3Q82A

Meropenem acylated blar1 sensor domain from staphylococcus aureus
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
QSITDYNYKKPLHNDYQILDKSKIFGSNSGSFVMYSMAADAYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lysine Nzeta-decarboxylation switch and activation of the beta-lactam sensor domain of BlaR1 protein of methicillin-resistant Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase regulator/antibiotic
molecule keywords Beta-lactamase regulatory protein BlaR1
total genus 85
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q82A00
2Y2OA 1WE4A 3MZFA 3C7UA 4OOLA 1HVBA 3G35A 3LY3A 3IT9A 3BYDA 5GLCA 1ZG6A 4N9LA 1ERQA 4E3OA 1TVFA 4FD8A 4LV1A 1W5DA 3G2ZA 3VFFA 1NJ4A 1NXYA 3NDEA 2JE5A 1YLYA 1ES4A 4RX3A 3A3IA 3UN7A 4EBLA 1ZKJA 3OPLA 3VOZA 4X55A 3CMZA 2Y59A 4YINA 1WYCA 3NY4A 3HUNA 3PAGA 1KGGA 1YM1A 2Z2LB 2A49A 4KG5A 4OQIA 4OLDA 2EX6A 4UAAA 4PM7A 4R0QA 5CECA 5EVIB 3MFDA 3A3EA 4U3TA 2DCFA 2WAFA 2OSUA 5HAIA 1SDNA 2WYXA 4OPZA 1ERMA 4R3BA 3IXGA 1FCMA 2ZD8A 1ONGA 1K56A 2V20A 2Y2QA 3HREA 5EVIC 2X02A 4DKIA 4HESA 4PM5A 4LV0A 3W4OA 5A93A 1KDWA 3N8RA 3Q81A 4PPRA 4S2LA 5E43A 5FI2A 4XUXA 1MPLA 1W7FA 5GL9A 4FSFA 4DE3A 1M6KA 3AGFA 5EECA 3N7WA 3ZHHA 1W79A 4IEDA 4BD0A 1JVJA 4KG2A 3M2KA 1IKGA 4Z9QA 3VP2A 4IVKA 1BLPA 1LI9A 3IF6C 1ALQA 2HDQA 3GMWA 4B4ZA 4DDSA 1E4DA 1EWZA 5FQKA 1EROA 1KE0A 2IWBA 3PTEA 5EVID 5CHUA 2P9VB 5F1GA 4BD1A 5AQ9A 4QJGA 4EUZA 4XXRA 3UNWA 1PZOA 3HUOA 1G68A 1K6RA 4EWFA 1BLHA 3VMAA 3AGDA 1AXBA 3BM6A 1IELA 4FH4A 1ZG4A 3IHAA 4JPMA 5DTTA 3SS5A 2HPBA 3VSKA 5GLBA 2EXAA 1XGIA 1PWCA 3WS4A 1GHPA 3E2LA 1MXOA 3DTMA 2GDNA 1NYMA 2Y55A 5L2FA 4U0XA 3V3SA 4KQRA 4OQGA 4ID4A 2ZC5B 5DF8A 1ONHA 1KE3A 2XFSA 3G34A 2C5WB 3G2YA 1DJBA 3IWIA 3MKEA 2EFUA 4GD8A 3V39A 3ZVTA 4S2OA 1K4FA 4ZJ1A 5JYPA 4S2NA 1YQSA 4WEKA 2ZQ8A 5KMWA 3B3XA 3HUMA 5CRFA 1RCJA 4BJPA 2PU2A 1CI8A 5FQIA 2Y2IA 4X56A 5EVLA 2G2WA 3P98A 4P87A 3GVBA 2CC1A 1I2SA 3NIAA 2WKHA 1G6AA 2WUQA 3UPNA 5EUAA 3O88A 4D2OA 5JYOA 1TDLA 3SH7A 3WS0A 2XEPA 1YT4A 3V50A 4HEFA 1PWDA 2XD1A 4K0XA 2DNSA 2XD5A 1N9BA 3A3JA 3N8SA 3JYIA 3UO9A 1ZC2A 4KZ9A 1DJAA 3HLDA 1C3BA 4C3QA 1Q2QA 4M3KA 4DE2A 5HAQA 4JXSA 2ZC4B 5E2EA 2OLUA 3ZGAB 3C7VA 1GA0A 2JCHA 5U47A 2XF3A 3AGEA 1S6RA 2ZQ9A 5EVIA 1JWZA 1BT5A 5CHJA 3ITAA 5HL1A 2Q9NA 4OP8A 3GSGA 3MXRA 4OPRA 5CHMA 2I72A 3SH9A 2Y2JA 5FAQA 3G32A 4UHUA 4N92A 3A3FA 4JF6A 3NDGA 1TDGA 4OLGA 4F94A 3O3VA 1RGZA 2P9VA 3SS3A 1YLTA 2ZQ7A 3HLEA 2R9XA 5HARA 3WS1A 2J9PA 1MWRA 1YMXA 1XXMA 3HLCA 1K6SA 4WZ5A 4UA6A 3TOIA 3UPPA 4RYEA 2Y91A 2XR0A 4IBRA 2ZM2A 2ZM0A 3VFHA 4K91A 5TR7A 3VP0A 4MLLA 3PBTA 1I2WA 3BFEA 3Q1FA 1L0EA 2JC7A 3ZG5A 1BLCA 2WGWA 1ES5A 1K38A 2FFFB 3M6HA 2WKIA 4WYYA 2ZLYA 3UDXA 4QB8A 4A5RA 1FOFA 1XA7A 2BG1A 4O7DA 4OPQA 5FAOA 1XGJA 4JBFA 2X71A 5M18A 3FZCA 1PIOA 3G30A 3IWQA 2WAEA 4DXBA 1L0GA 4JF4A 5FQJA 3EQUA 3OZHA 3M2JA 2Y2MA 1KVLA 1BTLA 1OMEA 3N8LA 1K54C 1LL5A 4UA7A 4KZAA 3ZFZA 5EOEA 2XH9A 1YLPA 4EBNA 3S4XA 5E2FA 1KGEA 5HW3A 4LV2A 4C75A 4OOYA 2ZJ9A 4ZJ3A 1IYQA 1CK3A 1MKIA 3PAEA 3Q7VA 4Y7PA 5TGFA 2E8IA 2Y2KA 3IXDA 5DF9A 3W8KA 4S2PA 3V3RA 2XLNA 1GCEA 4QU3A 5FAPA 2FFYA 1K54A 1H8ZA 1PW8A 3BLSA 1NZOA 4JXVA 1LHYA 4BQMA 5CERA 2HP6A 4MBHA 4S2KA 1E25A 1BULA 3FKVA 2Y2GA 5FQQA 2UWXA 2Q9MA 3C4PA 2XK1A 3V5MA 4HBUA 1MY8A 3HLGA 1NZUA 1KGFA 5I94A 5GHZA 4S2JA 3O86A 3MKFA 4RA7A 4WBGA 3WS5A 1QMEA 4EV4A 1SDEA 1W8QA 1FSYA 3UE3A 5BOHA 5J8XA 3NCKA 3BRMA 1DJCA 2OLVA 3ZG8B 2IWCA 4GNUA 1JWPA 1S0WA 4LENA 1LI0A 5M1AA 3WWXA 2A3UA 2ZC7A 4BL2A 1GHIA 3BFDA 5A92A 5FATA 4PM6A 4B88A 2EX8A 4GDBA 2WGWB 4XUZA 4C6YA 2V1ZA 4MBKA 4NETA 2PU4A 3Q82A 1DY6A 1K57C 4E3IA 4R4SA 4DDYA 5EOOA 1RGYA 3QNBA 4ZBEA 4FH2A 3G4PA 3HL9A 2VGJA 2DRWA 3IQAA 4OOMA 4PMAA 3DWKA 2EX9A 4E3LA 5F1FA 1NY0A 4OQ0A 1IEMA 3GTCA 1M40A 4WZ4A 2BLSA 1VM1A 3GR2A 4BENA 3TG9A 3SH8A 3DWZA 3BECA 1H8YA 1PI5A 1FSWA 1JTGA 3MZEA 1PI4A 4GOGA 3I7JA 4KENB 5CTNA 4Y0OA 3HLFA 1K55C 4S2MA 1YMSA 4NK3A 5FQMA 2HDRA 1K57A 4OONA 5M19A 3UE0A 1YLZA 3N4IA 1XKZA 2B5RA 4LCMA 1IYOA 4MNRA 3UPOA 1ES2A 1GA9A 3IWOA 5F82A 1K56D 2H0YA 3NBLA 2Y2LA 4KZ8A 3PBOA 4X6TA 3WS2A 1XA1A 4DRTA 2JBFA 4P85A 5FI6A 1BSGA 1BUEA 4HBTA 1IYPA 1PYYA 3UDIA 4BLMA 4Y0UA 4MBFA 3ZVWA 3VOYA 5CXWA 1BZAA 3OPPA 3QHYA 1HD8A 4Q8IA 3GV9A 1L0FA 3RXWA 4E3KA 1EI5A 3SOIA 3PBSA 1LL9A 3E2KA 1JWVA 3NC8A 1WYBA 2Y4AA 3FKWA 1MBLA 4PM9A 5DTKA 2QMIA 3VP3A 4DXCA 2EXBA 2WZXA 2ZQAA 1FCNA 4KQQA 3IF6A 4QY5A 5GHYA 4WMCD 4X68A 1PWGA 2WKEA 4R4RA 2WZZA 4KZ3A 5CGXA 4OPYA 3O87A 4N1XA 3FYZA 3OC2A 3LCEA 5CTMA 1MWSA 4OKPA 1W8YA 5D3OA 5AQAA 4N9KA 3HBRA 4S2NC 3UE1A 4U0TA 4KG6A 4YFMA 3UY6A 3HLWA 5EE8A 5FSRA 1XP4A 1VQQA 1SHVA 3OCLA 4E3JA 1L2SA 1XX2A 3D4FA 1CEGA 4Y0TA 1SKFA 3DW0A 3CG5A 1LLBA 4KZ6A 3LY4A 4ZJ2A 1FCOA 1K25A 1QMFA 4FCFA 4R3JA 4DE0A 4QD4A 1HZOA 1ESUA 3OCNA 4P0MA 2PBYA 5E2HA 1O7EA 2C6WB 1KDSA 2G2UA 5GHXA 2OV5A 4ZDXA 4E6XA 4JKTA 1FR1A 3VP4A 3IXHA 4OQHA 2ZQDA 2HP5A 2QZ6A 1PZPA 2V2FF 5DTSA 2X01A 3GRJA 2RCXA 1K55A 1Q2PA 4RVAA 2H5SA 4GZBA 1YLWA 4UA9A 2ZM8A 3FWLA 3OPHA 5FA7A 4KZ4A 5TFQA 4PM8A 4N1HA 1CI9A 5EPHA 2R9WA 2J7VA 5A91A 1SCWA 2WADA 5GLAA 1N4OA 1TEMA 4OH0A 4ZTKA 1NYYA 4E6WA 5KSCA 1XPBA 4GN2A 5GLDA 4CJNA 2WGVA 1MWUA 3G31A 2XDMA 2J9OA 1HTZA 3MXSA 5AQBA 5CEDA 3Q7VB 1I5QA 3BFCA 2RL3A 3FV7A 3RXXA 4JF5A 4GB7A 4IBXA 1U60A 5E2GA 4WMCA 5DVAA 4MEZA 2ZC6B 1GHMA 1ES3A 3IH9A 3BEBA 4QY6A 3IH8A 1IYSA 1FQGA 3P09A 4P6BA 5FI7A 4L0LA 3C4OA 5G18A 1Z6FA 2H0TA 3WRZA 1H5XA 2WK0A 3ISGA 4JXWA 4K0WA 4CPKA 5KZHA 4OP5A 1K4EA 3QNCA 2Y2PA 3PBQA 4QHCA 5HX9A 3RJUA 5FASA 2Y2NA 3ZG9B 1E3UD 2EFXA 2H10A 4RX2A 1KVMA 1YLJA 4KZBA 3VSLA 2ZMAA 4BL3A 5CEBA 2HDUA 1L0DA 3BFFA 3HLBA 2HDSA 4H8RA 5F83A 3GQZA 4DE1A 4KZ5A 3NI9A 2XQZA 3A3DA 1NRFA 4IVIA 4EQIA 3CJMA 3ZG7B 4WZ5C 3W4QA 5HAPA 2Z2MB 3HVFA 2ZQCA 3S1YA 1O07A 3IF6B 3Q7ZA 2XGNA 3LO7A 4WEJA 2EX2A 5CGWA 4DF6A 2ZC3B 3CZDA 4JXGA 3ZNYA 1KE4A 3W4PA 3ZG0A 5KSHA 1RP5A 4LV3A 3UDFA 3OPRA 4X69A 3PBNA 3BFGA 3VP1A 4S2IA 3S22A 3BLMA 5HFOA 3ZNTA 3WRTA 3M6BA 4EBPA 1E3UA 3MBZA 2VGKA 2WGIA 3TSGA 4KQOA 1PW1A 3ZCZA 5FQ9A 4JLFA 2J8YA 3IXBA 5CGSA 4B4XA 4GDNA 3N6IA 5DF7A 3ZDJA 2Y2HA 3IF5A 1ESIA 3LEZA 4KZ7A 4X53A 5A90A 5AQ7A 5FDHA 1JTDA 4WELA 1J9MA 3Q07A 3IHBA 4ZAMA 1Y54A 4LCLA 1MWTA 2XFTA 4R1GA 2P74A 1CEFA 4R23A 3C5AA 4GD6A 2HP9A 2QPNA 4GKUA 4E3MA 5IHVA 3MZDA 4E3NA 4WM9A 3SS4A 4OVDA 3ITBA 1IKIA 1FR6A 1BLSA 3PBRA 2IWDA 3EQVA
chains in the Genus database with same CATH superfamily
2Y2OA 2V0WA 5FL3A 4F3LA 1HVBA 4E3OA 3G2ZA 3VFFA 1NJ4A 1NXYA 3L9KA 1ZHHB 2JE5A 3A3IA 4FTXA 3OPLA 3JPUA 2Y59A 1YM1A 2A49A 3NHQA 4UAAA 4CQHA 4WF0A 4PM7A 5EVIB 3MFDA 4U3TA 2WAFA 5HAIA 3EEHA 2I9VA 1SDNA 2WYXA 2V8FA 3ZYTA 5EVIC 2V9AA 1LSXA 3W4OA 1STZA 1KDWA 3Q81A 4S2LA 4QWOA 4XUXA 1W7FA 4FSFA 1M6KA 1OTAA 3AGFA 5EECA 4ARZB 2PHYA 4BD0A 1JVJA 3M2KA 1IKGA 3VP2A 5G4YA 3GMWA 5EVID 5CHUA 5AQ9A 4EW7A 2G7UA 3UNWA 1PZOA 4EWFA 3VMAA 3AGDA 1AXBA 3VSKA 2EXAA 2BASA 3WS4A 1ZTUA 1S66L 2Y55A 4U0XA 3V3SA 4CLCA 1SKOA 1DP8A 3V39A 4D60A 3ZVTA 1SZVA 1YQSA 3QP4A 5CRFA 1CI8A 5FQIA 3K3CA 4I5SA 5EVLA 3P98A 4O0PA 4P87A 3GVBA 1I2SA 3NIAA 4IUHA 3O88A 1TDLA 3V50A 1PWDA 4K0XA 3N8SA 3A3JA 1ZC2A 4KZ9A 1VHMA 4L9EA 2B95A 3H82A 5E2EA 3ZGAB 1GA0A 5J7EA 3AGEA 1S6RA 2ZQ9A 5EVIA 5CHJA 3ITAA 5HL1A 2Q9NA 3K3DA 4MN5A 5CHMA 2I72A 3SH9A 4LFUA 5CX7A 2QHKA 4F94A 2P9VA 3WS1A 1XXMA 3CUEC 4WZ5A 3UPPA 2Y91A 2XR0A 1OTIA 4IBRA 4K91A 3VP0A 4MLLA 3BFEA 2JKGA 3HJIA 2FFFB 3CITA 1JNUA 2BG1A 5F6AA 2X71A 1VEUA 1D7EA 4Q0HA 5M18A 1L0GA 1BTLA 2BTFP 3N8LA 1K54C 1LL5A 4KZAA 1F5MA 1YLPA 4EBNA 3KSHA 1KGEA 1SKOB 4OOYA 1MKIA 3Q7VA 2NUTC 5TGFA 2E8IA 2Y2KA 3W8KA 4S2PA 3T1RA 4F3LB 5FAPA 1LT0A 3B47A 1K54A 3BLSA 1LHYA 4BQMA 2VGLM 4BBVA 1E25A 1BULA 2JKTM 4R6LA 1DP9A 2HGVA 3C4PA 3JVVA 3U2AA 1NZUA 4S2JA 3MKFA 2B02A 4ARZA 4EV4A 1SDEA 1W8QA 3UE3A 1W63Q 5J8XA 2UV0E 3RFBA 4LENA 2ZMVA 4CLCC 3NOUC 5A92A 2A24A 3CLOA 4XUZA 1PRQA 4KQDA 4E3IA 4GHIA 4GCZA 4WUJA 3EOIA 5DFYA 5EOOA 4FH2A 3G4PA 3HL9A 3IQAA 2DRWA 4JGPA 4PMAA 1NY0A 3LR0A 4WZ4A 3TG9A 3SH8A 3DWZA 4R3AA 1H8YA 1FSWA 3MZEA 4KENB 3HLFA 1K55C 1YMSA 1A0KA 4ETXA 2VKSA 3K2NA 5M19A 1Y4OA 2VV7A 3UPOA 1GA9A 1F9IA 2H0YA 3FPVA 3PBOA 4EQ1A 4MDZA 4HBTA 5L09A 2W0NA 3UDIA 3LIDA 3ZVWA 2GNXA 2OWJA 3H82B 5CXWA 2PT7A 1KOUA 3RXWA 1EI5A 3PBSA 3E2KA 3T4QA 3FKWA 4Y15A 5DTKA 1XFNA 2QMIA 4HIAA 2JHEA 4P6ZS 2ZQAA 3IF6A 2WKEA 4R4RA 2WZZA 4KZ3A 2FZ0A 5IT5A 4N1XA 3FYZA 5CTMA 4KUOA 5AQAA 4N9KA 4DJ3A 4S2NC 5EE8A 3BQAA 2Y79A 5FSRA 1VQQA 1SHVA 3LR4A 1L2SA 3C38A 4Y0TA 3CG5A 3R4KA 4HJ6A 1QMFA 5EM0A 2V0UA 3TJZC 1XJ6A 1VB6A 1OTBA 1FR1A 3VP4A 5HL6A 4OQHA 2EWWA 1Q2PA 2H5SA 4UA9A 2Q0OA 1YSPA 3CAXA 5EPHA 2XA7M 1SCWA 2ZOIA 1N4OA 4ZTKA 5KSCA 2XDMA 3KX0X 5CEDA 3Q7VB 3LGOA 5KIZA 5E2GA 3G6OA 1H8MA 4WMCA 4I3IA 1ES3A 3IH9A 3LIEA 4QY6A 2MJ6A 3IH8A 4P6BA 4L0LA 4DDYA 1Z6FA 4CPKA 1H5XA 3NULA 4HJ3A 4OP5A 1K4EA 2J3TD 3MXQA 4QHCA 5F69A 3RJUA 2Y2NA 4RX2A 1KVMA 2A24B 1TF1A 3HLBA 4DE1A 3A3DA 4L9FA 4YWZA 5DFXA 5HAPA 2L4RA 2QYBA 2Z2MB 3HVFA 1O07A 3IF6B 4BWIA 4MMNA 2LB9A 2EX2A 1ODVA 3ZG0A 1RP5A 4LV3A 3UDFA 1G6OA 3VP1A 3S22A 3BLMA 5HFOA 1E3UA 3TSGA 1PW1A 4HJ4A 2J8YA 5CGSA 2HJEA 3IX4A 5DF7A 3B33A 1ESIA 3LEZA 4KZ7A 3QP1A 4M4XA 5A90A 5FDHA 3W2ZA 1J9MA 3IHBA 4MN6A 3LIAA 4EUVA 1MWTA 2P74A 5HPFA 2CMNA 5HD3A 1D06A 4WM9A 3SS4A 3ITBA 1BLSA 3EQVA 1WE4A 1Z09A 3G35A 4B93A 4LV1A 1TS0A 4NXFA 2W1TA 1ES4A 4YNRA 4WLAA 3ULFA 4X55A 1WYCA 3HUNA 3RH8B 1EW0A 1V9YA 3P7NA 4OLDA 3MFXA 3A3EA 2WKPA 2OSUA 2JKRI 5F68A 3IXGA 3HREA 4Y3IA 3NOTC 4JGRA 3N8RA 4HHDA 5E43A 5FI2A 4FUWA 3DBAA 3L7HA 3S7PA 3LI8A 2J80A 1LI9A 4DDSA 2HDQA 2OOLA 1EWZA 3FC7A 3PXPA 1UWNX 4QJGA 5J4EA 1K6RA 5DTTA 1IELA 4EBLA 1ZG4A 3SS5A 2GZAA 1XGIA 5AJGA 2GDNA 5L2FA 4KQRA 3MQQA 2ZC5B 5HWTA 5FEGA 2C5WB 1DJBA 3IWIA 5AVFA 2EFUA 1K4FA 3HJKA 4GLQA 4S2NA 5KMWA 2PU2A 3FPWA 4UQIM 2WUQA 2PD7A 1P97A 5EUAA 4D2OA 5JYOA 2QJ5A 4MN7A 3UB8A 4XT2B 2DNSA 1N9BA 3LUQA 1ACFA 3UO9A 3QP5A 4C3QA 2A2LA 4M3KA 2OLUA 4BBUA 3LYXA 3A0RA 3MXRA 4OPRA 2PYPA 2Y2JA 1XFQA 4UHUA 1TDGA 4Y2FA 3SS3A 2VLGA 1MWRA 1K6SA 4LRXC 4UA6A 1S4RA 2O0YA 5TR7A 2WKRA 5I5LA 1I2WA 4UQIS 1L0EA 2JC7A 3ZG5A 5EFWA 1BLCA 2R78A 2WGWA 1K38A 3M6HA 2P7JA 3UDXA 1FOFA 3T1QB 4O7DA 3FZCA 4DXBA 3IWQA 2PDRA 4JF4A 3M2JA 2Y2MA 3T50A 5HWWA 1PNEA 2XH9A 3S4XA 5E2FA 4LV2A 2ZJ9A 2VV8A 4ZJ3A 2JN7A 1IYQA 3PAEA 2XROA 4HP4A 3V3RA 2K31A 2XLNA 4L9GA 2VX8A 4JXVA 5CERA 4S2KA 2XA7S 3NJAA 2M7VA 2UWXA 3KYZA 2ZBBA 1KGFA 4H6JA 3CHWP 4WBGA 3WS5A 1QMEA 4IHQA 1FSYA 1DJCA 2OLVA 3ZG8B 2P08A 1JWPA 3WWXA 4EERA 4X25A 1GHIA 3BFDA 2V1ZA 3Q82A 1P0ZA 2HZ5A 3QNBA 4ZBEA 2VGJA 4E3LA 2VEAA 2D01A 3GECA 3GTCA 1VM1A 1N9NA 3GR2A 5F5YA 2PRFA 3BECA 1PI5A 1YAXA 4Y0OA 1TD5A 2OAP1 1GSXA 3PYPA 3H9WA 4LCMA 2GX5A 4ESPA 2V1BA 1GSWA 3KYEA 4HI4A 3SW1A 1T19A 4PAUA 4X6TA 5HDSA 4X1LA 2JBFA 4BLMA 4Y0UA 3E0YA 4Q0JA 1BZAA 4Q8IA 3KSGA 1L0FA 3SOIA 2W1RA 3E4QA 1LL9A 3NC8A 1WYBA 2Y4AA 4XT2A 1V9ZA 4EEUA 5J3WA 3VP3A 4Y13A 1FCNA 4KQQA 4Q0IA 2WKQA 5GHYA 1VEUB 3MJQA 1W8YA 4U0TA 4KG6A 4YOFA 4YFMA 3PR6A 1OT6A 4E3JA 5IU1A 4EESA 2PR6A 1SKFA 4I3AA 3LY4A 1S1ZA 4ZJ2A 3ZQ5A 1FCOA 4DE0A 1HZOA 4E04A 1ESUA 2PBYA 1O7EA 4GJ4A 1NWZA 4PHTA 2OV5A 2KDKA 1XJ3A 4PKYG 1PZPA 1K55A 4RVAA 4GZBA 4N1HA 1T1AA 3MQOA 2R9WA 5A91A 1TEMA 4OH0A 2VGLS 1YSQA 1XPBA 4GN2A 3IS2B 2WGVA 1MWUA 3G31A 1HTZA 2XSSA 3FV7A 3RXXA 4JF5A 5DVAA 3C4OA 1UGUA 3MMHA 4JXWA 4K0WA 1N9LA 1Y28A 2Y2PA 3BW6A 4ETZA 1YLJA 2HDUA 1L0DA 5F83A 4BBTA 4KZ5A 3ZG7B 3TW8A 3E98A 2M1CA 4WEJA 4DF6A 3ZNYA 1KE4A 5KSHA 4X69A 3ZNTA 3MBZA 1S67L 4KQOA 3N6IA 3VV4A 2QWSA 4LCLA 4HH3A 4R23A 4GD6A 2HJ9C 4GKUA 4E3MA 5IHVA 4I39A 4DN0A 3MZFA 2PAVP 4OOLA 3DTKA 3BYDA 5GLCA 1ZG6A 4N9LA 3NDEA 3B42A 1YLYA 2KLIA 3VOZA 1CQAA 3NY4A 3PAGA 1KGGA 4KG5A 4IUKA 3ICYA 4OQIA 2W27A 2DCFA 3C30A 3LIBA 4OPZA 4R3BA 3VE3A 1FCMA 2ZD8A 1ONGA 1K56A 2V20A 3DTEA 4DKIA 2X02A 4HESA 4PM5A 3C8CA 5A93A 4PPRA 1MZUA 3FG8A 1DP6A 1MPLA 2D02A 3T4OA 2GJ3A 3UB5P 4IEDA 4Z9QA 4IVKA 1BLPA 4B4ZA 3RTYA 5FQKA 2IWBA 3PTEA 5F1GA 4EUZA 4XXRA 4JGOA 1BLHA 4EETB 4FH4A 2HPBA 5GLBA 4Y5FA 1GHPA 1MXOA 3DTMA 3NECA 4OQGA 1P9WA 4ID4A 2E8JA 3EEAA 3LICA 1H3QA 1D1JA 3VOLA 1H0MA 4HP9A 3JVUA 4S2OA 4ZJ1A 5JYPA 2JKTI 2ZQ8A 3B3XA 5HWVA 2EWVA 1K0KA 2K7SA 3QP8A 2L0WA 2WKHA 3UPNA 2XEPA 1YT4A 1N9OA 3C2WA 5FDSA 4HEFA 1MKMA 3JYIA 2W3DA 1C3BA 5HAQA 4JXSA 2ZC4B 3C7VA 2JCHA 1BT5A 5FEFA 3PHYA 3D72A 4DJ2A 5FAQA 3UB9A 3A3FA 4JF6A 4OLGA 3O3VA 1J3WA 1RGZA 1YLTA 3HLEA 2R9XA 2J9PA 1YMXA 4LRYC 3TOIA 5DJUA 2ZM2A 2ZM0A 4WN5A 1ES5A 4AFIA 2WKIA 4A5RA 1XA7A 1HLUP 3UMDA 4OPQA 5FAOA 5TBMA 4I3JA 1KVLA 1OMEA 3S7OA 4UA7A 4R70A 3H7WB 5HW3A 4HY8A 4IJGA 3KSFA 1CF0A 3IXDA 4JGQA 5DKKA 1GCEA 4QU3A 1OJ5A 1PW8A 1NZOA 5G4ZA 4MBHA 2OWHA 2Y2GA 5FQQA 2Q9MA 2XK1A 1MY8A 3LI9A 5GHZA 3QP2A 3O86A 4RA7A 1FILA 1TS8A 3BRMA 2IWCA 4GNUA 4WL9A 1WA9A 5M1AA 2W3HA 2ZC7A 4BL2A 5FATA 4B88A 2WGWB 1S4SA 1DY6A 2W3EA 3F1NB 4R4SA 1RGYA 4OOMA 4LRZE 2EX9A 1S1YA 1IEMA 1OTDA 2BLSA 4BENA 5EM1A 2KX6A 3S7NA 2K2NA 5CTNA 2ZOHA 3GDIA 4LGWA 4NKPA 4S2MA 4NK3A 2HDRA 3F1OA 3P01A 3N4IA 3IBJA 5MC7A 3UB6A 4MNRA 3IWOA 1K56D 3NBLA 1VETB 4G3WA 3WS2A 1XA1A 5L07A 4BMWA 4EXOA 2ACGA 1BUEA 1IYPA 1PYYA 4MBFA 3UE6A 3VOYA 3QHYA 4H6JB 3GV9A 3DAVA 1JWVA 3BY9A 3IX3A 2EXBA 2WZXA 2VZWA 4X68A 4WMCD 1TS6A 1NRJA 1CJFA 3O87A 3OC2A 3LCEA 4OKPA 3BWLA 3HLWA 3OCLA 1NLZA 3T4TA 3IBRA 4CLCE 1XX2A 1CEGA 4Y17A 1LLBA 3OOVA 4R3JA 4LPZA 4P0MA 5LBRA 2Z6CA 2C6WB 5L10A 2G2UA 2Y8HA 4JKTA 3IXHA 2V1AA 2QZ6A 2V2FF 2JKRM 2X01A 1YLWA 3FWLA 5FA7A 5TBMB 4NXEA 1F98A 4PM8A 4DMZA 1LSVA 5GLAA 2VJWA 3DTIA 3LR3A 2L1MA 3F1PB 2PYRA 4CJNA 2VA0A 4B9OA 2W3GA 1I5QA 2RL3A 3O5YA 2ZC6B 3BY8A 1GHMA 1FQGA 3P09A 5FI7A 2H0TA 2WK0A 3ISGA 2AVXA 3PBQA 5FASA 2EFXA 2H10A 4KZBA 3VSLA 1T1CA 5CEBA 1IOUA 3BFFA 2XQZA 4EQIA 3CJMA 2J3WA 4FOFA 3S1YA 3Q7ZA 3UMEA 3LO7A 2ZC3B 4JXGA 3W4PA 3BFGA 4S2IA 3D3OA 3WRTA 2VGKA 3S7QA 4X1MA 3F1OB 4B4XA 3T4SA 3IXBA 3EGXC 4GDNA 3CPTB 2O99A 2Y2HA 3IF5A 1F2KA 5AQ7A 1JTDA 4WELA 3Q07A 4R1GA 3E4PA 2DMWA 3C5AA 1GSVA 2HP9A 2QPNA 3MZDA 3FKVA 3C7UA 3LY3A 3IT9A 5EVEA 1ERQA 1TVFA 4FD8A 1W5DA 1LSWA 3UN7A 4RX3A 1ZKJA 3CMZA 4YINA 2Z2LB 2EX6A 3LR5A 4R0QA 3LIFA 5CECA 1AWIA 1ERMA 5C5KA 2Y2QA 2LB5A 4LV0A 2HV1A 1L3LA 5GL9A 4DE3A 4GW9A 3A0VA 3N7WA 3ZHHA 1W79A 3MF0A 4KG2A 2W1TB 3IF6C 1ALQA 1E4DA 1EROA 1KE0A 2P9VB 4BD1A 3IS2A 3HUOA 1G68A 3BQ8A 2O9CA 3BM6A 4JPMA 3V5MA 3IHAA 1PWCA 3E2LA 3EGDC 1MC0A 1NYMA 1FIKA 5DF8A 3F1PA 1ONHA 1DRMA 1KE3A 2XFSA 2B18A 3CPTA 3G34A 4EU0A 3G2YA 3E4OA 3MKEA 4GD8A 3SZTA 3T4LA 1W63M 4WEKA 4GHIB 3HUMA 1RCJA 4BJPA 2Y2IA 4X56A 2G2WA 2CC1A 4QPRA 1G6AA 3QP6A 4PKYA 3SH7A 3WS0A 2XD1A 2XD5A 2O9BA 1DJAA 3HLDA 1Q2QA 4DE2A 2J3TC 4HQAA 5U47A 2XF3A 4RQ9A 1JWZA 3LFVA 2ZL1A 4OP8A 3GSGA 1UWPX 5AVEA 1P9RA 3G32A 4N92A 1YKDA 3NDGA 2ZQ7A 5HARA 5A8BA 3HLCA 3V67A 4RYEA 2FH5A 3VFHA 3PBTA 3Q1FA 1PFLA 4WYYA 2ZLYA 4QB8A 5HPIA 1XGJA 3T4KA 1T18A 4JBFA 1PIOA 3MSHA 3G30A 2WAEA 5FQJA 3EQUA 3OZHA 1OT9A 3ZFZA 4NXGA 5EOEA 1YPRA 2O9AA 2V8CA 4LLOB 4R38A 4C75A 1CK3A 4Y7PA 5DF9A 5IS1A 3KSIA 2FFYA 3R7WA 1H8ZA 5HD5A 2H28A 2HP6A 4NEED 4NG2A 1OPXA 1T1BA 4HBUA 4UEYA 3HLGA 5I94A 2YKFA 4EEPA 3LEQA 5BOHA 4G3KA 3NCKA 3BJNA 3EWKA 3OBFA 1S0WA 1LI0A 1OTEA 2A3UA 3A0SA 3KO6A 2Z6DA 3TRCA 2M7UA 4PM6A 2VK3A 2EX8A 4GDBA 4C6YA 4MBKA 4NETA 3CI6A 2PU4A 1K57C 3T1XA 3T1SA 5TJJA 4ZRRA 3DWKA 5F1FA 4CLCD 4OQ0A 1M40A 2PD8A 2IA2A 3D9YA 2INWA 1JTGA 1PI4A 4GOGA 3I7JA 1TS7A 3H7WA 5FQMA 4GS9A 1XJ2A 1K57A 4OONA 4MCWA 3UE0A 4NXBA 1YLZA 1XKZA 2B5RA 4O8GA 2OAQ1 4KUKA 5HDCA 1IYOA 1ES2A 5F82A 1OJGA 2Y2LA 4KZ8A 4DRTA 4P85A 5FI6A 4Z1WA 1BSGA 4I38A 3MQ0A 5HDDA 1G28A 5HZHA 2EA9A 2ZMFA 3TE8A 4HOIA 3OPPA 1HD8A 4E3KA 2ZL1B 3R7WB 1MBLA 4PM9A 4DXCA 5DJTA 2QKPA 4HNBA 4QY5A 1PWGA 1LL8A 5CGXA 4OPYA 2W3FA 1MWSA 5D3OA 3HBRA 3F1NA 4II7A 3UE1A 3UY6A 1XP4A 5HSQA 3T4JA 3OLOA 3D4FA 2QJ7A 3DW0A 3HCYA 4KZ6A 1K25A 2JKFA 4FCFA 5EV0A 5K5BA 4QD4A 3OCNA 5E2HA 2PR5A 1KDSA 5GHXA 3U4LP 4ZDXA 1BYWA 5DKLA 4E6XA 1G5UA 2ZQDA 3UB7A 2HP5A 5DTSA 3CWFA 3GRJA 2RCXA 2PBDP 4G3VA 2ZM8A 3OPHA 5TFQA 4KZ4A 2VV6A 1CI9A 2J7VA 4CLCB 2WADA 1NYYA 4E6WA 5GLDA 1X0OA 3NOPC 2J9OA 3MXSA 5AQBA 3BFCA 4GB7A 4IBXA 1U60A 4MEZA 1XJ4A 3BEBA 1IYSA 5G18A 3WRZA 1NLYA 5KZHA 3QNCA 5HX9A 4O01A 3KYQA 3ZG9B 1E3UD 4ME4A 3IX8A 2ZMAA 2HF6A 1VETA 4BL3A 3MR0A 2NUPC 4H8RA 2HDSA 1IFQA 3GQZA 3NI9A 1NRFA 4IVIA 3CUEA 4WZ5C 3W4QA 2ZQCA 3T12B 2XGNA 5CGWA 2XRNA 3CZDA 2KOIA 4HH2A 2P04A 4P6ZM 3OPRA 3PBNA 3M6BA 4EBPA 2WGIA 4K08A 2YKHA 3ZCZA 5FQ9A 4JLFA 3VE4A 3ZDJA 4X53A 4ZAMA 1Y54A 2XFTA 1CEFA 5L8MA 4E3NA 4OVDA 1IKIA 1FR6A 3PBRA 4GS9B 2IWDA 3MS6A
chains in the Genus database with same CATH topology
2Y2OA 1WE4A 3MZFA 3C7UA 4OOLA 1HVBA 3G35A 3LY3A 3IT9A 3BYDA 5GLCA 1ZG6A 4N9LA 1ERQA 4E3OA 1TVFA 4FD8A 4LV1A 1W5DA 3G2ZA 3VFFA 1NJ4A 1NXYA 3NDEA 2JE5A 1YLYA 1ES4A 4RX3A 3A3IA 3UN7A 4EBLA 1ZKJA 3OPLA 3VOZA 4X55A 3CMZA 2Y59A 4YINA 1WYCA 3NY4A 3HUNA 3PAGA 1KGGA 1YM1A 2Z2LB 2A49A 4KG5A 4OQIA 4OLDA 2EX6A 4UAAA 4PM7A 4R0QA 5CECA 5EVIB 3MFDA 3A3EA 4U3TA 2DCFA 2WAFA 2OSUA 5HAIA 1SDNA 2WYXA 4OPZA 1ERMA 4R3BA 3IXGA 1FCMA 2ZD8A 1ONGA 1K56A 2V20A 2Y2QA 3HREA 5EVIC 2X02A 4DKIA 4HESA 4PM5A 4LV0A 3W4OA 5A93A 1KDWA 3N8RA 3Q81A 4PPRA 4S2LA 5E43A 5FI2A 4XUXA 1MPLA 1W7FA 5GL9A 4FSFA 4DE3A 1M6KA 3AGFA 5EECA 3N7WA 3ZHHA 1W79A 4IEDA 4BD0A 1JVJA 4KG2A 3M2KA 1IKGA 4Z9QA 3VP2A 4IVKA 1BLPA 1LI9A 3IF6C 1ALQA 2HDQA 3GMWA 4B4ZA 4DDSA 1E4DA 1EWZA 5FQKA 1EROA 1KE0A 2IWBA 3PTEA 5EVID 5CHUA 2P9VB 5F1GA 4BD1A 5AQ9A 4QJGA 4EUZA 4XXRA 3UNWA 1PZOA 3HUOA 1G68A 1K6RA 4EWFA 1BLHA 3VMAA 3AGDA 1AXBA 3BM6A 1IELA 4FH4A 1ZG4A 3IHAA 4JPMA 5DTTA 3SS5A 2HPBA 3VSKA 5GLBA 2EXAA 1XGIA 1PWCA 3WS4A 1GHPA 3E2LA 1MXOA 3DTMA 2GDNA 1NYMA 2Y55A 5L2FA 4U0XA 3V3SA 4KQRA 4OQGA 4ID4A 2ZC5B 5DF8A 1ONHA 1KE3A 2XFSA 3G34A 2C5WB 3G2YA 1DJBA 3IWIA 3MKEA 2EFUA 4GD8A 3V39A 3ZVTA 4S2OA 1K4FA 4ZJ1A 5JYPA 4S2NA 1YQSA 4WEKA 2ZQ8A 5KMWA 3B3XA 3HUMA 5CRFA 1RCJA 4BJPA 2PU2A 1CI8A 5FQIA 2Y2IA 4X56A 5EVLA 2G2WA 3P98A 4P87A 3GVBA 2CC1A 1I2SA 3NIAA 2WKHA 1G6AA 2WUQA 3UPNA 5EUAA 3O88A 4D2OA 5JYOA 1TDLA 3SH7A 3WS0A 2XEPA 1YT4A 3V50A 4HEFA 1PWDA 2XD1A 4K0XA 2DNSA 2XD5A 1N9BA 3A3JA 3N8SA 3JYIA 3UO9A 1ZC2A 4KZ9A 1DJAA 3HLDA 1C3BA 4C3QA 1Q2QA 4M3KA 4DE2A 5HAQA 4JXSA 2ZC4B 5E2EA 2OLUA 3ZGAB 3C7VA 1GA0A 2JCHA 5U47A 2XF3A 3AGEA 1S6RA 2ZQ9A 5EVIA 1JWZA 1BT5A 5CHJA 3ITAA 5HL1A 2Q9NA 4OP8A 3GSGA 3MXRA 4OPRA 5CHMA 2I72A 3SH9A 2Y2JA 5FAQA 3G32A 4UHUA 4N92A 3A3FA 4JF6A 3NDGA 1TDGA 4OLGA 4F94A 3O3VA 1RGZA 2P9VA 3SS3A 1YLTA 2ZQ7A 3HLEA 2R9XA 5HARA 3WS1A 2J9PA 1MWRA 1YMXA 1XXMA 3HLCA 1K6SA 4WZ5A 4UA6A 3TOIA 3UPPA 4RYEA 2Y91A 2XR0A 4IBRA 2ZM2A 2ZM0A 3VFHA 4K91A 5TR7A 3VP0A 4MLLA 3PBTA 1I2WA 3BFEA 3Q1FA 1L0EA 2JC7A 3ZG5A 1BLCA 2WGWA 1ES5A 1K38A 2FFFB 3M6HA 2WKIA 4WYYA 2ZLYA 3UDXA 4QB8A 4A5RA 1FOFA 1XA7A 2BG1A 4O7DA 4OPQA 5FAOA 1XGJA 4JBFA 2X71A 5M18A 3FZCA 1PIOA 3G30A 3IWQA 2WAEA 4DXBA 1L0GA 4JF4A 5FQJA 3EQUA 3OZHA 3M2JA 2Y2MA 1KVLA 1BTLA 1OMEA 3N8LA 1K54C 1LL5A 4UA7A 4KZAA 3ZFZA 5EOEA 2XH9A 1YLPA 4EBNA 3S4XA 5E2FA 1KGEA 5HW3A 4LV2A 4C75A 4OOYA 2ZJ9A 4ZJ3A 1IYQA 1CK3A 1MKIA 3PAEA 3Q7VA 4Y7PA 5TGFA 2E8IA 2Y2KA 3IXDA 5DF9A 3W8KA 4S2PA 3V3RA 2XLNA 1GCEA 4QU3A 5FAPA 2FFYA 1K54A 1H8ZA 1PW8A 3BLSA 1NZOA 4JXVA 1LHYA 4BQMA 5CERA 2HP6A 4MBHA 4S2KA 1E25A 1BULA 3FKVA 2Y2GA 5FQQA 2UWXA 2Q9MA 3C4PA 2XK1A 3V5MA 4HBUA 1MY8A 3HLGA 1NZUA 1KGFA 5I94A 5GHZA 4S2JA 3O86A 3MKFA 4RA7A 4WBGA 3WS5A 1QMEA 4EV4A 1SDEA 1W8QA 1FSYA 3UE3A 5BOHA 5J8XA 3NCKA 3BRMA 1DJCA 2OLVA 3ZG8B 2IWCA 4GNUA 1JWPA 1S0WA 4LENA 1LI0A 5M1AA 3WWXA 2A3UA 2ZC7A 4BL2A 1GHIA 3BFDA 5A92A 5FATA 4PM6A 4B88A 2EX8A 4GDBA 2WGWB 4XUZA 4C6YA 2V1ZA 4MBKA 4NETA 2PU4A 3Q82A 1DY6A 1K57C 4E3IA 4R4SA 4DDYA 5EOOA 1RGYA 3QNBA 4ZBEA 4FH2A 3G4PA 3HL9A 2VGJA 2DRWA 3IQAA 4OOMA 4PMAA 3DWKA 2EX9A 4E3LA 5F1FA 1NY0A 4OQ0A 1IEMA 3GTCA 1M40A 4WZ4A 2BLSA 1VM1A 3GR2A 4BENA 3TG9A 3SH8A 3DWZA 3BECA 1H8YA 1PI5A 1FSWA 1JTGA 3MZEA 1PI4A 4GOGA 3I7JA 4KENB 5CTNA 4Y0OA 3HLFA 1K55C 4S2MA 1YMSA 4NK3A 5FQMA 2HDRA 1K57A 4OONA 5M19A 3UE0A 1YLZA 3N4IA 1XKZA 2B5RA 4LCMA 1IYOA 4MNRA 3UPOA 1ES2A 1GA9A 3IWOA 5F82A 1K56D 2H0YA 3NBLA 2Y2LA 4KZ8A 3PBOA 4X6TA 3WS2A 1XA1A 4DRTA 2JBFA 4P85A 5FI6A 1BSGA 1BUEA 4HBTA 1IYPA 1PYYA 3UDIA 4BLMA 4Y0UA 4MBFA 3ZVWA 3VOYA 5CXWA 1BZAA 3OPPA 3QHYA 1HD8A 4Q8IA 3GV9A 1L0FA 3RXWA 4E3KA 1EI5A 3SOIA 3PBSA 1LL9A 3E2KA 1JWVA 3NC8A 1WYBA 2Y4AA 3FKWA 1MBLA 4PM9A 5DTKA 2QMIA 3VP3A 4DXCA 2EXBA 2WZXA 2ZQAA 1FCNA 4KQQA 3IF6A 4QY5A 5GHYA 4WMCD 4X68A 1PWGA 2WKEA 4R4RA 2WZZA 4KZ3A 5CGXA 4OPYA 3O87A 4N1XA 3FYZA 3OC2A 3LCEA 5CTMA 1MWSA 4OKPA 1W8YA 5D3OA 5AQAA 4N9KA 3HBRA 4S2NC 3UE1A 4U0TA 4KG6A 4YFMA 3UY6A 3HLWA 5EE8A 5FSRA 1XP4A 1VQQA 1SHVA 3OCLA 4E3JA 1L2SA 1XX2A 3D4FA 1CEGA 4Y0TA 1SKFA 3DW0A 3CG5A 1LLBA 4KZ6A 3LY4A 4ZJ2A 1FCOA 1K25A 1QMFA 4FCFA 4R3JA 4DE0A 4QD4A 1HZOA 1ESUA 3OCNA 4P0MA 2PBYA 5E2HA 1O7EA 2C6WB 1KDSA 2G2UA 5GHXA 2OV5A 4ZDXA 4E6XA 4JKTA 1FR1A 3VP4A 3IXHA 4OQHA 2ZQDA 2HP5A 2QZ6A 1PZPA 2V2FF 5DTSA 2X01A 3GRJA 2RCXA 1K55A 1Q2PA 4RVAA 2H5SA 4GZBA 1YLWA 4UA9A 2ZM8A 3FWLA 3OPHA 5FA7A 4KZ4A 5TFQA 4PM8A 4N1HA 1CI9A 5EPHA 2R9WA 2J7VA 5A91A 1SCWA 2WADA 5GLAA 1N4OA 1TEMA 4OH0A 4ZTKA 1NYYA 4E6WA 5KSCA 1XPBA 4GN2A 5GLDA 4CJNA 2WGVA 1MWUA 3G31A 2XDMA 2J9OA 1HTZA 3MXSA 5AQBA 5CEDA 3Q7VB 1I5QA 3BFCA 2RL3A 3FV7A 3RXXA 4JF5A 4GB7A 4IBXA 1U60A 5E2GA 4WMCA 5DVAA 4MEZA 2ZC6B 1GHMA 1ES3A 3IH9A 3BEBA 4QY6A 3IH8A 1IYSA 1FQGA 3P09A 4P6BA 5FI7A 4L0LA 3C4OA 5G18A 1Z6FA 2H0TA 3WRZA 1H5XA 2WK0A 3ISGA 4JXWA 4K0WA 4CPKA 5KZHA 4OP5A 1K4EA 3QNCA 2Y2PA 3PBQA 4QHCA 5HX9A 3RJUA 5FASA 2Y2NA 3ZG9B 1E3UD 2EFXA 2H10A 4RX2A 1KVMA 1YLJA 4KZBA 3VSLA 2ZMAA 4BL3A 5CEBA 2HDUA 1L0DA 3BFFA 3HLBA 2HDSA 4H8RA 5F83A 3GQZA 4DE1A 4KZ5A 3NI9A 2XQZA 3A3DA 1NRFA 4IVIA 4EQIA 3CJMA 3ZG7B 4WZ5C 3W4QA 5HAPA 2Z2MB 3HVFA 2ZQCA 3S1YA 1O07A 3IF6B 3Q7ZA 2XGNA 3LO7A 4WEJA 2EX2A 5CGWA 4DF6A 2ZC3B 3CZDA 4JXGA 3ZNYA 1KE4A 3W4PA 3ZG0A 5KSHA 1RP5A 4LV3A 3UDFA 3OPRA 4X69A 3PBNA 3BFGA 3VP1A 4S2IA 3S22A 3BLMA 5HFOA 3ZNTA 3WRTA 3M6BA 4EBPA 1E3UA 3MBZA 2VGKA 2WGIA 3TSGA 4KQOA 1PW1A 3ZCZA 5FQ9A 4JLFA 2J8YA 3IXBA 5CGSA 4B4XA 4GDNA 3N6IA 5DF7A 3ZDJA 2Y2HA 3IF5A 1ESIA 3LEZA 4KZ7A 4X53A 5A90A 5AQ7A 5FDHA 1JTDA 4WELA 1J9MA 3Q07A 3IHBA 4ZAMA 1Y54A 4LCLA 1MWTA 2XFTA 4R1GA 2P74A 1CEFA 4R23A 3C5AA 4GD6A 2HP9A 2QPNA 4GKUA 4E3MA 5IHVA 3MZDA 4E3NA 4WM9A 3SS4A 4OVDA 3ITBA 1IKIA 1FR6A 1BLSA 3PBRA 2IWDA 3EQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2O A;  1WE4 A;  3MZF A;  3C7U A;  4OOL A;  1HVB A;  3G35 A;  3LY3 A;  3IT9 A;  3BYD A;  5GLC A;  1ZG6 A;  4N9L A;  1ERQ A;  4E3O A;  1TVF A;  4FD8 A;  4LV1 A;  1W5D A;  3G2Z A;  3VFF A;  1NJ4 A;  1NXY A;  3NDE A;  2JE5 A;  1YLY A;  1ES4 A;  4RX3 A;  3A3I A;  3UN7 A;  4EBL A;  1ZKJ A;  3OPL A;  3VOZ A;  4X55 A;  3CMZ A;  2Y59 A;  4YIN A;  1WYC A;  3NY4 A;  3HUN A;  3PAG A;  1KGG A;  1YM1 A;  2Z2L B;  2A49 A;  4KG5 A;  4OQI A;  4OLD A;  2EX6 A;  4UAA A;  4PM7 A;  4R0Q A;  5CEC A;  5EVI B;  3MFD A;  3A3E A;  4U3T A;  2DCF A;  2WAF A;  2OSU A;  5HAI A;  1SDN A;  2WYX A;  4OPZ A;  1ERM A;  4R3B A;  3IXG A;  1FCM A;  2ZD8 A;  1ONG A;  1K56 A;  2V20 A;  2Y2Q A;  3HRE A;  5EVI C;  2X02 A;  4DKI A;  4HES A;  4PM5 A;  4LV0 A;  3W4O A;  5A93 A;  1KDW A;  3N8R A;  3Q81 A;  4PPR A;  4S2L A;  5E43 A;  5FI2 A;  4XUX A;  1MPL A;  1W7F A;  5GL9 A;  4FSF A;  4DE3 A;  1M6K A;  3AGF A;  5EEC A;  3N7W A;  3ZHH A;  1W79 A;  4IED A;  4BD0 A;  1JVJ A;  4KG2 A;  3M2K A;  1IKG A;  4Z9Q A;  3VP2 A;  4IVK A;  1BLP A;  1LI9 A;  3IF6 C;  1ALQ A;  2HDQ A;  3GMW A;  4B4Z A;  4DDS A;  1E4D A;  1EWZ A;  5FQK A;  1ERO A;  1KE0 A;  2IWB A;  3PTE A;  5EVI D;  5CHU A;  2P9V B;  5F1G A;  4BD1 A;  5AQ9 A;  4QJG A;  4EUZ A;  4XXR A;  3UNW A;  1PZO A;  3HUO A;  1G68 A;  1K6R A;  4EWF A;  1BLH A;  3VMA A;  3AGD A;  1AXB A;  3BM6 A;  1IEL A;  4FH4 A;  1ZG4 A;  3IHA A;  4JPM A;  5DTT A;  3SS5 A;  2HPB A;  3VSK A;  5GLB A;  2EXA A;  1XGI A;  1PWC A;  3WS4 A;  1GHP A;  3E2L A;  1MXO A;  3DTM A;  2GDN A;  1NYM A;  2Y55 A;  5L2F A;  4U0X A;  3V3S A;  4KQR A;  4OQG A;  4ID4 A;  2ZC5 B;  5DF8 A;  1ONH A;  1KE3 A;  2XFS A;  3G34 A;  2C5W B;  3G2Y A;  1DJB A;  3IWI A;  3MKE A;  2EFU A;  4GD8 A;  3V39 A;  3ZVT A;  4S2O A;  1K4F A;  4ZJ1 A;  5JYP A;  4S2N A;  1YQS A;  4WEK A;  2ZQ8 A;  5KMW A;  3B3X A;  3HUM A;  5CRF A;  1RCJ A;  4BJP A;  2PU2 A;  1CI8 A;  5FQI A;  2Y2I A;  4X56 A;  5EVL A;  2G2W A;  3P98 A;  4P87 A;  3GVB A;  2CC1 A;  1I2S A;  3NIA A;  2WKH A;  1G6A A;  2WUQ A;  3UPN A;  5EUA A;  3O88 A;  4D2O A;  5JYO A;  1TDL A;  3SH7 A;  3WS0 A;  2XEP A;  1YT4 A;  3V50 A;  4HEF A;  1PWD A;  2XD1 A;  4K0X A;  2DNS A;  2XD5 A;  1N9B A;  3A3J A;  3N8S A;  3JYI A;  3UO9 A;  1ZC2 A;  4KZ9 A;  1DJA A;  3HLD A;  1C3B A;  4C3Q A;  1Q2Q A;  4M3K A;  4DE2 A;  5HAQ A;  4JXS A;  2ZC4 B;  5E2E A;  2OLU A;  3ZGA B;  3C7V A;  1GA0 A;  2JCH A;  5U47 A;  2XF3 A;  3AGE A;  1S6R A;  2ZQ9 A;  5EVI A;  1JWZ A;  1BT5 A;  5CHJ A;  3ITA A;  5HL1 A;  2Q9N A;  4OP8 A;  3GSG A;  3MXR A;  4OPR A;  5CHM A;  2I72 A;  3SH9 A;  2Y2J A;  5FAQ A;  3G32 A;  4UHU A;  4N92 A;  3A3F A;  4JF6 A;  3NDG A;  1TDG A;  4OLG A;  4F94 A;  3O3V A;  1RGZ A;  2P9V A;  3SS3 A;  1YLT A;  2ZQ7 A;  3HLE A;  2R9X A;  5HAR A;  3WS1 A;  2J9P A;  1MWR A;  1YMX A;  1XXM A;  3HLC A;  1K6S A;  4WZ5 A;  4UA6 A;  3TOI A;  3UPP A;  4RYE A;  2Y91 A;  2XR0 A;  4IBR A;  2ZM2 A;  2ZM0 A;  3VFH A;  4K91 A;  5TR7 A;  3VP0 A;  4MLL A;  3PBT A;  1I2W A;  3BFE A;  3Q1F A;  1L0E A;  2JC7 A;  3ZG5 A;  1BLC A;  2WGW A;  1ES5 A;  1K38 A;  2FFF B;  3M6H A;  2WKI A;  4WYY A;  2ZLY A;  3UDX A;  4QB8 A;  4A5R A;  1FOF A;  1XA7 A;  2BG1 A;  4O7D A;  4OPQ A;  5FAO A;  1XGJ A;  4JBF A;  2X71 A;  5M18 A;  3FZC A;  1PIO A;  3G30 A;  3IWQ A;  2WAE A;  4DXB A;  1L0G A;  4JF4 A;  5FQJ A;  3EQU A;  3OZH A;  3M2J A;  2Y2M A;  1KVL A;  1BTL A;  1OME A;  3N8L A;  1K54 C;  1LL5 A;  4UA7 A;  4KZA A;  3ZFZ A;  5EOE A;  2XH9 A;  1YLP A;  4EBN A;  3S4X A;  5E2F A;  1KGE A;  5HW3 A;  4LV2 A;  4C75 A;  4OOY A;  2ZJ9 A;  4ZJ3 A;  1IYQ A;  1CK3 A;  1MKI A;  3PAE A;  3Q7V A;  4Y7P A;  5TGF A;  2E8I A;  2Y2K A;  3IXD A;  5DF9 A;  3W8K A;  4S2P A;  3V3R A;  2XLN A;  1GCE A;  4QU3 A;  5FAP A;  2FFY A;  1K54 A;  1H8Z A;  1PW8 A;  3BLS A;  1NZO A;  4JXV A;  1LHY A;  4BQM A;  5CER A;  2HP6 A;  4MBH A;  4S2K A;  1E25 A;  1BUL A;  3FKV A;  2Y2G A;  5FQQ A;  2UWX A;  2Q9M A;  3C4P A;  2XK1 A;  3V5M A;  4HBU A;  1MY8 A;  3HLG A;  1NZU A;  1KGF A;  5I94 A;  5GHZ A;  4S2J A;  3O86 A;  3MKF A;  4RA7 A;  4WBG A;  3WS5 A;  1QME A;  4EV4 A;  1SDE A;  1W8Q A;  1FSY A;  3UE3 A;  5BOH A;  5J8X A;  3NCK A;  3BRM A;  1DJC A;  2OLV A;  3ZG8 B;  2IWC A;  4GNU A;  1JWP A;  1S0W A;  4LEN A;  1LI0 A;  5M1A A;  3WWX A;  2A3U A;  2ZC7 A;  4BL2 A;  1GHI A;  3BFD A;  5A92 A;  5FAT A;  4PM6 A;  4B88 A;  2EX8 A;  4GDB A;  2WGW B;  4XUZ A;  4C6Y A;  2V1Z A;  4MBK A;  4NET A;  2PU4 A;  3Q82 A;  1DY6 A;  1K57 C;  4E3I A;  4R4S A;  4DDY A;  5EOO A;  1RGY A;  3QNB A;  4ZBE A;  4FH2 A;  3G4P A;  3HL9 A;  2VGJ A;  2DRW A;  3IQA A;  4OOM A;  4PMA A;  3DWK A;  2EX9 A;  4E3L A;  5F1F A;  1NY0 A;  4OQ0 A;  1IEM A;  3GTC A;  1M40 A;  4WZ4 A;  2BLS A;  1VM1 A;  3GR2 A;  4BEN A;  3TG9 A;  3SH8 A;  3DWZ A;  3BEC A;  1H8Y A;  1PI5 A;  1FSW A;  1JTG A;  3MZE A;  1PI4 A;  4GOG A;  3I7J A;  4KEN B;  5CTN A;  4Y0O A;  3HLF A;  1K55 C;  4S2M A;  1YMS A;  4NK3 A;  5FQM A;  2HDR A;  1K57 A;  4OON A;  5M19 A;  3UE0 A;  1YLZ A;  3N4I A;  1XKZ A;  2B5R A;  4LCM A;  1IYO A;  4MNR A;  3UPO A;  1ES2 A;  1GA9 A;  3IWO A;  5F82 A;  1K56 D;  2H0Y A;  3NBL A;  2Y2L A;  4KZ8 A;  3PBO A;  4X6T A;  3WS2 A;  1XA1 A;  4DRT A;  2JBF A;  4P85 A;  5FI6 A;  1BSG A;  1BUE A;  4HBT A;  1IYP A;  1PYY A;  3UDI A;  4BLM A;  4Y0U A;  4MBF A;  3ZVW A;  3VOY A;  5CXW A;  1BZA A;  3OPP A;  3QHY A;  1HD8 A;  4Q8I A;  3GV9 A;  1L0F A;  3RXW A;  4E3K A;  1EI5 A;  3SOI A;  3PBS A;  1LL9 A;  3E2K A;  1JWV A;  3NC8 A;  1WYB A;  2Y4A A;  3FKW A;  1MBL A;  4PM9 A;  5DTK A;  2QMI A;  3VP3 A;  4DXC A;  2EXB A;  2WZX A;  2ZQA A;  1FCN A;  4KQQ A;  3IF6 A;  4QY5 A;  5GHY A;  4WMC D;  4X68 A;  1PWG A;  2WKE A;  4R4R A;  2WZZ A;  4KZ3 A;  5CGX A;  4OPY A;  3O87 A;  4N1X A;  3FYZ A;  3OC2 A;  3LCE A;  5CTM A;  1MWS A;  4OKP A;  1W8Y A;  5D3O A;  5AQA A;  4N9K A;  3HBR A;  4S2N C;  3UE1 A;  4U0T A;  4KG6 A;  4YFM A;  3UY6 A;  3HLW A;  5EE8 A;  5FSR A;  1XP4 A;  1VQQ A;  1SHV A;  3OCL A;  4E3J A;  1L2S A;  1XX2 A;  3D4F A;  1CEG A;  4Y0T A;  1SKF A;  3DW0 A;  3CG5 A;  1LLB A;  4KZ6 A;  3LY4 A;  4ZJ2 A;  1FCO A;  1K25 A;  1QMF A;  4FCF A;  4R3J A;  4DE0 A;  4QD4 A;  1HZO A;  1ESU A;  3OCN A;  4P0M A;  2PBY A;  5E2H A;  1O7E A;  2C6W B;  1KDS A;  2G2U A;  5GHX A;  2OV5 A;  4ZDX A;  4E6X A;  4JKT A;  1FR1 A;  3VP4 A;  3IXH A;  4OQH A;  2ZQD A;  2HP5 A;  2QZ6 A;  1PZP A;  2V2F F;  5DTS A;  2X01 A;  3GRJ A;  2RCX A;  1K55 A;  1Q2P A;  4RVA A;  2H5S A;  4GZB A;  1YLW A;  4UA9 A;  2ZM8 A;  3FWL A;  3OPH A;  5FA7 A;  4KZ4 A;  5TFQ A;  4PM8 A;  4N1H A;  1CI9 A;  5EPH A;  2R9W A;  2J7V A;  5A91 A;  1SCW A;  2WAD A;  5GLA A;  1N4O A;  1TEM A;  4OH0 A;  4ZTK A;  1NYY A;  4E6W A;  5KSC A;  1XPB A;  4GN2 A;  5GLD A;  4CJN A;  2WGV A;  1MWU A;  3G31 A;  2XDM A;  2J9O A;  1HTZ A;  3MXS A;  5AQB A;  5CED A;  3Q7V B;  1I5Q A;  3BFC A;  2RL3 A;  3FV7 A;  3RXX A;  4JF5 A;  4GB7 A;  4IBX A;  1U60 A;  5E2G A;  4WMC A;  5DVA A;  4MEZ A;  2ZC6 B;  1GHM A;  1ES3 A;  3IH9 A;  3BEB A;  4QY6 A;  3IH8 A;  1IYS A;  1FQG A;  3P09 A;  4P6B A;  5FI7 A;  4L0L A;  3C4O A;  5G18 A;  1Z6F A;  2H0T A;  3WRZ A;  1H5X A;  2WK0 A;  3ISG A;  4JXW A;  4K0W A;  4CPK A;  5KZH A;  4OP5 A;  1K4E A;  3QNC A;  2Y2P A;  3PBQ A;  4QHC A;  5HX9 A;  3RJU A;  5FAS A;  2Y2N A;  3ZG9 B;  1E3U D;  2EFX A;  2H10 A;  4RX2 A;  1KVM A;  1YLJ A;  4KZB A;  3VSL A;  2ZMA A;  4BL3 A;  5CEB A;  2HDU A;  1L0D A;  3BFF A;  3HLB A;  2HDS A;  4H8R A;  5F83 A;  3GQZ A;  4DE1 A;  4KZ5 A;  3NI9 A;  2XQZ A;  3A3D A;  1NRF A;  4IVI A;  4EQI A;  3CJM A;  3ZG7 B;  4WZ5 C;  3W4Q A;  5HAP A;  2Z2M B;  3HVF A;  2ZQC A;  3S1Y A;  1O07 A;  3IF6 B;  3Q7Z A;  2XGN A;  3LO7 A;  4WEJ A;  2EX2 A;  5CGW A;  4DF6 A;  2ZC3 B;  3CZD A;  4JXG A;  3ZNY A;  1KE4 A;  3W4P A;  3ZG0 A;  5KSH A;  1RP5 A;  4LV3 A;  3UDF A;  3OPR A;  4X69 A;  3PBN A;  3BFG A;  3VP1 A;  4S2I A;  3S22 A;  3BLM A;  5HFO A;  3ZNT A;  3WRT A;  3M6B A;  4EBP A;  1E3U A;  3MBZ A;  2VGK A;  2WGI A;  3TSG A;  4KQO A;  1PW1 A;  3ZCZ A;  5FQ9 A;  4JLF A;  2J8Y A;  3IXB A;  5CGS A;  4B4X A;  4GDN A;  3N6I A;  5DF7 A;  3ZDJ A;  2Y2H A;  3IF5 A;  1ESI A;  3LEZ A;  4KZ7 A;  4X53 A;  5A90 A;  5AQ7 A;  5FDH A;  1JTD A;  4WEL A;  1J9M A;  3Q07 A;  3IHB A;  4ZAM A;  1Y54 A;  4LCL A;  1MWT A;  2XFT A;  4R1G A;  2P74 A;  1CEF A;  4R23 A;  3C5A A;  4GD6 A;  2HP9 A;  2QPN A;  4GKU A;  4E3M A;  5IHV A;  3MZD A;  4E3N A;  4WM9 A;  3SS4 A;  4OVD A;  3ITB A;  1IKI A;  1FR6 A;  1BLS A;  3PBR A;  2IWD A;  3EQV A; 
#chains in the Genus database with same CATH topology
 2Y2O A;  2V0W A;  5FL3 A;  4F3L A;  1HVB A;  4E3O A;  3G2Z A;  3VFF A;  1NJ4 A;  1NXY A;  3L9K A;  1ZHH B;  2JE5 A;  3A3I A;  4FTX A;  3OPL A;  3JPU A;  2Y59 A;  1YM1 A;  2A49 A;  3NHQ A;  4UAA A;  4CQH A;  4WF0 A;  4PM7 A;  5EVI B;  3MFD A;  4U3T A;  2WAF A;  5HAI A;  3EEH A;  2I9V A;  1SDN A;  2WYX A;  2V8F A;  3ZYT A;  5EVI C;  2V9A A;  1LSX A;  3W4O A;  1STZ A;  1KDW A;  3Q81 A;  4S2L A;  4QWO A;  4XUX A;  1W7F A;  4FSF A;  1M6K A;  1OTA A;  3AGF A;  5EEC A;  4ARZ B;  2PHY A;  4BD0 A;  1JVJ A;  3M2K A;  1IKG A;  3VP2 A;  5G4Y A;  3GMW A;  5EVI D;  5CHU A;  5AQ9 A;  4EW7 A;  2G7U A;  3UNW A;  1PZO A;  4EWF A;  3VMA A;  3AGD A;  1AXB A;  3VSK A;  2EXA A;  2BAS A;  3WS4 A;  1ZTU A;  1S66 L;  2Y55 A;  4U0X A;  3V3S A;  4CLC A;  1SKO A;  1DP8 A;  3V39 A;  4D60 A;  3ZVT A;  1SZV A;  1YQS A;  3QP4 A;  5CRF A;  1CI8 A;  5FQI A;  3K3C A;  4I5S A;  5EVL A;  3P98 A;  4O0P A;  4P87 A;  3GVB A;  1I2S A;  3NIA A;  4IUH A;  3O88 A;  1TDL A;  3V50 A;  1PWD A;  4K0X A;  3N8S A;  3A3J A;  1ZC2 A;  4KZ9 A;  1VHM A;  4L9E A;  2B95 A;  3H82 A;  5E2E A;  3ZGA B;  1GA0 A;  5J7E A;  3AGE A;  1S6R A;  2ZQ9 A;  5EVI A;  5CHJ A;  3ITA A;  5HL1 A;  2Q9N A;  3K3D A;  4MN5 A;  5CHM A;  2I72 A;  3SH9 A;  4LFU A;  5CX7 A;  2QHK A;  4F94 A;  2P9V A;  3WS1 A;  1XXM A;  3CUE C;  4WZ5 A;  3UPP A;  2Y91 A;  2XR0 A;  1OTI A;  4IBR A;  4K91 A;  3VP0 A;  4MLL A;  3BFE A;  2JKG A;  3HJI A;  2FFF B;  3CIT A;  1JNU A;  2BG1 A;  5F6A A;  2X71 A;  1VEU A;  1D7E A;  4Q0H A;  5M18 A;  1L0G A;  1BTL A;  2BTF P;  3N8L A;  1K54 C;  1LL5 A;  4KZA A;  1F5M A;  1YLP A;  4EBN A;  3KSH A;  1KGE A;  1SKO B;  4OOY A;  1MKI A;  3Q7V A;  2NUT C;  5TGF A;  2E8I A;  2Y2K A;  3W8K A;  4S2P A;  3T1R A;  4F3L B;  5FAP A;  1LT0 A;  3B47 A;  1K54 A;  3BLS A;  1LHY A;  4BQM A;  2VGL M;  4BBV A;  1E25 A;  1BUL A;  2JKT M;  4R6L A;  1DP9 A;  2HGV A;  3C4P A;  3JVV A;  3U2A A;  1NZU A;  4S2J A;  3MKF A;  2B02 A;  4ARZ A;  4EV4 A;  1SDE A;  1W8Q A;  3UE3 A;  1W63 Q;  5J8X A;  2UV0 E;  3RFB A;  4LEN A;  2ZMV A;  4CLC C;  3NOU C;  5A92 A;  2A24 A;  3CLO A;  4XUZ A;  1PRQ A;  4KQD A;  4E3I A;  4GHI A;  4GCZ A;  4WUJ A;  3EOI A;  5DFY A;  5EOO A;  4FH2 A;  3G4P A;  3HL9 A;  3IQA A;  2DRW A;  4JGP A;  4PMA A;  1NY0 A;  3LR0 A;  4WZ4 A;  3TG9 A;  3SH8 A;  3DWZ A;  4R3A A;  1H8Y A;  1FSW A;  3MZE A;  4KEN B;  3HLF A;  1K55 C;  1YMS A;  1A0K A;  4ETX A;  2VKS A;  3K2N A;  5M19 A;  1Y4O A;  2VV7 A;  3UPO A;  1GA9 A;  1F9I A;  2H0Y A;  3FPV A;  3PBO A;  4EQ1 A;  4MDZ A;  4HBT A;  5L09 A;  2W0N A;  3UDI A;  3LID A;  3ZVW A;  2GNX A;  2OWJ A;  3H82 B;  5CXW A;  2PT7 A;  1KOU A;  3RXW A;  1EI5 A;  3PBS A;  3E2K A;  3T4Q A;  3FKW A;  4Y15 A;  5DTK A;  1XFN A;  2QMI A;  4HIA A;  2JHE A;  4P6Z S;  2ZQA A;  3IF6 A;  2WKE A;  4R4R A;  2WZZ A;  4KZ3 A;  2FZ0 A;  5IT5 A;  4N1X A;  3FYZ A;  5CTM A;  4KUO A;  5AQA A;  4N9K A;  4DJ3 A;  4S2N C;  5EE8 A;  3BQA A;  2Y79 A;  5FSR A;  1VQQ A;  1SHV A;  3LR4 A;  1L2S A;  3C38 A;  4Y0T A;  3CG5 A;  3R4K A;  4HJ6 A;  1QMF A;  5EM0 A;  2V0U A;  3TJZ C;  1XJ6 A;  1VB6 A;  1OTB A;  1FR1 A;  3VP4 A;  5HL6 A;  4OQH A;  2EWW A;  1Q2P A;  2H5S A;  4UA9 A;  2Q0O A;  1YSP A;  3CAX A;  5EPH A;  2XA7 M;  1SCW A;  2ZOI A;  1N4O A;  4ZTK A;  5KSC A;  2XDM A;  3KX0 X;  5CED A;  3Q7V B;  3LGO A;  5KIZ A;  5E2G A;  3G6O A;  1H8M A;  4WMC A;  4I3I A;  1ES3 A;  3IH9 A;  3LIE A;  4QY6 A;  2MJ6 A;  3IH8 A;  4P6B A;  4L0L A;  4DDY A;  1Z6F A;  4CPK A;  1H5X A;  3NUL A;  4HJ3 A;  4OP5 A;  1K4E A;  2J3T D;  3MXQ A;  4QHC A;  5F69 A;  3RJU A;  2Y2N A;  4RX2 A;  1KVM A;  2A24 B;  1TF1 A;  3HLB A;  4DE1 A;  3A3D A;  4L9F A;  4YWZ A;  5DFX A;  5HAP A;  2L4R A;  2QYB A;  2Z2M B;  3HVF A;  1O07 A;  3IF6 B;  4BWI A;  4MMN A;  2LB9 A;  2EX2 A;  1ODV A;  3ZG0 A;  1RP5 A;  4LV3 A;  3UDF A;  1G6O A;  3VP1 A;  3S22 A;  3BLM A;  5HFO A;  1E3U A;  3TSG A;  1PW1 A;  4HJ4 A;  2J8Y A;  5CGS A;  2HJE A;  3IX4 A;  5DF7 A;  3B33 A;  1ESI A;  3LEZ A;  4KZ7 A;  3QP1 A;  4M4X A;  5A90 A;  5FDH A;  3W2Z A;  1J9M A;  3IHB A;  4MN6 A;  3LIA A;  4EUV A;  1MWT A;  2P74 A;  5HPF A;  2CMN A;  5HD3 A;  1D06 A;  4WM9 A;  3SS4 A;  3ITB A;  1BLS A;  3EQV A;  1WE4 A;  1Z09 A;  3G35 A;  4B93 A;  4LV1 A;  1TS0 A;  4NXF A;  2W1T A;  1ES4 A;  4YNR A;  4WLA A;  3ULF A;  4X55 A;  1WYC A;  3HUN A;  3RH8 B;  1EW0 A;  1V9Y A;  3P7N A;  4OLD A;  3MFX A;  3A3E A;  2WKP A;  2OSU A;  2JKR I;  5F68 A;  3IXG A;  3HRE A;  4Y3I A;  3NOT C;  4JGR A;  3N8R A;  4HHD A;  5E43 A;  5FI2 A;  4FUW A;  3DBA A;  3L7H A;  3S7P A;  3LI8 A;  2J80 A;  1LI9 A;  4DDS A;  2HDQ A;  2OOL A;  1EWZ A;  3FC7 A;  3PXP A;  1UWN X;  4QJG A;  5J4E A;  1K6R A;  5DTT A;  1IEL A;  4EBL A;  1ZG4 A;  3SS5 A;  2GZA A;  1XGI A;  5AJG A;  2GDN A;  5L2F A;  4KQR A;  3MQQ A;  2ZC5 B;  5HWT A;  5FEG A;  2C5W B;  1DJB A;  3IWI A;  5AVF A;  2EFU A;  1K4F A;  3HJK A;  4GLQ A;  4S2N A;  5KMW A;  2PU2 A;  3FPW A;  4UQI M;  2WUQ A;  2PD7 A;  1P97 A;  5EUA A;  4D2O A;  5JYO A;  2QJ5 A;  4MN7 A;  3UB8 A;  4XT2 B;  2DNS A;  1N9B A;  3LUQ A;  1ACF A;  3UO9 A;  3QP5 A;  4C3Q A;  2A2L A;  4M3K A;  2OLU A;  4BBU A;  3LYX A;  3A0R A;  3MXR A;  4OPR A;  2PYP A;  2Y2J A;  1XFQ A;  4UHU A;  1TDG A;  4Y2F A;  3SS3 A;  2VLG A;  1MWR A;  1K6S A;  4LRX C;  4UA6 A;  1S4R A;  2O0Y A;  5TR7 A;  2WKR A;  5I5L A;  1I2W A;  4UQI S;  1L0E A;  2JC7 A;  3ZG5 A;  5EFW A;  1BLC A;  2R78 A;  2WGW A;  1K38 A;  3M6H A;  2P7J A;  3UDX A;  1FOF A;  3T1Q B;  4O7D A;  3FZC A;  4DXB A;  3IWQ A;  2PDR A;  4JF4 A;  3M2J A;  2Y2M A;  3T50 A;  5HWW A;  1PNE A;  2XH9 A;  3S4X A;  5E2F A;  4LV2 A;  2ZJ9 A;  2VV8 A;  4ZJ3 A;  2JN7 A;  1IYQ A;  3PAE A;  2XRO A;  4HP4 A;  3V3R A;  2K31 A;  2XLN A;  4L9G A;  2VX8 A;  4JXV A;  5CER A;  4S2K A;  2XA7 S;  3NJA A;  2M7V A;  2UWX A;  3KYZ A;  2ZBB A;  1KGF A;  4H6J A;  3CHW P;  4WBG A;  3WS5 A;  1QME A;  4IHQ A;  1FSY A;  1DJC A;  2OLV A;  3ZG8 B;  2P08 A;  1JWP A;  3WWX A;  4EER A;  4X25 A;  1GHI A;  3BFD A;  2V1Z A;  3Q82 A;  1P0Z A;  2HZ5 A;  3QNB A;  4ZBE A;  2VGJ A;  4E3L A;  2VEA A;  2D01 A;  3GEC A;  3GTC A;  1VM1 A;  1N9N A;  3GR2 A;  5F5Y A;  2PRF A;  3BEC A;  1PI5 A;  1YAX A;  4Y0O A;  1TD5 A;  2OAP 1;  1GSX A;  3PYP A;  3H9W A;  4LCM A;  2GX5 A;  4ESP A;  2V1B A;  1GSW A;  3KYE A;  4HI4 A;  3SW1 A;  1T19 A;  4PAU A;  4X6T A;  5HDS A;  4X1L A;  2JBF A;  4BLM A;  4Y0U A;  3E0Y A;  4Q0J A;  1BZA A;  4Q8I A;  3KSG A;  1L0F A;  3SOI A;  2W1R A;  3E4Q A;  1LL9 A;  3NC8 A;  1WYB A;  2Y4A A;  4XT2 A;  1V9Z A;  4EEU A;  5J3W A;  3VP3 A;  4Y13 A;  1FCN A;  4KQQ A;  4Q0I A;  2WKQ A;  5GHY A;  1VEU B;  3MJQ A;  1W8Y A;  4U0T A;  4KG6 A;  4YOF A;  4YFM A;  3PR6 A;  1OT6 A;  4E3J A;  5IU1 A;  4EES A;  2PR6 A;  1SKF A;  4I3A A;  3LY4 A;  1S1Z A;  4ZJ2 A;  3ZQ5 A;  1FCO A;  4DE0 A;  1HZO A;  4E04 A;  1ESU A;  2PBY A;  1O7E A;  4GJ4 A;  1NWZ A;  4PHT A;  2OV5 A;  2KDK A;  1XJ3 A;  4PKY G;  1PZP A;  1K55 A;  4RVA A;  4GZB A;  4N1H A;  1T1A A;  3MQO A;  2R9W A;  5A91 A;  1TEM A;  4OH0 A;  2VGL S;  1YSQ A;  1XPB A;  4GN2 A;  3IS2 B;  2WGV A;  1MWU A;  3G31 A;  1HTZ A;  2XSS A;  3FV7 A;  3RXX A;  4JF5 A;  5DVA A;  3C4O A;  1UGU A;  3MMH A;  4JXW A;  4K0W A;  1N9L A;  1Y28 A;  2Y2P A;  3BW6 A;  4ETZ A;  1YLJ A;  2HDU A;  1L0D A;  5F83 A;  4BBT A;  4KZ5 A;  3ZG7 B;  3TW8 A;  3E98 A;  2M1C A;  4WEJ A;  4DF6 A;  3ZNY A;  1KE4 A;  5KSH A;  4X69 A;  3ZNT A;  3MBZ A;  1S67 L;  4KQO A;  3N6I A;  3VV4 A;  2QWS A;  4LCL A;  4HH3 A;  4R23 A;  4GD6 A;  2HJ9 C;  4GKU A;  4E3M A;  5IHV A;  4I39 A;  4DN0 A;  3MZF A;  2PAV P;  4OOL A;  3DTK A;  3BYD A;  5GLC A;  1ZG6 A;  4N9L A;  3NDE A;  3B42 A;  1YLY A;  2KLI A;  3VOZ A;  1CQA A;  3NY4 A;  3PAG A;  1KGG A;  4KG5 A;  4IUK A;  3ICY A;  4OQI A;  2W27 A;  2DCF A;  3C30 A;  3LIB A;  4OPZ A;  4R3B A;  3VE3 A;  1FCM A;  2ZD8 A;  1ONG A;  1K56 A;  2V20 A;  3DTE A;  4DKI A;  2X02 A;  4HES A;  4PM5 A;  3C8C A;  5A93 A;  4PPR A;  1MZU A;  3FG8 A;  1DP6 A;  1MPL A;  2D02 A;  3T4O A;  2GJ3 A;  3UB5 P;  4IED A;  4Z9Q A;  4IVK A;  1BLP A;  4B4Z A;  3RTY A;  5FQK A;  2IWB A;  3PTE A;  5F1G A;  4EUZ A;  4XXR A;  4JGO A;  1BLH A;  4EET B;  4FH4 A;  2HPB A;  5GLB A;  4Y5F A;  1GHP A;  1MXO A;  3DTM A;  3NEC A;  4OQG A;  1P9W A;  4ID4 A;  2E8J A;  3EEA A;  3LIC A;  1H3Q A;  1D1J A;  3VOL A;  1H0M A;  4HP9 A;  3JVU A;  4S2O A;  4ZJ1 A;  5JYP A;  2JKT I;  2ZQ8 A;  3B3X A;  5HWV A;  2EWV A;  1K0K A;  2K7S A;  3QP8 A;  2L0W A;  2WKH A;  3UPN A;  2XEP A;  1YT4 A;  1N9O A;  3C2W A;  5FDS A;  4HEF A;  1MKM A;  3JYI A;  2W3D A;  1C3B A;  5HAQ A;  4JXS A;  2ZC4 B;  3C7V A;  2JCH A;  1BT5 A;  5FEF A;  3PHY A;  3D72 A;  4DJ2 A;  5FAQ A;  3UB9 A;  3A3F A;  4JF6 A;  4OLG A;  3O3V A;  1J3W A;  1RGZ A;  1YLT A;  3HLE A;  2R9X A;  2J9P A;  1YMX A;  4LRY C;  3TOI A;  5DJU A;  2ZM2 A;  2ZM0 A;  4WN5 A;  1ES5 A;  4AFI A;  2WKI A;  4A5R A;  1XA7 A;  1HLU P;  3UMD A;  4OPQ A;  5FAO A;  5TBM A;  4I3J A;  1KVL A;  1OME A;  3S7O A;  4UA7 A;  4R70 A;  3H7W B;  5HW3 A;  4HY8 A;  4IJG A;  3KSF A;  1CF0 A;  3IXD A;  4JGQ A;  5DKK A;  1GCE A;  4QU3 A;  1OJ5 A;  1PW8 A;  1NZO A;  5G4Z A;  4MBH A;  2OWH A;  2Y2G A;  5FQQ A;  2Q9M A;  2XK1 A;  1MY8 A;  3LI9 A;  5GHZ A;  3QP2 A;  3O86 A;  4RA7 A;  1FIL A;  1TS8 A;  3BRM A;  2IWC A;  4GNU A;  4WL9 A;  1WA9 A;  5M1A A;  2W3H A;  2ZC7 A;  4BL2 A;  5FAT A;  4B88 A;  2WGW B;  1S4S A;  1DY6 A;  2W3E A;  3F1N B;  4R4S A;  1RGY A;  4OOM A;  4LRZ E;  2EX9 A;  1S1Y A;  1IEM A;  1OTD A;  2BLS A;  4BEN A;  5EM1 A;  2KX6 A;  3S7N A;  2K2N A;  5CTN A;  2ZOH A;  3GDI A;  4LGW A;  4NKP A;  4S2M A;  4NK3 A;  2HDR A;  3F1O A;  3P01 A;  3N4I A;  3IBJ A;  5MC7 A;  3UB6 A;  4MNR A;  3IWO A;  1K56 D;  3NBL A;  1VET B;  4G3W A;  3WS2 A;  1XA1 A;  5L07 A;  4BMW A;  4EXO A;  2ACG A;  1BUE A;  1IYP A;  1PYY A;  4MBF A;  3UE6 A;  3VOY A;  3QHY A;  4H6J B;  3GV9 A;  3DAV A;  1JWV A;  3BY9 A;  3IX3 A;  2EXB A;  2WZX A;  2VZW A;  4X68 A;  4WMC D;  1TS6 A;  1NRJ A;  1CJF A;  3O87 A;  3OC2 A;  3LCE A;  4OKP A;  3BWL A;  3HLW A;  3OCL A;  1NLZ A;  3T4T A;  3IBR A;  4CLC E;  1XX2 A;  1CEG A;  4Y17 A;  1LLB A;  3OOV A;  4R3J A;  4LPZ A;  4P0M A;  5LBR A;  2Z6C A;  2C6W B;  5L10 A;  2G2U A;  2Y8H A;  4JKT A;  3IXH A;  2V1A A;  2QZ6 A;  2V2F F;  2JKR M;  2X01 A;  1YLW A;  3FWL A;  5FA7 A;  5TBM B;  4NXE A;  1F98 A;  4PM8 A;  4DMZ A;  1LSV A;  5GLA A;  2VJW A;  3DTI A;  3LR3 A;  2L1M A;  3F1P B;  2PYR A;  4CJN A;  2VA0 A;  4B9O A;  2W3G A;  1I5Q A;  2RL3 A;  3O5Y A;  2ZC6 B;  3BY8 A;  1GHM A;  1FQG A;  3P09 A;  5FI7 A;  2H0T A;  2WK0 A;  3ISG A;  2AVX A;  3PBQ A;  5FAS A;  2EFX A;  2H10 A;  4KZB A;  3VSL A;  1T1C A;  5CEB A;  1IOU A;  3BFF A;  2XQZ A;  4EQI A;  3CJM A;  2J3W A;  4FOF A;  3S1Y A;  3Q7Z A;  3UME A;  3LO7 A;  2ZC3 B;  4JXG A;  3W4P A;  3BFG A;  4S2I A;  3D3O A;  3WRT A;  2VGK A;  3S7Q A;  4X1M A;  3F1O B;  4B4X A;  3T4S A;  3IXB A;  3EGX C;  4GDN A;  3CPT B;  2O99 A;  2Y2H A;  3IF5 A;  1F2K A;  5AQ7 A;  1JTD A;  4WEL A;  3Q07 A;  4R1G A;  3E4P A;  2DMW A;  3C5A A;  1GSV A;  2HP9 A;  2QPN A;  3MZD A;  3FKV A;  3C7U A;  3LY3 A;  3IT9 A;  5EVE A;  1ERQ A;  1TVF A;  4FD8 A;  1W5D A;  1LSW A;  3UN7 A;  4RX3 A;  1ZKJ A;  3CMZ A;  4YIN A;  2Z2L B;  2EX6 A;  3LR5 A;  4R0Q A;  3LIF A;  5CEC A;  1AWI A;  1ERM A;  5C5K A;  2Y2Q A;  2LB5 A;  4LV0 A;  2HV1 A;  1L3L A;  5GL9 A;  4DE3 A;  4GW9 A;  3A0V A;  3N7W A;  3ZHH A;  1W79 A;  3MF0 A;  4KG2 A;  2W1T B;  3IF6 C;  1ALQ A;  1E4D A;  1ERO A;  1KE0 A;  2P9V B;  4BD1 A;  3IS2 A;  3HUO A;  1G68 A;  3BQ8 A;  2O9C A;  3BM6 A;  4JPM A;  3V5M A;  3IHA A;  1PWC A;  3E2L A;  3EGD C;  1MC0 A;  1NYM A;  1FIK A;  5DF8 A;  3F1P A;  1ONH A;  1DRM A;  1KE3 A;  2XFS A;  2B18 A;  3CPT A;  3G34 A;  4EU0 A;  3G2Y A;  3E4O A;  3MKE A;  4GD8 A;  3SZT A;  3T4L A;  1W63 M;  4WEK A;  4GHI B;  3HUM A;  1RCJ A;  4BJP A;  2Y2I A;  4X56 A;  2G2W A;  2CC1 A;  4QPR A;  1G6A A;  3QP6 A;  4PKY A;  3SH7 A;  3WS0 A;  2XD1 A;  2XD5 A;  2O9B A;  1DJA A;  3HLD A;  1Q2Q A;  4DE2 A;  2J3T C;  4HQA A;  5U47 A;  2XF3 A;  4RQ9 A;  1JWZ A;  3LFV A;  2ZL1 A;  4OP8 A;  3GSG A;  1UWP X;  5AVE A;  1P9R A;  3G32 A;  4N92 A;  1YKD A;  3NDG A;  2ZQ7 A;  5HAR A;  5A8B A;  3HLC A;  3V67 A;  4RYE A;  2FH5 A;  3VFH A;  3PBT A;  3Q1F A;  1PFL A;  4WYY A;  2ZLY A;  4QB8 A;  5HPI A;  1XGJ A;  3T4K A;  1T18 A;  4JBF A;  1PIO A;  3MSH A;  3G30 A;  2WAE A;  5FQJ A;  3EQU A;  3OZH A;  1OT9 A;  3ZFZ A;  4NXG A;  5EOE A;  1YPR A;  2O9A A;  2V8C A;  4LLO B;  4R38 A;  4C75 A;  1CK3 A;  4Y7P A;  5DF9 A;  5IS1 A;  3KSI A;  2FFY A;  3R7W A;  1H8Z A;  5HD5 A;  2H28 A;  2HP6 A;  4NEE D;  4NG2 A;  1OPX A;  1T1B A;  4HBU A;  4UEY A;  3HLG A;  5I94 A;  2YKF A;  4EEP A;  3LEQ A;  5BOH A;  4G3K A;  3NCK A;  3BJN A;  3EWK A;  3OBF A;  1S0W A;  1LI0 A;  1OTE A;  2A3U A;  3A0S A;  3KO6 A;  2Z6D A;  3TRC A;  2M7U A;  4PM6 A;  2VK3 A;  2EX8 A;  4GDB A;  4C6Y A;  4MBK A;  4NET A;  3CI6 A;  2PU4 A;  1K57 C;  3T1X A;  3T1S A;  5TJJ A;  4ZRR A;  3DWK A;  5F1F A;  4CLC D;  4OQ0 A;  1M40 A;  2PD8 A;  2IA2 A;  3D9Y A;  2INW A;  1JTG A;  1PI4 A;  4GOG A;  3I7J A;  1TS7 A;  3H7W A;  5FQM A;  4GS9 A;  1XJ2 A;  1K57 A;  4OON A;  4MCW A;  3UE0 A;  4NXB A;  1YLZ A;  1XKZ A;  2B5R A;  4O8G A;  2OAQ 1;  4KUK A;  5HDC A;  1IYO A;  1ES2 A;  5F82 A;  1OJG A;  2Y2L A;  4KZ8 A;  4DRT A;  4P85 A;  5FI6 A;  4Z1W A;  1BSG A;  4I38 A;  3MQ0 A;  5HDD A;  1G28 A;  5HZH A;  2EA9 A;  2ZMF A;  3TE8 A;  4HOI A;  3OPP A;  1HD8 A;  4E3K A;  2ZL1 B;  3R7W B;  1MBL A;  4PM9 A;  4DXC A;  5DJT A;  2QKP A;  4HNB A;  4QY5 A;  1PWG A;  1LL8 A;  5CGX A;  4OPY A;  2W3F A;  1MWS A;  5D3O A;  3HBR A;  3F1N A;  4II7 A;  3UE1 A;  3UY6 A;  1XP4 A;  5HSQ A;  3T4J A;  3OLO A;  3D4F A;  2QJ7 A;  3DW0 A;  3HCY A;  4KZ6 A;  1K25 A;  2JKF A;  4FCF A;  5EV0 A;  5K5B A;  4QD4 A;  3OCN A;  5E2H A;  2PR5 A;  1KDS A;  5GHX A;  3U4L P;  4ZDX A;  1BYW A;  5DKL A;  4E6X A;  1G5U A;  2ZQD A;  3UB7 A;  2HP5 A;  5DTS A;  3CWF A;  3GRJ A;  2RCX A;  2PBD P;  4G3V A;  2ZM8 A;  3OPH A;  5TFQ A;  4KZ4 A;  2VV6 A;  1CI9 A;  2J7V A;  4CLC B;  2WAD A;  1NYY A;  4E6W A;  5GLD A;  1X0O A;  3NOP C;  2J9O A;  3MXS A;  5AQB A;  3BFC A;  4GB7 A;  4IBX A;  1U60 A;  4MEZ A;  1XJ4 A;  3BEB A;  1IYS A;  5G18 A;  3WRZ A;  1NLY A;  5KZH A;  3QNC A;  5HX9 A;  4O01 A;  3KYQ A;  3ZG9 B;  1E3U D;  4ME4 A;  3IX8 A;  2ZMA A;  2HF6 A;  1VET A;  4BL3 A;  3MR0 A;  2NUP C;  4H8R A;  2HDS A;  1IFQ A;  3GQZ A;  3NI9 A;  1NRF A;  4IVI A;  3CUE A;  4WZ5 C;  3W4Q A;  2ZQC A;  3T12 B;  2XGN A;  5CGW A;  2XRN A;  3CZD A;  2KOI A;  4HH2 A;  2P04 A;  4P6Z M;  3OPR A;  3PBN A;  3M6B A;  4EBP A;  2WGI A;  4K08 A;  2YKH A;  3ZCZ A;  5FQ9 A;  4JLF A;  3VE4 A;  3ZDJ A;  4X53 A;  4ZAM A;  1Y54 A;  2XFT A;  1CEF A;  5L8M A;  4E3N A;  4OVD A;  1IKI A;  1FR6 A;  3PBR A;  4GS9 B;  2IWD A;  3MS6 A; 
#chains in the Genus database with same CATH homology
 2Y2O A;  1WE4 A;  3MZF A;  3C7U A;  4OOL A;  1HVB A;  3G35 A;  3LY3 A;  3IT9 A;  3BYD A;  5GLC A;  1ZG6 A;  4N9L A;  1ERQ A;  4E3O A;  1TVF A;  4FD8 A;  4LV1 A;  1W5D A;  3G2Z A;  3VFF A;  1NJ4 A;  1NXY A;  3NDE A;  2JE5 A;  1YLY A;  1ES4 A;  4RX3 A;  3A3I A;  3UN7 A;  4EBL A;  1ZKJ A;  3OPL A;  3VOZ A;  4X55 A;  3CMZ A;  2Y59 A;  4YIN A;  1WYC A;  3NY4 A;  3HUN A;  3PAG A;  1KGG A;  1YM1 A;  2Z2L B;  2A49 A;  4KG5 A;  4OQI A;  4OLD A;  2EX6 A;  4UAA A;  4PM7 A;  4R0Q A;  5CEC A;  5EVI B;  3MFD A;  3A3E A;  4U3T A;  2DCF A;  2WAF A;  2OSU A;  5HAI A;  1SDN A;  2WYX A;  4OPZ A;  1ERM A;  4R3B A;  3IXG A;  1FCM A;  2ZD8 A;  1ONG A;  1K56 A;  2V20 A;  2Y2Q A;  3HRE A;  5EVI C;  2X02 A;  4DKI A;  4HES A;  4PM5 A;  4LV0 A;  3W4O A;  5A93 A;  1KDW A;  3N8R A;  3Q81 A;  4PPR A;  4S2L A;  5E43 A;  5FI2 A;  4XUX A;  1MPL A;  1W7F A;  5GL9 A;  4FSF A;  4DE3 A;  1M6K A;  3AGF A;  5EEC A;  3N7W A;  3ZHH A;  1W79 A;  4IED A;  4BD0 A;  1JVJ A;  4KG2 A;  3M2K A;  1IKG A;  4Z9Q A;  3VP2 A;  4IVK A;  1BLP A;  1LI9 A;  3IF6 C;  1ALQ A;  2HDQ A;  3GMW A;  4B4Z A;  4DDS A;  1E4D A;  1EWZ A;  5FQK A;  1ERO A;  1KE0 A;  2IWB A;  3PTE A;  5EVI D;  5CHU A;  2P9V B;  5F1G A;  4BD1 A;  5AQ9 A;  4QJG A;  4EUZ A;  4XXR A;  3UNW A;  1PZO A;  3HUO A;  1G68 A;  1K6R A;  4EWF A;  1BLH A;  3VMA A;  3AGD A;  1AXB A;  3BM6 A;  1IEL A;  4FH4 A;  1ZG4 A;  3IHA A;  4JPM A;  5DTT A;  3SS5 A;  2HPB A;  3VSK A;  5GLB A;  2EXA A;  1XGI A;  1PWC A;  3WS4 A;  1GHP A;  3E2L A;  1MXO A;  3DTM A;  2GDN A;  1NYM A;  2Y55 A;  5L2F A;  4U0X A;  3V3S A;  4KQR A;  4OQG A;  4ID4 A;  2ZC5 B;  5DF8 A;  1ONH A;  1KE3 A;  2XFS A;  3G34 A;  2C5W B;  3G2Y A;  1DJB A;  3IWI A;  3MKE A;  2EFU A;  4GD8 A;  3V39 A;  3ZVT A;  4S2O A;  1K4F A;  4ZJ1 A;  5JYP A;  4S2N A;  1YQS A;  4WEK A;  2ZQ8 A;  5KMW A;  3B3X A;  3HUM A;  5CRF A;  1RCJ A;  4BJP A;  2PU2 A;  1CI8 A;  5FQI A;  2Y2I A;  4X56 A;  5EVL A;  2G2W A;  3P98 A;  4P87 A;  3GVB A;  2CC1 A;  1I2S A;  3NIA A;  2WKH A;  1G6A A;  2WUQ A;  3UPN A;  5EUA A;  3O88 A;  4D2O A;  5JYO A;  1TDL A;  3SH7 A;  3WS0 A;  2XEP A;  1YT4 A;  3V50 A;  4HEF A;  1PWD A;  2XD1 A;  4K0X A;  2DNS A;  2XD5 A;  1N9B A;  3A3J A;  3N8S A;  3JYI A;  3UO9 A;  1ZC2 A;  4KZ9 A;  1DJA A;  3HLD A;  1C3B A;  4C3Q A;  1Q2Q A;  4M3K A;  4DE2 A;  5HAQ A;  4JXS A;  2ZC4 B;  5E2E A;  2OLU A;  3ZGA B;  3C7V A;  1GA0 A;  2JCH A;  5U47 A;  2XF3 A;  3AGE A;  1S6R A;  2ZQ9 A;  5EVI A;  1JWZ A;  1BT5 A;  5CHJ A;  3ITA A;  5HL1 A;  2Q9N A;  4OP8 A;  3GSG A;  3MXR A;  4OPR A;  5CHM A;  2I72 A;  3SH9 A;  2Y2J A;  5FAQ A;  3G32 A;  4UHU A;  4N92 A;  3A3F A;  4JF6 A;  3NDG A;  1TDG A;  4OLG A;  4F94 A;  3O3V A;  1RGZ A;  2P9V A;  3SS3 A;  1YLT A;  2ZQ7 A;  3HLE A;  2R9X A;  5HAR A;  3WS1 A;  2J9P A;  1MWR A;  1YMX A;  1XXM A;  3HLC A;  1K6S A;  4WZ5 A;  4UA6 A;  3TOI A;  3UPP A;  4RYE A;  2Y91 A;  2XR0 A;  4IBR A;  2ZM2 A;  2ZM0 A;  3VFH A;  4K91 A;  5TR7 A;  3VP0 A;  4MLL A;  3PBT A;  1I2W A;  3BFE A;  3Q1F A;  1L0E A;  2JC7 A;  3ZG5 A;  1BLC A;  2WGW A;  1ES5 A;  1K38 A;  2FFF B;  3M6H A;  2WKI A;  4WYY A;  2ZLY A;  3UDX A;  4QB8 A;  4A5R A;  1FOF A;  1XA7 A;  2BG1 A;  4O7D A;  4OPQ A;  5FAO A;  1XGJ A;  4JBF A;  2X71 A;  5M18 A;  3FZC A;  1PIO A;  3G30 A;  3IWQ A;  2WAE A;  4DXB A;  1L0G A;  4JF4 A;  5FQJ A;  3EQU A;  3OZH A;  3M2J A;  2Y2M A;  1KVL A;  1BTL A;  1OME A;  3N8L A;  1K54 C;  1LL5 A;  4UA7 A;  4KZA A;  3ZFZ A;  5EOE A;  2XH9 A;  1YLP A;  4EBN A;  3S4X A;  5E2F A;  1KGE A;  5HW3 A;  4LV2 A;  4C75 A;  4OOY A;  2ZJ9 A;  4ZJ3 A;  1IYQ A;  1CK3 A;  1MKI A;  3PAE A;  3Q7V A;  4Y7P A;  5TGF A;  2E8I A;  2Y2K A;  3IXD A;  5DF9 A;  3W8K A;  4S2P A;  3V3R A;  2XLN A;  1GCE A;  4QU3 A;  5FAP A;  2FFY A;  1K54 A;  1H8Z A;  1PW8 A;  3BLS A;  1NZO A;  4JXV A;  1LHY A;  4BQM A;  5CER A;  2HP6 A;  4MBH A;  4S2K A;  1E25 A;  1BUL A;  3FKV A;  2Y2G A;  5FQQ A;  2UWX A;  2Q9M A;  3C4P A;  2XK1 A;  3V5M A;  4HBU A;  1MY8 A;  3HLG A;  1NZU A;  1KGF A;  5I94 A;  5GHZ A;  4S2J A;  3O86 A;  3MKF A;  4RA7 A;  4WBG A;  3WS5 A;  1QME A;  4EV4 A;  1SDE A;  1W8Q A;  1FSY A;  3UE3 A;  5BOH A;  5J8X A;  3NCK A;  3BRM A;  1DJC A;  2OLV A;  3ZG8 B;  2IWC A;  4GNU A;  1JWP A;  1S0W A;  4LEN A;  1LI0 A;  5M1A A;  3WWX A;  2A3U A;  2ZC7 A;  4BL2 A;  1GHI A;  3BFD A;  5A92 A;  5FAT A;  4PM6 A;  4B88 A;  2EX8 A;  4GDB A;  2WGW B;  4XUZ A;  4C6Y A;  2V1Z A;  4MBK A;  4NET A;  2PU4 A;  3Q82 A;  1DY6 A;  1K57 C;  4E3I A;  4R4S A;  4DDY A;  5EOO A;  1RGY A;  3QNB A;  4ZBE A;  4FH2 A;  3G4P A;  3HL9 A;  2VGJ A;  2DRW A;  3IQA A;  4OOM A;  4PMA A;  3DWK A;  2EX9 A;  4E3L A;  5F1F A;  1NY0 A;  4OQ0 A;  1IEM A;  3GTC A;  1M40 A;  4WZ4 A;  2BLS A;  1VM1 A;  3GR2 A;  4BEN A;  3TG9 A;  3SH8 A;  3DWZ A;  3BEC A;  1H8Y A;  1PI5 A;  1FSW A;  1JTG A;  3MZE A;  1PI4 A;  4GOG A;  3I7J A;  4KEN B;  5CTN A;  4Y0O A;  3HLF A;  1K55 C;  4S2M A;  1YMS A;  4NK3 A;  5FQM A;  2HDR A;  1K57 A;  4OON A;  5M19 A;  3UE0 A;  1YLZ A;  3N4I A;  1XKZ A;  2B5R A;  4LCM A;  1IYO A;  4MNR A;  3UPO A;  1ES2 A;  1GA9 A;  3IWO A;  5F82 A;  1K56 D;  2H0Y A;  3NBL A;  2Y2L A;  4KZ8 A;  3PBO A;  4X6T A;  3WS2 A;  1XA1 A;  4DRT A;  2JBF A;  4P85 A;  5FI6 A;  1BSG A;  1BUE A;  4HBT A;  1IYP A;  1PYY A;  3UDI A;  4BLM A;  4Y0U A;  4MBF A;  3ZVW A;  3VOY A;  5CXW A;  1BZA A;  3OPP A;  3QHY A;  1HD8 A;  4Q8I A;  3GV9 A;  1L0F A;  3RXW A;  4E3K A;  1EI5 A;  3SOI A;  3PBS A;  1LL9 A;  3E2K A;  1JWV A;  3NC8 A;  1WYB A;  2Y4A A;  3FKW A;  1MBL A;  4PM9 A;  5DTK A;  2QMI A;  3VP3 A;  4DXC A;  2EXB A;  2WZX A;  2ZQA A;  1FCN A;  4KQQ A;  3IF6 A;  4QY5 A;  5GHY A;  4WMC D;  4X68 A;  1PWG A;  2WKE A;  4R4R A;  2WZZ A;  4KZ3 A;  5CGX A;  4OPY A;  3O87 A;  4N1X A;  3FYZ A;  3OC2 A;  3LCE A;  5CTM A;  1MWS A;  4OKP A;  1W8Y A;  5D3O A;  5AQA A;  4N9K A;  3HBR A;  4S2N C;  3UE1 A;  4U0T A;  4KG6 A;  4YFM A;  3UY6 A;  3HLW A;  5EE8 A;  5FSR A;  1XP4 A;  1VQQ A;  1SHV A;  3OCL A;  4E3J A;  1L2S A;  1XX2 A;  3D4F A;  1CEG A;  4Y0T A;  1SKF A;  3DW0 A;  3CG5 A;  1LLB A;  4KZ6 A;  3LY4 A;  4ZJ2 A;  1FCO A;  1K25 A;  1QMF A;  4FCF A;  4R3J A;  4DE0 A;  4QD4 A;  1HZO A;  1ESU A;  3OCN A;  4P0M A;  2PBY A;  5E2H A;  1O7E A;  2C6W B;  1KDS A;  2G2U A;  5GHX A;  2OV5 A;  4ZDX A;  4E6X A;  4JKT A;  1FR1 A;  3VP4 A;  3IXH A;  4OQH A;  2ZQD A;  2HP5 A;  2QZ6 A;  1PZP A;  2V2F F;  5DTS A;  2X01 A;  3GRJ A;  2RCX A;  1K55 A;  1Q2P A;  4RVA A;  2H5S A;  4GZB A;  1YLW A;  4UA9 A;  2ZM8 A;  3FWL A;  3OPH A;  5FA7 A;  4KZ4 A;  5TFQ A;  4PM8 A;  4N1H A;  1CI9 A;  5EPH A;  2R9W A;  2J7V A;  5A91 A;  1SCW A;  2WAD A;  5GLA A;  1N4O A;  1TEM A;  4OH0 A;  4ZTK A;  1NYY A;  4E6W A;  5KSC A;  1XPB A;  4GN2 A;  5GLD A;  4CJN A;  2WGV A;  1MWU A;  3G31 A;  2XDM A;  2J9O A;  1HTZ A;  3MXS A;  5AQB A;  5CED A;  3Q7V B;  1I5Q A;  3BFC A;  2RL3 A;  3FV7 A;  3RXX A;  4JF5 A;  4GB7 A;  4IBX A;  1U60 A;  5E2G A;  4WMC A;  5DVA A;  4MEZ A;  2ZC6 B;  1GHM A;  1ES3 A;  3IH9 A;  3BEB A;  4QY6 A;  3IH8 A;  1IYS A;  1FQG A;  3P09 A;  4P6B A;  5FI7 A;  4L0L A;  3C4O A;  5G18 A;  1Z6F A;  2H0T A;  3WRZ A;  1H5X A;  2WK0 A;  3ISG A;  4JXW A;  4K0W A;  4CPK A;  5KZH A;  4OP5 A;  1K4E A;  3QNC A;  2Y2P A;  3PBQ A;  4QHC A;  5HX9 A;  3RJU A;  5FAS A;  2Y2N A;  3ZG9 B;  1E3U D;  2EFX A;  2H10 A;  4RX2 A;  1KVM A;  1YLJ A;  4KZB A;  3VSL A;  2ZMA A;  4BL3 A;  5CEB A;  2HDU A;  1L0D A;  3BFF A;  3HLB A;  2HDS A;  4H8R A;  5F83 A;  3GQZ A;  4DE1 A;  4KZ5 A;  3NI9 A;  2XQZ A;  3A3D A;  1NRF A;  4IVI A;  4EQI A;  3CJM A;  3ZG7 B;  4WZ5 C;  3W4Q A;  5HAP A;  2Z2M B;  3HVF A;  2ZQC A;  3S1Y A;  1O07 A;  3IF6 B;  3Q7Z A;  2XGN A;  3LO7 A;  4WEJ A;  2EX2 A;  5CGW A;  4DF6 A;  2ZC3 B;  3CZD A;  4JXG A;  3ZNY A;  1KE4 A;  3W4P A;  3ZG0 A;  5KSH A;  1RP5 A;  4LV3 A;  3UDF A;  3OPR A;  4X69 A;  3PBN A;  3BFG A;  3VP1 A;  4S2I A;  3S22 A;  3BLM A;  5HFO A;  3ZNT A;  3WRT A;  3M6B A;  4EBP A;  1E3U A;  3MBZ A;  2VGK A;  2WGI A;  3TSG A;  4KQO A;  1PW1 A;  3ZCZ A;  5FQ9 A;  4JLF A;  2J8Y A;  3IXB A;  5CGS A;  4B4X A;  4GDN A;  3N6I A;  5DF7 A;  3ZDJ A;  2Y2H A;  3IF5 A;  1ESI A;  3LEZ A;  4KZ7 A;  4X53 A;  5A90 A;  5AQ7 A;  5FDH A;  1JTD A;  4WEL A;  1J9M A;  3Q07 A;  3IHB A;  4ZAM A;  1Y54 A;  4LCL A;  1MWT A;  2XFT A;  4R1G A;  2P74 A;  1CEF A;  4R23 A;  3C5A A;  4GD6 A;  2HP9 A;  2QPN A;  4GKU A;  4E3M A;  5IHV A;  3MZD A;  4E3N A;  4WM9 A;  3SS4 A;  4OVD A;  3ITB A;  1IKI A;  1FR6 A;  1BLS A;  3PBR A;  2IWD A;  3EQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...