3Q82A

Meropenem acylated blar1 sensor domain from staphylococcus aureus
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
QSITDYNYKKPLHNDYQILDKSKIFGSNSGSFVMYSMAADAYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase regulatory protein BlaR1
publication title Lysine Nzeta-decarboxylation switch and activation of the beta-lactam sensor domain of BlaR1 protein of methicillin-resistant Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase regulator/antibiotic
total genus 85
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q82A00
4ID4A 4DE3A 5M1AA 3Q1FA 3CJMA 3G2YA 1XA1A 2Y2QA 2C6WB 2J9PA 5CGSA 2FFFB 4LV3A 3PBOA 1CI8A 1XKZA 4DXBA 3IH8A 5U47A 4JBFA 3N8RA 4KZ7A 3A3IA 3IXDA 2Y2IA 3B3XA 5HW3A 3UY6A 1ONGA 1RP5A 1NRFA 1PYYA 4OONA 4KENB 4FSFA 2ZJ9A 1ESUA 3V5MA 1I2SA 3HUMA 3CMZA 5GHXA 3IF5A 3OCNA 4S2OA 4FH4A 3N8SA 4OLGA 4KZ5A 3VFHA 2G2WA 4F94A 1L2SA 1LHYA 3ZGAB 3MZFA 1IEMA 4IBXA 1K4EA 5EVID 5GHYA 3W4PA 3UPNA 4DE2A 5CHMA 4E3MA 2QMIA 3WS5A 3MBZA 5EOEA 1KGGA 3GRJA 1NZUA 1K6SA 2QPNA 4B88A 3UE0A 1G6AA 2HDUA 3ZG5A 1MY8A 2J9OA 2WZZA 2X01A 2PU4A 1I2WA 3PBQA 3PBSA 3PBNA 4RA7A 3PBRA 4N1HA 1PZOA 1IYPA 2E8IA 4GDBA 1FCNA 3HLDA 4P87A 4U3TA 4WELA 4WYYA 4YINA 4DXCA 5EECA 1KVMA 3W4OA 1KGEA 3HLBA 4Z9QA 3WRZA 4OPYA 1K6RA 3N7WA 4E3NA 1TDLA 3O88A 1PWCA 1K57A 3UE1A 1WYCA 1XPBA 3NI9A 4RX2A 3ZHHA 1VM1A 1ES2A 3QHYA 2ZQAA 4YFMA 3IT9A 3MXSA 4BLMA 1W8YA 3GSGA 4WZ5A 5F1FA 4EUZA 3BFFA 4PMAA 2OSUA 4OPZA 3IHBA 3BECA 2OV5A 3WS0A 2JC7A 4DF6A 3ISGA 3UDFA 5GLBA 4KQQA 3VP4A 1CEFA 5GLAA 4U0XA 4R3JA 1CI9A 2EX9A 1LL5A 2HDSA 2B5RA 4R4RA 1MXOA 1YMSA 2ZM2A 3M2JA 3ZFZA 2XD1A 2EXAA 3PTEA 4K0WA 5EVIA 4JXVA 4E3LA 3UDXA 5FQMA 1LI0A 2Y2HA 4JPMA 1M6KA 2Y91A 3GV9A 5GL9A 3SH7A 4WMCA 5CECA 5HAQA 2WAEA 3V3SA 5EVIB 5FI7A 1YT4A 2WKHA 3TG9A 4JXSA 5DF9A 1BLCA 1ERMA 1H5XA 4OQ0A 3VSLA 4S2LA 1YLPA 3C4PA 1YLZA 1WE4A 4R4SA 1RGYA 3ZG9B 4RVAA 3HVFA 3A3DA 3E2LA 5FAPA 3G30A 1H8YA 1GA9A 2VGJA 4WEJA 2OLUA 4HBTA 4OQGA 2ZQ9A 4OLDA 1YMXA 5E2HA 1SKFA 3UNWA 3NCKA 5AQ9A 5F82A 4OPRA 4MEZA 1EI5A 2Z2MB 4X68A 4DKIA 3Q7ZA 4EWFA 4LCMA 1PWDA 4LV1A 3MXRA 4S2KA 5A93A 1C3BA 1L0DA 1XXMA 1YQSA 2DRWA 3PAGA 1W8QA 4B4XA 2XD5A 5GHZA 1BLHA 3ZNYA 1XGJA 5E2EA 3TOIA 3G34A 1Q2PA 3GVBA 1JWZA 4MNRA 3DW0A 3GMWA 4PM7A 2ZM8A 1K4FA 4UA9A 4OKPA 2Q9NA 2CC1A 4WZ4A 4NETA 2P74A 1E25A 1I5QA 2WK0A 2Y2GA 5FQJA 3JYIA 2ZM0A 3FKWA 3MKEA 4Y0OA 2ZC7A 4PM8A 4ZJ1A 4KZ3A 1L0FA 4X55A 3D4FA 4FCFA 3EQVA 1LI9A 3DTMA 3V3RA 1JWVA 2V1ZA 2R9XA 3E2KA 4GD8A 4E3JA 1PW1A 3AGFA 4BD1A 4C75A 1FOFA 1W5DA 5HX9A 1HVBA 4N92A 1BSGA 2HP9A 4IEDA 3VP3A 4KZAA 3HL9A 3OCLA 5EUAA 4H8RA 1Q2QA 2Y2MA 4QD4A 5KSCA 2EX6A 4KZ4A 3WRTA 1MWRA 3N4IA 3BRMA 4ZJ2A 5KSHA 4KQRA 1JVJA 1TVFA 5GLCA 4D2OA 5HARA 4BL2A 2ZMAA 3FYZA 3OPRA 3IXHA 3NDGA 4ZDXA 3HLWA 2RL3A 3VOYA 5AQBA 4E6XA 3AGEA 4UHUA 4OOLA 4OPQA 3WWXA 5IHVA 4WMCD 1ES5A 2Y59A 3HBRA 3NIAA 1KGFA 5CTNA 1K57C 2IWCA 3S22A 4BL3A 2XFTA 1FSYA 1SDEA 2HDQA 1MWSA 4S2NA 2P9VA 3M2KA 4UAAA 2Y2KA 4QY6A 1NYMA 3G2ZA 4WZ5C 4GNUA 2WKEA 3LO7A 4FD8A 4X56A 3G31A 1ONHA 2WAFA 3DWZA 3ZVTA 4DDSA 2ZD8A 4QHCA 1ESIA 2WGVA 4PM6A 1K54A 4Q8IA 2P9VB 5CHUA 1O7EA 4DRTA 2UWXA 1TDGA 4JF6A 5DF7A 5A90A 5DTSA 5AQAA 5EVIC 1JTDA 1W79A 1YLJA 2A3UA 1DY6A 3NY4A 1XX2A 4LCLA 1ALQA 4RX3A 1DJCA 3IF6A 3GR2A 3OPLA 5HAIA 2WZXA 3IH9A 1IYSA 1SCWA 4PM5A 2ZC5B 3BYDA 3Q81A 4R3BA 1DJAA 4ZBEA 4LV2A 4QY5A 4XUZA 3LY4A 5F83A 3IHAA 3VSKA 4OQHA 2OLVA 2ZC6B 3AGDA 3WS4A 1FQGA 3VOZA 3IF6B 3MFDA 3V39A 4E6WA 1NZOA 4E3KA 3SS5A 4C3QA 5A91A 1L0EA 1HD8A 1TEMA 2RCXA 4GOGA 1BZAA 4IVKA 1KDSA 2EFXA 2WUQA 4MBKA 4KG6A 1CK3A 1S0WA 3M6HA 5FQIA 3MKFA 2R9WA 5AQ7A 5JYPA 5M18A 2Y2NA 4BJPA 4CJNA 3IXGA 3UO9A 3VP1A 4S2MA 4P85A 1YM1A 4GZBA 2XLNA 5EVLA 2ZQ7A 1NY0A 5CERA 4DE1A 1K38A 4S2PA 5FQ9A 3BFGA 4RYEA 1XGIA 5FQKA 5TGFA 4EV4A 5G18A 2XFSA 4C6YA 4KG2A 5E2FA 2WGIA 3C5AA 3BFEA 4A5RA 4CPKA 4HBUA 1DJBA 1ZG4A 3A3EA 4GB7A 4DDYA 1IYQA 4M3KA 1GHMA 3UE3A 1IKIA 4JF5A 2JBFA 2H0YA 3BM6A 1KDWA 1K56D 1ZC2A 4N9KA 4OQIA 1MBLA 5FQQA 3BLSA 1KE3A 3ITBA 2XF3A 2IWBA 3SH8A 3TSGA 1M40A 5HAPA 3CG5A 1CEGA 5DTKA 4HESA 2Y55A 3LCEA 3N6IA 4ZAMA 3O3VA 4XUXA 1HTZA 3BFDA 1E3UD 1K55A 3UPOA 1FR1A 1IKGA 3FV7A 1SHVA 1YLYA 4LV0A 1G68A 1ES4A 1L0GA 4BENA 3RJUA 4OOYA 4EBLA 2HP6A 5BOHA 3C4OA 2WADA 1KE4A 3FWLA 4Y0UA 1N4OA 2PBYA 2IWDA 3SS3A 4MBHA 2C5WB 3W8KA 2ZLYA 4WEKA 1BT5A 1PI5A 5TFQA 1H8ZA 4R23A 4EBPA 3FKVA 4UA6A 1IELA 3IXBA 4S2JA 5DF8A 2EX2A 1FR6A 5FI6A 5E2GA 5CEDA 4E3OA 3P98A 5EOOA 1JTGA 2PU2A 1PIOA 1MPLA 1ZKJA 5FAOA 1MWTA 2GDNA 2XR0A 4S2NC 5FI2A 4GDNA 3M6BA 3OC2A 5CGWA 4KZ9A 5DVAA 2Y2JA 4B4ZA 4JXWA 3IWIA 4Y7PA 5DTTA 3HLEA 4JKTA 4X53A 2WGWA 2G2UA 4L0LA 4KZBA 3HUOA 5M19A 1LL9A 1K56A 1GA0A 1NJ4A 3HLFA 4X69A 1K54C 3IQAA 5FAQA 5FATA 3OPHA 3DWKA 1EWZA 2XK1A 3IWQA 1PI4A 3NC8A 2VGKA 3HLCA 4JLFA 4P0MA 4ZJ3A 1FCMA 4KZ6A 4OVDA 2WYXA 1Y54A 2WGWB 4HEFA 5F1GA 4BD0A 3I7JA 3LEZA 4KZ8A 3PAEA 2X71A 2ZQ8A 3OPPA 3Q07A 4JF4A 3NDEA 3HLGA 1XA7A 2DCFA 4GD6A 3S1YA 3C7VA 3ZVWA 1GCEA 1E3UA 1ZG6A 3GQZA 3IF6C 4P6BA 3QNCA 2HPBA 1HZOA 3FZCA 3BLMA 3P09A 1PW8A 1JWPA 1Z6FA 2ZQCA 4E3IA 1YLTA 5L2FA 2I72A 1QMEA 1ES3A 2JE5A 5CTMA 1VQQA 3WS2A 4NK3A 2J7VA 3G35A 3LY3A 3MZEA 1EROA 1K25A 3G32A 4O7DA 2EFUA 4S2IA 5CHJA 2HDRA 2Y2LA 3IWOA 3S4XA 5HL1A 1XP4A 2FFYA 4MBFA 1SDNA 3HUNA 2Y2PA 2XDMA 3ZG8B 1BLSA 1IYOA 4KG5A 4OP5A 4R1GA 1U60A 2BG1A 1FSWA 1QMFA 3EQUA 4MLLA 3VP0A 5CGXA 3W4QA 5EE8A 2HP5A 2Y2OA 3HREA 2EXBA 2ZQDA 2XGNA 2XEPA 4LENA 4KQOA 3GTCA 3QNBA 3N8LA 1KVLA 5CRFA 3SS4A 1BUEA 4XXRA 4OH0A 2XH9A 1N9BA 1OMEA 2H10A 2H5SA 2Y4AA 1RGZA 4JXGA 4QU3A 2V20A 3WS1A 1ERQA 5E43A 2QZ6A 4GKUA 1S6RA 3SH9A 3A3JA 4QB8A 3UDIA 3CZDA 4BQMA 4EBNA 5KMWA 5KZHA 1BULA 4ZTKA 3VP2A 3C7UA 4DE0A 5I94A 2XQZA 2Z2LB 5TR7A 3SOIA 1GHPA 3RXXA 5CXWA 5CEBA 1E4DA 1FCOA 3BFCA 3O86A 3G4PA 3PBTA 4WM9A 4GN2A 2ZC3B 4EQIA 1KE0A 4OP8A 1W7FA 4U0TA 3ZG0A 3ZG7B 3ZDJA 3Q7VA 4IVIA 4PM9A 2DNSA 3MZDA 4Y0TA 2JCHA 1MWUA 3VFFA 4QJGA 5FDHA 3ITAA 3ZNTA 2J8YA 3A3FA 4K0XA 3Q82A 3O87A 3VMAA 1NXYA 1MKIA 2Q9MA 2X02A 4N9LA 1WYBA 4OOMA 5HFOA 5JYOA 5GLDA 5FASA 1K55C 3OZHA 1AXBA 5D3OA 1RCJA 2WKIA 3Q7VB 1PZPA 4IBRA 4WBGA 5FSRA 5J8XA 4K91A 1O07A 4UA7A 3ZCZA 5A92A 5EPHA 2V2FF 1GHIA 4X6TA 2BLSA 2H0TA 4N1XA 4FH2A 3RXWA 3V50A 1YLWA 3UPPA 1NYYA 5FA7A 3BEBA 2A49A 4PPRA 2ZC4B 1BLPA 1BTLA 1PWGA 3UN7A 1LLBA 3NBLA 1J9MA 4R0QA 2EX8A
chains in the Genus database with same CATH superfamily
2W1TA 4DE3A 5HDSA 4MMNA 2QJ7A 1LSWA 5TJJA 2FFFB 5FEFA 3PBOA 3N8RA 3A3IA 4HIAA 1ONGA 5HDCA 4OONA 4FSFA 2ZJ9A 1ESUA 5F69A 3HUMA 1XFNA 4FH4A 4WUJA 2G2WA 3B33A 1OT9A 4IBXA 3V67A 5EOEA 1KGGA 3UB5P 2QPNA 4B88A 3OOVA 1PFLA 2M7VA 3F1PA 3PBQA 3PBSA 1JNUA 4RA7A 3UB6A 3EOIA 1IYPA 4P87A 1KGEA 3KO6A 4G3VA 3O88A 2OWHA 1PWCA 4BLMA 2KX6A 4WZ5A 5HDDA 2INWA 2OV5A 4PMAA 3WS0A 2JC7A 4DF6A 4EEUA 3UB7A 2W3GA 5F68A 4R3JA 2EX9A 2HDSA 4R4RA 1MXOA 4HHDA 2XD1A 2EXAA 2J3WA 4E3LA 1UWNX 3NHQA 3UDXA 5HD5A 3BQAA 1LI0A 2Y2HA 3DAVA 3GV9A 3MR0A 4WMCA 3T1RA 5HAQA 4NKPA 1H5XA 4OQ0A 3MQ0A 4S2LA 1WE4A 4R4SA 4NG2A 3A3DA 5FAPA 4WEJA 2OLUA 4OLDA 3LIBA 3UNWA 3NCKA 3R7WB 4GLQA 2PR6A 2Q0OA 1PWDA 3JVUA 3MXRA 4S2KA 3PAGA 1W8QA 3CUEC 5G4YA 1Q2PA 3OBFA 4PM7A 4WZ4A 4NETA 2WK0A 2ZM0A 2ZC7A 3FC7A 3D4FA 3DTMA 3V3RA 4LPZA 3E2KA 1GSWA 4NXGA 3T4LA 4EEPA 3QP2A 1W5DA 2HP9A 4KZAA 3OCLA 5EUAA 4H8RA 2Y2MA 5AVFA 3LR0A 5KSHA 3BW6A 4G3KA 2EWWA 4E04A 1IFQA 3NDGA 3HLWA 2RL3A 3VOYA 2JKFA 2WKPA 3MFXA 4I3JA 1ES5A 1XJ4A 2Y59A 4HOIA 4CLCE 5CTNA 2XFTA 2ZMFA 3LFVA 4S2NA 2P9VA 1FIKA 3M2KA 1NYMA 3G31A 4I3AA 1ONHA 2WAFA 3ZVTA 4QHCA 1ESIA 4Q0HA 1K54A 3DTKA 2G7UA 4EETB 1SKOB 1O7EA 1TDGA 4ZRRA 2QKPA 3NY4A 4LCLA 4RX3A 4ETXA 2WZXA 1YKDA 4PM5A 3F1OA 2R78A 5LBRA 4MN7A 5DFYA 3AGDA 3WS4A 1FQGA 3IF6B 2YKFA 4E6WA 1NRJA 3SS5A 5J7EA 4EQ1A 2B18A 2OAQ1 4IVKA 3MQOA 2WUQA 4KG6A 5JYPA 4GS9B 2L4RA 2Y2NA 5M18A 4CJNA 3IXGA 3VP1A 4GZBA 2XLNA 1NY0A 5CERA 4DE1A 4HNBA 5FQKA 3BJNA 5TGFA 5G18A 4KG2A 1ZG4A 3ZQ5A 1IKIA 4JF5A 2JBFA 2H0YA 1ZC2A 2OWJA 3BLSA 3TSGA 1M40A 2QWSA 5HAPA 1CEGA 5DTKA 1CF0A 2PDRA 1W63Q 3JVVA 1K55A 4HI4A 3FV7A 4LV0A 4OOYA 2HP6A 4FOFA 2WADA 3SS3A 2C5WB 2ZLYA 3FKVA 2E8JA 1PRQA 2D01A 3IXBA 4S2JA 1FR6A 5CEDA 5E2GA 3P98A 2UV0E 4Q0IA 3IS2B 1PIOA 1GSVA 4HJ3A 2Y79A 2W3EA 1S66L 4F3LA 2O99A 2XSSA 4Y7PA 3H7WA 1L3LA 2WGWA 4NXFA 2G2UA 4KZBA 3QP6A 1K56A 3E4PA 2XK1A 4Y13A 2VGKA 3HLCA 3VE4A 4ZJ3A 2WYXA 4BD0A 5IS1A 3I7JA 3DTEA 2V0WA 2X71A 2ZQ8A 3Q07A 2BTFP 4JF4A 3HLGA 1XA7A 4GD6A 3S1YA 1E3UA 1ZG6A 3IF6C 5HL6A 3C30A 4P6BA 1D7EA 3QNCA 4HH2A 3FZCA 1PW8A 1JWPA 2PT7A 3QP8A 4B9OA 4E3IA 1YLTA 3LIAA 2I72A 1ES3A 1H3QA 3WS2A 2J7VA 2GNXA 5HSQA 3TRCA 4L9GA 1K25A 3MSHA 5CHJA 2OOLA 2HDRA 4MN6A 4X25A 2BASA 4XT2A 1FILA 4BMWA 3ZG8B 3T4TA 1G6OA 4R1GA 1U60A 3VP0A 3EQUA 1QMFA 4UQIS 3OLOA 5EE8A 2Y2OA 4O0PA 1AWIA 4LENA 2XRNA 3SS4A 2MJ6A 1N9BA 2XH9A 2H5SA 1RGZA 4QU3A 2P04A 2QZ6A 1TS8A 4GKUA 3A3JA 3LR3A 3CZDA 3D9YA 1K0KA 3EGDC 4ZTKA 3VP2A 4M4XA 1FCOA 2VV8A 3KSIA 4WM9A 5MC7A 3ZG0A 3Q7VA 4LFUA 2W3FA 1HLUP 4QJGA 1UWPX 2KDKA 2X02A 1MKIA 2Q9MA 4N9LA 1WYBA 5FASA 5D3OA 5FSRA 2M1CA 4R3AA 3ZCZA 5EPHA 4X6TA 2BLSA 2H0TA 3RXWA 2V1AA 4BBUA 4PPRA 1BTLA 3TW8A 4ID4A 3CUEA 2NUPC 3Q1FA 1XA1A 4HH3A 3F1NB 5CGSA 3BY9A 1CI8A 4IHQA 1VETA 3IXDA 5L09A 3B3XA 3UY6A 1NRFA 3EEHA 2JN7A 5GHXA 3IF5A 3OCNA 3N8SA 1P9WA 4KZ5A 3VFHA 1LHYA 4UQIM 3ZGAB 1K4EA 4NEED 3A0RA 4WF0A 1NZUA 3UE0A 1Y28A 2HDUA 3ZG5A 1GSXA 2WZZA 2X01A 2PU4A 1EW0A 4Y0OA 2E8IA 4YINA 1KVMA 4GHIB 4OPYA 4LRYC 3UE1A 3NI9A 3ZHHA 1OJ5A 3KSGA 3QHYA 2HF6A 4YFMA 3MXSA 4KQDA 3BFFA 2OSUA 3BECA 2O9BA 5GLAA 1CI9A 3M2JA 3VE3A 3ZFZA 3LGOA 5FQMA 5FL3A 4NXBA 4JPMA 2Y91A 4BWIA 5CECA 2WKQA 2ZOHA 5DKLA 5EVIB 5FI7A 2WKHA 3UB8A 3R7WA 1YLPA 3C4PA 1VHMA 5EM1A 3HVFA 1N9OA 4YWZA 2VGJA 1GA9A 4HBTA 4OQGA 1YMXA 5E2HA 3P01A 2KOIA 4OPRA 4MEZA 4EWFA 5A93A 1C3BA 1XXMA 2DRWA 3UMEA 3EGXC 1MZUA 5HD3A 3TOIA 4MNRA 2ZM8A 3T1XA 2Q9NA 2VV6A 1E25A 1I5QA 5DJTA 5FQJA 5G4ZA 3FKWA 4WL9A 5HZHA 1L0FA 3EQVA 1LI9A 1JWVA 2V1ZA 3LIEA 2VV7A 2L1MA 4BD1A 1FOFA 4P6ZS 5HX9A 4IEDA 3LEQA 5HWWA 4QD4A 3GECA 1W63M 2EX6A 3B42A 4KZ4A 3N4IA 3BRMA 4KQRA 5GLCA 4D2OA 1LL8A 2Z6DA 4BL2A 2ZMAA 3FYZA 2A24B 3JPUA 4LGWA 4ZDXA 3MS6A 5AQBA 3AGEA 2PAVP 4OOLA 3WWXA 3NIAA 1KGFA 1T19A 3S22A 1VB6A 1S1YA 1MWSA 1SKOA 1V9ZA 1XFQA 3G2ZA 4GNUA 2WKEA 3DWZA 4DDSA 2WGVA 4JGQA 5CHUA 4DRTA 2UWXA 5DTSA 3EEAA 5EVIC 1W79A 2K2NA 1N9LA 2A3UA 2QJ5A 3IF6A 3GR2A 5HAIA 1SCWA 1DP8A 2ZC5B 1YAXA 4R3BA 4LV2A 3E98A 4QY5A 2GJ3A 4OQHA 1TS7A 1NZOA 4E3KA 4GS9A 2RCXA 1CJFA 1BZAA 3ZYTA 1T1AA 1WA9A 2HGVA 1S0WA 3M6HA 4P6ZM 3KYQA 5AQ7A 2K31A 4S2MA 4P85A 4PKYA 3H82B 2ZQ7A 1DRMA 1VEUB 4FTXA 1XGIA 4C6YA 3MF0A 4A5RA 5F6AA 1DJBA 3A3EA 4N9KA 1K56D 2OAP1 4OQIA 5FQQA 2VGLS 2XF3A 2HJ9C 1ZHHB 3DTIA 3LCEA 4ZAMA 5A8BA 4HP4A 4ARZB 3BFDA 1E3UD 3UPOA 1FR1A 1YLYA 1L0GA 1G68A 4EBLA 3IS2A 2IWDA 3CAXA 4DN0A 1H8ZA 1ZTUA 4UA6A 1T1BA 4EU0A 3MQQA 2PU2A 5FAOA 1MWTA 3IX8A 4MCWA 5FDSA 2XA7S 3M6BA 3OC2A 5AVEA 4X53A 1ODVA 4L0LA 5M19A 4ETZA 1NJ4A 3IQAA 1EWZA 1Y54A 1V9YA 3VOLA 3OPPA 3GQZA 1HZOA 2JKRM 3P09A 1Z6FA 2ZQCA 2VKSA 5CX7A 2JE5A 1VQQA 1S67L 2ZOIA 5TBMB 4S2IA 3FPWA 1F98A 3NULA 3QP5A 2V8FA 1SDNA 3G6OA 2H28A 4R38A 4KG5A 1IYOA 2VGLM 1YSQA 5CGXA 3W4QA 2XEPA 3GTCA 3QNBA 3BY8A 3N8LA 1BUEA 2H10A 1ERQA 5E43A 4QB8A 3UDIA 4BQMA 4WN5A 4DE0A 3SOIA 3RXXA 5CXWA 3D72A 4PM9A 4H6JB 4Y0TA 3VFFA 4X1LA 2XA7M 3A3FA 4K0XA 3HCYA 5JYOA 3T4OA 4K91A 1O07A 5A92A 1GHIA 4I3IA 4N1XA 2PD8A 1YLWA 3F1NA 1OTIA 4BBVA 3NECA 2JKTM 1BLPA 1PWGA 1J9MA 2ACGA 3D3OA 5M1AA 3P7NA 2PR5A 2Y2QA 2C6WB 3KYEA 1PNEA 4KUOA 3U2AA 3T1QB 4LV3A 1XKZA 3IH8A 5U47A 4JBFA 2Y2IA 1RP5A 2O0YA 1PYYA 4KENB 3V5MA 1I2SA 4S2OA 3IX3A 4F94A 1D1JA 4PHTA 5C5KA 1IEMA 5GHYA 3W4PA 4DE2A 4E3MA 2QMIA 3MBZA 3GRJA 2ZL1B 4CLCD 4GHIA 2O9CA 2J9OA 3PBNA 3T4SA 1FCNA 5I5LA 4WYYA 4DXCA 5EECA 3W4OA 4Z9QA 3LUQA 1K6RA 1TS0A 3S7QA 1NLYA 1WYCA 4RX2A 3CITA 5EFWA 4R70A 2ZQAA 3IT9A 3FG8A 1W8YA 3GSGA 5F1FA 4OPZA 3W2ZA 4Y5FA 5GLBA 4KQQA 3VP4A 1CEFA 3K2NA 4U0XA 2A2LA 2VJWA 1OJGA 1YMSA 2V0UA 2ZM2A 5HWVA 4GW9A 4K0WA 5EVIA 2PYRA 3PR6A 5HWTA 4JXVA 3H9WA 3IX4A 4JGOA 3SH7A 4X1MA 3QP1A 1YT4A 3TG9A 5DF9A 1BLCA 1OTDA 4GJ4A 1YLZA 1RGYA 4RVAA 3LICA 3G30A 1H8YA 3LYXA 3CLOA 2VK3A 4GCZA 5AQ9A 5F82A 2Z6CA 1EI5A 4DKIA 4LCMA 3A0SA 1OTEA 1P97A 1YQSA 3KSFA 3ZNYA 1XGJA 4EW7A 3B47A 3GMWA 4PM8A 4FUWA 3E4OA 4UEYA 2V8CA 2ZMVA 1PW1A 3AGFA 3EWKA 3PYPA 2V9AA 4N92A 2A24A 1BSGA 3VP3A 2CMNA 3WRTA 1MWRA 4ZJ2A 1TVFA 5F5YA 5HARA 4EERA 3OPRA 3IXHA 3T4JA 4E6XA 4UHUA 5IHVA 4WMCD 3MMHA 4NXEA 1ACFA 1K57C 2IWCA 1S4RA 3RTYA 1FSYA 2HDQA 3CPTB 3DBAA 4UAAA 4QY6A 2ZD8A 2YKHA 4PM6A 2KLIA 4Q8IA 4JF6A 5IT5A 4CQHA 3E0YA 1XX2A 2HZ5A 1ALQA 1DJCA 3OPLA 5HPFA 3BYDA 4ZBEA 3MJQA 3T4QA 1X0OA 4I5SA 5L07A 2O9AA 2OLVA 3VSKA 3VOZA 3MFDA 3V39A 2Y8HA 2QYBA 1YPRA 2JKRI 3H82A 3T4KA 1TEMA 4GOGA 1VEUA 2EFXA 3UB9A 4MBKA 1CK3A 2R9WA 4BJPA 4YOFA 2VX8A 1K38A 4S2PA 5FQ9A 4RYEA 4EV4A 2J3TD 5E2FA 3C5AA 4DMZA 4IJGA 4HBUA 2PD7A 4GB7A 2P08A 1IYQA 3KYZA 3UE3A 5IU1A 4ARZA 1XJ3A 4PKYG 3ITBA 2IWBA 2Y55A 1TS6A 4XUXA 1IKGA 3K3CA 1SHVA 4BENA 3FWLA 1KE4A 3VV4A 1N4OA 2PBYA 1Y4OA 4MBHA 2VLGA 1MC0A 3W8KA 1PI5A 4HJ4A 5TFQA 4EBPA 4KUKA 1LSXA 1IELA 2I9VA 1G5UA 5EOOA 5FEGA 1MPLA 1ZKJA 2GX5A 3SW1A 4HJ6A 5CGWA 4KZ9A 4LRZE 4HY8A 2Y2JA 4JXWA 5L10A 3HUOA 4MDZA 4EUVA 2JKTI 1VETB 5FATA 1STZA 3IWQA 1PI4A 3NC8A 3S7OA 4JLFA 4P0MA 1FCMA 4OVDA 3LR5A 4EESA 4HEFA 4YNRA 3ICYA 5KIZA 3NDEA 2DCFA 3ZVWA 3UMDA 5TBMA 1J3WA 3BLMA 2P7JA 5L2FA 1QMEA 2GZAA 3G35A 2FZ0A 4ESPA 3LY3A 1EROA 3S4XA 5HL1A 5K5BA 3IWOA 4O8GA 4MBFA 4K08A 1T1CA 1BLSA 2VZWA 2BG1A 1H0MA 1FSWA 4MLLA 1SZVA 2HP5A 2EXBA 2XGNA 3O5YA 5CRFA 4OH0A 1S4SA 2VA0A 1S6RA 4QPRA 4EBNA 5KMWA 4H6JA 1BULA 3HJIA 4Y15A 2Z2LB 1GHPA 2W0NA 2W3DA 5CEBA 1E4DA 3BFCA 1KE0A 2M7UA 1W7FA 4CLCB 4I38A 2QHKA 1NLZA 2JCHA 2L0WA 1MWUA 4D60A 5DJUA 1MKMA 1P0ZA 3Q82A 3O87A 3VMAA 4L9FA 1RCJA 2WKIA 4IBRA 4UA7A 3U4LP 2PBDP 4FH2A 5FA7A 2A49A 3UN7A 1LLBA 3E4QA 3NBLA 3K3DA 2EX8A 3CJMA 3G2YA 3BQ8A 2J9PA 3L9KA 4DXBA 1TD5A 2EA9A 4JGPA 2K7SA 2W1TB 4KZ7A 4Y2FA 5HW3A 2ZL1A 4LLOB 3CMZA 2PRFA 3LI9A 4OLGA 1L2SA 3MZFA 4PAUA 5EVID 3UPNA 5CHMA 3WS5A 2HJEA 1K6SA 1G6AA 1MY8A 1I2WA 2AVXA 3PBRA 4N1HA 1PZOA 4GDBA 1DP9A 3GDIA 3HLDA 4U3TA 4WELA 5KZHA 5EV0A 3HLBA 3SZTA 3WRZA 4Z1WA 3N7WA 4E3NA 1TDLA 3IBJA 1K57A 1XPBA 3F1PB 1VM1A 1ES2A 1YSPA 2EWVA 2V1BA 4EUZA 4HP9A 3IHBA 2JKGA 3ISGA 3ULFA 3UDFA 1OTAA 5AJGA 5EVEA 3LR4A 3C2WA 2W1RA 4CLCC 1LL5A 2B5RA 1LSVA 2WKRA 4B93A 3PTEA 4DJ3A 1G28A 1M6KA 5GL9A 3RH8B 3S7NA 2WAEA 3V3SA 5J4EA 1P9RA 4JXSA 1ERMA 3VSLA 3NOUC 3ZG9B 3E2LA 4BBTA 2ZQ9A 2ZBBA 1SKFA 4EXOA 4G3WA 4X68A 1CQAA 2Z2MB 3Q7ZA 4LV1A 1F9IA 1L0DA 4O01A 3KSHA 4B4XA 2FH5A 2XD5A 5GHZA 1BLHA 5E2EA 1OTBA 3G34A 3GVBA 1JWZA 1XJ2A 3DW0A 4UA9A 1K4FA 4OKPA 2CC1A 2P74A 2Y2GA 3JYIA 3NOTC 3MKEA 4ZJ1A 4KZ3A 4X55A 4FCFA 1LT0A 3S7PA 2R9XA 4GD8A 4E3JA 4C75A 2IA2A 3PXPA 1HVBA 1F2KA 3QP4A 3HL9A 1Q2QA 5KSCA 1F5MA 3LI8A 3NJAA 2XROA 3TE8A 1JVJA 1S1ZA 4II7A 3CPTA 4OPQA 3T50A 3HBRA 2PHYA 4BL3A 1OPXA 1SDEA 4IUHA 1D06A 2Y2KA 3C8CA 2B02A 4WZ5C 4Y17A 4X56A 3CHWP 3LO7A 4FD8A 1TF1A 3T1SA 2P9VB 5A90A 5DF7A 5AQAA 1JTDA 2J80A 3BWLA 1UGUA 1YLJA 3C38A 1DY6A 3CI6A 1Z09A 5DFXA 3IH9A 1IYSA 4I39A 3Q81A 1DJAA 1A0KA 4XUZA 4MN5A 3LY4A 5F83A 3IHAA 2ZC6B 5J3WA 4C3QA 3F1OB 2NUTC 3T12B 5A91A 1L0EA 1HD8A 1IOUA 1KDSA 3CWFA 5FQIA 3MKFA 3MXQA 3UO9A 1YM1A 5EVLA 3IBRA 4HQAA 3BFGA 2XFSA 2WGIA 3FPVA 3BFEA 4CPKA 4DDYA 4JGRA 4M3KA 1GHMA 3BM6A 1DP6A 4R6LA 1KDWA 1T18A 1MBLA 1KE3A 3SH8A 3HJKA 3CG5A 4HESA 3N6IA 3O3VA 2PYPA 1BYWA 1HTZA 5L8MA 5BOHA 1ES4A 3RJUA 3C4OA 4Y0UA 2LB5A 4WEKA 1BT5A 2J3TC 4R23A 5DF8A 2EX2A 5FI6A 1H8MA 4E3OA 1JTGA 2GDNA 2XR0A 4S2NC 5FI2A 4AFIA 4GDNA 5DVAA 4B4ZA 4QWOA 3IWIA 5DTTA 5HPIA 3HLEA 4JKTA 1LL9A 1GA0A 3HLFA 4X69A 1K54C 5FAQA 3OPHA 3DWKA 4F3LB 4DJ2A 3L7HA 3H7WB 4KZ6A 1KOUA 2WGWB 5F1GA 3LEZA 3PHYA 4KZ8A 3PAEA 3UE6A 3C7VA 1GCEA 2HPBA 5EM0A 5CTMA 3A0VA 4NK3A 4Y3IA 3MZEA 2JHEA 3G32A 4O7DA 2EFUA 2Y2LA 4LRXC 1XP4A 2FFYA 3HUNA 2Y2PA 2XDMA 4OP5A 3HREA 3LIDA 2ZQDA 4KQOA 1KVLA 4XT2B 4XXRA 1OMEA 2D02A 4JXGA 2Y4AA 3LIFA 1NWZA 2V20A 3WS1A 2W3HA 1OT6A 3SH9A 4Q0JA 3RFBA 4CLCA 3C7UA 5I94A 2XQZA 3NOPC 5TR7A 4IUKA 1N9NA 1XJ6A 3O86A 3G4PA 3PBTA 4GN2A 2ZC3B 3R4KA 4EQIA 4OP8A 4U0TA 3ZG7B 3ZDJA 4IVIA 2DNSA 3MZDA 5FDHA 3ITAA 3ZNTA 2LB9A 2VEAA 2J8YA 2W27A 1NXYA 4OOMA 5HFOA 4WLAA 5GLDA 1K55C 2B95A 3OZHA 3TJZC 1AXBA 3Q7VB 4WBGA 1PZPA 5J8XA 4ME4A 2DMWA 4L9EA 2V2FF 4RQ9A 2HV1A 3V50A 5DKKA 3UPPA 3KX0X 1NYYA 3BEBA 2ZC4B 4R0QA
chains in the Genus database with same CATH topology
4ID4A 4DE3A 5M1AA 3Q1FA 3CJMA 3G2YA 1XA1A 2Y2QA 2C6WB 2J9PA 5CGSA 2FFFB 4LV3A 3PBOA 1CI8A 1XKZA 4DXBA 3IH8A 5U47A 4JBFA 3N8RA 4KZ7A 3A3IA 3IXDA 2Y2IA 3B3XA 5HW3A 3UY6A 1ONGA 1RP5A 1NRFA 1PYYA 4OONA 4KENB 4FSFA 2ZJ9A 1ESUA 3V5MA 1I2SA 3HUMA 3CMZA 5GHXA 3IF5A 3OCNA 4S2OA 4FH4A 3N8SA 4OLGA 4KZ5A 3VFHA 2G2WA 4F94A 1L2SA 1LHYA 3ZGAB 3MZFA 1IEMA 4IBXA 1K4EA 5EVID 5GHYA 3W4PA 3UPNA 4DE2A 5CHMA 4E3MA 2QMIA 3WS5A 3MBZA 5EOEA 1KGGA 3GRJA 1NZUA 1K6SA 2QPNA 4B88A 3UE0A 1G6AA 2HDUA 3ZG5A 1MY8A 2J9OA 2WZZA 2X01A 2PU4A 1I2WA 3PBQA 3PBSA 3PBNA 4RA7A 3PBRA 4N1HA 1PZOA 1IYPA 2E8IA 4GDBA 1FCNA 3HLDA 4P87A 4U3TA 4WELA 4WYYA 4YINA 4DXCA 5EECA 1KVMA 3W4OA 1KGEA 3HLBA 4Z9QA 3WRZA 4OPYA 1K6RA 3N7WA 4E3NA 1TDLA 3O88A 1PWCA 1K57A 3UE1A 1WYCA 1XPBA 3NI9A 4RX2A 3ZHHA 1VM1A 1ES2A 3QHYA 2ZQAA 4YFMA 3IT9A 3MXSA 4BLMA 1W8YA 3GSGA 4WZ5A 5F1FA 4EUZA 3BFFA 4PMAA 2OSUA 4OPZA 3IHBA 3BECA 2OV5A 3WS0A 2JC7A 4DF6A 3ISGA 3UDFA 5GLBA 4KQQA 3VP4A 1CEFA 5GLAA 4U0XA 4R3JA 1CI9A 2EX9A 1LL5A 2HDSA 2B5RA 4R4RA 1MXOA 1YMSA 2ZM2A 3M2JA 3ZFZA 2XD1A 2EXAA 3PTEA 4K0WA 5EVIA 4JXVA 4E3LA 3UDXA 5FQMA 1LI0A 2Y2HA 4JPMA 1M6KA 2Y91A 3GV9A 5GL9A 3SH7A 4WMCA 5CECA 5HAQA 2WAEA 3V3SA 5EVIB 5FI7A 1YT4A 2WKHA 3TG9A 4JXSA 5DF9A 1BLCA 1ERMA 1H5XA 4OQ0A 3VSLA 4S2LA 1YLPA 3C4PA 1YLZA 1WE4A 4R4SA 1RGYA 3ZG9B 4RVAA 3HVFA 3A3DA 3E2LA 5FAPA 3G30A 1H8YA 1GA9A 2VGJA 4WEJA 2OLUA 4HBTA 4OQGA 2ZQ9A 4OLDA 1YMXA 5E2HA 1SKFA 3UNWA 3NCKA 5AQ9A 5F82A 4OPRA 4MEZA 1EI5A 2Z2MB 4X68A 4DKIA 3Q7ZA 4EWFA 4LCMA 1PWDA 4LV1A 3MXRA 4S2KA 5A93A 1C3BA 1L0DA 1XXMA 1YQSA 2DRWA 3PAGA 1W8QA 4B4XA 2XD5A 5GHZA 1BLHA 3ZNYA 1XGJA 5E2EA 3TOIA 3G34A 1Q2PA 3GVBA 1JWZA 4MNRA 3DW0A 3GMWA 4PM7A 2ZM8A 1K4FA 4UA9A 4OKPA 2Q9NA 2CC1A 4WZ4A 4NETA 2P74A 1E25A 1I5QA 2WK0A 2Y2GA 5FQJA 3JYIA 2ZM0A 3FKWA 3MKEA 4Y0OA 2ZC7A 4PM8A 4ZJ1A 4KZ3A 1L0FA 4X55A 3D4FA 4FCFA 3EQVA 1LI9A 3DTMA 3V3RA 1JWVA 2V1ZA 2R9XA 3E2KA 4GD8A 4E3JA 1PW1A 3AGFA 4BD1A 4C75A 1FOFA 1W5DA 5HX9A 1HVBA 4N92A 1BSGA 2HP9A 4IEDA 3VP3A 4KZAA 3HL9A 3OCLA 5EUAA 4H8RA 1Q2QA 2Y2MA 4QD4A 5KSCA 2EX6A 4KZ4A 3WRTA 1MWRA 3N4IA 3BRMA 4ZJ2A 5KSHA 4KQRA 1JVJA 1TVFA 5GLCA 4D2OA 5HARA 4BL2A 2ZMAA 3FYZA 3OPRA 3IXHA 3NDGA 4ZDXA 3HLWA 2RL3A 3VOYA 5AQBA 4E6XA 3AGEA 4UHUA 4OOLA 4OPQA 3WWXA 5IHVA 4WMCD 1ES5A 2Y59A 3HBRA 3NIAA 1KGFA 5CTNA 1K57C 2IWCA 3S22A 4BL3A 2XFTA 1FSYA 1SDEA 2HDQA 1MWSA 4S2NA 2P9VA 3M2KA 4UAAA 2Y2KA 4QY6A 1NYMA 3G2ZA 4WZ5C 4GNUA 2WKEA 3LO7A 4FD8A 4X56A 3G31A 1ONHA 2WAFA 3DWZA 3ZVTA 4DDSA 2ZD8A 4QHCA 1ESIA 2WGVA 4PM6A 1K54A 4Q8IA 2P9VB 5CHUA 1O7EA 4DRTA 2UWXA 1TDGA 4JF6A 5DF7A 5A90A 5DTSA 5AQAA 5EVIC 1JTDA 1W79A 1YLJA 2A3UA 1DY6A 3NY4A 1XX2A 4LCLA 1ALQA 4RX3A 1DJCA 3IF6A 3GR2A 3OPLA 5HAIA 2WZXA 3IH9A 1IYSA 1SCWA 4PM5A 2ZC5B 3BYDA 3Q81A 4R3BA 1DJAA 4ZBEA 4LV2A 4QY5A 4XUZA 3LY4A 5F83A 3IHAA 3VSKA 4OQHA 2OLVA 2ZC6B 3AGDA 3WS4A 1FQGA 3VOZA 3IF6B 3MFDA 3V39A 4E6WA 1NZOA 4E3KA 3SS5A 4C3QA 5A91A 1L0EA 1HD8A 1TEMA 2RCXA 4GOGA 1BZAA 4IVKA 1KDSA 2EFXA 2WUQA 4MBKA 4KG6A 1CK3A 1S0WA 3M6HA 5FQIA 3MKFA 2R9WA 5AQ7A 5JYPA 5M18A 2Y2NA 4BJPA 4CJNA 3IXGA 3UO9A 3VP1A 4S2MA 4P85A 1YM1A 4GZBA 2XLNA 5EVLA 2ZQ7A 1NY0A 5CERA 4DE1A 1K38A 4S2PA 5FQ9A 3BFGA 4RYEA 1XGIA 5FQKA 5TGFA 4EV4A 5G18A 2XFSA 4C6YA 4KG2A 5E2FA 2WGIA 3C5AA 3BFEA 4A5RA 4CPKA 4HBUA 1DJBA 1ZG4A 3A3EA 4GB7A 4DDYA 1IYQA 4M3KA 1GHMA 3UE3A 1IKIA 4JF5A 2JBFA 2H0YA 3BM6A 1KDWA 1K56D 1ZC2A 4N9KA 4OQIA 1MBLA 5FQQA 3BLSA 1KE3A 3ITBA 2XF3A 2IWBA 3SH8A 3TSGA 1M40A 5HAPA 3CG5A 1CEGA 5DTKA 4HESA 2Y55A 3LCEA 3N6IA 4ZAMA 3O3VA 4XUXA 1HTZA 3BFDA 1E3UD 1K55A 3UPOA 1FR1A 1IKGA 3FV7A 1SHVA 1YLYA 4LV0A 1G68A 1ES4A 1L0GA 4BENA 3RJUA 4OOYA 4EBLA 2HP6A 5BOHA 3C4OA 2WADA 1KE4A 3FWLA 4Y0UA 1N4OA 2PBYA 2IWDA 3SS3A 4MBHA 2C5WB 3W8KA 2ZLYA 4WEKA 1BT5A 1PI5A 5TFQA 1H8ZA 4R23A 4EBPA 3FKVA 4UA6A 1IELA 3IXBA 4S2JA 5DF8A 2EX2A 1FR6A 5FI6A 5E2GA 5CEDA 4E3OA 3P98A 5EOOA 1JTGA 2PU2A 1PIOA 1MPLA 1ZKJA 5FAOA 1MWTA 2GDNA 2XR0A 4S2NC 5FI2A 4GDNA 3M6BA 3OC2A 5CGWA 4KZ9A 5DVAA 2Y2JA 4B4ZA 4JXWA 3IWIA 4Y7PA 5DTTA 3HLEA 4JKTA 4X53A 2WGWA 2G2UA 4L0LA 4KZBA 3HUOA 5M19A 1LL9A 1K56A 1GA0A 1NJ4A 3HLFA 4X69A 1K54C 3IQAA 5FAQA 5FATA 3OPHA 3DWKA 1EWZA 2XK1A 3IWQA 1PI4A 3NC8A 2VGKA 3HLCA 4JLFA 4P0MA 4ZJ3A 1FCMA 4KZ6A 4OVDA 2WYXA 1Y54A 2WGWB 4HEFA 5F1GA 4BD0A 3I7JA 3LEZA 4KZ8A 3PAEA 2X71A 2ZQ8A 3OPPA 3Q07A 4JF4A 3NDEA 3HLGA 1XA7A 2DCFA 4GD6A 3S1YA 3C7VA 3ZVWA 1GCEA 1E3UA 1ZG6A 3GQZA 3IF6C 4P6BA 3QNCA 2HPBA 1HZOA 3FZCA 3BLMA 3P09A 1PW8A 1JWPA 1Z6FA 2ZQCA 4E3IA 1YLTA 5L2FA 2I72A 1QMEA 1ES3A 2JE5A 5CTMA 1VQQA 3WS2A 4NK3A 2J7VA 3G35A 3LY3A 3MZEA 1EROA 1K25A 3G32A 4O7DA 2EFUA 4S2IA 5CHJA 2HDRA 2Y2LA 3IWOA 3S4XA 5HL1A 1XP4A 2FFYA 4MBFA 1SDNA 3HUNA 2Y2PA 2XDMA 3ZG8B 1BLSA 1IYOA 4KG5A 4OP5A 4R1GA 1U60A 2BG1A 1FSWA 1QMFA 3EQUA 4MLLA 3VP0A 5CGXA 3W4QA 5EE8A 2HP5A 2Y2OA 3HREA 2EXBA 2ZQDA 2XGNA 2XEPA 4LENA 4KQOA 3GTCA 3QNBA 3N8LA 1KVLA 5CRFA 3SS4A 1BUEA 4XXRA 4OH0A 2XH9A 1N9BA 1OMEA 2H10A 2H5SA 2Y4AA 1RGZA 4JXGA 4QU3A 2V20A 3WS1A 1ERQA 5E43A 2QZ6A 4GKUA 1S6RA 3SH9A 3A3JA 4QB8A 3UDIA 3CZDA 4BQMA 4EBNA 5KMWA 5KZHA 1BULA 4ZTKA 3VP2A 3C7UA 4DE0A 5I94A 2XQZA 2Z2LB 5TR7A 3SOIA 1GHPA 3RXXA 5CXWA 5CEBA 1E4DA 1FCOA 3BFCA 3O86A 3G4PA 3PBTA 4WM9A 4GN2A 2ZC3B 4EQIA 1KE0A 4OP8A 1W7FA 4U0TA 3ZG0A 3ZG7B 3ZDJA 3Q7VA 4IVIA 4PM9A 2DNSA 3MZDA 4Y0TA 2JCHA 1MWUA 3VFFA 4QJGA 5FDHA 3ITAA 3ZNTA 2J8YA 3A3FA 4K0XA 3Q82A 3O87A 3VMAA 1NXYA 1MKIA 2Q9MA 2X02A 4N9LA 1WYBA 4OOMA 5HFOA 5JYOA 5GLDA 5FASA 1K55C 3OZHA 1AXBA 5D3OA 1RCJA 2WKIA 3Q7VB 1PZPA 4IBRA 4WBGA 5FSRA 5J8XA 4K91A 1O07A 4UA7A 3ZCZA 5A92A 5EPHA 2V2FF 1GHIA 4X6TA 2BLSA 2H0TA 4N1XA 4FH2A 3RXWA 3V50A 1YLWA 3UPPA 1NYYA 5FA7A 3BEBA 2A49A 4PPRA 2ZC4B 1BLPA 1BTLA 1PWGA 3UN7A 1LLBA 3NBLA 1J9MA 4R0QA 2EX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ID4 A;  4DE3 A;  5M1A A;  3Q1F A;  3CJM A;  3G2Y A;  1XA1 A;  2Y2Q A;  2C6W B;  2J9P A;  5CGS A;  2FFF B;  4LV3 A;  3PBO A;  1CI8 A;  1XKZ A;  4DXB A;  3IH8 A;  5U47 A;  4JBF A;  3N8R A;  4KZ7 A;  3A3I A;  3IXD A;  2Y2I A;  3B3X A;  5HW3 A;  3UY6 A;  1ONG A;  1RP5 A;  1NRF A;  1PYY A;  4OON A;  4KEN B;  4FSF A;  2ZJ9 A;  1ESU A;  3V5M A;  1I2S A;  3HUM A;  3CMZ A;  5GHX A;  3IF5 A;  3OCN A;  4S2O A;  4FH4 A;  3N8S A;  4OLG A;  4KZ5 A;  3VFH A;  2G2W A;  4F94 A;  1L2S A;  1LHY A;  3ZGA B;  3MZF A;  1IEM A;  4IBX A;  1K4E A;  5EVI D;  5GHY A;  3W4P A;  3UPN A;  4DE2 A;  5CHM A;  4E3M A;  2QMI A;  3WS5 A;  3MBZ A;  5EOE A;  1KGG A;  3GRJ A;  1NZU A;  1K6S A;  2QPN A;  4B88 A;  3UE0 A;  1G6A A;  2HDU A;  3ZG5 A;  1MY8 A;  2J9O A;  2WZZ A;  2X01 A;  2PU4 A;  1I2W A;  3PBQ A;  3PBS A;  3PBN A;  4RA7 A;  3PBR A;  4N1H A;  1PZO A;  1IYP A;  2E8I A;  4GDB A;  1FCN A;  3HLD A;  4P87 A;  4U3T A;  4WEL A;  4WYY A;  4YIN A;  4DXC A;  5EEC A;  1KVM A;  3W4O A;  1KGE A;  3HLB A;  4Z9Q A;  3WRZ A;  4OPY A;  1K6R A;  3N7W A;  4E3N A;  1TDL A;  3O88 A;  1PWC A;  1K57 A;  3UE1 A;  1WYC A;  1XPB A;  3NI9 A;  4RX2 A;  3ZHH A;  1VM1 A;  1ES2 A;  3QHY A;  2ZQA A;  4YFM A;  3IT9 A;  3MXS A;  4BLM A;  1W8Y A;  3GSG A;  4WZ5 A;  5F1F A;  4EUZ A;  3BFF A;  4PMA A;  2OSU A;  4OPZ A;  3IHB A;  3BEC A;  2OV5 A;  3WS0 A;  2JC7 A;  4DF6 A;  3ISG A;  3UDF A;  5GLB A;  4KQQ A;  3VP4 A;  1CEF A;  5GLA A;  4U0X A;  4R3J A;  1CI9 A;  2EX9 A;  1LL5 A;  2HDS A;  2B5R A;  4R4R A;  1MXO A;  1YMS A;  2ZM2 A;  3M2J A;  3ZFZ A;  2XD1 A;  2EXA A;  3PTE A;  4K0W A;  5EVI A;  4JXV A;  4E3L A;  3UDX A;  5FQM A;  1LI0 A;  2Y2H A;  4JPM A;  1M6K A;  2Y91 A;  3GV9 A;  5GL9 A;  3SH7 A;  4WMC A;  5CEC A;  5HAQ A;  2WAE A;  3V3S A;  5EVI B;  5FI7 A;  1YT4 A;  2WKH A;  3TG9 A;  4JXS A;  5DF9 A;  1BLC A;  1ERM A;  1H5X A;  4OQ0 A;  3VSL A;  4S2L A;  1YLP A;  3C4P A;  1YLZ A;  1WE4 A;  4R4S A;  1RGY A;  3ZG9 B;  4RVA A;  3HVF A;  3A3D A;  3E2L A;  5FAP A;  3G30 A;  1H8Y A;  1GA9 A;  2VGJ A;  4WEJ A;  2OLU A;  4HBT A;  4OQG A;  2ZQ9 A;  4OLD A;  1YMX A;  5E2H A;  1SKF A;  3UNW A;  3NCK A;  5AQ9 A;  5F82 A;  4OPR A;  4MEZ A;  1EI5 A;  2Z2M B;  4X68 A;  4DKI A;  3Q7Z A;  4EWF A;  4LCM A;  1PWD A;  4LV1 A;  3MXR A;  4S2K A;  5A93 A;  1C3B A;  1L0D A;  1XXM A;  1YQS A;  2DRW A;  3PAG A;  1W8Q A;  4B4X A;  2XD5 A;  5GHZ A;  1BLH A;  3ZNY A;  1XGJ A;  5E2E A;  3TOI A;  3G34 A;  1Q2P A;  3GVB A;  1JWZ A;  4MNR A;  3DW0 A;  3GMW A;  4PM7 A;  2ZM8 A;  1K4F A;  4UA9 A;  4OKP A;  2Q9N A;  2CC1 A;  4WZ4 A;  4NET A;  2P74 A;  1E25 A;  1I5Q A;  2WK0 A;  2Y2G A;  5FQJ A;  3JYI A;  2ZM0 A;  3FKW A;  3MKE A;  4Y0O A;  2ZC7 A;  4PM8 A;  4ZJ1 A;  4KZ3 A;  1L0F A;  4X55 A;  3D4F A;  4FCF A;  3EQV A;  1LI9 A;  3DTM A;  3V3R A;  1JWV A;  2V1Z A;  2R9X A;  3E2K A;  4GD8 A;  4E3J A;  1PW1 A;  3AGF A;  4BD1 A;  4C75 A;  1FOF A;  1W5D A;  5HX9 A;  1HVB A;  4N92 A;  1BSG A;  2HP9 A;  4IED A;  3VP3 A;  4KZA A;  3HL9 A;  3OCL A;  5EUA A;  4H8R A;  1Q2Q A;  2Y2M A;  4QD4 A;  5KSC A;  2EX6 A;  4KZ4 A;  3WRT A;  1MWR A;  3N4I A;  3BRM A;  4ZJ2 A;  5KSH A;  4KQR A;  1JVJ A;  1TVF A;  5GLC A;  4D2O A;  5HAR A;  4BL2 A;  2ZMA A;  3FYZ A;  3OPR A;  3IXH A;  3NDG A;  4ZDX A;  3HLW A;  2RL3 A;  3VOY A;  5AQB A;  4E6X A;  3AGE A;  4UHU A;  4OOL A;  4OPQ A;  3WWX A;  5IHV A;  4WMC D;  1ES5 A;  2Y59 A;  3HBR A;  3NIA A;  1KGF A;  5CTN A;  1K57 C;  2IWC A;  3S22 A;  4BL3 A;  2XFT A;  1FSY A;  1SDE A;  2HDQ A;  1MWS A;  4S2N A;  2P9V A;  3M2K A;  4UAA A;  2Y2K A;  4QY6 A;  1NYM A;  3G2Z A;  4WZ5 C;  4GNU A;  2WKE A;  3LO7 A;  4FD8 A;  4X56 A;  3G31 A;  1ONH A;  2WAF A;  3DWZ A;  3ZVT A;  4DDS A;  2ZD8 A;  4QHC A;  1ESI A;  2WGV A;  4PM6 A;  1K54 A;  4Q8I A;  2P9V B;  5CHU A;  1O7E A;  4DRT A;  2UWX A;  1TDG A;  4JF6 A;  5DF7 A;  5A90 A;  5DTS A;  5AQA A;  5EVI C;  1JTD A;  1W79 A;  1YLJ A;  2A3U A;  1DY6 A;  3NY4 A;  1XX2 A;  4LCL A;  1ALQ A;  4RX3 A;  1DJC A;  3IF6 A;  3GR2 A;  3OPL A;  5HAI A;  2WZX A;  3IH9 A;  1IYS A;  1SCW A;  4PM5 A;  2ZC5 B;  3BYD A;  3Q81 A;  4R3B A;  1DJA A;  4ZBE A;  4LV2 A;  4QY5 A;  4XUZ A;  3LY4 A;  5F83 A;  3IHA A;  3VSK A;  4OQH A;  2OLV A;  2ZC6 B;  3AGD A;  3WS4 A;  1FQG A;  3VOZ A;  3IF6 B;  3MFD A;  3V39 A;  4E6W A;  1NZO A;  4E3K A;  3SS5 A;  4C3Q A;  5A91 A;  1L0E A;  1HD8 A;  1TEM A;  2RCX A;  4GOG A;  1BZA A;  4IVK A;  1KDS A;  2EFX A;  2WUQ A;  4MBK A;  4KG6 A;  1CK3 A;  1S0W A;  3M6H A;  5FQI A;  3MKF A;  2R9W A;  5AQ7 A;  5JYP A;  5M18 A;  2Y2N A;  4BJP A;  4CJN A;  3IXG A;  3UO9 A;  3VP1 A;  4S2M A;  4P85 A;  1YM1 A;  4GZB A;  2XLN A;  5EVL A;  2ZQ7 A;  1NY0 A;  5CER A;  4DE1 A;  1K38 A;  4S2P A;  5FQ9 A;  3BFG A;  4RYE A;  1XGI A;  5FQK A;  5TGF A;  4EV4 A;  5G18 A;  2XFS A;  4C6Y A;  4KG2 A;  5E2F A;  2WGI A;  3C5A A;  3BFE A;  4A5R A;  4CPK A;  4HBU A;  1DJB A;  1ZG4 A;  3A3E A;  4GB7 A;  4DDY A;  1IYQ A;  4M3K A;  1GHM A;  3UE3 A;  1IKI A;  4JF5 A;  2JBF A;  2H0Y A;  3BM6 A;  1KDW A;  1K56 D;  1ZC2 A;  4N9K A;  4OQI A;  1MBL A;  5FQQ A;  3BLS A;  1KE3 A;  3ITB A;  2XF3 A;  2IWB A;  3SH8 A;  3TSG A;  1M40 A;  5HAP A;  3CG5 A;  1CEG A;  5DTK A;  4HES A;  2Y55 A;  3LCE A;  3N6I A;  4ZAM A;  3O3V A;  4XUX A;  1HTZ A;  3BFD A;  1E3U D;  1K55 A;  3UPO A;  1FR1 A;  1IKG A;  3FV7 A;  1SHV A;  1YLY A;  4LV0 A;  1G68 A;  1ES4 A;  1L0G A;  4BEN A;  3RJU A;  4OOY A;  4EBL A;  2HP6 A;  5BOH A;  3C4O A;  2WAD A;  1KE4 A;  3FWL A;  4Y0U A;  1N4O A;  2PBY A;  2IWD A;  3SS3 A;  4MBH A;  2C5W B;  3W8K A;  2ZLY A;  4WEK A;  1BT5 A;  1PI5 A;  5TFQ A;  1H8Z A;  4R23 A;  4EBP A;  3FKV A;  4UA6 A;  1IEL A;  3IXB A;  4S2J A;  5DF8 A;  2EX2 A;  1FR6 A;  5FI6 A;  5E2G A;  5CED A;  4E3O A;  3P98 A;  5EOO A;  1JTG A;  2PU2 A;  1PIO A;  1MPL A;  1ZKJ A;  5FAO A;  1MWT A;  2GDN A;  2XR0 A;  4S2N C;  5FI2 A;  4GDN A;  3M6B A;  3OC2 A;  5CGW A;  4KZ9 A;  5DVA A;  2Y2J A;  4B4Z A;  4JXW A;  3IWI A;  4Y7P A;  5DTT A;  3HLE A;  4JKT A;  4X53 A;  2WGW A;  2G2U A;  4L0L A;  4KZB A;  3HUO A;  5M19 A;  1LL9 A;  1K56 A;  1GA0 A;  1NJ4 A;  3HLF A;  4X69 A;  1K54 C;  3IQA A;  5FAQ A;  5FAT A;  3OPH A;  3DWK A;  1EWZ A;  2XK1 A;  3IWQ A;  1PI4 A;  3NC8 A;  2VGK A;  3HLC A;  4JLF A;  4P0M A;  4ZJ3 A;  1FCM A;  4KZ6 A;  4OVD A;  2WYX A;  1Y54 A;  2WGW B;  4HEF A;  5F1G A;  4BD0 A;  3I7J A;  3LEZ A;  4KZ8 A;  3PAE A;  2X71 A;  2ZQ8 A;  3OPP A;  3Q07 A;  4JF4 A;  3NDE A;  3HLG A;  1XA7 A;  2DCF A;  4GD6 A;  3S1Y A;  3C7V A;  3ZVW A;  1GCE A;  1E3U A;  1ZG6 A;  3GQZ A;  3IF6 C;  4P6B A;  3QNC A;  2HPB A;  1HZO A;  3FZC A;  3BLM A;  3P09 A;  1PW8 A;  1JWP A;  1Z6F A;  2ZQC A;  4E3I A;  1YLT A;  5L2F A;  2I72 A;  1QME A;  1ES3 A;  2JE5 A;  5CTM A;  1VQQ A;  3WS2 A;  4NK3 A;  2J7V A;  3G35 A;  3LY3 A;  3MZE A;  1ERO A;  1K25 A;  3G32 A;  4O7D A;  2EFU A;  4S2I A;  5CHJ A;  2HDR A;  2Y2L A;  3IWO A;  3S4X A;  5HL1 A;  1XP4 A;  2FFY A;  4MBF A;  1SDN A;  3HUN A;  2Y2P A;  2XDM A;  3ZG8 B;  1BLS A;  1IYO A;  4KG5 A;  4OP5 A;  4R1G A;  1U60 A;  2BG1 A;  1FSW A;  1QMF A;  3EQU A;  4MLL A;  3VP0 A;  5CGX A;  3W4Q A;  5EE8 A;  2HP5 A;  2Y2O A;  3HRE A;  2EXB A;  2ZQD A;  2XGN A;  2XEP A;  4LEN A;  4KQO A;  3GTC A;  3QNB A;  3N8L A;  1KVL A;  5CRF A;  3SS4 A;  1BUE A;  4XXR A;  4OH0 A;  2XH9 A;  1N9B A;  1OME A;  2H10 A;  2H5S A;  2Y4A A;  1RGZ A;  4JXG A;  4QU3 A;  2V20 A;  3WS1 A;  1ERQ A;  5E43 A;  2QZ6 A;  4GKU A;  1S6R A;  3SH9 A;  3A3J A;  4QB8 A;  3UDI A;  3CZD A;  4BQM A;  4EBN A;  5KMW A;  5KZH A;  1BUL A;  4ZTK A;  3VP2 A;  3C7U A;  4DE0 A;  5I94 A;  2XQZ A;  2Z2L B;  5TR7 A;  3SOI A;  1GHP A;  3RXX A;  5CXW A;  5CEB A;  1E4D A;  1FCO A;  3BFC A;  3O86 A;  3G4P A;  3PBT A;  4WM9 A;  4GN2 A;  2ZC3 B;  4EQI A;  1KE0 A;  4OP8 A;  1W7F A;  4U0T A;  3ZG0 A;  3ZG7 B;  3ZDJ A;  3Q7V A;  4IVI A;  4PM9 A;  2DNS A;  3MZD A;  4Y0T A;  2JCH A;  1MWU A;  3VFF A;  4QJG A;  5FDH A;  3ITA A;  3ZNT A;  2J8Y A;  3A3F A;  4K0X A;  3Q82 A;  3O87 A;  3VMA A;  1NXY A;  1MKI A;  2Q9M A;  2X02 A;  4N9L A;  1WYB A;  4OOM A;  5HFO A;  5JYO A;  5GLD A;  5FAS A;  1K55 C;  3OZH A;  1AXB A;  5D3O A;  1RCJ A;  2WKI A;  3Q7V B;  1PZP A;  4IBR A;  4WBG A;  5FSR A;  5J8X A;  4K91 A;  1O07 A;  4UA7 A;  3ZCZ A;  5A92 A;  5EPH A;  2V2F F;  1GHI A;  4X6T A;  2BLS A;  2H0T A;  4N1X A;  4FH2 A;  3RXW A;  3V50 A;  1YLW A;  3UPP A;  1NYY A;  5FA7 A;  3BEB A;  2A49 A;  4PPR A;  2ZC4 B;  1BLP A;  1BTL A;  1PWG A;  3UN7 A;  1LLB A;  3NBL A;  1J9M A;  4R0Q A;  2EX8 A; 
#chains in the Genus database with same CATH topology
 2W1T A;  4DE3 A;  5HDS A;  4MMN A;  2QJ7 A;  1LSW A;  5TJJ A;  2FFF B;  5FEF A;  3PBO A;  3N8R A;  3A3I A;  4HIA A;  1ONG A;  5HDC A;  4OON A;  4FSF A;  2ZJ9 A;  1ESU A;  5F69 A;  3HUM A;  1XFN A;  4FH4 A;  4WUJ A;  2G2W A;  3B33 A;  1OT9 A;  4IBX A;  3V67 A;  5EOE A;  1KGG A;  3UB5 P;  2QPN A;  4B88 A;  3OOV A;  1PFL A;  2M7V A;  3F1P A;  3PBQ A;  3PBS A;  1JNU A;  4RA7 A;  3UB6 A;  3EOI A;  1IYP A;  4P87 A;  1KGE A;  3KO6 A;  4G3V A;  3O88 A;  2OWH A;  1PWC A;  4BLM A;  2KX6 A;  4WZ5 A;  5HDD A;  2INW A;  2OV5 A;  4PMA A;  3WS0 A;  2JC7 A;  4DF6 A;  4EEU A;  3UB7 A;  2W3G A;  5F68 A;  4R3J A;  2EX9 A;  2HDS A;  4R4R A;  1MXO A;  4HHD A;  2XD1 A;  2EXA A;  2J3W A;  4E3L A;  1UWN X;  3NHQ A;  3UDX A;  5HD5 A;  3BQA A;  1LI0 A;  2Y2H A;  3DAV A;  3GV9 A;  3MR0 A;  4WMC A;  3T1R A;  5HAQ A;  4NKP A;  1H5X A;  4OQ0 A;  3MQ0 A;  4S2L A;  1WE4 A;  4R4S A;  4NG2 A;  3A3D A;  5FAP A;  4WEJ A;  2OLU A;  4OLD A;  3LIB A;  3UNW A;  3NCK A;  3R7W B;  4GLQ A;  2PR6 A;  2Q0O A;  1PWD A;  3JVU A;  3MXR A;  4S2K A;  3PAG A;  1W8Q A;  3CUE C;  5G4Y A;  1Q2P A;  3OBF A;  4PM7 A;  4WZ4 A;  4NET A;  2WK0 A;  2ZM0 A;  2ZC7 A;  3FC7 A;  3D4F A;  3DTM A;  3V3R A;  4LPZ A;  3E2K A;  1GSW A;  4NXG A;  3T4L A;  4EEP A;  3QP2 A;  1W5D A;  2HP9 A;  4KZA A;  3OCL A;  5EUA A;  4H8R A;  2Y2M A;  5AVF A;  3LR0 A;  5KSH A;  3BW6 A;  4G3K A;  2EWW A;  4E04 A;  1IFQ A;  3NDG A;  3HLW A;  2RL3 A;  3VOY A;  2JKF A;  2WKP A;  3MFX A;  4I3J A;  1ES5 A;  1XJ4 A;  2Y59 A;  4HOI A;  4CLC E;  5CTN A;  2XFT A;  2ZMF A;  3LFV A;  4S2N A;  2P9V A;  1FIK A;  3M2K A;  1NYM A;  3G31 A;  4I3A A;  1ONH A;  2WAF A;  3ZVT A;  4QHC A;  1ESI A;  4Q0H A;  1K54 A;  3DTK A;  2G7U A;  4EET B;  1SKO B;  1O7E A;  1TDG A;  4ZRR A;  2QKP A;  3NY4 A;  4LCL A;  4RX3 A;  4ETX A;  2WZX A;  1YKD A;  4PM5 A;  3F1O A;  2R78 A;  5LBR A;  4MN7 A;  5DFY A;  3AGD A;  3WS4 A;  1FQG A;  3IF6 B;  2YKF A;  4E6W A;  1NRJ A;  3SS5 A;  5J7E A;  4EQ1 A;  2B18 A;  2OAQ 1;  4IVK A;  3MQO A;  2WUQ A;  4KG6 A;  5JYP A;  4GS9 B;  2L4R A;  2Y2N A;  5M18 A;  4CJN A;  3IXG A;  3VP1 A;  4GZB A;  2XLN A;  1NY0 A;  5CER A;  4DE1 A;  4HNB A;  5FQK A;  3BJN A;  5TGF A;  5G18 A;  4KG2 A;  1ZG4 A;  3ZQ5 A;  1IKI A;  4JF5 A;  2JBF A;  2H0Y A;  1ZC2 A;  2OWJ A;  3BLS A;  3TSG A;  1M40 A;  2QWS A;  5HAP A;  1CEG A;  5DTK A;  1CF0 A;  2PDR A;  1W63 Q;  3JVV A;  1K55 A;  4HI4 A;  3FV7 A;  4LV0 A;  4OOY A;  2HP6 A;  4FOF A;  2WAD A;  3SS3 A;  2C5W B;  2ZLY A;  3FKV A;  2E8J A;  1PRQ A;  2D01 A;  3IXB A;  4S2J A;  1FR6 A;  5CED A;  5E2G A;  3P98 A;  2UV0 E;  4Q0I A;  3IS2 B;  1PIO A;  1GSV A;  4HJ3 A;  2Y79 A;  2W3E A;  1S66 L;  4F3L A;  2O99 A;  2XSS A;  4Y7P A;  3H7W A;  1L3L A;  2WGW A;  4NXF A;  2G2U A;  4KZB A;  3QP6 A;  1K56 A;  3E4P A;  2XK1 A;  4Y13 A;  2VGK A;  3HLC A;  3VE4 A;  4ZJ3 A;  2WYX A;  4BD0 A;  5IS1 A;  3I7J A;  3DTE A;  2V0W A;  2X71 A;  2ZQ8 A;  3Q07 A;  2BTF P;  4JF4 A;  3HLG A;  1XA7 A;  4GD6 A;  3S1Y A;  1E3U A;  1ZG6 A;  3IF6 C;  5HL6 A;  3C30 A;  4P6B A;  1D7E A;  3QNC A;  4HH2 A;  3FZC A;  1PW8 A;  1JWP A;  2PT7 A;  3QP8 A;  4B9O A;  4E3I A;  1YLT A;  3LIA A;  2I72 A;  1ES3 A;  1H3Q A;  3WS2 A;  2J7V A;  2GNX A;  5HSQ A;  3TRC A;  4L9G A;  1K25 A;  3MSH A;  5CHJ A;  2OOL A;  2HDR A;  4MN6 A;  4X25 A;  2BAS A;  4XT2 A;  1FIL A;  4BMW A;  3ZG8 B;  3T4T A;  1G6O A;  4R1G A;  1U60 A;  3VP0 A;  3EQU A;  1QMF A;  4UQI S;  3OLO A;  5EE8 A;  2Y2O A;  4O0P A;  1AWI A;  4LEN A;  2XRN A;  3SS4 A;  2MJ6 A;  1N9B A;  2XH9 A;  2H5S A;  1RGZ A;  4QU3 A;  2P04 A;  2QZ6 A;  1TS8 A;  4GKU A;  3A3J A;  3LR3 A;  3CZD A;  3D9Y A;  1K0K A;  3EGD C;  4ZTK A;  3VP2 A;  4M4X A;  1FCO A;  2VV8 A;  3KSI A;  4WM9 A;  5MC7 A;  3ZG0 A;  3Q7V A;  4LFU A;  2W3F A;  1HLU P;  4QJG A;  1UWP X;  2KDK A;  2X02 A;  1MKI A;  2Q9M A;  4N9L A;  1WYB A;  5FAS A;  5D3O A;  5FSR A;  2M1C A;  4R3A A;  3ZCZ A;  5EPH A;  4X6T A;  2BLS A;  2H0T A;  3RXW A;  2V1A A;  4BBU A;  4PPR A;  1BTL A;  3TW8 A;  4ID4 A;  3CUE A;  2NUP C;  3Q1F A;  1XA1 A;  4HH3 A;  3F1N B;  5CGS A;  3BY9 A;  1CI8 A;  4IHQ A;  1VET A;  3IXD A;  5L09 A;  3B3X A;  3UY6 A;  1NRF A;  3EEH A;  2JN7 A;  5GHX A;  3IF5 A;  3OCN A;  3N8S A;  1P9W A;  4KZ5 A;  3VFH A;  1LHY A;  4UQI M;  3ZGA B;  1K4E A;  4NEE D;  3A0R A;  4WF0 A;  1NZU A;  3UE0 A;  1Y28 A;  2HDU A;  3ZG5 A;  1GSX A;  2WZZ A;  2X01 A;  2PU4 A;  1EW0 A;  4Y0O A;  2E8I A;  4YIN A;  1KVM A;  4GHI B;  4OPY A;  4LRY C;  3UE1 A;  3NI9 A;  3ZHH A;  1OJ5 A;  3KSG A;  3QHY A;  2HF6 A;  4YFM A;  3MXS A;  4KQD A;  3BFF A;  2OSU A;  3BEC A;  2O9B A;  5GLA A;  1CI9 A;  3M2J A;  3VE3 A;  3ZFZ A;  3LGO A;  5FQM A;  5FL3 A;  4NXB A;  4JPM A;  2Y91 A;  4BWI A;  5CEC A;  2WKQ A;  2ZOH A;  5DKL A;  5EVI B;  5FI7 A;  2WKH A;  3UB8 A;  3R7W A;  1YLP A;  3C4P A;  1VHM A;  5EM1 A;  3HVF A;  1N9O A;  4YWZ A;  2VGJ A;  1GA9 A;  4HBT A;  4OQG A;  1YMX A;  5E2H A;  3P01 A;  2KOI A;  4OPR A;  4MEZ A;  4EWF A;  5A93 A;  1C3B A;  1XXM A;  2DRW A;  3UME A;  3EGX C;  1MZU A;  5HD3 A;  3TOI A;  4MNR A;  2ZM8 A;  3T1X A;  2Q9N A;  2VV6 A;  1E25 A;  1I5Q A;  5DJT A;  5FQJ A;  5G4Z A;  3FKW A;  4WL9 A;  5HZH A;  1L0F A;  3EQV A;  1LI9 A;  1JWV A;  2V1Z A;  3LIE A;  2VV7 A;  2L1M A;  4BD1 A;  1FOF A;  4P6Z S;  5HX9 A;  4IED A;  3LEQ A;  5HWW A;  4QD4 A;  3GEC A;  1W63 M;  2EX6 A;  3B42 A;  4KZ4 A;  3N4I A;  3BRM A;  4KQR A;  5GLC A;  4D2O A;  1LL8 A;  2Z6D A;  4BL2 A;  2ZMA A;  3FYZ A;  2A24 B;  3JPU A;  4LGW A;  4ZDX A;  3MS6 A;  5AQB A;  3AGE A;  2PAV P;  4OOL A;  3WWX A;  3NIA A;  1KGF A;  1T19 A;  3S22 A;  1VB6 A;  1S1Y A;  1MWS A;  1SKO A;  1V9Z A;  1XFQ A;  3G2Z A;  4GNU A;  2WKE A;  3DWZ A;  4DDS A;  2WGV A;  4JGQ A;  5CHU A;  4DRT A;  2UWX A;  5DTS A;  3EEA A;  5EVI C;  1W79 A;  2K2N A;  1N9L A;  2A3U A;  2QJ5 A;  3IF6 A;  3GR2 A;  5HAI A;  1SCW A;  1DP8 A;  2ZC5 B;  1YAX A;  4R3B A;  4LV2 A;  3E98 A;  4QY5 A;  2GJ3 A;  4OQH A;  1TS7 A;  1NZO A;  4E3K A;  4GS9 A;  2RCX A;  1CJF A;  1BZA A;  3ZYT A;  1T1A A;  1WA9 A;  2HGV A;  1S0W A;  3M6H A;  4P6Z M;  3KYQ A;  5AQ7 A;  2K31 A;  4S2M A;  4P85 A;  4PKY A;  3H82 B;  2ZQ7 A;  1DRM A;  1VEU B;  4FTX A;  1XGI A;  4C6Y A;  3MF0 A;  4A5R A;  5F6A A;  1DJB A;  3A3E A;  4N9K A;  1K56 D;  2OAP 1;  4OQI A;  5FQQ A;  2VGL S;  2XF3 A;  2HJ9 C;  1ZHH B;  3DTI A;  3LCE A;  4ZAM A;  5A8B A;  4HP4 A;  4ARZ B;  3BFD A;  1E3U D;  3UPO A;  1FR1 A;  1YLY A;  1L0G A;  1G68 A;  4EBL A;  3IS2 A;  2IWD A;  3CAX A;  4DN0 A;  1H8Z A;  1ZTU A;  4UA6 A;  1T1B A;  4EU0 A;  3MQQ A;  2PU2 A;  5FAO A;  1MWT A;  3IX8 A;  4MCW A;  5FDS A;  2XA7 S;  3M6B A;  3OC2 A;  5AVE A;  4X53 A;  1ODV A;  4L0L A;  5M19 A;  4ETZ A;  1NJ4 A;  3IQA A;  1EWZ A;  1Y54 A;  1V9Y A;  3VOL A;  3OPP A;  3GQZ A;  1HZO A;  2JKR M;  3P09 A;  1Z6F A;  2ZQC A;  2VKS A;  5CX7 A;  2JE5 A;  1VQQ A;  1S67 L;  2ZOI A;  5TBM B;  4S2I A;  3FPW A;  1F98 A;  3NUL A;  3QP5 A;  2V8F A;  1SDN A;  3G6O A;  2H28 A;  4R38 A;  4KG5 A;  1IYO A;  2VGL M;  1YSQ A;  5CGX A;  3W4Q A;  2XEP A;  3GTC A;  3QNB A;  3BY8 A;  3N8L A;  1BUE A;  2H10 A;  1ERQ A;  5E43 A;  4QB8 A;  3UDI A;  4BQM A;  4WN5 A;  4DE0 A;  3SOI A;  3RXX A;  5CXW A;  3D72 A;  4PM9 A;  4H6J B;  4Y0T A;  3VFF A;  4X1L A;  2XA7 M;  3A3F A;  4K0X A;  3HCY A;  5JYO A;  3T4O A;  4K91 A;  1O07 A;  5A92 A;  1GHI A;  4I3I A;  4N1X A;  2PD8 A;  1YLW A;  3F1N A;  1OTI A;  4BBV A;  3NEC A;  2JKT M;  1BLP A;  1PWG A;  1J9M A;  2ACG A;  3D3O A;  5M1A A;  3P7N A;  2PR5 A;  2Y2Q A;  2C6W B;  3KYE A;  1PNE A;  4KUO A;  3U2A A;  3T1Q B;  4LV3 A;  1XKZ A;  3IH8 A;  5U47 A;  4JBF A;  2Y2I A;  1RP5 A;  2O0Y A;  1PYY A;  4KEN B;  3V5M A;  1I2S A;  4S2O A;  3IX3 A;  4F94 A;  1D1J A;  4PHT A;  5C5K A;  1IEM A;  5GHY A;  3W4P A;  4DE2 A;  4E3M A;  2QMI A;  3MBZ A;  3GRJ A;  2ZL1 B;  4CLC D;  4GHI A;  2O9C A;  2J9O A;  3PBN A;  3T4S A;  1FCN A;  5I5L A;  4WYY A;  4DXC A;  5EEC A;  3W4O A;  4Z9Q A;  3LUQ A;  1K6R A;  1TS0 A;  3S7Q A;  1NLY A;  1WYC A;  4RX2 A;  3CIT A;  5EFW A;  4R70 A;  2ZQA A;  3IT9 A;  3FG8 A;  1W8Y A;  3GSG A;  5F1F A;  4OPZ A;  3W2Z A;  4Y5F A;  5GLB A;  4KQQ A;  3VP4 A;  1CEF A;  3K2N A;  4U0X A;  2A2L A;  2VJW A;  1OJG A;  1YMS A;  2V0U A;  2ZM2 A;  5HWV A;  4GW9 A;  4K0W A;  5EVI A;  2PYR A;  3PR6 A;  5HWT A;  4JXV A;  3H9W A;  3IX4 A;  4JGO A;  3SH7 A;  4X1M A;  3QP1 A;  1YT4 A;  3TG9 A;  5DF9 A;  1BLC A;  1OTD A;  4GJ4 A;  1YLZ A;  1RGY A;  4RVA A;  3LIC A;  3G30 A;  1H8Y A;  3LYX A;  3CLO A;  2VK3 A;  4GCZ A;  5AQ9 A;  5F82 A;  2Z6C A;  1EI5 A;  4DKI A;  4LCM A;  3A0S A;  1OTE A;  1P97 A;  1YQS A;  3KSF A;  3ZNY A;  1XGJ A;  4EW7 A;  3B47 A;  3GMW A;  4PM8 A;  4FUW A;  3E4O A;  4UEY A;  2V8C A;  2ZMV A;  1PW1 A;  3AGF A;  3EWK A;  3PYP A;  2V9A A;  4N92 A;  2A24 A;  1BSG A;  3VP3 A;  2CMN A;  3WRT A;  1MWR A;  4ZJ2 A;  1TVF A;  5F5Y A;  5HAR A;  4EER A;  3OPR A;  3IXH A;  3T4J A;  4E6X A;  4UHU A;  5IHV A;  4WMC D;  3MMH A;  4NXE A;  1ACF A;  1K57 C;  2IWC A;  1S4R A;  3RTY A;  1FSY A;  2HDQ A;  3CPT B;  3DBA A;  4UAA A;  4QY6 A;  2ZD8 A;  2YKH A;  4PM6 A;  2KLI A;  4Q8I A;  4JF6 A;  5IT5 A;  4CQH A;  3E0Y A;  1XX2 A;  2HZ5 A;  1ALQ A;  1DJC A;  3OPL A;  5HPF A;  3BYD A;  4ZBE A;  3MJQ A;  3T4Q A;  1X0O A;  4I5S A;  5L07 A;  2O9A A;  2OLV A;  3VSK A;  3VOZ A;  3MFD A;  3V39 A;  2Y8H A;  2QYB A;  1YPR A;  2JKR I;  3H82 A;  3T4K A;  1TEM A;  4GOG A;  1VEU A;  2EFX A;  3UB9 A;  4MBK A;  1CK3 A;  2R9W A;  4BJP A;  4YOF A;  2VX8 A;  1K38 A;  4S2P A;  5FQ9 A;  4RYE A;  4EV4 A;  2J3T D;  5E2F A;  3C5A A;  4DMZ A;  4IJG A;  4HBU A;  2PD7 A;  4GB7 A;  2P08 A;  1IYQ A;  3KYZ A;  3UE3 A;  5IU1 A;  4ARZ A;  1XJ3 A;  4PKY G;  3ITB A;  2IWB A;  2Y55 A;  1TS6 A;  4XUX A;  1IKG A;  3K3C A;  1SHV A;  4BEN A;  3FWL A;  1KE4 A;  3VV4 A;  1N4O A;  2PBY A;  1Y4O A;  4MBH A;  2VLG A;  1MC0 A;  3W8K A;  1PI5 A;  4HJ4 A;  5TFQ A;  4EBP A;  4KUK A;  1LSX A;  1IEL A;  2I9V A;  1G5U A;  5EOO A;  5FEG A;  1MPL A;  1ZKJ A;  2GX5 A;  3SW1 A;  4HJ6 A;  5CGW A;  4KZ9 A;  4LRZ E;  4HY8 A;  2Y2J A;  4JXW A;  5L10 A;  3HUO A;  4MDZ A;  4EUV A;  2JKT I;  1VET B;  5FAT A;  1STZ A;  3IWQ A;  1PI4 A;  3NC8 A;  3S7O A;  4JLF A;  4P0M A;  1FCM A;  4OVD A;  3LR5 A;  4EES A;  4HEF A;  4YNR A;  3ICY A;  5KIZ A;  3NDE A;  2DCF A;  3ZVW A;  3UMD A;  5TBM A;  1J3W A;  3BLM A;  2P7J A;  5L2F A;  1QME A;  2GZA A;  3G35 A;  2FZ0 A;  4ESP A;  3LY3 A;  1ERO A;  3S4X A;  5HL1 A;  5K5B A;  3IWO A;  4O8G A;  4MBF A;  4K08 A;  1T1C A;  1BLS A;  2VZW A;  2BG1 A;  1H0M A;  1FSW A;  4MLL A;  1SZV A;  2HP5 A;  2EXB A;  2XGN A;  3O5Y A;  5CRF A;  4OH0 A;  1S4S A;  2VA0 A;  1S6R A;  4QPR A;  4EBN A;  5KMW A;  4H6J A;  1BUL A;  3HJI A;  4Y15 A;  2Z2L B;  1GHP A;  2W0N A;  2W3D A;  5CEB A;  1E4D A;  3BFC A;  1KE0 A;  2M7U A;  1W7F A;  4CLC B;  4I38 A;  2QHK A;  1NLZ A;  2JCH A;  2L0W A;  1MWU A;  4D60 A;  5DJU A;  1MKM A;  1P0Z A;  3Q82 A;  3O87 A;  3VMA A;  4L9F A;  1RCJ A;  2WKI A;  4IBR A;  4UA7 A;  3U4L P;  2PBD P;  4FH2 A;  5FA7 A;  2A49 A;  3UN7 A;  1LLB A;  3E4Q A;  3NBL A;  3K3D A;  2EX8 A;  3CJM A;  3G2Y A;  3BQ8 A;  2J9P A;  3L9K A;  4DXB A;  1TD5 A;  2EA9 A;  4JGP A;  2K7S A;  2W1T B;  4KZ7 A;  4Y2F A;  5HW3 A;  2ZL1 A;  4LLO B;  3CMZ A;  2PRF A;  3LI9 A;  4OLG A;  1L2S A;  3MZF A;  4PAU A;  5EVI D;  3UPN A;  5CHM A;  3WS5 A;  2HJE A;  1K6S A;  1G6A A;  1MY8 A;  1I2W A;  2AVX A;  3PBR A;  4N1H A;  1PZO A;  4GDB A;  1DP9 A;  3GDI A;  3HLD A;  4U3T A;  4WEL A;  5KZH A;  5EV0 A;  3HLB A;  3SZT A;  3WRZ A;  4Z1W A;  3N7W A;  4E3N A;  1TDL A;  3IBJ A;  1K57 A;  1XPB A;  3F1P B;  1VM1 A;  1ES2 A;  1YSP A;  2EWV A;  2V1B A;  4EUZ A;  4HP9 A;  3IHB A;  2JKG A;  3ISG A;  3ULF A;  3UDF A;  1OTA A;  5AJG A;  5EVE A;  3LR4 A;  3C2W A;  2W1R A;  4CLC C;  1LL5 A;  2B5R A;  1LSV A;  2WKR A;  4B93 A;  3PTE A;  4DJ3 A;  1G28 A;  1M6K A;  5GL9 A;  3RH8 B;  3S7N A;  2WAE A;  3V3S A;  5J4E A;  1P9R A;  4JXS A;  1ERM A;  3VSL A;  3NOU C;  3ZG9 B;  3E2L A;  4BBT A;  2ZQ9 A;  2ZBB A;  1SKF A;  4EXO A;  4G3W A;  4X68 A;  1CQA A;  2Z2M B;  3Q7Z A;  4LV1 A;  1F9I A;  1L0D A;  4O01 A;  3KSH A;  4B4X A;  2FH5 A;  2XD5 A;  5GHZ A;  1BLH A;  5E2E A;  1OTB A;  3G34 A;  3GVB A;  1JWZ A;  1XJ2 A;  3DW0 A;  4UA9 A;  1K4F A;  4OKP A;  2CC1 A;  2P74 A;  2Y2G A;  3JYI A;  3NOT C;  3MKE A;  4ZJ1 A;  4KZ3 A;  4X55 A;  4FCF A;  1LT0 A;  3S7P A;  2R9X A;  4GD8 A;  4E3J A;  4C75 A;  2IA2 A;  3PXP A;  1HVB A;  1F2K A;  3QP4 A;  3HL9 A;  1Q2Q A;  5KSC A;  1F5M A;  3LI8 A;  3NJA A;  2XRO A;  3TE8 A;  1JVJ A;  1S1Z A;  4II7 A;  3CPT A;  4OPQ A;  3T50 A;  3HBR A;  2PHY A;  4BL3 A;  1OPX A;  1SDE A;  4IUH A;  1D06 A;  2Y2K A;  3C8C A;  2B02 A;  4WZ5 C;  4Y17 A;  4X56 A;  3CHW P;  3LO7 A;  4FD8 A;  1TF1 A;  3T1S A;  2P9V B;  5A90 A;  5DF7 A;  5AQA A;  1JTD A;  2J80 A;  3BWL A;  1UGU A;  1YLJ A;  3C38 A;  1DY6 A;  3CI6 A;  1Z09 A;  5DFX A;  3IH9 A;  1IYS A;  4I39 A;  3Q81 A;  1DJA A;  1A0K A;  4XUZ A;  4MN5 A;  3LY4 A;  5F83 A;  3IHA A;  2ZC6 B;  5J3W A;  4C3Q A;  3F1O B;  2NUT C;  3T12 B;  5A91 A;  1L0E A;  1HD8 A;  1IOU A;  1KDS A;  3CWF A;  5FQI A;  3MKF A;  3MXQ A;  3UO9 A;  1YM1 A;  5EVL A;  3IBR A;  4HQA A;  3BFG A;  2XFS A;  2WGI A;  3FPV A;  3BFE A;  4CPK A;  4DDY A;  4JGR A;  4M3K A;  1GHM A;  3BM6 A;  1DP6 A;  4R6L A;  1KDW A;  1T18 A;  1MBL A;  1KE3 A;  3SH8 A;  3HJK A;  3CG5 A;  4HES A;  3N6I A;  3O3V A;  2PYP A;  1BYW A;  1HTZ A;  5L8M A;  5BOH A;  1ES4 A;  3RJU A;  3C4O A;  4Y0U A;  2LB5 A;  4WEK A;  1BT5 A;  2J3T C;  4R23 A;  5DF8 A;  2EX2 A;  5FI6 A;  1H8M A;  4E3O A;  1JTG A;  2GDN A;  2XR0 A;  4S2N C;  5FI2 A;  4AFI A;  4GDN A;  5DVA A;  4B4Z A;  4QWO A;  3IWI A;  5DTT A;  5HPI A;  3HLE A;  4JKT A;  1LL9 A;  1GA0 A;  3HLF A;  4X69 A;  1K54 C;  5FAQ A;  3OPH A;  3DWK A;  4F3L B;  4DJ2 A;  3L7H A;  3H7W B;  4KZ6 A;  1KOU A;  2WGW B;  5F1G A;  3LEZ A;  3PHY A;  4KZ8 A;  3PAE A;  3UE6 A;  3C7V A;  1GCE A;  2HPB A;  5EM0 A;  5CTM A;  3A0V A;  4NK3 A;  4Y3I A;  3MZE A;  2JHE A;  3G32 A;  4O7D A;  2EFU A;  2Y2L A;  4LRX C;  1XP4 A;  2FFY A;  3HUN A;  2Y2P A;  2XDM A;  4OP5 A;  3HRE A;  3LID A;  2ZQD A;  4KQO A;  1KVL A;  4XT2 B;  4XXR A;  1OME A;  2D02 A;  4JXG A;  2Y4A A;  3LIF A;  1NWZ A;  2V20 A;  3WS1 A;  2W3H A;  1OT6 A;  3SH9 A;  4Q0J A;  3RFB A;  4CLC A;  3C7U A;  5I94 A;  2XQZ A;  3NOP C;  5TR7 A;  4IUK A;  1N9N A;  1XJ6 A;  3O86 A;  3G4P A;  3PBT A;  4GN2 A;  2ZC3 B;  3R4K A;  4EQI A;  4OP8 A;  4U0T A;  3ZG7 B;  3ZDJ A;  4IVI A;  2DNS A;  3MZD A;  5FDH A;  3ITA A;  3ZNT A;  2LB9 A;  2VEA A;  2J8Y A;  2W27 A;  1NXY A;  4OOM A;  5HFO A;  4WLA A;  5GLD A;  1K55 C;  2B95 A;  3OZH A;  3TJZ C;  1AXB A;  3Q7V B;  4WBG A;  1PZP A;  5J8X A;  4ME4 A;  2DMW A;  4L9E A;  2V2F F;  4RQ9 A;  2HV1 A;  3V50 A;  5DKK A;  3UPP A;  3KX0 X;  1NYY A;  3BEB A;  2ZC4 B;  4R0Q A; 
#chains in the Genus database with same CATH homology
 4ID4 A;  4DE3 A;  5M1A A;  3Q1F A;  3CJM A;  3G2Y A;  1XA1 A;  2Y2Q A;  2C6W B;  2J9P A;  5CGS A;  2FFF B;  4LV3 A;  3PBO A;  1CI8 A;  1XKZ A;  4DXB A;  3IH8 A;  5U47 A;  4JBF A;  3N8R A;  4KZ7 A;  3A3I A;  3IXD A;  2Y2I A;  3B3X A;  5HW3 A;  3UY6 A;  1ONG A;  1RP5 A;  1NRF A;  1PYY A;  4OON A;  4KEN B;  4FSF A;  2ZJ9 A;  1ESU A;  3V5M A;  1I2S A;  3HUM A;  3CMZ A;  5GHX A;  3IF5 A;  3OCN A;  4S2O A;  4FH4 A;  3N8S A;  4OLG A;  4KZ5 A;  3VFH A;  2G2W A;  4F94 A;  1L2S A;  1LHY A;  3ZGA B;  3MZF A;  1IEM A;  4IBX A;  1K4E A;  5EVI D;  5GHY A;  3W4P A;  3UPN A;  4DE2 A;  5CHM A;  4E3M A;  2QMI A;  3WS5 A;  3MBZ A;  5EOE A;  1KGG A;  3GRJ A;  1NZU A;  1K6S A;  2QPN A;  4B88 A;  3UE0 A;  1G6A A;  2HDU A;  3ZG5 A;  1MY8 A;  2J9O A;  2WZZ A;  2X01 A;  2PU4 A;  1I2W A;  3PBQ A;  3PBS A;  3PBN A;  4RA7 A;  3PBR A;  4N1H A;  1PZO A;  1IYP A;  2E8I A;  4GDB A;  1FCN A;  3HLD A;  4P87 A;  4U3T A;  4WEL A;  4WYY A;  4YIN A;  4DXC A;  5EEC A;  1KVM A;  3W4O A;  1KGE A;  3HLB A;  4Z9Q A;  3WRZ A;  4OPY A;  1K6R A;  3N7W A;  4E3N A;  1TDL A;  3O88 A;  1PWC A;  1K57 A;  3UE1 A;  1WYC A;  1XPB A;  3NI9 A;  4RX2 A;  3ZHH A;  1VM1 A;  1ES2 A;  3QHY A;  2ZQA A;  4YFM A;  3IT9 A;  3MXS A;  4BLM A;  1W8Y A;  3GSG A;  4WZ5 A;  5F1F A;  4EUZ A;  3BFF A;  4PMA A;  2OSU A;  4OPZ A;  3IHB A;  3BEC A;  2OV5 A;  3WS0 A;  2JC7 A;  4DF6 A;  3ISG A;  3UDF A;  5GLB A;  4KQQ A;  3VP4 A;  1CEF A;  5GLA A;  4U0X A;  4R3J A;  1CI9 A;  2EX9 A;  1LL5 A;  2HDS A;  2B5R A;  4R4R A;  1MXO A;  1YMS A;  2ZM2 A;  3M2J A;  3ZFZ A;  2XD1 A;  2EXA A;  3PTE A;  4K0W A;  5EVI A;  4JXV A;  4E3L A;  3UDX A;  5FQM A;  1LI0 A;  2Y2H A;  4JPM A;  1M6K A;  2Y91 A;  3GV9 A;  5GL9 A;  3SH7 A;  4WMC A;  5CEC A;  5HAQ A;  2WAE A;  3V3S A;  5EVI B;  5FI7 A;  1YT4 A;  2WKH A;  3TG9 A;  4JXS A;  5DF9 A;  1BLC A;  1ERM A;  1H5X A;  4OQ0 A;  3VSL A;  4S2L A;  1YLP A;  3C4P A;  1YLZ A;  1WE4 A;  4R4S A;  1RGY A;  3ZG9 B;  4RVA A;  3HVF A;  3A3D A;  3E2L A;  5FAP A;  3G30 A;  1H8Y A;  1GA9 A;  2VGJ A;  4WEJ A;  2OLU A;  4HBT A;  4OQG A;  2ZQ9 A;  4OLD A;  1YMX A;  5E2H A;  1SKF A;  3UNW A;  3NCK A;  5AQ9 A;  5F82 A;  4OPR A;  4MEZ A;  1EI5 A;  2Z2M B;  4X68 A;  4DKI A;  3Q7Z A;  4EWF A;  4LCM A;  1PWD A;  4LV1 A;  3MXR A;  4S2K A;  5A93 A;  1C3B A;  1L0D A;  1XXM A;  1YQS A;  2DRW A;  3PAG A;  1W8Q A;  4B4X A;  2XD5 A;  5GHZ A;  1BLH A;  3ZNY A;  1XGJ A;  5E2E A;  3TOI A;  3G34 A;  1Q2P A;  3GVB A;  1JWZ A;  4MNR A;  3DW0 A;  3GMW A;  4PM7 A;  2ZM8 A;  1K4F A;  4UA9 A;  4OKP A;  2Q9N A;  2CC1 A;  4WZ4 A;  4NET A;  2P74 A;  1E25 A;  1I5Q A;  2WK0 A;  2Y2G A;  5FQJ A;  3JYI A;  2ZM0 A;  3FKW A;  3MKE A;  4Y0O A;  2ZC7 A;  4PM8 A;  4ZJ1 A;  4KZ3 A;  1L0F A;  4X55 A;  3D4F A;  4FCF A;  3EQV A;  1LI9 A;  3DTM A;  3V3R A;  1JWV A;  2V1Z A;  2R9X A;  3E2K A;  4GD8 A;  4E3J A;  1PW1 A;  3AGF A;  4BD1 A;  4C75 A;  1FOF A;  1W5D A;  5HX9 A;  1HVB A;  4N92 A;  1BSG A;  2HP9 A;  4IED A;  3VP3 A;  4KZA A;  3HL9 A;  3OCL A;  5EUA A;  4H8R A;  1Q2Q A;  2Y2M A;  4QD4 A;  5KSC A;  2EX6 A;  4KZ4 A;  3WRT A;  1MWR A;  3N4I A;  3BRM A;  4ZJ2 A;  5KSH A;  4KQR A;  1JVJ A;  1TVF A;  5GLC A;  4D2O A;  5HAR A;  4BL2 A;  2ZMA A;  3FYZ A;  3OPR A;  3IXH A;  3NDG A;  4ZDX A;  3HLW A;  2RL3 A;  3VOY A;  5AQB A;  4E6X A;  3AGE A;  4UHU A;  4OOL A;  4OPQ A;  3WWX A;  5IHV A;  4WMC D;  1ES5 A;  2Y59 A;  3HBR A;  3NIA A;  1KGF A;  5CTN A;  1K57 C;  2IWC A;  3S22 A;  4BL3 A;  2XFT A;  1FSY A;  1SDE A;  2HDQ A;  1MWS A;  4S2N A;  2P9V A;  3M2K A;  4UAA A;  2Y2K A;  4QY6 A;  1NYM A;  3G2Z A;  4WZ5 C;  4GNU A;  2WKE A;  3LO7 A;  4FD8 A;  4X56 A;  3G31 A;  1ONH A;  2WAF A;  3DWZ A;  3ZVT A;  4DDS A;  2ZD8 A;  4QHC A;  1ESI A;  2WGV A;  4PM6 A;  1K54 A;  4Q8I A;  2P9V B;  5CHU A;  1O7E A;  4DRT A;  2UWX A;  1TDG A;  4JF6 A;  5DF7 A;  5A90 A;  5DTS A;  5AQA A;  5EVI C;  1JTD A;  1W79 A;  1YLJ A;  2A3U A;  1DY6 A;  3NY4 A;  1XX2 A;  4LCL A;  1ALQ A;  4RX3 A;  1DJC A;  3IF6 A;  3GR2 A;  3OPL A;  5HAI A;  2WZX A;  3IH9 A;  1IYS A;  1SCW A;  4PM5 A;  2ZC5 B;  3BYD A;  3Q81 A;  4R3B A;  1DJA A;  4ZBE A;  4LV2 A;  4QY5 A;  4XUZ A;  3LY4 A;  5F83 A;  3IHA A;  3VSK A;  4OQH A;  2OLV A;  2ZC6 B;  3AGD A;  3WS4 A;  1FQG A;  3VOZ A;  3IF6 B;  3MFD A;  3V39 A;  4E6W A;  1NZO A;  4E3K A;  3SS5 A;  4C3Q A;  5A91 A;  1L0E A;  1HD8 A;  1TEM A;  2RCX A;  4GOG A;  1BZA A;  4IVK A;  1KDS A;  2EFX A;  2WUQ A;  4MBK A;  4KG6 A;  1CK3 A;  1S0W A;  3M6H A;  5FQI A;  3MKF A;  2R9W A;  5AQ7 A;  5JYP A;  5M18 A;  2Y2N A;  4BJP A;  4CJN A;  3IXG A;  3UO9 A;  3VP1 A;  4S2M A;  4P85 A;  1YM1 A;  4GZB A;  2XLN A;  5EVL A;  2ZQ7 A;  1NY0 A;  5CER A;  4DE1 A;  1K38 A;  4S2P A;  5FQ9 A;  3BFG A;  4RYE A;  1XGI A;  5FQK A;  5TGF A;  4EV4 A;  5G18 A;  2XFS A;  4C6Y A;  4KG2 A;  5E2F A;  2WGI A;  3C5A A;  3BFE A;  4A5R A;  4CPK A;  4HBU A;  1DJB A;  1ZG4 A;  3A3E A;  4GB7 A;  4DDY A;  1IYQ A;  4M3K A;  1GHM A;  3UE3 A;  1IKI A;  4JF5 A;  2JBF A;  2H0Y A;  3BM6 A;  1KDW A;  1K56 D;  1ZC2 A;  4N9K A;  4OQI A;  1MBL A;  5FQQ A;  3BLS A;  1KE3 A;  3ITB A;  2XF3 A;  2IWB A;  3SH8 A;  3TSG A;  1M40 A;  5HAP A;  3CG5 A;  1CEG A;  5DTK A;  4HES A;  2Y55 A;  3LCE A;  3N6I A;  4ZAM A;  3O3V A;  4XUX A;  1HTZ A;  3BFD A;  1E3U D;  1K55 A;  3UPO A;  1FR1 A;  1IKG A;  3FV7 A;  1SHV A;  1YLY A;  4LV0 A;  1G68 A;  1ES4 A;  1L0G A;  4BEN A;  3RJU A;  4OOY A;  4EBL A;  2HP6 A;  5BOH A;  3C4O A;  2WAD A;  1KE4 A;  3FWL A;  4Y0U A;  1N4O A;  2PBY A;  2IWD A;  3SS3 A;  4MBH A;  2C5W B;  3W8K A;  2ZLY A;  4WEK A;  1BT5 A;  1PI5 A;  5TFQ A;  1H8Z A;  4R23 A;  4EBP A;  3FKV A;  4UA6 A;  1IEL A;  3IXB A;  4S2J A;  5DF8 A;  2EX2 A;  1FR6 A;  5FI6 A;  5E2G A;  5CED A;  4E3O A;  3P98 A;  5EOO A;  1JTG A;  2PU2 A;  1PIO A;  1MPL A;  1ZKJ A;  5FAO A;  1MWT A;  2GDN A;  2XR0 A;  4S2N C;  5FI2 A;  4GDN A;  3M6B A;  3OC2 A;  5CGW A;  4KZ9 A;  5DVA A;  2Y2J A;  4B4Z A;  4JXW A;  3IWI A;  4Y7P A;  5DTT A;  3HLE A;  4JKT A;  4X53 A;  2WGW A;  2G2U A;  4L0L A;  4KZB A;  3HUO A;  5M19 A;  1LL9 A;  1K56 A;  1GA0 A;  1NJ4 A;  3HLF A;  4X69 A;  1K54 C;  3IQA A;  5FAQ A;  5FAT A;  3OPH A;  3DWK A;  1EWZ A;  2XK1 A;  3IWQ A;  1PI4 A;  3NC8 A;  2VGK A;  3HLC A;  4JLF A;  4P0M A;  4ZJ3 A;  1FCM A;  4KZ6 A;  4OVD A;  2WYX A;  1Y54 A;  2WGW B;  4HEF A;  5F1G A;  4BD0 A;  3I7J A;  3LEZ A;  4KZ8 A;  3PAE A;  2X71 A;  2ZQ8 A;  3OPP A;  3Q07 A;  4JF4 A;  3NDE A;  3HLG A;  1XA7 A;  2DCF A;  4GD6 A;  3S1Y A;  3C7V A;  3ZVW A;  1GCE A;  1E3U A;  1ZG6 A;  3GQZ A;  3IF6 C;  4P6B A;  3QNC A;  2HPB A;  1HZO A;  3FZC A;  3BLM A;  3P09 A;  1PW8 A;  1JWP A;  1Z6F A;  2ZQC A;  4E3I A;  1YLT A;  5L2F A;  2I72 A;  1QME A;  1ES3 A;  2JE5 A;  5CTM A;  1VQQ A;  3WS2 A;  4NK3 A;  2J7V A;  3G35 A;  3LY3 A;  3MZE A;  1ERO A;  1K25 A;  3G32 A;  4O7D A;  2EFU A;  4S2I A;  5CHJ A;  2HDR A;  2Y2L A;  3IWO A;  3S4X A;  5HL1 A;  1XP4 A;  2FFY A;  4MBF A;  1SDN A;  3HUN A;  2Y2P A;  2XDM A;  3ZG8 B;  1BLS A;  1IYO A;  4KG5 A;  4OP5 A;  4R1G A;  1U60 A;  2BG1 A;  1FSW A;  1QMF A;  3EQU A;  4MLL A;  3VP0 A;  5CGX A;  3W4Q A;  5EE8 A;  2HP5 A;  2Y2O A;  3HRE A;  2EXB A;  2ZQD A;  2XGN A;  2XEP A;  4LEN A;  4KQO A;  3GTC A;  3QNB A;  3N8L A;  1KVL A;  5CRF A;  3SS4 A;  1BUE A;  4XXR A;  4OH0 A;  2XH9 A;  1N9B A;  1OME A;  2H10 A;  2H5S A;  2Y4A A;  1RGZ A;  4JXG A;  4QU3 A;  2V20 A;  3WS1 A;  1ERQ A;  5E43 A;  2QZ6 A;  4GKU A;  1S6R A;  3SH9 A;  3A3J A;  4QB8 A;  3UDI A;  3CZD A;  4BQM A;  4EBN A;  5KMW A;  5KZH A;  1BUL A;  4ZTK A;  3VP2 A;  3C7U A;  4DE0 A;  5I94 A;  2XQZ A;  2Z2L B;  5TR7 A;  3SOI A;  1GHP A;  3RXX A;  5CXW A;  5CEB A;  1E4D A;  1FCO A;  3BFC A;  3O86 A;  3G4P A;  3PBT A;  4WM9 A;  4GN2 A;  2ZC3 B;  4EQI A;  1KE0 A;  4OP8 A;  1W7F A;  4U0T A;  3ZG0 A;  3ZG7 B;  3ZDJ A;  3Q7V A;  4IVI A;  4PM9 A;  2DNS A;  3MZD A;  4Y0T A;  2JCH A;  1MWU A;  3VFF A;  4QJG A;  5FDH A;  3ITA A;  3ZNT A;  2J8Y A;  3A3F A;  4K0X A;  3Q82 A;  3O87 A;  3VMA A;  1NXY A;  1MKI A;  2Q9M A;  2X02 A;  4N9L A;  1WYB A;  4OOM A;  5HFO A;  5JYO A;  5GLD A;  5FAS A;  1K55 C;  3OZH A;  1AXB A;  5D3O A;  1RCJ A;  2WKI A;  3Q7V B;  1PZP A;  4IBR A;  4WBG A;  5FSR A;  5J8X A;  4K91 A;  1O07 A;  4UA7 A;  3ZCZ A;  5A92 A;  5EPH A;  2V2F F;  1GHI A;  4X6T A;  2BLS A;  2H0T A;  4N1X A;  4FH2 A;  3RXW A;  3V50 A;  1YLW A;  3UPP A;  1NYY A;  5FA7 A;  3BEB A;  2A49 A;  4PPR A;  2ZC4 B;  1BLP A;  1BTL A;  1PWG A;  3UN7 A;  1LLB A;  3NBL A;  1J9M A;  4R0Q A;  2EX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...