3Q90A

Crystal structure of the ntf2 domain of ras gtpase-activating protein-binding protein 1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
121
Chain Sequence
SPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras GTPase-activating protein-binding protein 1
publication title Crystal structure of the NTF2 domain of Ras GTPase-activating protein-binding protein 1
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 36
structure length 121
sequence length 131
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3q90A00
4XDWA 3EC9A 2RFRA 4OVMA 3CNXA 4CDLA 1E3VA 4H3UA 5KP1A 3KSPA 4MJDA 2UX0A 2GEYA 3EN8A 5BVBA 1GS3A 4HM8B 3FSDA 5STDA 2YFLB 3LYGA 2CKFB 3FF0A 5JPPA 1JB4A 4HM4B 3M8CA 3ER7A 1UUWB 2RCDA 3JUNA 1OCVA 4OUQA 1JKGA 2HMOB 2STDA 4XB5A 2XRXB 3JUPA 3DZLA 1E97A 3G0KA 5D82A 3OWUA 4WYKA 3MG2A 1DMQA 1OUNA 4HM3B 1JB2A 3SOYA 2XSHB 1O7PB 2QIYA 3T8NA 3RGAA 3WMDA 3OWYA 1ASKA 4X2HA 4U13A 1GY7A 1Z1SA 3FGYA 4HVNA 1ZX2A 3T8UA 3F7SA 2HMKB 5IG3A 4X2OA 8CHOA 2A15A 4J9AA 5TGNA 3B8LA 3EF8A 2OWPA 3G16A 5IF6A 1OF5A 3DXOA 3FF2A 5D83A 1ULJB 3DMCA 5AEWB 3NHXA 3S5CA 3EHCA 1W6YA 3EN1B 3LZAA 3E99A 5FW5A 4XBYA 4R1KA 4HJLB 4K1UA 2Z76A 1JKGB 1GYBA 1EG9B 3H3HA 1ULIB 1W01A 1S5AA 1W00A 3F9SA 2CHCA 1DMNA 3ECFA 4WYKB 4Q53A 2B24B 3HX8A 3B4PA 1JN5A 5IG5A 3FZWA 5IG4A 2BMOB 1OH0A 4R9KA 3FKAA 3Q90A 1OPYA 1STDA 2B1XB 3B4OA 3CPOA 3KE7A 4L8PA 3NM2A 4XM4A 3D9RA 4I4KA 1O7HB 1GY5A 3NXJA 4ORLA 3CNMA 3EJVA 1IDPA 1OF5B 7STDA 3F7XA 5JPUA 3DUKA 3GZYB 1WQLB 2QGUA 4PEJA 1O7NB 3HK4A 2GBWB 4IIAA 4RZMA 1QJGA 1U5OA 3EX9A 5AIFA 2INXA 4HKVB 3KZTA 1UUVB 5IEOA 1CQSA 3SOAA 5IEPA 2I9WA 5KP4A 3IPTA 5AI1A 1OHSA 1JB5A 1JN5B 1VZZA 4HZBB 4KVHA 3GZBA 3BLZA 5EVHA 3FLJA 5CLKA 4HM7B 2F98A 5BXQA 1OHOA 3UNLA 5IENA 3F8XA 2GXFA 1A2KA 1OGZA 3K0ZA 2Z77A 3KKGA 3JUOA 3F8HA 3EBYA 3GZRA 4XDVA 4XBTA 4HZ9B 1GY6A 2RGQA 2R4IA 1O7GB 1TUHA 1DMMA 3NV0A 4HM2B 5CF2A 1BUQA 4J8TA 3JUQA 3H51A 5CK6A 1OHPA 3NUVA 1NDOB 3OV4A 4LEHA 2HMNB 3I0YA 5D81A 3EBTA 4HM6B 2IMJA 5DRVA 5AIGA 1ZO2A 2GBXB 2YFIB 1NU3A 1NWWA 2HMJB 4LGQA 3MG3A 3EQQB 5CF1A 1QMAA 3F14A 3OXAA 1Q40A 2PZVA 3GWRA 2BMRB 1E3RA 1O7MB 1K41A 1O7WB 3UJMA 2W2CA 4HM1B 4L8OA 4K1VA 2F86B 1HKXA 1OGXA 1W02A 1C7HA 3OX9A 3DM8A 3MSOA 3STDA 1EA2A 2JQ5A 3MHEA 3VSYA 5IERA 4WWUC 4L7KA 4HM0B 3GZXB 2XSOB 5HGRA 2GEXA 3CU3A 5DREA 2BNGA 3NV0B 5AIIA 1SJWA 3GRDA 5CXOA 3HZPA 4XBXA 4STDA 3MKIA 3F40A 3VGNA 2F99A 4FCMA 4HM5B 5AEUB 3RGRA 3B7CA 3K7CA 3NBRA 3JUMA 4LMIA 4N3VA 3A76A 3G8ZA 1AR0A 6STDA 5G2GA 5IG0A 4WP5A 2XR8B 2YFJB 1ISKA 2BMQB 4GB5A 3MYTA 3FH1A 3SEDA 2HMMB 5AIHA 2HMLB 3MG1A 1Q40B 2Z7AA 1TP6A 4R9LA 3ROBA 5KP3A 2K54A 3BB9A 3OWSA 4FCJA 1Q42A
chains in the Genus database with same CATH superfamily
4AEQA 4XDWA 3EC9A 3WODG 1RKYA 2SBLA 3BNCA 5AYRB 2RFRA 1PY3A 2D1WA 4OVMA 1BRIA 3WA3A 3CNXA 4CDLA 1RN4A 3PGBA 4IT7A 4EBGA 3CME3 1BRKA 1LOYA 2RNTA 1KSIA 4CJNA 2WGQA 2L4VA 1TRPA 1SQWA 1E3VA 2GU3A 1BRNL 1RDSA 2KXGA 4H3UA 1A67A 1CYUA 5KP1A 1YVBI 2WGOA 3LTDA 5I97A 1FA3A 3KSPA 4CCVA 1NNVA 4MJDA 3PS8A 2UX0A 1BNJA 3NX0A 2GEYA 5LC7A 3UB1A 3CC73 1AQZA 3EN8A 1GS3A 4HM8B 5BVBA 2K0MA 3FSDA 1SARA 5STDA 2YFLB 3G6E3 3LYGA 2CKFB 1DVCA 3FF0A 1JB4A 2KAAA 3NQZA 4BTXA 5JPPA 1RJOA 3LTAA 1IVXA 4HM4B 2BT3A 3M8CA 3ER7A 1UUWB 1RLSA 2RCDA 3JUNA 4HYZA 1X1XA 2Z6BA 3DGYA 1OCVA 4OUQA 1JKGA 2ZDJA 1BU4A 2HMOB 1YJW3 2STDA 1W4NA 4XB5A 3S67A 3KFQC 1DETA 1K28A 2WOHA 3WOEB 4AKYA 2XRXB 3LT9A 4K90B 1I70A 3JUPA 4LSOA 4J5GA 2CWVA 2L1SA 2J8XB 3WA2X 4O3VA 2W6JH 1BSEA 3DZLA 3NM7A 3Q3FA 4KT3B 3X3YA 1JZOA 2CX1A 1E97A 1F8NA 3G0KA 5D82A 1Q814 3S29A 1JBTA 1RN7A 1STFI 3OWUA 4WYKA 3MG2A 1DMQA 2D42A 4RNYA 1OUNA 1W6CA 4HM3B 1JB2A 3SOYA 2XSHB 4NPBA 1O7PB 2QIYA 1W6GA 3X40A 3CXC2 3S27A 3PYJA 3RGAA 3T8NA 3WMDA 3OWYA 1ASKA 1I2FA 1IYYA 4X2HA 4U13A 1T2HA 4BU4A 1GMQA 1YJN3 1BIRA 1GY7A 1UI7A 3D3LA 1B3SA 1X1YA 1Z1SA 6GSPA 3FGYA 4LZIA 4HVNA 1ZX2A 3T8UA 1TJDA 3CCL3 3F7SA 2R41A 1DVDA 1EUIC 2HMKB 5IG3A 4X2OA 3TDGA 3A5EA 2A15A 2KCDA 8CHOA 3PXMA 4J9AA 3V98A 5TGNA 4FMCA 2SARA 1GOVA 2C10A 2CC3A 1UW1A 1CH0A 3B8LA 2LYXA 2P0XA 2OWPA 1WMPA 1R4YA 3EF8A 3G16A 3UL6A 1A90A 3LTBA 6RNTA 5IF6A 1OF5A 3LT8A 5HOHA 1RRHA 1A2VA 4JRFA 1WTHA 4WHAA 3DXOA 2CFDA 3LXUX 3U97A 4GL6A 2GU1A 2ZHXB 3AHSA 3FF2A 3NBBA 5D83A 1FW7A 2XFTA 1N8R4 1IQXA 3OW22 1C54A 5JBSA 1GSPA 1ULJB 3DMCA 5AEWB 1BVIA 2WOFA 1M904 2H0IA 1RGKA 3NHXA 3WR2A 3PCSA 3S5CA 3EHCA 1Q824 1BNRA 1MWUA 1W6YA 1QVF2 3CCU3 1YJ93 3EN1B 1DE3A 3LZAA 3WHOA 2IYJA 3E99A 1N9JA 1UCJA 1IQYA 5FW5A 5M1AA 1PU4A 4XBYA 4R1KA 4HJLB 3FG3A 4K1UA 2Z76A 1JKGB 1GYBA 1YIT3 1EG9B 1LRAA 3H3HA 2CFLA 1ULIB 1CYVA 3FG4A 4K61A 1SIIA 1T3BA 1W01A 3URPA 1S5AA 2OTL3 1W00A 3RDEA 1RGCA 1VQ93 3DGOA 1JZDA 1RHLA 1VQM3 1BUJA 1BGSA 3F9SA 5BU4A 2CHCA 3MWZA 2W03A 1B20A 1BSCA 4N6MA 1DMNA 1D6UA 3LTCA 3O8YA 1SPUA 1OACA 3ECFA 4WYKB 4Q53A 1GMRA 2B24B 2W9PA 3HX8A 1Q7HA 3B4PA 4NHFA 1JN5A 5IG5A 3FZWA 4I5QA 1ZGXA 4LYLB 4EC6A 5IG4A 2BMOB 1I2EA 1LOVA 1I0VA 1OH0A 1I3FA 2K3DA 4R9KA 3FKAA 4O8SA 1A2PA 2CWUA 3Q90A 3Q2PA 1VQO3 1OPYA 3K9MC 1M1XB 1LXEA 4KFEA 1BNEA 1US1A 4N6NB 1M9GA 2H0HA 1QVG2 3AMOA 1RN1A 3DH2A 3BNDA 1STDA 1WMOA 3HI7A 5AYSC 1TIJA 2B1XB 3B4OA 4N6LA 1IQ8A 1TRQA 3CPOA 3HIGA 3K63A 3CD63 3KE7A 4L8PA 3NM2A 4XM4A 2F5WA 4QWTA 1D6ZA 4OK0A 3D9RA 4I4KA 2ML6A 1MWSA 1O7HB 1GY5A 3NXJA 1V74A 3CNMA 4ORLA 2OOVA 1EEJA 2UUGC 3EJVA 4EXRA 4MMYB 1IT8A 1IDPA 1OF5B 2XH9A 7STDA 1YI23 3F7XA 5FGOA 3DY5A 1B2SA 5JPUA 4FR9A 4WFOA 2YX9A 1LNIA 2OOVC 2MC8A 3AGNA 3DUKA 1MNLA 1RMSA 2KRTA 3GZYB 2Y73A 5ELJA 3VF1A 1WQLB 4N6OB 4KZ1A 3PZWA 2QGUA 4RNTA 4EV5A 1VQN3 4PEJA 1WNHA 1O7NB 5M19A 1V58A 3CCR3 1TTOA 3HK4A 4N6UA 2GBWB 3Q1CA 1I0XA 3WDGB 1YHQ3 1AV4A 1VQ43 1GOYA 1UDII 4IIAA 1PFPA 4RZMA 2FGTA 4BL2A 1RNBA 1QJGA 1U5OA 2IA7A 1Q864 2Q07A 2KF5A 3EX9A 1VQ63 5G1LA 2AADA 3V99A 3PCRA 1B2UA 4HBRA 5AIFA 4N6V0 3CC23 1NJI4 5IW9A 1EKMA 2Y74A 2INXA 1FYSA 5M18A 2OQEA 2KF6A 2P05A 3DGLA 2AAEA 4HKVB 3KZTA 3SX1A 1QAKA 4H61A 1ROAA 1LOWA 1AVLA 3D4AA 2KF4A 1UUVB 3LOYA 1BANA 5IEOA 2RBIA 1CQSA 1RTUA 2W56A 2ML5A 1N5HA 1N8QA 2F4YA 3SOAA 5IEPA 1ZS7A 1VQK3 4FCZA 1T5YA 2I9WA 1VQQA 1FGRA 1BNSA 5KP4A 2CIUA 1W2ZA 1RGGA 2JDIH 3IPTA 5AI1A 3CCE3 4MMXB 1OHSA 1JB5A 1JN5B 1UGIA 1VZZA 4HZBB 4KVHA 1N5PA 1T2IA 3GZBA 1IV7A 1JBRA 3BU4A 1GMPA 3BLZA 2C4BA 5EVHA 4MMZB 3FLJA 5CLKA 5BIRA 1YIJ3 8RNTA 2P0MA 2C11A 3AMOB 1FGOA 1HZ1A 3N54B 3U1WA 4HM7B 2W04A 3CCQ3 2F98A 5BXQA 1OHOA 1X1UA 2ZA4A 1TFOA 3UNLA 1W5ZA 5IENA 1UGHI 4EW5A 2KF3A 3F8XA 4CPKA 1M1K4 3KN4A 2CK3H 2GXFA 2P38A 2UGIA 1A2KA 1OGZA 1LNHA 2BU4A 5G1KA 2CFKA 3G713 1W7CA 4EV2A 1D6YA 2E2TA 3AHWA 3K0ZA 2Z77A 3KKGA 1GD4A 3JUOA 4J5KA 3F8HA 1HYFA 1B21A 3EBYA 3GZRA 4XDVA 3UL5A 4BL3A 4XBTA 4HZ9B 5ELUA 1YGWA 1EQKA 1GY6A 4GSPA 1HU9A 2RGQA 3JVCA 2M7OA 3N9HA 1IK3A 2R4IA 3FG1A 1O7GB 1TUHA 1DMMA 1BSDA 3D79A 1K9M4 4RNZA 3NV0A 4HM2B 5CF2A 1LOXA 1BUQA 3D5GA 4J8TA 3J7Yd 1YGEA 3JUQA 2W9QA 3H51A 3KSED 1OHPA 5CK6A 4GHOA 3NUVA 3NQYA 2V1LA 3X41A 2E2VA 1NDOB 2IY2A 2O9UX 2XF3A 3OV4A 4LEHA 1AVKA 3K5TA 1BRGA 2XFSA 2RSXA 2HMNB 2XEPA 3I0YA 3D5IA 4O02B 1CEWI 5D81A 2CW9A 5LC6A 3EBTA 4RBNA 3FCSB 1FGMA 4HM6B 5EQLA 2IMJA 1V57A 1JV2B 2CWTA 3G4S3 4R4KA 4FMDA 1BRJA 5DRVA 5AIGA 3X3ZA 1BSBA 2FXTA 1ZO2A 4BTWA 9RNTA 2F5MA 1G02A 2GBXB 1RSNA 3X42A 3BIRA 1MWTA 2W56B 1RCLA 2MF7A 2YFIB 1VQL3 1BOXA 3LMLA 3CCM3 1KD14 1N9EA 1JRQA 1NU3A 1JBSA 3CMA3 1NWWA 1FUWA 1WMNA 1MGWA 2F56A 3WOFB 4DKIA 1VQP3 1KC84 2HMJB 1NB3I 4ILFA 4R80A 1S723 4LGQA 4EYCA 2E2UA 3QRDA 1R4CA 3MG3A 2W0QA 5EEOA 3GSPA 1RRLA 7RNTA 4BTYA 3EQQB 1IVUA 3SYUA 1RGAA 1RGFA 1ROVA 3CPW2 5CF1A 1QMAA 3F14A 2IUKA 2ZL8A 1VQ53 3OXAA 4HAAA 1UCKA 1VQ83 1Q40A 2PZVA 1NB5I 3GWRA 2CFWA 1KWIA 2BMRB 1MOLA 1E3RA 4AKZA 4IPBA 3CCJ3 1O7MB 1K41A 1O7WB 3ALAA 3ZG0A 1QAFA 3UJMA 2W2CA 1IV9A 1RGEA 1JJ22 2BHMA 1Q7Y4 3KCHA 1I3IA 4HM1B 4L8OA 2CG0A 4K1VA 1Y4KA 2F86B 1VQ73 1BRSA 2FNQA 1FGTA 1HKXA 1OGXA 3RNTA 1W02A 1C7HA 3N8BA 3SXXA 3NBJA 3DM8A 3MSOA 3OX9A 3STDA 1EA2A 2JQ5A 3ZFZA 2QA43 1W2B2 3MHEA 3VSYA 1GOUA 5IERA 3ZG5A 1K8A4 2PNCA 1YNVX 4WWUC 4L7KA 3DGMA 3CCS3 3DGNA 4FMAA 2OQEC 1BSAA 4HM0B 1BAOA 1KQS2 3GZXB 4G1MB 4N6TA 2XSOB 3IMAB 1LQGC 1RGHA 2WO0A 5HGRA 5A0OB 2GEXA 3BNEA 3CU3A 5DREA 1FZUA 4O2HA 1LQMB 3V92A 1UCIA 2BNGA 1LVNA 2CX0A 3NV0B 5AIIA 1SJWA 3GRDA 2CH9A 3L0RA 1J2BA 5CXOA 1QALA 1BNFA 1UCLA 3HIIA 3T0UA 4HOHA 3SLUA 1YVSA 3X3XA 3HZPA 1I2GA 3BNBA 4XBXA 1MGRA 3MKIA 4JF8A 1RCKA 2HOHA 3F40A 4STDA 3VGNA 1IT7A 3I563 1UUGB 2F99A 3EE1A 1BRHA 4FCMA 4HM5B 5AEUB 7GSPA 2LQVA 2XGLA 1IVWA 1FUTA 3RGRA 3B7CA 1G0TA 3K7CA 1SIHA 1UI8A 3NBRA 3CC43 3JUMA 1I8VA 3KIIA 2CFGA 1MWRA 3EB8A 1RNTA 4LMIA 1X1WA 1B2ZA 2GSPA 3A76A 3G8ZA 4N3VA 1AR0A 2O3OA 3I553 6STDA 1B2MA 3MPHA 1AY7A 1IVVA 1BNIA 3GAXA 3QK9A 1B27A 4NREA 5GSPA 5RNTA 1U8CB 1GD3A 3SVAA 5G2GA 1L5GB 1BNGA 5IG0A 4BIRA 3AGOA 4WP5A 1K734 3CCV3 1PYLA 2XR8B 2YFJB 1RGLA 1ISKA 1FGQA 1DYUA 2H0GA 2BMQB 1NO3A 2QEX3 2P09A 2BIRA 3HOHA 4GB5A 2OTJ3 2OCTA 3MYTA 3FH1A 4ZM8A 3SEDA 4TX4A 2HMMB 4FMBA 2IUJA 1IU7A 1FUSA 5AIHA 2HMLB 3MG1A 1Q40B 3IJEB 4KFDA 1B2XA 2Z7AA 1TU5A 2BO9B 2XGNA 3LH4A 1TP6A 2CG1A 4R9LA 1Q9EA 5KP3A 2K54A 3BB9A 3ROBA 1G96A 3OWSA 1JNQA 3S28A 4KFFA 1TFKA 4MEIA 4FCJA 1Q42A
chains in the Genus database with same CATH topology
4AEQA 4XDWA 3EC9A 3WODG 1RKYA 2SBLA 3BNCA 5AYRB 2RFRA 2D1WA 4OVMA 3WA3A 3CNXA 4CDLA 3PGBA 4IT7A 4EBGA 3CME3 1KSIA 2WGQA 2L4VA 1CYUA 1SQWA 1E3VA 2GU3A 2KXGA 4H3UA 1A67A 5KP1A 1YVBI 2WGOA 3LTDA 5I97A 1FA3A 3KSPA 4CCVA 4MJDA 3PS8A 2UX0A 3NX0A 2GEYA 5LC7A 3UB1A 3CC73 3EN8A 5BVBA 1GS3A 4HM8B 2K0MA 3FSDA 5STDA 3G6E3 2YFLB 3LYGA 2CKFB 1DVCA 3FF0A 1JB4A 3NQZA 4BTXA 5JPPA 1RJOA 3LTAA 1IVXA 4HM4B 2BT3A 3M8CA 3ER7A 1UUWB 2RCDA 3JUNA 4HYZA 2Z6BA 1OCVA 4OUQA 1JKGA 2ZDJA 1YJW3 2HMOB 2STDA 1W4NA 4XB5A 3S67A 3KFQC 1K28A 3WOEB 2WOHA 4AKYA 2XRXB 3LT9A 4K90B 3JUPA 4LSOA 2CWVA 3WA2X 4O3VA 2W6JH 3DZLA 3NM7A 3X3YA 1E97A 1F8NA 3G0KA 5D82A 1Q814 3S29A 1RN7A 1STFI 3OWUA 4WYKA 3MG2A 1DMQA 2D42A 4RNYA 1OUNA 1W6CA 4HM3B 1JB2A 3SOYA 2XSHB 1O7PB 2QIYA 1W6GA 3X40A 3CXC2 3S27A 3PYJA 3RGAA 3T8NA 3WMDA 3OWYA 1ASKA 4X2HA 4U13A 1YJN3 1GY7A 1UI7A 3D3LA 1Z1SA 3FGYA 4LZIA 4HVNA 1ZX2A 3T8UA 3CCL3 3F7SA 1DVDA 2HMKB 5IG3A 4X2OA 3TDGA 8CHOA 2A15A 2KCDA 3PXMA 4J9AA 3V98A 5TGNA 4FMCA 2CC3A 2C10A 1UW1A 3B8LA 2LYXA 2P0XA 2OWPA 1WMPA 3EF8A 3UL6A 3G16A 1A90A 3LTBA 5IF6A 1OF5A 3LT8A 1RRHA 1A2VA 4JRFA 1WTHA 4WHAA 3DXOA 2CFDA 3LXUX 3U97A 4GL6A 2GU1A 3FF2A 3NBBA 5D83A 2XFTA 1N8R4 1IQXA 3OW22 5JBSA 1ULJB 3DMCA 5AEWB 2WOFA 1M904 1Q824 3NHXA 3PCSA 3S5CA 3EHCA 1W6YA 1QVF2 3CCU3 1YJ93 3EN1B 3LZAA 3E99A 1N9JA 1IQYA 5FW5A 1PU4A 4XBYA 4R1KA 4HJLB 3FG3A 4K1UA 2Z76A 1JKGB 1GYBA 1YIT3 1EG9B 3H3HA 2CFLA 1ULIB 1CYVA 3FG4A 4K61A 1SIIA 1W01A 1S5AA 2OTL3 1W00A 3RDEA 1VQ93 3DGOA 1VQM3 3F9SA 2CHCA 3MWZA 2W03A 4N6MA 1DMNA 1D6UA 3LTCA 3O8YA 1SPUA 1OACA 3ECFA 4WYKB 4Q53A 2B24B 2W9PA 3HX8A 3B4PA 4NHFA 1JN5A 5IG5A 3FZWA 4EC6A 5IG4A 2BMOB 1OH0A 4R9KA 1VQO3 3FKAA 4O8SA 2CWUA 3Q90A 3Q2PA 1OPYA 3K9MC 1M1XB 1LXEA 4KFEA 1US1A 4N6NB 1QVG2 1M9GA 3AMOA 3HI7A 3BNDA 1STDA 1WMOA 5AYSC 1TIJA 2B1XB 3B4OA 4N6LA 1IQ8A 3HIGA 3CPOA 3CD63 3K63A 3KE7A 4L8PA 3NM2A 4XM4A 4QWTA 1D6ZA 4OK0A 3D9RA 4I4KA 2ML6A 1O7HB 1GY5A 3NXJA 1V74A 3CNMA 4ORLA 2OOVA 3EJVA 4EXRA 4MMYB 1IT8A 1IDPA 1OF5B 2XH9A 7STDA 1YI23 3F7XA 5FGOA 3DY5A 5JPUA 4FR9A 4WFOA 2YX9A 2OOVC 2MC8A 3DUKA 1MNLA 2KRTA 3GZYB 3VF1A 2Y73A 5ELJA 1WQLB 4N6OB 4KZ1A 3PZWA 2QGUA 4EV5A 1VQN3 4PEJA 1WNHA 1O7NB 3CCR3 3HK4A 4N6UA 2GBWB 3Q1CA 3WDGB 1YHQ3 1AV4A 1VQ43 4IIAA 1PFPA 4RZMA 2FGTA 1QJGA 1U5OA 2IA7A 1Q864 2Q07A 3EX9A 1VQ63 3V99A 3PCRA 4HBRA 3CC23 5AIFA 4N6V0 1NJI4 5IW9A 1EKMA 2Y74A 2INXA 2OQEA 2P05A 3DGLA 4HKVB 3KZTA 3SX1A 1QAKA 4H61A 1ROAA 1AVLA 1UUVB 3LOYA 5IEOA 1CQSA 2W56A 2ML5A 1N5HA 1N8QA 3SOAA 5IEPA 1VQK3 4FCZA 1T5YA 2I9WA 1FGRA 5KP4A 2CIUA 1W2ZA 2JDIH 3IPTA 5AI1A 3CCE3 4MMXB 1OHSA 1JB5A 1JN5B 1VZZA 4HZBB 4KVHA 1N5PA 3GZBA 1IV7A 3BLZA 5EVHA 4MMZB 3FLJA 5CLKA 1YIJ3 2P0MA 2C11A 3AMOB 1FGOA 3N54B 3U1WA 4HM7B 2W04A 3CCQ3 2F98A 5BXQA 1OHOA 1TFOA 3UNLA 1W5ZA 5IENA 3F8XA 1M1K4 3KN4A 2CK3H 2GXFA 2P38A 1A2KA 1OGZA 1LNHA 2CFKA 3G713 1W7CA 4EV2A 1D6YA 2E2TA 3K0ZA 2Z77A 3KKGA 1GD4A 3JUOA 3F8HA 3EBYA 3GZRA 4XDVA 3UL5A 4XBTA 4HZ9B 5ELUA 1EQKA 1GY6A 1HU9A 2RGQA 3JVCA 2M7OA 3N9HA 1IK3A 2R4IA 3FG1A 1O7GB 1TUHA 1DMMA 1K9M4 4RNZA 3NV0A 4HM2B 5CF2A 1LOXA 1BUQA 4J8TA 3J7Yd 1YGEA 3JUQA 2W9QA 3H51A 3KSED 1OHPA 5CK6A 3NUVA 3NQYA 2V1LA 3X41A 2E2VA 1NDOB 2O9UX 2XF3A 3OV4A 4LEHA 1AVKA 3K5TA 2XFSA 2RSXA 2HMNB 2XEPA 3I0YA 4O02B 5D81A 1CEWI 2CW9A 5LC6A 3EBTA 4RBNA 3FCSB 1FGMA 4HM6B 5EQLA 2IMJA 1JV2B 2CWTA 3G4S3 4R4KA 4FMDA 5DRVA 5AIGA 3X3ZA 2FXTA 1ZO2A 4BTWA 2GBXB 3X42A 2W56B 2MF7A 2YFIB 1VQL3 3LMLA 3CCM3 1KD14 1N9EA 1JRQA 1NU3A 3CMA3 1NWWA 1FUWA 1WMNA 1KC84 3WOFB 1VQP3 2HMJB 1NB3I 4R80A 1S723 4LGQA 4EYCA 2E2UA 3QRDA 1R4CA 3MG3A 2W0QA 5EEOA 1RRLA 4BTYA 3EQQB 1IVUA 1ROVA 3CPW2 5CF1A 1QMAA 3F14A 2IUKA 2ZL8A 1VQ53 3OXAA 1VQ83 1Q40A 2PZVA 1NB5I 3GWRA 2CFWA 1KWIA 2BMRB 1MOLA 1E3RA 4AKZA 4IPBA 3CCJ3 1O7MB 1K41A 1O7WB 3ALAA 1QAFA 3UJMA 2W2CA 1IV9A 1JJ22 2BHMA 1Q7Y4 4HM1B 4L8OA 2CG0A 4K1VA 1Y4KA 2F86B 1VQ73 2FNQA 1FGTA 1HKXA 1OGXA 1W02A 1C7HA 3N8BA 3SXXA 3NBJA 3DM8A 3MSOA 3OX9A 3STDA 1EA2A 2JQ5A 2QA43 1W2B2 3MHEA 3VSYA 5IERA 1K8A4 2PNCA 4WWUC 4L7KA 3DGMA 3CCS3 3DGNA 4FMAA 2OQEC 4HM0B 1KQS2 3GZXB 4G1MB 4N6TA 2XSOB 3IMAB 5HGRA 2WO0A 5A0OB 2GEXA 3BNEA 3CU3A 5DREA 4O2HA 3V92A 2BNGA 1LVNA 3NV0B 5AIIA 1SJWA 3GRDA 2CH9A 3L0RA 1J2BA 5CXOA 1QALA 3HIIA 3T0UA 3X3XA 3SLUA 3HZPA 3BNBA 4XBXA 3MKIA 4JF8A 4STDA 3I563 3F40A 3VGNA 1IT7A 2F99A 3EE1A 4FCMA 4HM5B 5AEUB 2LQVA 2XGLA 1IVWA 3RGRA 3B7CA 3K7CA 1SIHA 1UI8A 3NBRA 3CC43 3JUMA 3KIIA 2CFGA 3EB8A 4LMIA 4N3VA 3A76A 3G8ZA 1AR0A 2O3OA 3I553 6STDA 3MPHA 1IVVA 3QK9A 3GAXA 4NREA 1U8CB 1GD3A 3SVAA 5G2GA 1L5GB 5IG0A 4WP5A 1K734 3CCV3 2XR8B 2YFJB 1ISKA 1FGQA 1DYUA 2BMQB 1NO3A 2QEX3 2P09A 4GB5A 2OTJ3 2OCTA 3MYTA 3FH1A 4ZM8A 3SEDA 4TX4A 2HMMB 4FMBA 2IUJA 1IU7A 5AIHA 2HMLB 3MG1A 1Q40B 3IJEB 4KFDA 2Z7AA 1TU5A 2BO9B 2XGNA 3LH4A 1TP6A 2CG1A 4R9LA 3ROBA 5KP3A 2K54A 3BB9A 1G96A 3OWSA 1JNQA 3S28A 4KFFA 1TFKA 4MEIA 4FCJA 1Q42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XDW A;  3EC9 A;  2RFR A;  4OVM A;  3CNX A;  4CDL A;  1E3V A;  4H3U A;  5KP1 A;  3KSP A;  4MJD A;  2UX0 A;  2GEY A;  3EN8 A;  5BVB A;  1GS3 A;  4HM8 B;  3FSD A;  5STD A;  2YFL B;  3LYG A;  2CKF B;  3FF0 A;  5JPP A;  1JB4 A;  4HM4 B;  3M8C A;  3ER7 A;  1UUW B;  2RCD A;  3JUN A;  1OCV A;  4OUQ A;  1JKG A;  2HMO B;  2STD A;  4XB5 A;  2XRX B;  3JUP A;  3DZL A;  1E97 A;  3G0K A;  5D82 A;  3OWU A;  4WYK A;  3MG2 A;  1DMQ A;  1OUN A;  4HM3 B;  1JB2 A;  3SOY A;  2XSH B;  1O7P B;  2QIY A;  3T8N A;  3RGA A;  3WMD A;  3OWY A;  1ASK A;  4X2H A;  4U13 A;  1GY7 A;  1Z1S A;  3FGY A;  4HVN A;  1ZX2 A;  3T8U A;  3F7S A;  2HMK B;  5IG3 A;  4X2O A;  8CHO A;  2A15 A;  4J9A A;  5TGN A;  3B8L A;  3EF8 A;  2OWP A;  3G16 A;  5IF6 A;  1OF5 A;  3DXO A;  3FF2 A;  5D83 A;  1ULJ B;  3DMC A;  5AEW B;  3NHX A;  3S5C A;  3EHC A;  1W6Y A;  3EN1 B;  3LZA A;  3E99 A;  5FW5 A;  4XBY A;  4R1K A;  4HJL B;  4K1U A;  2Z76 A;  1JKG B;  1GYB A;  1EG9 B;  3H3H A;  1ULI B;  1W01 A;  1S5A A;  1W00 A;  3F9S A;  2CHC A;  1DMN A;  3ECF A;  4WYK B;  4Q53 A;  2B24 B;  3HX8 A;  3B4P A;  1JN5 A;  5IG5 A;  3FZW A;  5IG4 A;  2BMO B;  1OH0 A;  4R9K A;  3FKA A;  3Q90 A;  1OPY A;  1STD A;  2B1X B;  3B4O A;  3CPO A;  3KE7 A;  4L8P A;  3NM2 A;  4XM4 A;  3D9R A;  4I4K A;  1O7H B;  1GY5 A;  3NXJ A;  4ORL A;  3CNM A;  3EJV A;  1IDP A;  1OF5 B;  7STD A;  3F7X A;  5JPU A;  3DUK A;  3GZY B;  1WQL B;  2QGU A;  4PEJ A;  1O7N B;  3HK4 A;  2GBW B;  4IIA A;  4RZM A;  1QJG A;  1U5O A;  3EX9 A;  5AIF A;  2INX A;  4HKV B;  3KZT A;  1UUV B;  5IEO A;  1CQS A;  3SOA A;  5IEP A;  2I9W A;  5KP4 A;  3IPT A;  5AI1 A;  1OHS A;  1JB5 A;  1JN5 B;  1VZZ A;  4HZB B;  4KVH A;  3GZB A;  3BLZ A;  5EVH A;  3FLJ A;  5CLK A;  4HM7 B;  2F98 A;  5BXQ A;  1OHO A;  3UNL A;  5IEN A;  3F8X A;  2GXF A;  1A2K A;  1OGZ A;  3K0Z A;  2Z77 A;  3KKG A;  3JUO A;  3F8H A;  3EBY A;  3GZR A;  4XDV A;  4XBT A;  4HZ9 B;  1GY6 A;  2RGQ A;  2R4I A;  1O7G B;  1TUH A;  1DMM A;  3NV0 A;  4HM2 B;  5CF2 A;  1BUQ A;  4J8T A;  3JUQ A;  3H51 A;  5CK6 A;  1OHP A;  3NUV A;  1NDO B;  3OV4 A;  4LEH A;  2HMN B;  3I0Y A;  5D81 A;  3EBT A;  4HM6 B;  2IMJ A;  5DRV A;  5AIG A;  1ZO2 A;  2GBX B;  2YFI B;  1NU3 A;  1NWW A;  2HMJ B;  4LGQ A;  3MG3 A;  3EQQ B;  5CF1 A;  1QMA A;  3F14 A;  3OXA A;  1Q40 A;  2PZV A;  3GWR A;  2BMR B;  1E3R A;  1O7M B;  1K41 A;  1O7W B;  3UJM A;  2W2C A;  4HM1 B;  4L8O A;  4K1V A;  2F86 B;  1HKX A;  1OGX A;  1W02 A;  1C7H A;  3OX9 A;  3DM8 A;  3MSO A;  3STD A;  1EA2 A;  2JQ5 A;  3MHE A;  3VSY A;  5IER A;  4WWU C;  4L7K A;  4HM0 B;  3GZX B;  2XSO B;  5HGR A;  2GEX A;  3CU3 A;  5DRE A;  2BNG A;  3NV0 B;  5AII A;  1SJW A;  3GRD A;  5CXO A;  3HZP A;  4XBX A;  4STD A;  3MKI A;  3F40 A;  3VGN A;  2F99 A;  4FCM A;  4HM5 B;  5AEU B;  3RGR A;  3B7C A;  3K7C A;  3NBR A;  3JUM A;  4LMI A;  4N3V A;  3A76 A;  3G8Z A;  1AR0 A;  6STD A;  5G2G A;  5IG0 A;  4WP5 A;  2XR8 B;  2YFJ B;  1ISK A;  2BMQ B;  4GB5 A;  3MYT A;  3FH1 A;  3SED A;  2HMM B;  5AIH A;  2HML B;  3MG1 A;  1Q40 B;  2Z7A A;  1TP6 A;  4R9L A;  3ROB A;  5KP3 A;  2K54 A;  3BB9 A;  3OWS A;  4FCJ A;  1Q42 A; 
#chains in the Genus database with same CATH topology
 4AEQ A;  4XDW A;  3EC9 A;  3WOD G;  1RKY A;  2SBL A;  3BNC A;  5AYR B;  2RFR A;  1PY3 A;  2D1W A;  4OVM A;  1BRI A;  3WA3 A;  3CNX A;  4CDL A;  1RN4 A;  3PGB A;  4IT7 A;  4EBG A;  3CME 3;  1BRK A;  1LOY A;  2RNT A;  1KSI A;  4CJN A;  2WGQ A;  2L4V A;  1TRP A;  1SQW A;  1E3V A;  2GU3 A;  1BRN L;  1RDS A;  2KXG A;  4H3U A;  1A67 A;  1CYU A;  5KP1 A;  1YVB I;  2WGO A;  3LTD A;  5I97 A;  1FA3 A;  3KSP A;  4CCV A;  1NNV A;  4MJD A;  3PS8 A;  2UX0 A;  1BNJ A;  3NX0 A;  2GEY A;  5LC7 A;  3UB1 A;  3CC7 3;  1AQZ A;  3EN8 A;  1GS3 A;  4HM8 B;  5BVB A;  2K0M A;  3FSD A;  1SAR A;  5STD A;  2YFL B;  3G6E 3;  3LYG A;  2CKF B;  1DVC A;  3FF0 A;  1JB4 A;  2KAA A;  3NQZ A;  4BTX A;  5JPP A;  1RJO A;  3LTA A;  1IVX A;  4HM4 B;  2BT3 A;  3M8C A;  3ER7 A;  1UUW B;  1RLS A;  2RCD A;  3JUN A;  4HYZ A;  1X1X A;  2Z6B A;  3DGY A;  1OCV A;  4OUQ A;  1JKG A;  2ZDJ A;  1BU4 A;  2HMO B;  1YJW 3;  2STD A;  1W4N A;  4XB5 A;  3S67 A;  3KFQ C;  1DET A;  1K28 A;  2WOH A;  3WOE B;  4AKY A;  2XRX B;  3LT9 A;  4K90 B;  1I70 A;  3JUP A;  4LSO A;  4J5G A;  2CWV A;  2L1S A;  2J8X B;  3WA2 X;  4O3V A;  2W6J H;  1BSE A;  3DZL A;  3NM7 A;  3Q3F A;  4KT3 B;  3X3Y A;  1JZO A;  2CX1 A;  1E97 A;  1F8N A;  3G0K A;  5D82 A;  1Q81 4;  3S29 A;  1JBT A;  1RN7 A;  1STF I;  3OWU A;  4WYK A;  3MG2 A;  1DMQ A;  2D42 A;  4RNY A;  1OUN A;  1W6C A;  4HM3 B;  1JB2 A;  3SOY A;  2XSH B;  4NPB A;  1O7P B;  2QIY A;  1W6G A;  3X40 A;  3CXC 2;  3S27 A;  3PYJ A;  3RGA A;  3T8N A;  3WMD A;  3OWY A;  1ASK A;  1I2F A;  1IYY A;  4X2H A;  4U13 A;  1T2H A;  4BU4 A;  1GMQ A;  1YJN 3;  1BIR A;  1GY7 A;  1UI7 A;  3D3L A;  1B3S A;  1X1Y A;  1Z1S A;  6GSP A;  3FGY A;  4LZI A;  4HVN A;  1ZX2 A;  3T8U A;  1TJD A;  3CCL 3;  3F7S A;  2R41 A;  1DVD A;  1EUI C;  2HMK B;  5IG3 A;  4X2O A;  3TDG A;  3A5E A;  2A15 A;  2KCD A;  8CHO A;  3PXM A;  4J9A A;  3V98 A;  5TGN A;  4FMC A;  2SAR A;  1GOV A;  2C10 A;  2CC3 A;  1UW1 A;  1CH0 A;  3B8L A;  2LYX A;  2P0X A;  2OWP A;  1WMP A;  1R4Y A;  3EF8 A;  3G16 A;  3UL6 A;  1A90 A;  3LTB A;  6RNT A;  5IF6 A;  1OF5 A;  3LT8 A;  5HOH A;  1RRH A;  1A2V A;  4JRF A;  1WTH A;  4WHA A;  3DXO A;  2CFD A;  3LXU X;  3U97 A;  4GL6 A;  2GU1 A;  2ZHX B;  3AHS A;  3FF2 A;  3NBB A;  5D83 A;  1FW7 A;  2XFT A;  1N8R 4;  1IQX A;  3OW2 2;  1C54 A;  5JBS A;  1GSP A;  1ULJ B;  3DMC A;  5AEW B;  1BVI A;  2WOF A;  1M90 4;  2H0I A;  1RGK A;  3NHX A;  3WR2 A;  3PCS A;  3S5C A;  3EHC A;  1Q82 4;  1BNR A;  1MWU A;  1W6Y A;  1QVF 2;  3CCU 3;  1YJ9 3;  3EN1 B;  1DE3 A;  3LZA A;  3WHO A;  2IYJ A;  3E99 A;  1N9J A;  1UCJ A;  1IQY A;  5FW5 A;  5M1A A;  1PU4 A;  4XBY A;  4R1K A;  4HJL B;  3FG3 A;  4K1U A;  2Z76 A;  1JKG B;  1GYB A;  1YIT 3;  1EG9 B;  1LRA A;  3H3H A;  2CFL A;  1ULI B;  1CYV A;  3FG4 A;  4K61 A;  1SII A;  1T3B A;  1W01 A;  3URP A;  1S5A A;  2OTL 3;  1W00 A;  3RDE A;  1RGC A;  1VQ9 3;  3DGO A;  1JZD A;  1RHL A;  1VQM 3;  1BUJ A;  1BGS A;  3F9S A;  5BU4 A;  2CHC A;  3MWZ A;  2W03 A;  1B20 A;  1BSC A;  4N6M A;  1DMN A;  1D6U A;  3LTC A;  3O8Y A;  1SPU A;  1OAC A;  3ECF A;  4WYK B;  4Q53 A;  1GMR A;  2B24 B;  2W9P A;  3HX8 A;  1Q7H A;  3B4P A;  4NHF A;  1JN5 A;  5IG5 A;  3FZW A;  4I5Q A;  1ZGX A;  4LYL B;  4EC6 A;  5IG4 A;  2BMO B;  1I2E A;  1LOV A;  1I0V A;  1OH0 A;  1I3F A;  2K3D A;  4R9K A;  3FKA A;  4O8S A;  1A2P A;  2CWU A;  3Q90 A;  3Q2P A;  1VQO 3;  1OPY A;  3K9M C;  1M1X B;  1LXE A;  4KFE A;  1BNE A;  1US1 A;  4N6N B;  1M9G A;  2H0H A;  1QVG 2;  3AMO A;  1RN1 A;  3DH2 A;  3BND A;  1STD A;  1WMO A;  3HI7 A;  5AYS C;  1TIJ A;  2B1X B;  3B4O A;  4N6L A;  1IQ8 A;  1TRQ A;  3CPO A;  3HIG A;  3K63 A;  3CD6 3;  3KE7 A;  4L8P A;  3NM2 A;  4XM4 A;  2F5W A;  4QWT A;  1D6Z A;  4OK0 A;  3D9R A;  4I4K A;  2ML6 A;  1MWS A;  1O7H B;  1GY5 A;  3NXJ A;  1V74 A;  3CNM A;  4ORL A;  2OOV A;  1EEJ A;  2UUG C;  3EJV A;  4EXR A;  4MMY B;  1IT8 A;  1IDP A;  1OF5 B;  2XH9 A;  7STD A;  1YI2 3;  3F7X A;  5FGO A;  3DY5 A;  1B2S A;  5JPU A;  4FR9 A;  4WFO A;  2YX9 A;  1LNI A;  2OOV C;  2MC8 A;  3AGN A;  3DUK A;  1MNL A;  1RMS A;  2KRT A;  3GZY B;  2Y73 A;  5ELJ A;  3VF1 A;  1WQL B;  4N6O B;  4KZ1 A;  3PZW A;  2QGU A;  4RNT A;  4EV5 A;  1VQN 3;  4PEJ A;  1WNH A;  1O7N B;  5M19 A;  1V58 A;  3CCR 3;  1TTO A;  3HK4 A;  4N6U A;  2GBW B;  3Q1C A;  1I0X A;  3WDG B;  1YHQ 3;  1AV4 A;  1VQ4 3;  1GOY A;  1UDI I;  4IIA A;  1PFP A;  4RZM A;  2FGT A;  4BL2 A;  1RNB A;  1QJG A;  1U5O A;  2IA7 A;  1Q86 4;  2Q07 A;  2KF5 A;  3EX9 A;  1VQ6 3;  5G1L A;  2AAD A;  3V99 A;  3PCR A;  1B2U A;  4HBR A;  5AIF A;  4N6V 0;  3CC2 3;  1NJI 4;  5IW9 A;  1EKM A;  2Y74 A;  2INX A;  1FYS A;  5M18 A;  2OQE A;  2KF6 A;  2P05 A;  3DGL A;  2AAE A;  4HKV B;  3KZT A;  3SX1 A;  1QAK A;  4H61 A;  1ROA A;  1LOW A;  1AVL A;  3D4A A;  2KF4 A;  1UUV B;  3LOY A;  1BAN A;  5IEO A;  2RBI A;  1CQS A;  1RTU A;  2W56 A;  2ML5 A;  1N5H A;  1N8Q A;  2F4Y A;  3SOA A;  5IEP A;  1ZS7 A;  1VQK 3;  4FCZ A;  1T5Y A;  2I9W A;  1VQQ A;  1FGR A;  1BNS A;  5KP4 A;  2CIU A;  1W2Z A;  1RGG A;  2JDI H;  3IPT A;  5AI1 A;  3CCE 3;  4MMX B;  1OHS A;  1JB5 A;  1JN5 B;  1UGI A;  1VZZ A;  4HZB B;  4KVH A;  1N5P A;  1T2I A;  3GZB A;  1IV7 A;  1JBR A;  3BU4 A;  1GMP A;  3BLZ A;  2C4B A;  5EVH A;  4MMZ B;  3FLJ A;  5CLK A;  5BIR A;  1YIJ 3;  8RNT A;  2P0M A;  2C11 A;  3AMO B;  1FGO A;  1HZ1 A;  3N54 B;  3U1W A;  4HM7 B;  2W04 A;  3CCQ 3;  2F98 A;  5BXQ A;  1OHO A;  1X1U A;  2ZA4 A;  1TFO A;  3UNL A;  1W5Z A;  5IEN A;  1UGH I;  4EW5 A;  2KF3 A;  3F8X A;  4CPK A;  1M1K 4;  3KN4 A;  2CK3 H;  2GXF A;  2P38 A;  2UGI A;  1A2K A;  1OGZ A;  1LNH A;  2BU4 A;  5G1K A;  2CFK A;  3G71 3;  1W7C A;  4EV2 A;  1D6Y A;  2E2T A;  3AHW A;  3K0Z A;  2Z77 A;  3KKG A;  1GD4 A;  3JUO A;  4J5K A;  3F8H A;  1HYF A;  1B21 A;  3EBY A;  3GZR A;  4XDV A;  3UL5 A;  4BL3 A;  4XBT A;  4HZ9 B;  5ELU A;  1YGW A;  1EQK A;  1GY6 A;  4GSP A;  1HU9 A;  2RGQ A;  3JVC A;  2M7O A;  3N9H A;  1IK3 A;  2R4I A;  3FG1 A;  1O7G B;  1TUH A;  1DMM A;  1BSD A;  3D79 A;  1K9M 4;  4RNZ A;  3NV0 A;  4HM2 B;  5CF2 A;  1LOX A;  1BUQ A;  3D5G A;  4J8T A;  3J7Y d;  1YGE A;  3JUQ A;  2W9Q A;  3H51 A;  3KSE D;  1OHP A;  5CK6 A;  4GHO A;  3NUV A;  3NQY A;  2V1L A;  3X41 A;  2E2V A;  1NDO B;  2IY2 A;  2O9U X;  2XF3 A;  3OV4 A;  4LEH A;  1AVK A;  3K5T A;  1BRG A;  2XFS A;  2RSX A;  2HMN B;  2XEP A;  3I0Y A;  3D5I A;  4O02 B;  1CEW I;  5D81 A;  2CW9 A;  5LC6 A;  3EBT A;  4RBN A;  3FCS B;  1FGM A;  4HM6 B;  5EQL A;  2IMJ A;  1V57 A;  1JV2 B;  2CWT A;  3G4S 3;  4R4K A;  4FMD A;  1BRJ A;  5DRV A;  5AIG A;  3X3Z A;  1BSB A;  2FXT A;  1ZO2 A;  4BTW A;  9RNT A;  2F5M A;  1G02 A;  2GBX B;  1RSN A;  3X42 A;  3BIR A;  1MWT A;  2W56 B;  1RCL A;  2MF7 A;  2YFI B;  1VQL 3;  1BOX A;  3LML A;  3CCM 3;  1KD1 4;  1N9E A;  1JRQ A;  1NU3 A;  1JBS A;  3CMA 3;  1NWW A;  1FUW A;  1WMN A;  1MGW A;  2F56 A;  3WOF B;  4DKI A;  1VQP 3;  1KC8 4;  2HMJ B;  1NB3 I;  4ILF A;  4R80 A;  1S72 3;  4LGQ A;  4EYC A;  2E2U A;  3QRD A;  1R4C A;  3MG3 A;  2W0Q A;  5EEO A;  3GSP A;  1RRL A;  7RNT A;  4BTY A;  3EQQ B;  1IVU A;  3SYU A;  1RGA A;  1RGF A;  1ROV A;  3CPW 2;  5CF1 A;  1QMA A;  3F14 A;  2IUK A;  2ZL8 A;  1VQ5 3;  3OXA A;  4HAA A;  1UCK A;  1VQ8 3;  1Q40 A;  2PZV A;  1NB5 I;  3GWR A;  2CFW A;  1KWI A;  2BMR B;  1MOL A;  1E3R A;  4AKZ A;  4IPB A;  3CCJ 3;  1O7M B;  1K41 A;  1O7W B;  3ALA A;  3ZG0 A;  1QAF A;  3UJM A;  2W2C A;  1IV9 A;  1RGE A;  1JJ2 2;  2BHM A;  1Q7Y 4;  3KCH A;  1I3I A;  4HM1 B;  4L8O A;  2CG0 A;  4K1V A;  1Y4K A;  2F86 B;  1VQ7 3;  1BRS A;  2FNQ A;  1FGT A;  1HKX A;  1OGX A;  3RNT A;  1W02 A;  1C7H A;  3N8B A;  3SXX A;  3NBJ A;  3DM8 A;  3MSO A;  3OX9 A;  3STD A;  1EA2 A;  2JQ5 A;  3ZFZ A;  2QA4 3;  1W2B 2;  3MHE A;  3VSY A;  1GOU A;  5IER A;  3ZG5 A;  1K8A 4;  2PNC A;  1YNV X;  4WWU C;  4L7K A;  3DGM A;  3CCS 3;  3DGN A;  4FMA A;  2OQE C;  1BSA A;  4HM0 B;  1BAO A;  1KQS 2;  3GZX B;  4G1M B;  4N6T A;  2XSO B;  3IMA B;  1LQG C;  1RGH A;  2WO0 A;  5HGR A;  5A0O B;  2GEX A;  3BNE A;  3CU3 A;  5DRE A;  1FZU A;  4O2H A;  1LQM B;  3V92 A;  1UCI A;  2BNG A;  1LVN A;  2CX0 A;  3NV0 B;  5AII A;  1SJW A;  3GRD A;  2CH9 A;  3L0R A;  1J2B A;  5CXO A;  1QAL A;  1BNF A;  1UCL A;  3HII A;  3T0U A;  4HOH A;  3SLU A;  1YVS A;  3X3X A;  3HZP A;  1I2G A;  3BNB A;  4XBX A;  1MGR A;  3MKI A;  4JF8 A;  1RCK A;  2HOH A;  3F40 A;  4STD A;  3VGN A;  1IT7 A;  3I56 3;  1UUG B;  2F99 A;  3EE1 A;  1BRH A;  4FCM A;  4HM5 B;  5AEU B;  7GSP A;  2LQV A;  2XGL A;  1IVW A;  1FUT A;  3RGR A;  3B7C A;  1G0T A;  3K7C A;  1SIH A;  1UI8 A;  3NBR A;  3CC4 3;  3JUM A;  1I8V A;  3KII A;  2CFG A;  1MWR A;  3EB8 A;  1RNT A;  4LMI A;  1X1W A;  1B2Z A;  2GSP A;  3A76 A;  3G8Z A;  4N3V A;  1AR0 A;  2O3O A;  3I55 3;  6STD A;  1B2M A;  3MPH A;  1AY7 A;  1IVV A;  1BNI A;  3GAX A;  3QK9 A;  1B27 A;  4NRE A;  5GSP A;  5RNT A;  1U8C B;  1GD3 A;  3SVA A;  5G2G A;  1L5G B;  1BNG A;  5IG0 A;  4BIR A;  3AGO A;  4WP5 A;  1K73 4;  3CCV 3;  1PYL A;  2XR8 B;  2YFJ B;  1RGL A;  1ISK A;  1FGQ A;  1DYU A;  2H0G A;  2BMQ B;  1NO3 A;  2QEX 3;  2P09 A;  2BIR A;  3HOH A;  4GB5 A;  2OTJ 3;  2OCT A;  3MYT A;  3FH1 A;  4ZM8 A;  3SED A;  4TX4 A;  2HMM B;  4FMB A;  2IUJ A;  1IU7 A;  1FUS A;  5AIH A;  2HML B;  3MG1 A;  1Q40 B;  3IJE B;  4KFD A;  1B2X A;  2Z7A A;  1TU5 A;  2BO9 B;  2XGN A;  3LH4 A;  1TP6 A;  2CG1 A;  4R9L A;  1Q9E A;  5KP3 A;  2K54 A;  3BB9 A;  3ROB A;  1G96 A;  3OWS A;  1JNQ A;  3S28 A;  4KFF A;  1TFK A;  4MEI A;  4FCJ A;  1Q42 A; 
#chains in the Genus database with same CATH homology
 4AEQ A;  4XDW A;  3EC9 A;  3WOD G;  1RKY A;  2SBL A;  3BNC A;  5AYR B;  2RFR A;  2D1W A;  4OVM A;  3WA3 A;  3CNX A;  4CDL A;  3PGB A;  4IT7 A;  4EBG A;  3CME 3;  1KSI A;  2WGQ A;  2L4V A;  1CYU A;  1SQW A;  1E3V A;  2GU3 A;  2KXG A;  4H3U A;  1A67 A;  5KP1 A;  1YVB I;  2WGO A;  3LTD A;  5I97 A;  1FA3 A;  3KSP A;  4CCV A;  4MJD A;  3PS8 A;  2UX0 A;  3NX0 A;  2GEY A;  5LC7 A;  3UB1 A;  3CC7 3;  3EN8 A;  5BVB A;  1GS3 A;  4HM8 B;  2K0M A;  3FSD A;  5STD A;  3G6E 3;  2YFL B;  3LYG A;  2CKF B;  1DVC A;  3FF0 A;  1JB4 A;  3NQZ A;  4BTX A;  5JPP A;  1RJO A;  3LTA A;  1IVX A;  4HM4 B;  2BT3 A;  3M8C A;  3ER7 A;  1UUW B;  2RCD A;  3JUN A;  4HYZ A;  2Z6B A;  1OCV A;  4OUQ A;  1JKG A;  2ZDJ A;  1YJW 3;  2HMO B;  2STD A;  1W4N A;  4XB5 A;  3S67 A;  3KFQ C;  1K28 A;  3WOE B;  2WOH A;  4AKY A;  2XRX B;  3LT9 A;  4K90 B;  3JUP A;  4LSO A;  2CWV A;  3WA2 X;  4O3V A;  2W6J H;  3DZL A;  3NM7 A;  3X3Y A;  1E97 A;  1F8N A;  3G0K A;  5D82 A;  1Q81 4;  3S29 A;  1RN7 A;  1STF I;  3OWU A;  4WYK A;  3MG2 A;  1DMQ A;  2D42 A;  4RNY A;  1OUN A;  1W6C A;  4HM3 B;  1JB2 A;  3SOY A;  2XSH B;  1O7P B;  2QIY A;  1W6G A;  3X40 A;  3CXC 2;  3S27 A;  3PYJ A;  3RGA A;  3T8N A;  3WMD A;  3OWY A;  1ASK A;  4X2H A;  4U13 A;  1YJN 3;  1GY7 A;  1UI7 A;  3D3L A;  1Z1S A;  3FGY A;  4LZI A;  4HVN A;  1ZX2 A;  3T8U A;  3CCL 3;  3F7S A;  1DVD A;  2HMK B;  5IG3 A;  4X2O A;  3TDG A;  8CHO A;  2A15 A;  2KCD A;  3PXM A;  4J9A A;  3V98 A;  5TGN A;  4FMC A;  2CC3 A;  2C10 A;  1UW1 A;  3B8L A;  2LYX A;  2P0X A;  2OWP A;  1WMP A;  3EF8 A;  3UL6 A;  3G16 A;  1A90 A;  3LTB A;  5IF6 A;  1OF5 A;  3LT8 A;  1RRH A;  1A2V A;  4JRF A;  1WTH A;  4WHA A;  3DXO A;  2CFD A;  3LXU X;  3U97 A;  4GL6 A;  2GU1 A;  3FF2 A;  3NBB A;  5D83 A;  2XFT A;  1N8R 4;  1IQX A;  3OW2 2;  5JBS A;  1ULJ B;  3DMC A;  5AEW B;  2WOF A;  1M90 4;  1Q82 4;  3NHX A;  3PCS A;  3S5C A;  3EHC A;  1W6Y A;  1QVF 2;  3CCU 3;  1YJ9 3;  3EN1 B;  3LZA A;  3E99 A;  1N9J A;  1IQY A;  5FW5 A;  1PU4 A;  4XBY A;  4R1K A;  4HJL B;  3FG3 A;  4K1U A;  2Z76 A;  1JKG B;  1GYB A;  1YIT 3;  1EG9 B;  3H3H A;  2CFL A;  1ULI B;  1CYV A;  3FG4 A;  4K61 A;  1SII A;  1W01 A;  1S5A A;  2OTL 3;  1W00 A;  3RDE A;  1VQ9 3;  3DGO A;  1VQM 3;  3F9S A;  2CHC A;  3MWZ A;  2W03 A;  4N6M A;  1DMN A;  1D6U A;  3LTC A;  3O8Y A;  1SPU A;  1OAC A;  3ECF A;  4WYK B;  4Q53 A;  2B24 B;  2W9P A;  3HX8 A;  3B4P A;  4NHF A;  1JN5 A;  5IG5 A;  3FZW A;  4EC6 A;  5IG4 A;  2BMO B;  1OH0 A;  4R9K A;  1VQO 3;  3FKA A;  4O8S A;  2CWU A;  3Q90 A;  3Q2P A;  1OPY A;  3K9M C;  1M1X B;  1LXE A;  4KFE A;  1US1 A;  4N6N B;  1QVG 2;  1M9G A;  3AMO A;  3HI7 A;  3BND A;  1STD A;  1WMO A;  5AYS C;  1TIJ A;  2B1X B;  3B4O A;  4N6L A;  1IQ8 A;  3HIG A;  3CPO A;  3CD6 3;  3K63 A;  3KE7 A;  4L8P A;  3NM2 A;  4XM4 A;  4QWT A;  1D6Z A;  4OK0 A;  3D9R A;  4I4K A;  2ML6 A;  1O7H B;  1GY5 A;  3NXJ A;  1V74 A;  3CNM A;  4ORL A;  2OOV A;  3EJV A;  4EXR A;  4MMY B;  1IT8 A;  1IDP A;  1OF5 B;  2XH9 A;  7STD A;  1YI2 3;  3F7X A;  5FGO A;  3DY5 A;  5JPU A;  4FR9 A;  4WFO A;  2YX9 A;  2OOV C;  2MC8 A;  3DUK A;  1MNL A;  2KRT A;  3GZY B;  3VF1 A;  2Y73 A;  5ELJ A;  1WQL B;  4N6O B;  4KZ1 A;  3PZW A;  2QGU A;  4EV5 A;  1VQN 3;  4PEJ A;  1WNH A;  1O7N B;  3CCR 3;  3HK4 A;  4N6U A;  2GBW B;  3Q1C A;  3WDG B;  1YHQ 3;  1AV4 A;  1VQ4 3;  4IIA A;  1PFP A;  4RZM A;  2FGT A;  1QJG A;  1U5O A;  2IA7 A;  1Q86 4;  2Q07 A;  3EX9 A;  1VQ6 3;  3V99 A;  3PCR A;  4HBR A;  3CC2 3;  5AIF A;  4N6V 0;  1NJI 4;  5IW9 A;  1EKM A;  2Y74 A;  2INX A;  2OQE A;  2P05 A;  3DGL A;  4HKV B;  3KZT A;  3SX1 A;  1QAK A;  4H61 A;  1ROA A;  1AVL A;  1UUV B;  3LOY A;  5IEO A;  1CQS A;  2W56 A;  2ML5 A;  1N5H A;  1N8Q A;  3SOA A;  5IEP A;  1VQK 3;  4FCZ A;  1T5Y A;  2I9W A;  1FGR A;  5KP4 A;  2CIU A;  1W2Z A;  2JDI H;  3IPT A;  5AI1 A;  3CCE 3;  4MMX B;  1OHS A;  1JB5 A;  1JN5 B;  1VZZ A;  4HZB B;  4KVH A;  1N5P A;  3GZB A;  1IV7 A;  3BLZ A;  5EVH A;  4MMZ B;  3FLJ A;  5CLK A;  1YIJ 3;  2P0M A;  2C11 A;  3AMO B;  1FGO A;  3N54 B;  3U1W A;  4HM7 B;  2W04 A;  3CCQ 3;  2F98 A;  5BXQ A;  1OHO A;  1TFO A;  3UNL A;  1W5Z A;  5IEN A;  3F8X A;  1M1K 4;  3KN4 A;  2CK3 H;  2GXF A;  2P38 A;  1A2K A;  1OGZ A;  1LNH A;  2CFK A;  3G71 3;  1W7C A;  4EV2 A;  1D6Y A;  2E2T A;  3K0Z A;  2Z77 A;  3KKG A;  1GD4 A;  3JUO A;  3F8H A;  3EBY A;  3GZR A;  4XDV A;  3UL5 A;  4XBT A;  4HZ9 B;  5ELU A;  1EQK A;  1GY6 A;  1HU9 A;  2RGQ A;  3JVC A;  2M7O A;  3N9H A;  1IK3 A;  2R4I A;  3FG1 A;  1O7G B;  1TUH A;  1DMM A;  1K9M 4;  4RNZ A;  3NV0 A;  4HM2 B;  5CF2 A;  1LOX A;  1BUQ A;  4J8T A;  3J7Y d;  1YGE A;  3JUQ A;  2W9Q A;  3H51 A;  3KSE D;  1OHP A;  5CK6 A;  3NUV A;  3NQY A;  2V1L A;  3X41 A;  2E2V A;  1NDO B;  2O9U X;  2XF3 A;  3OV4 A;  4LEH A;  1AVK A;  3K5T A;  2XFS A;  2RSX A;  2HMN B;  2XEP A;  3I0Y A;  4O02 B;  5D81 A;  1CEW I;  2CW9 A;  5LC6 A;  3EBT A;  4RBN A;  3FCS B;  1FGM A;  4HM6 B;  5EQL A;  2IMJ A;  1JV2 B;  2CWT A;  3G4S 3;  4R4K A;  4FMD A;  5DRV A;  5AIG A;  3X3Z A;  2FXT A;  1ZO2 A;  4BTW A;  2GBX B;  3X42 A;  2W56 B;  2MF7 A;  2YFI B;  1VQL 3;  3LML A;  3CCM 3;  1KD1 4;  1N9E A;  1JRQ A;  1NU3 A;  3CMA 3;  1NWW A;  1FUW A;  1WMN A;  1KC8 4;  3WOF B;  1VQP 3;  2HMJ B;  1NB3 I;  4R80 A;  1S72 3;  4LGQ A;  4EYC A;  2E2U A;  3QRD A;  1R4C A;  3MG3 A;  2W0Q A;  5EEO A;  1RRL A;  4BTY A;  3EQQ B;  1IVU A;  1ROV A;  3CPW 2;  5CF1 A;  1QMA A;  3F14 A;  2IUK A;  2ZL8 A;  1VQ5 3;  3OXA A;  1VQ8 3;  1Q40 A;  2PZV A;  1NB5 I;  3GWR A;  2CFW A;  1KWI A;  2BMR B;  1MOL A;  1E3R A;  4AKZ A;  4IPB A;  3CCJ 3;  1O7M B;  1K41 A;  1O7W B;  3ALA A;  1QAF A;  3UJM A;  2W2C A;  1IV9 A;  1JJ2 2;  2BHM A;  1Q7Y 4;  4HM1 B;  4L8O A;  2CG0 A;  4K1V A;  1Y4K A;  2F86 B;  1VQ7 3;  2FNQ A;  1FGT A;  1HKX A;  1OGX A;  1W02 A;  1C7H A;  3N8B A;  3SXX A;  3NBJ A;  3DM8 A;  3MSO A;  3OX9 A;  3STD A;  1EA2 A;  2JQ5 A;  2QA4 3;  1W2B 2;  3MHE A;  3VSY A;  5IER A;  1K8A 4;  2PNC A;  4WWU C;  4L7K A;  3DGM A;  3CCS 3;  3DGN A;  4FMA A;  2OQE C;  4HM0 B;  1KQS 2;  3GZX B;  4G1M B;  4N6T A;  2XSO B;  3IMA B;  5HGR A;  2WO0 A;  5A0O B;  2GEX A;  3BNE A;  3CU3 A;  5DRE A;  4O2H A;  3V92 A;  2BNG A;  1LVN A;  3NV0 B;  5AII A;  1SJW A;  3GRD A;  2CH9 A;  3L0R A;  1J2B A;  5CXO A;  1QAL A;  3HII A;  3T0U A;  3X3X A;  3SLU A;  3HZP A;  3BNB A;  4XBX A;  3MKI A;  4JF8 A;  4STD A;  3I56 3;  3F40 A;  3VGN A;  1IT7 A;  2F99 A;  3EE1 A;  4FCM A;  4HM5 B;  5AEU B;  2LQV A;  2XGL A;  1IVW A;  3RGR A;  3B7C A;  3K7C A;  1SIH A;  1UI8 A;  3NBR A;  3CC4 3;  3JUM A;  3KII A;  2CFG A;  3EB8 A;  4LMI A;  4N3V A;  3A76 A;  3G8Z A;  1AR0 A;  2O3O A;  3I55 3;  6STD A;  3MPH A;  1IVV A;  3QK9 A;  3GAX A;  4NRE A;  1U8C B;  1GD3 A;  3SVA A;  5G2G A;  1L5G B;  5IG0 A;  4WP5 A;  1K73 4;  3CCV 3;  2XR8 B;  2YFJ B;  1ISK A;  1FGQ A;  1DYU A;  2BMQ B;  1NO3 A;  2QEX 3;  2P09 A;  4GB5 A;  2OTJ 3;  2OCT A;  3MYT A;  3FH1 A;  4ZM8 A;  3SED A;  4TX4 A;  2HMM B;  4FMB A;  2IUJ A;  1IU7 A;  5AIH A;  2HML B;  3MG1 A;  1Q40 B;  3IJE B;  4KFD A;  2Z7A A;  1TU5 A;  2BO9 B;  2XGN A;  3LH4 A;  1TP6 A;  2CG1 A;  4R9L A;  3ROB A;  5KP3 A;  2K54 A;  3BB9 A;  1G96 A;  3OWS A;  1JNQ A;  3S28 A;  4KFF A;  1TFK A;  4MEI A;  4FCJ A;  1Q42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...