3IHA A;  2DRW A;  3GSG A;  3NEC A;  1NY0 A;  3UY6 A;  4WN5 A;  5FAP A;  5AQB A;  5A90 A;  1K38 A;  2JBF A;  3C5A A;  5CGW A;  1VM1 A;  1PWC A;  3A0R A;  1AXB A;  2W27 A;  3VOL A;  3NI9 A;  4KQR A;  1HD8 A;  4GB7 A;  3NUL A;  4Y0T A;  4HQA A;  2AVX A;  2BAS A;  1A0K A;  4ME4 A;  2A3U A;  1F2K A;  3CUE C;  3VE4 A;  1SCW A;  4S2M A;  4MN7 A;  2WYX A;  4E6W A;  4DJ2 A;  1DJC A;  2HZ5 A;  2JCH A;  1F5M A;  4HJ6 A;  4EEU A;  4UHU A;  4ARZ A;  3FYZ A;  2V8F A;  1BTL A;  3U4L P;  4HBU A;  5FQQ A;  1XJ2 A;  1OTE A;  4WEL A;  4EUV A;  1T18 A;  3LR4 A;  3S7N A;  4K0W A;  4Y0O A;  4RYE A;  3TW8 A;  4N1X A;  2XD1 A;  4O01 A;  2J8Y A;  1IOU A;  4MBF A;  1ONG A;  1N9O A;  3SS5 A;  4B9O A;  2KLI A;  3UNW A;  1ZC2 A;  1GHP A;  2DNS A;  3TOI A;  3DTK A;  1NZU A;  5FA7 A;  1TF1 A;  3ZG0 A;  2V2F F;  1Z09 A;  5DFX A;  3PXP A;  1MXO A;  1YLJ A;  4X69 A;  1OTA A;  4F3L A;  4KQD A;  4DE1 A;  4HH3 A;  3O86 A;  3MJQ A;  1ES5 A;  2Y79 A;  2QHK A;  2VGL S;  1YLP A;  2ZC7 A;  1XKZ A;  1P9W A;  4I38 A;  1OT9 A;  4EUZ A;  2J9O A;  2OLV A;  4FH2 A;  3F1N B;  1W7F A;  4UA7 A;  2JHE A;  3PBN A;  3S4X A;  4OLD A;  1K25 A;  1ODV A;  1Z6F A;  5GHY A;  3TRC A;  1DJA A;  3P09 A;  1FOF A;  1NZO A;  1L0G A;  5HAR A;  4KZ9 A;  3T4O A;  4PM7 A;  3LIC A;  1PFL A;  3BFF A;  4DN0 A;  1K57 C;  3ULF A;  2ZQC A;  4B4Z A;  3BQ8 A;  2WKH A;  2OAQ 1;  4NXG A;  1K55 C;  2J3T D;  4N9L A;  2XF3 A;  4LV0 A;  3UE6 A;  5A8B A;  2Z6C A;  3PBT A;  2JE5 A;  3IXD A;  3NJA A;  2C6W B;  2ZQ9 A;  3BFC A;  2BLS A;  4JGR A;  1KVM A;  5A92 A;  4UA6 A;  3C7U A;  3NY4 A;  5EEC A;  3R7W B;  1PW1 A;  3PAE A;  1MPL A;  2XR0 A;  1PNE A;  4I39 A;  2EWV A;  4EU0 A;  3IF5 A;  1IYO A;  3OC2 A;  1OT6 A;  1NJ4 A;  1QMF A;  5TBM B;  3P01 A;  3PAG A;  2ZL1 B;  4YIN A;  3V50 A;  1BLH A;  1F9I A;  2H0Y A;  3SW1 A;  4P85 A;  4PHT A;  4X25 A;  2A24 B;  4L0L A;  3QP4 A;  4ZRR A;  1H3Q A;  4JPM A;  3HLC A;  3TG9 A;  4FUW A;  3CUE A;  4OQI A;  5HDS A;  3IH8 A;  3OPL A;  1LSX A;  4MN5 A;  3WRT A;  2OWH A;  4R3J A;  4GOG A;  1FIK A;  1ERO A;  1K56 D;  2IWD A;  1ALQ A;  4IVI A;  1H8Y A;  3JPU A;  3C2W A;  5DKK A;  1VET A;  3IF6 C;  5EM0 A;  4RVA A;  5FI2 A;  1UWP X;  5F82 A;  1ACF A;  3C4P A;  3DTM A;  3FPW A;  2WKR A;  3LID A;  4LRZ E;  3MBZ A;  3SOI A;  3KSI A;  1PWG A;  2PR6 A;  2XFT A;  2Y59 A;  2D02 A;  3ZDJ A;  1OJG A;  3UDF A;  1S4S A;  4R0Q A;  2V1B A;  3UE3 A;  4OON A;  3E4Q A;  1ZTU A;  1YT4 A;  1HLU P;  3MKE A;  2W1R A;  4O7D A;  1IYS A;  1K6S A;  3A3F A;  2P08 A;  3A0S A;  5DTS A;  4K0X A;  4B93 A;  3BWL A;  1L0D A;  1VB6 A;  1U60 A;  5L2F A;  1VEU A;  1C3B A;  5HDC A;  4IJG A;  4E04 A;  2V9A A;  4C6Y A;  1RCJ A;  2WAE A;  1NLY A;  2PBY A;  1BZA A;  2Q9N A;  5FQK A;  3EGX C;  2EA9 A;  4JLF A;  1GSX A;  1K57 A;  2Y2P A;  4FD8 A;  4X1L A;  2EX2 A;  1K55 A;  2PBD P;  3ZQ5 A;  4JGP A;  3TE8 A;  4BWI A;  4KZ7 A;  2ZC6 B;  3OCL A;  1TEM A;  4AFI A;  2VGL M;  1DP6 A;  3RTY A;  5BOH A;  3TJZ C;  5IT5 A;  4BEN A;  3NHQ A;  2XK1 A;  4PM9 A;  5HAI A;  2RL3 A;  2XRO A;  2A2L A;  5EVL A;  3MR0 A;  1ZG4 A;  2Y2O A;  3MSH A;  2ZMA A;  3G31 A;  3T4J A;  4ZBE A;  4OLG A;  3H7W B;  1CQA A;  1DY6 A;  1PRQ A;  3HJI A;  2J3W A;  1YM1 A;  3M6H A;  3N8R A;  5KMW A;  2WZZ A;  2P9V A;  4KG5 A;  4EQI A;  1HVB A;  2GDN A;  5TR7 A;  2XDM A;  1O7E A;  4U0T A;  2JKF A;  5DF9 A;  4EBP A;  3W2Z A;  1PWD A;  3HLE A;  1TS8 A;  4KZB A;  4OOL A;  4EBN A;  1NRJ A;  3VP1 A;  3E0Y A;  4DE0 A;  2XEP A;  3PYP A;  2I72 A;  2V8C A;  3BYD A;  3G32 A;  3N7W A;  5HPF A;  4BBT A;  4UAA A;  2W0N A;  3WS1 A;  3AGD A;  1BLS A;  2QZ6 A;  4U3T A;  1N9N A;  1YSQ A;  3IF6 A;  3IX8 A;  4R6L A;  3F1O A;  5CHU A;  4E3L A;  3IT9 A;  1FSW A;  2ZM8 A;  3QP6 A;  5I5L A;  3CIT A;  4HP4 A;  1J9M A;  4Y2F A;  3LUQ A;  3NC8 A;  1PZO A;  4G3V A;  4EV4 A;  3LCE A;  5HDD A;  3OPP A;  1XA7 A;  2V1Z A;  3KO6 A;  3UB6 A;  4MCW A;  4NK3 A;  1F98 A;  5FAT A;  4EW7 A;  2P74 A;  5CGX A;  4OQH A;  4DDS A;  5L09 A;  1TS0 A;  4QY5 A;  4R4S A;  4MN6 A;  2WUQ A;  4WBG A;  5CXW A;  3BM6 A;  5EFW A;  4Y0U A;  2VV6 A;  4BQM A;  3DWK A;  4KEN B;  3HUM A;  1OJ5 A;  2BG1 A;  3NDE A;  4QHC A;  3B42 A;  4GZB A;  3MZE A;  3M2K A;  3N4I A;  4S2O A;  3D3O A;  2Y55 A;  1KGF A;  2VEA A;  2D01 A;  5AQ9 A;  3DAV A;  3CPT B;  3Q82 A;  1W79 A;  2ZMF A;  2X01 A;  3BFG A;  4BMW A;  3LGO A;  3UE0 A;  4LCM A;  4NXF A;  3HVF A;  3AGE A;  2PD8 A;  2FZ0 A;  3UE1 A;  1BUE A;  4WZ5 C;  3ZFZ A;  1L2S A;  2Y2J A;  4X6T A;  3FZC A;  2WGV A;  3KSF A;  1S1Z A;  2XLN A;  1JTD A;  4OOM A;  3DBA A;  4NEE D;  1LHY A;  2WKI A;  2VGJ A;  4XT2 B;  1XGI A;  1KE0 A;  3EEA A;  5MC7 A;  3UPP A;  3Q7V B;  3LR5 A;  5TJJ A;  3UB9 A;  5HFO A;  5DTT A;  1G6A A;  4KG2 A;  4GHI B;  5FAS A;  2HP5 A;  2HDR A;  3T4S A;  2QWS A;  2WAD A;  4LCL A;  2GX5 A;  2FH5 A;  4DKI A;  5HSQ A;  5HWV A;  2PR5 A;  2ZC4 B;  1YLT A;  2XFS A;  4GCZ A;  4JXS A;  1Y54 A;  1G28 A;  3T1X A;  2W3G A;  5DTK A;  1FCN A;  5FQI A;  3W4Q A;  5CTN A;  2PU4 A;  4N1H A;  1CI9 A;  3F1N A;  2OAP 1;  3EGD C;  1K6R A;  5AVF A;  3K2N A;  5EM1 A;  3T1S A;  3LI8 A;  4B88 A;  3WS0 A;  1BUL A;  5J4E A;  3ZHH A;  1WE4 A;  3V5M A;  2R9X A;  3IS2 B;  1H5X A;  2H28 A;  4NG2 A;  2DMW A;  4YOF A;  2W3E A;  4RA7 A;  1YKD A;  3T1R A;  5HAQ A;  2NUP C;  1EWZ A;  3LEZ A;  4XUZ A;  2VK3 A;  5CTM A;  4IHQ A;  3PBO A;  3BJN A;  2QMI A;  3S22 A;  2UWX A;  3D72 A;  1W63 M;  5J3W A;  4EXO A;  2XD5 A;  1JVJ A;  4Y7P A;  5HAP A;  4KZ5 A;  2ZOI A;  1LSV A;  2R78 A;  4E3M A;  1ESI A;  5EVE A;  3BEB A;  4R70 A;  4P6Z S;  4E6X A;  5GLC A;  1I2S A;  3R7W A;  3BY9 A;  1SDE A;  2O9A A;  2ZBB A;  1M6K A;  2IWC A;  3KYQ A;  2HGV A;  1J3W A;  3OPH A;  4LV2 A;  2ZC3 B;  3BLS A;  1Y28 A;  5TBM A;  5F1F A;  5JYO A;  2PT7 A;  4Q0H A;  4OPQ A;  2EWW A;  2ZM2 A;  1KDS A;  3WRZ A;  4C75 A;  5HWT A;  1SHV A;  2LB5 A;  4GS9 B;  1CK3 A;  2A24 A;  5GLB A;  5DFY A;  3KSH A;  3K3C A;  4WMC D;  3RFB A;  5EPH A;  1P97 A;  3IX3 A;  3N6I A;  2KX6 A;  4MMN A;  3VFH A;  3Q81 A;  4WZ5 A;  5FI7 A;  5CRF A;  3MKF A;  1H8M A;  1O07 A;  5FI6 A;  4ZDX A;  1LL8 A;  1V9Z A;  1YLZ A;  3HL9 A;  4L9F A;  2Y91 A;  1DP9 A;  4OQG A;  2XH9 A;  3IWI A;  4CPK A;  2PAV P;  5HZH A;  3LIE A;  1G68 A;  2INW A;  3CWF A;  3DW0 A;  3UB7 A;  1GSV A;  5HD5 A;  4CQH A;  3HBR A;  1TS6 A;  4KQO A;  3O3V A;  1S1Y A;  1JTG A;  3MXQ A;  4KZ6 A;  1VQQ A;  3T4L A;  4ESP A;  4PPR A;  3CLO A;  3NBL A;  1KDW A;  4L9G A;  2DCF A;  4ZJ1 A;  3C7V A;  1E4D A;  1S66 L;  1N9B A;  1LSW A;  2B95 A;  3UB5 P;  1LT0 A;  4LRY C;  4QJG A;  3VMA A;  5DJU A;  4YWZ A;  4DE3 A;  1Q2Q A;  2LB9 A;  1X0O A;  4S2P A;  5CEB A;  2ACG A;  4ZJ2 A;  5EOE A;  3BEC A;  1EI5 A;  2Y8H A;  4XXR A;  5HX9 A;  1WA9 A;  4BD0 A;  3F1P B;  3EQU A;  2EFU A;  2XA7 S;  2CC1 A;  3H82 B;  3A3I A;  4C3Q A;  2ZMV A;  3G4P A;  1TD5 A;  5HWW A;  3HLD A;  2EXB A;  3MXS A;  3E2K A;  3WS5 A;  3QNC A;  1PW8 A;  4OP8 A;  5FSR A;  5L07 A;  4PKY G;  1XPB A;  1N4O A;  3N8L A;  4LEN A;  1GA9 A;  2HDS A;  1LI9 A;  4S2L A;  4Q8I A;  1PI5 A;  4CLC C;  5FEG A;  3LEQ A;  1PIO A;  4IBX A;  3V3R A;  3HCY A;  3CHW P;  2EFX A;  5E2E A;  3H7W A;  1JWP A;  4CLC E;  4N92 A;  2ZC5 B;  2Z2L B;  4NET A;  3E4O A;  3W8K A;  5GLD A;  1GHI A;  4I3J A;  4UEY A;  1V9Y A;  1W63 Q;  4P87 A;  1K0K A;  3VE3 A;  1T1A A;  3RH8 B;  4Y13 A;  5A93 A;  3HUN A;  1H8Z A;  4BD1 A;  1MWT A;  3MMH A;  5F1G A;  2MJ6 A;  5EVI D;  3OPR A;  5KIZ A;  4HBT A;  4X1M A;  1FCM A;  1SZV A;  2M7U A;  4P6Z M;  3D9Y A;  1XA1 A;  1FR6 A;  2WKE A;  2ZLY A;  3JVU A;  5FAO A;  3EWK A;  3VOZ A;  1MWU A;  1HZO A;  5HL1 A;  3M2J A;  2KOI A;  3O5Y A;  1ERM A;  4K91 A;  3V3S A;  1S0W A;  4H6J A;  3SH7 A; 
#chains in the Genus database with same CATH homology
 1SCW A;  5DF8 A;  1W8Q A;  4S2M A;  1SKF A;  2BG1 A;  1MBL A;  3HUM A;  5EUA A;  2WYX A;  3W4O A;  3ZVT A;  4E6W A;  5FQJ A;  1I5Q A;  3NDE A;  4QHC A;  3CG5 A;  5I94 A;  1DJC A;  5G18 A;  4GZB A;  3MZE A;  3M2K A;  4ZAM A;  4F94 A;  2JCH A;  3G34 A;  3N4I A;  4S2O A;  4B4X A;  5M18 A;  1IYP A;  4UHU A;  2Y55 A;  3FYZ A;  1KGF A;  3ITA A;  1BTL A;  4HBU A;  5FQQ A;  4BL3 A;  4WEL A;  5AQ9 A;  4GD6 A;  3Q82 A;  1W79 A;  3ZG7 B;  2X01 A;  3BFG A;  4K0W A;  4Y0O A;  2X02 A;  4RYE A;  3WS2 A;  4N1X A;  2XD1 A;  3UE0 A;  1WYB A;  2J8Y A;  5A91 A;  4LCM A;  3HVF A;  4MBF A;  1ONG A;  4OPZ A;  3AGE A;  4OPR A;  3SS5 A;  1ES4 A;  3VP0 A;  4E3N A;  2EX9 A;  3UNW A;  1ZC2 A;  1E3U A;  1GHP A;  2DNS A;  3UE1 A;  3TOI A;  4JF4 A;  5E2F A;  1BUE A;  1RGY A;  4WZ5 C;  3ZFZ A;  4FH4 A;  1L2S A;  1NZU A;  2Y2J A;  4X6T A;  5D3O A;  5FA7 A;  4PM5 A;  2HP9 A;  3FZC A;  2J9P A;  4KQQ A;  2WGV A;  1YLY A;  3ZG0 A;  1XGJ A;  2XLN A;  3ZNY A;  2V2F F;  1BSG A;  1JTD A;  1BLC A;  2ZQD A;  4OOM A;  1MXO A;  4U0X A;  1LHY A;  1YLJ A;  4X69 A;  2Y2I A;  2WGW B;  2WKI A;  4GKU A;  2VGJ A;  2ZQ7 A;  1XGI A;  4X68 A;  1KE0 A;  3PTE A;  4DE1 A;  3VSK A;  3O86 A;  2R9W A;  3EQV A;  3UPP A;  1ES5 A;  1NRF A;  2PU2 A;  3G2Z A;  3Q7V B;  5FQ9 A;  4S2K A;  3GTC A;  1YLP A;  2ZC7 A;  3SH8 A;  1XKZ A;  5HFO A;  4OKP A;  5DTT A;  3ZGA B;  3NIA A;  3NCK A;  4EUZ A;  4R23 A;  2J9O A;  1G6A A;  4KG2 A;  3SH9 A;  3V39 A;  2OLV A;  4FH2 A;  5FAS A;  4KG6 A;  2HP5 A;  2WK0 A;  4IBR A;  2HDR A;  3G35 A;  3G2Y A;  1W7F A;  1XX2 A;  4S2N C;  3OCN A;  4UA7 A;  2WAD A;  3PBN A;  4LCL A;  1ES3 A;  3S4X A;  1W8Y A;  4PM8 A;  4OLD A;  3ZCZ A;  1K25 A;  4WEK A;  4DKI A;  1Z6F A;  5GHY A;  1DJA A;  3P09 A;  2WGW A;  1FOF A;  1NZO A;  1OME A;  4JF5 A;  2ZC4 B;  1L0G A;  4KZ3 A;  1YLT A;  4DF6 A;  3Q07 A;  4OOY A;  4EBL A;  1FCO A;  5HAR A;  2OLU A;  2XFS A;  3N8S A;  4KZ9 A;  4PM7 A;  5CGS A;  4JXS A;  1Y54 A;  5U47 A;  3Q7V A;  1MWR A;  3BFF A;  1IEM A;  1K57 C;  3SS3 A;  2ZQC A;  1FCN A;  4S2J A;  5DTK A;  5FQI A;  4B4Z A;  4P0M A;  5KZH A;  2H0T A;  3W4Q A;  4GN2 A;  3UDX A;  2WKH A;  3A3E A;  3ZNT A;  2FFY A;  5CTN A;  2PU4 A;  1K55 C;  4N1H A;  1CI9 A;  4BLM A;  4N9L A;  2XF3 A;  4LV0 A;  1K6R A;  3G30 A;  4QY6 A;  3O88 A;  3MFD A;  3PBT A;  4LV3 A;  2C5W B;  2JE5 A;  3IXD A;  1DJB A;  2FFF B;  1I2W A;  4S2N A;  4DXC A;  4EWF A;  3ZG5 A;  4H8R A;  1E25 A;  2C6W B;  2ZQ9 A;  4YFM A;  3BFC A;  4B88 A;  1CEG A;  3WS0 A;  5GHZ A;  1BUL A;  3BLM A;  3IWO A;  3NDG A;  2BLS A;  3ZHH A;  2EXA A;  1WE4 A;  3V5M A;  5A92 A;  1KVM A;  1K56 A;  3GR2 A;  3RJU A;  2Y2H A;  2ZD8 A;  2R9X A;  4UA6 A;  2JC7 A;  1H5X A;  3VOY A;  5CEC A;  3C7U A;  2VGK A;  3S1Y A;  5HW3 A;  3HUO A;  3NY4 A;  1GA0 A;  5EEC A;  2Z2M B;  1PW1 A;  5M19 A;  3PAE A;  1MPL A;  4JXV A;  3CMZ A;  2XR0 A;  2Y2M A;  4RA7 A;  3MZD A;  1YMS A;  3ITB A;  5HAQ A;  3VFF A;  1EWZ A;  5GL9 A;  3LEZ A;  4XUZ A;  3IF5 A;  5CTM A;  5E43 A;  3PBO A;  1IYO A;  1YLW A;  3OC2 A;  5EVI C;  1Q2P A;  4WMC A;  1IKG A;  2QMI A;  3GRJ A;  1NJ4 A;  2UWX A;  4KZ4 A;  1QMF A;  3S22 A;  1TDG A;  2HDU A;  3VP4 A;  3C4O A;  3PAG A;  2HPB A;  2XD5 A;  1K54 C;  1JVJ A;  4Y7P A;  3IH9 A;  4YIN A;  4KZ5 A;  1BLH A;  3UPN A;  3V50 A;  5HAP A;  1FSY A;  2H0Y A;  3M6B A;  4P85 A;  1ESI A;  4IED A;  4E3M A;  4OH0 A;  1FQG A;  3BEB A;  4BJP A;  1KVL A;  1W5D A;  2XQZ A;  4E6X A;  3QHY A;  5GLC A;  1I2S A;  3UPO A;  4JXW A;  2OSU A;  3HRE A;  1SDE A;  4L0L A;  1M6K A;  2IWC A;  4JPM A;  1PI4 A;  3HLC A;  3TG9 A;  4E3O A;  3HLF A;  4OQ0 A;  4WM9 A;  4WYY A;  4OQI A;  2Q9M A;  3IXG A;  3IH8 A;  3OPL A;  3OPH A;  4P6B A;  4LV2 A;  4E3K A;  2ZC3 B;  1NXY A;  3BLS A;  2EX6 A;  3WRT A;  4R3J A;  2Y2G A;  4GOG A;  4RX2 A;  5F1F A;  5JYO A;  2V20 A;  4MBH A;  4OPQ A;  3GVB A;  1ERO A;  1K4E A;  1K56 D;  2IWD A;  3LY4 A;  3HLB A;  1ALQ A;  2ZM2 A;  1H8Y A;  4IVI A;  5EOO A;  1KDS A;  1CI8 A;  3WRZ A;  4C75 A;  3IF6 C;  4RVA A;  5FI2 A;  1SHV A;  3BFD A;  3BRM A;  5F82 A;  1CK3 A;  3RXW A;  3IQA A;  5GLB A;  3C4P A;  1ESU A;  3UDI A;  3DTM A;  3MBZ A;  3SOI A;  3IF6 B;  4A5R A;  4WMC D;  1LI0 A;  1IKI A;  3Q1F A;  5FAQ A;  5EPH A;  1PWG A;  2XFT A;  1BT5 A;  2ZJ9 A;  3FKV A;  3N6I A;  1BLP A;  2RCX A;  3DWZ A;  3VP2 A;  2Y59 A;  2Y2K A;  3VFH A;  3Q81 A;  4WZ5 A;  3O87 A;  3ZDJ A;  4JBF A;  1YQS A;  5DVA A;  5FI7 A;  3UDF A;  4R0Q A;  5CRF A;  3MKF A;  3ISG A;  3UE3 A;  4PM6 A;  1MY8 A;  4OON A;  1PYY A;  3PBQ A;  1O07 A;  4OP5 A;  1YT4 A;  3MKE A;  4S2I A;  5FI6 A;  4O7D A;  1IYS A;  4GD8 A;  4ZDX A;  1K6S A;  3BFE A;  1YLZ A;  4ZJ3 A;  3A3F A;  3HL9 A;  2Y91 A;  3D4F A;  5DTS A;  4K0X A;  3A3J A;  3QNB A;  4MEZ A;  4OQG A;  3WWX A;  2XH9 A;  4HEF A;  3IWI A;  4CPK A;  2ZQA A;  1L0D A;  3ZG8 B;  1G68 A;  2WGI A;  1RP5 A;  1U60 A;  3DW0 A;  4MNR A;  2H10 A;  5L2F A;  3HLW A;  3W4P A;  1C3B A;  4MLL A;  1KGG A;  1IEL A;  5GHX A;  4QD4 A;  3I7J A;  3LY3 A;  4C6Y A;  2Y4A A;  3HBR A;  1RCJ A;  3JYI A;  2WAE A;  5CHJ A;  4KQO A;  5E2H A;  2WZX A;  3ZG9 B;  1XP4 A;  2QPN A;  3O3V A;  2PBY A;  4M3K A;  5EE8 A;  1BZA A;  2Q9N A;  5FQK A;  5TFQ A;  1MKI A;  1JTG A;  1JWZ A;  4RX3 A;  4KZ6 A;  4JLF A;  1VQQ A;  3MXR A;  4PPR A;  1K57 A;  3NBL A;  1QME A;  1KDW A;  1ZKJ A;  2XGN A;  2DCF A;  2Y2P A;  4ZJ1 A;  3GQZ A;  3C7V A;  1TVF A;  4FD8 A;  1LL9 A;  3GMW A;  1E4D A;  4HES A;  2EX2 A;  1K55 A;  1N9B A;  2Y2Q A;  3B3X A;  3FV7 A;  4KZ7 A;  2ZC6 B;  1ONH A;  3OCL A;  4KZ8 A;  1GCE A;  4R4R A;  1TEM A;  1HTZ A;  5EVI B;  3FKW A;  4GDB A;  3FWL A;  5E2G A;  1S6R A;  3VP3 A;  2P9V B;  4QU3 A;  1JWV A;  4WZ4 A;  3VMA A;  1FR1 A;  2G2U A;  4DE3 A;  4PMA A;  4E3J A;  5BOH A;  5J8X A;  5M1A A;  2WAF A;  1Q2Q A;  4BEN A;  4S2P A;  1K4F A;  3IWQ A;  2XK1 A;  1L0F A;  3OZH A;  5CEB A;  2EX8 A;  4ZJ2 A;  5EOE A;  2ZM0 A;  1RGZ A;  1NYY A;  3UN7 A;  3PBR A;  3BEC A;  1EI5 A;  4PM9 A;  5HAI A;  4XXR A;  2RL3 A;  5IHV A;  5HX9 A;  4X53 A;  5EVL A;  4BD0 A;  3EQU A;  2HDQ A;  2EFU A;  4JKT A;  5CER A;  2CC1 A;  1ZG4 A;  2Y2O A;  3Q7Z A;  4ID4 A;  3A3I A;  3RXX A;  4IVK A;  4CJN A;  3IXB A;  2Y2L A;  2ZMA A;  3G31 A;  4C3Q A;  4QJG A;  3E2L A;  3G4P A;  2IWB A;  4JF6 A;  4ZBE A;  4OLG A;  3HLD A;  1IYQ A;  1DY6 A;  2EXB A;  3MXS A;  1WYC A;  2ZQ8 A;  1SDN A;  3E2K A;  3WS5 A;  5EVI A;  1XXM A;  5KSC A;  1YM1 A;  3CJM A;  3M6H A;  5JYP A;  3N8R A;  1PW8 A;  2WZZ A;  3QNC A;  1M40 A;  2P9V A;  4OP8 A;  5FSR A;  5KMW A;  4OPY A;  1ES2 A;  4JXG A;  4KG5 A;  3CZD A;  1HVB A;  2B5R A;  4EQI A;  1YMX A;  2GDN A;  5TR7 A;  1XPB A;  1K54 A;  1N4O A;  3HLG A;  2G2W A;  2XDM A;  1O7E A;  3N8L A;  4U0T A;  5FDH A;  4LEN A;  4DRT A;  4DXB A;  1GA9 A;  5DF9 A;  3LO7 A;  4EBP A;  2HDS A;  5DF7 A;  1LI9 A;  4WEJ A;  5AQA A;  4S2L A;  2OV5 A;  4X55 A;  4ZTK A;  1PWD A;  4Q8I A;  1PI5 A;  3HLE A;  1KE4 A;  1CEF A;  4KZB A;  5CED A;  4OOL A;  4EBN A;  5KSH A;  3UO9 A;  4E3I A;  1L0E A;  1PIO A;  4IBX A;  3V3R A;  4MBK A;  3GV9 A;  1KGE A;  2EFX A;  3A3D A;  5E2E A;  5GLA A;  4BL2 A;  1GHM A;  3P98 A;  5FQM A;  3VP1 A;  1JWP A;  1LL5 A;  4GNU A;  4N92 A;  4DE0 A;  2ZC5 B;  4QB8 A;  4UA9 A;  2H5S A;  2Z2L B;  4R1G A;  2XEP A;  4NET A;  4Z9Q A;  1TDL A;  3W8K A;  3ZVW A;  5GLD A;  1GHI A;  2I72 A;  3VSL A;  3BYD A;  3G32 A;  4X56 A;  1LLB A;  2E8I A;  3N7W A;  1MWS A;  4UAA A;  4P87 A;  3SS4 A;  3WS1 A;  5F83 A;  3AGD A;  1BLS A;  2QZ6 A;  1NYM A;  1KE3 A;  4U3T A;  3IF6 A;  4LV1 A;  4DE2 A;  3AGF A;  4N9K A;  5CHU A;  4R3B A;  4E3L A;  2Y2N A;  3IT9 A;  3MZF A;  1FSW A;  2ZM8 A;  3PBS A;  4GDN A;  5A93 A;  4XUX A;  3HUN A;  1H8Z A;  4BD1 A;  1J9M A;  1MWT A;  3WS4 A;  1E3U D;  3NC8 A;  1PZO A;  5F1G A;  4KZA A;  3IHA A;  5EVI D;  3OPR A;  4EV4 A;  4HBT A;  3LCE A;  2DRW A;  3OPP A;  1XA7 A;  2V1Z A;  1FCM A;  3GSG A;  4NK3 A;  5CHM A;  5FAT A;  2A49 A;  1NY0 A;  2P74 A;  5CGX A;  4FSF A;  5AQ7 A;  4OQH A;  4DDS A;  3UY6 A;  5FAP A;  5AQB A;  3IXH A;  5A90 A;  1XA1 A;  4FCF A;  1FR6 A;  1PZP A;  2WKE A;  1K38 A;  2JBF A;  3C5A A;  2ZLY A;  4QY5 A;  1ZG6 A;  4R4S A;  5FAO A;  5CGW A;  3VOZ A;  1VM1 A;  2WUQ A;  1MWU A;  1PWC A;  4WBG A;  5CXW A;  2J7V A;  3BM6 A;  3TSG A;  1HZO A;  5HL1 A;  1AXB A;  3M2J A;  5TGF A;  4DDY A;  2X71 A;  3NI9 A;  4KQR A;  1ERM A;  3IHB A;  1HD8 A;  4GB7 A;  4K91 A;  4OVD A;  4D2O A;  4Y0T A;  4Y0U A;  4BQM A;  2HP6 A;  3DWK A;  3V3S A;  1S0W A;  4KEN B;  2A3U A;  1ERQ A;  3SH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...