3Q90A

Crystal structure of the ntf2 domain of ras gtpase-activating protein-binding protein 1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
121
Chain Sequence
SPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras GTPase-activating protein-binding protein 1
publication title Crystal structure of the NTF2 domain of Ras GTPase-activating protein-binding protein 1
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 36
structure length 121
sequence length 131
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3q90A00
4L8PA 4R9LA 1O7MB 5CLKA 4K1VA 3STDA 5IG5A 3I0YA 1GS3A 1O7NB 1NU3A 3JUMA 1OGZA 4HM5B 5IENA 3M8CA 1JB2A 4HM8B 2YFIB 2GEYA 5EVHA 1QJGA 4J8TA 1W01A 3GZYB 1W6YA 3OV4A 4XBXA 1QMAA 5CF1A 1ULIB 1OF5A 2STDA 2CKFB 1ULJB 3MKIA 3OXAA 3DUKA 3G0KA 2CHCA 3EN1B 1O7PB 1ASKA 3D9RA 1S5AA 3EX9A 5AI1A 1DMMA 3EC9A 1Q42A 5AIHA 5KP4A 3UJMA 3WMDA 1ZX2A 2XSHB 2K54A 3G8ZA 3B8LA 2RCDA 3OWUA 4HM4B 3T8NA 1W02A 3BLZA 5DREA 1E3VA 4OVMA 4WWUC 4WYKB 1O7HB 3F7SA 1EG9B 3DXOA 3MG1A 3NHXA 1WQLB 1Q40A 7STDA 2BMRB 2F86B 3K0ZA 2BNGA 1BUQA 2F99A 4GB5A 1TP6A 1TUHA 1OPYA 2HMKB 1JKGA 3H3HA 1DMNA 5AEWB 5IF6A 1C7HA 4CDLA 1E97A 3F9SA 3JUOA 3MG3A 1JKGB 3DM8A 3MHEA 2I9WA 2W2CA 6STDA 1U5OA 3NV0B 3MG2A 1GY7A 4HJLB 1VZZA 3FLJA 1GY6A 4L7KA 4XDVA 5CK6A 3F7XA 4IIAA 4XBTA 1K41A 2F98A 1GYBA 3FF2A 4OUQA 1UUVB 3KSPA 1W00A 1DMQA 2BMOB 2RGQA 3SOYA 3FSDA 5KP1A 3GWRA 3MYTA 1SJWA 5AIGA 3EN8A 1OH0A 2HMOB 4MJDA 1OGXA 2YFLB 5BXQA 4I4KA 3BB9A 4LGQA 2HMLB 4LEHA 3F8HA 3EJVA 1JB5A 2OWPA 4HM3B 2GBXB 5KP3A 5IERA 1UUWB 3A76A 3EBYA 5IEOA 3SEDA 3KZTA 2QGUA 5G2GA 3LYGA 2GEXA 4XDWA 3FF0A 5CXOA 3NBRA 4WYKA 2HMJB 3NM2A 3FGYA 4RZMA 3F14A 4N3VA 4HM0B 2BMQB 5STDA 1OUNA 4HM6B 3KE7A 1JB4A 3UNLA 3NUVA 3JUNA 4HZ9B 3GZBA 4HM1B 4HZBB 4KVHA 3FZWA 2XRXB 4R9KA 3OX9A 3HK4A 3CNXA 4HKVB 8CHOA 3IPTA 3EHCA 5AIFA 3RGAA 5FW5A 3S5CA 3NV0A 4HVNA 4FCMA 1OHPA 2Z77A 3B4OA 4L8OA 4FCJA 3ROBA 4XB5A 1STDA 1EA2A 3HZPA 4HM2B 3Q90A 4X2OA 2PZVA 5IG4A 3GZXB 2XSOB 4PEJA 1NDOB 2QIYA 3F40A 3DZLA 1NWWA 2GXFA 2HMNB 2IMJA 4U13A 3VGNA 3JUQA 5CF2A 4Q53A 5IEPA 3RGRA 2XR8B 2B1XB 5BVBA 4LMIA 5AIIA 5D81A 3ER7A 3DMCA 5D82A 5JPPA 3MSOA 3EBTA 1A2KA 4HM7B 5JPUA 4XM4A 3E99A 3CNMA 5AEUB 1ISKA 2R4IA 2JQ5A 1OCVA 1HKXA 2A15A 1O7GB 4ORLA 1OF5B 3EQQB 4X2HA 1OHOA 3ECFA 3HX8A 5D83A 4J9AA 4STDA 3EF8A 1E3RA 1O7WB 5TGNA 1IDPA 3KKGA 1Z1SA 1OHSA 1CQSA 2RFRA 3FH1A 3JUPA 3F8XA 4WP5A 5DRVA 5IG0A 1AR0A 2HMMB 4XBYA 3CPOA 3VSYA 3NXJA 3G16A 3FKAA 2UX0A 2Z76A 2GBWB 2B24B 2YFJB 1JN5A 3K7CA 4K1UA 3B4PA 3B7CA 1GY5A 3CU3A 3LZAA 3GZRA 5HGRA 2INXA 3OWYA 3OWSA 1JN5B 5IG3A 4R1KA 3H51A 3SOAA 1Q40B 3GRDA 1ZO2A 2Z7AA 3T8UA 4H3UA
chains in the Genus database with same CATH superfamily
4L8PA 4NHFA 4ZM8A 3D5IA 4J5KA 1LVNA 1UI7A 1D6UA 4HAAA 1KWIA 1N9JA 4R9LA 3CCJ3 5A0OB 1O7MB 5CLKA 3WOEB 4K1VA 3STDA 5IG5A 3EE1A 1EQKA 4BIRA 4FCZA 2XF3A 3I0YA 1GS3A 3EB8A 1G02A 3PCRA 1O7NB 1BRNL 1NU3A 3JUMA 1OGZA 3U97A 4HM5B 1A90A 2BHMA 1FA3A 5IENA 3G713 1RRHA 1SPUA 3M8CA 2JDIH 2XEPA 1BNRA 1JB2A 4HM8B 3K5TA 1RGGA 2P05A 1LXEA 3S27A 2YFIB 1STFI 2GEYA 4TX4A 1QJGA 1RGCA 2PNCA 4J8TA 5EVHA 1R4YA 1W01A 3GZYB 1W6YA 3OV4A 1BNIA 1MGWA 2CX0A 3G6E3 5ELJA 4XBXA 4EC6A 1K734 2CX1A 1I0VA 1QMAA 2CH9A 2ML5A 1KC84 3NQYA 3V98A 3WODG 5CF1A 1ULIB 3NX0A 4H61A 1OF5A 2STDA 1YJ93 1IVUA 1LOVA 3OW22 3X42A 1W6GA 1RJOA 1BRJA 4RBNA 1GOUA 2CKFB 1ULJB 3MKIA 3X3YA 3OXAA 3LTCA 4J5GA 2CK3H 2IUKA 3DUKA 3G0KA 1Y4KA 1YNVX 4KFFA 4NPBA 2CHCA 1RDSA 5FGOA 2W0QA 3EN1B 1B2MA 3CD63 4O2HA 1O7PB 4K61A 1ASKA 3D9RA 1WNHA 2ZL8A 2BU4A 1S5AA 1TTOA 2L1SA 2KF4A 3EX9A 2D42A 5AI1A 1FGMA 2KF6A 1DMMA 1MWUA 4R80A 3EC9A 2LQVA 3N8BA 3GAXA 1YGWA 1Q42A 5AIHA 1LOWA 1FUTA 5KP4A 3UJMA 3WMDA 1TU5A 1ZX2A 1MGRA 2XSHB 3CXC2 3MPHA 2XFTA 2K54A 3BNCA 3G8ZA 3KFQC 1X1YA 3U1WA 4EV2A 1N5HA 4WFOA 4OK0A 2OQEA 2XGNA 2ZHXB 3S67A 3DGYA 3B8LA 1MWSA 1IV9A 2RCDA 1BSBA 5LC7A 3AGNA 3LXUX 3ZG0A 4AKZA 2CG1A 3DGMA 3OWUA 4HM4B 1JJ22 2ZA4A 3T8NA 1EUIC 3SXXA 8RNTA 1W02A 3BLZA 2OTJ3 1FUSA 2P0XA 1E3VA 3LTAA 3NBBA 4OVMA 2HOHA 4WWUC 1UCIA 5DREA 3WR2A 2OCTA 1PYLA 4WYKB 5JBSA 1O7HB 2FGTA 3FG1A 1YJW3 2F5WA 3F7SA 3WA3A 1EG9B 1D6ZA 2Q07A 2IA7A 3DXOA 4FMCA 4JF8A 3V99A 5BIRA 1VQ53 2RBIA 1VQ43 3MG1A 3NHXA 1SIIA 1WQLB 1I70A 1I2EA 1Q40A 3NM7A 4RNTA 2OOVC 5IW9A 1M1K4 1IQYA 1QALA 7STDA 2BMRB 1GD4A 2J8XB 1RGKA 4CJNA 2F86B 3I563 1V74A 4LYLB 4N6LA 3K0ZA 1W2B2 1YJN3 2W9QA 1JZOA 1ROVA 2BNGA 1BUQA 2F4YA 1UGHI 2F99A 1UGIA 1GOVA 4GB5A 3CME3 1RN1A 1TP6A 1DE3A 1VQO3 3BNEA 4CPKA 1TUHA 1OPYA 2HMKB 1JKGA 1VQQA 4EYCA 3CCS3 4FMBA 1SQWA 3LT8A 3H3HA 2BO9B 1DMNA 3X3ZA 5AEWB 1AY7A 1BANA 5IF6A 4BU4A 1BRKA 2F5MA 1C7HA 1EKMA 1JRQA 3UB1A 2XFSA 4CDLA 3CCM3 3CPW2 1E97A 4AEQA 4DKIA 1RMSA 3WOFB 4FR9A 3F9SA 1FGRA 3JUOA 3PYJA 2SARA 3MG3A 4N6V0 1JKGB 3DM8A 3MHEA 2CWTA 5G1KA 2I9WA 2W2CA 6STDA 1T5YA 1U5OA 3HIIA 3NV0B 3MG2A 3HIGA 3JVCA 3QRDA 1GY7A 2R41A 4HJLB 1BU4A 1IK3A 2WO0A 2WGQA 3K63A 3HOHA 1NB3I 2W6JH 4FMAA 1TRPA 1VZZA 3FLJA 1GY6A 3T0UA 1QVG2 1JBSA 4L7KA 4XDVA 1RKYA 1A2PA 1W7CA 4KFDA 2XH9A 5CK6A 1VQ63 1BSAA 3F7XA 4IIAA 1T3BA 4XBTA 3UL5A 1GMQA 1YVSA 3G4S3 1WMPA 3K9MC 4BL2A 1TIJA 1X1XA 1K41A 3AMOB 3LH4A 2F98A 4MMYB 1RNBA 3AGOA 3ZG5A 1UUGB 2L4VA 3Q2PA 1GYBA 1QAFA 1YHQ3 3FF2A 3KSED 4OUQA 3WA2X 3ZFZA 1UUVB 3BIRA 2F56A 3KSPA 3CMA3 1X1UA 1W00A 1N9EA 3D4AA 1DMQA 2BMOB 1G0TA 1I8VA 1LQMB 2RGQA 3SOYA 4N6OB 3FSDA 4HOHA 3FG3A 2O3OA 5KP1A 3GWRA 1MOLA 3MYTA 1SJWA 1DYUA 1JBRA 2KCDA 5AIGA 2FXTA 3EN8A 1OH0A 3IJEB 2HMOB 4G1MB 1LOXA 4ILFA 1TJDA 5G1LA 4MJDA 2SBLA 1OGXA 3UL6A 1B27A 4FMDA 2YFLB 5BXQA 1LNIA 4I4KA 1FYSA 3BB9A 3DGNA 4LGQA 1DVCA 1BRIA 1Q7Y4 1TRQA 2HMLB 4LEHA 4LSOA 4GHOA 1YGEA 1GMRA 2KAAA 1HYFA 3F8HA 3EJVA 3CCE3 1JBTA 3LMLA 1JB5A 4N6NB 1N8R4 2OWPA 4HM3B 2CFWA 2GBXB 5KP3A 4I5QA 5IERA 1YIT3 1BVIA 1UUWB 2V1LA 1FW7A 1A67A 3AHSA 2KRTA 3D3LA 5BU4A 3A76A 1IQXA 3EBYA 5AYRB 5IEOA 1RNTA 1KD14 2K0MA 1K9M4 3SEDA 1PU4A 3KZTA 3D79A 1W5ZA 2QGUA 1I2GA 3LYGA 5G2GA 2GEXA 3KIIA 1GSPA 1IVWA 4XDWA 1BNSA 3FF0A 3J7Yd 5CXOA 1MWTA 1TFKA 1BRHA 1NO3A 1W6CA 3NBRA 3VF1A 1UCKA 3SVAA 4MMZB 2KXGA 4WYKA 1GOYA 2HMJB 1YIJ3 2W03A 3NM2A 2CFDA 1HU9A 3S29A 1BSCA 4N6MA 1LOYA 3FGYA 1BNFA 3F14A 4N3VA 4RZMA 4HM0B 1US1A 1UI8A 1S723 2BMQB 1RGAA 3DGLA 1LRAA 4K90B 5STDA 1FGQA 1OUNA 2KF5A 2Y74A 4HM6B 5GSPA 1IU7A 1CYVA 3D5GA 1NB5I 3KE7A 4EV5A 1FGTA 2W56A 1GMPA 3PZWA 1IQ8A 1JB4A 1B3SA 1F8NA 3UNLA 1DVDA 1I2FA 2E2UA 3NUVA 3IMAB 3JUNA 2MF7A 4HZ9B 3GZBA 1RRLA 2FNQA 1AVKA 1NNVA 1NJI4 2H0GA 4HM1B 2C4BA 2UGIA 4HZBB 1EEJA 1VQN3 4KVHA 1RTUA 2CFLA 3RNTA 2W56B 1IV7A 3FZWA 3RDEA 2W9PA 2XRXB 5AYSC 1K8A4 1VQ73 1LQGC 4R9KA 1JZDA 2OOVA 3OX9A 3PS8A 3HK4A 4N6UA 1RSNA 1DETA 3CNXA 4HKVB 8CHOA 3IPTA 3EHCA 5EQLA 5I97A 3CCL3 5AIFA 1B2XA 3RGAA 4AKYA 5FW5A 3PGBA 1KQS2 4R4KA 3S5CA 1I3IA 3NV0A 1BRGA 4FCMA 2M7OA 1BNGA 1OHPA 2YX9A 3KN4A 4HVNA 1IVVA 2Z77A 6GSPA 2RNTA 1ZGXA 3B4OA 3SX1A 4L8OA 3NQZA 1BSEA 5LC6A 4FCJA 3ROBA 4XB5A 2D1WA 3URPA 1STDA 1EA2A 4EXRA 1MWRA 1RGLA 2IYJA 3HZPA 1YVBI 3GSPA 4HM2B 3AMOA 5M1AA 1T2HA 3HI7A 2GSPA 2O9UX 3Q90A 2IY2A 4LZIA 4N6TA 3L0RA 2P09A 1ROAA 4NREA 4EBGA 4X2OA 1KSIA 2PZVA 5IG4A 1RGHA 1RCKA 3GZXB 2XSOB 3FG4A 4IPBA 2W04A 4CCVA 4PEJA 1NDOB 1D6YA 1BGSA 4KZ1A 2E2VA 2QIYA 1L5GB 3SYUA 3PXMA 3F40A 3TDGA 3DZLA 3WDGB 1NWWA 2GXFA 4MMXB 3BU4A 2CC3A 3DH2A 1W2ZA 2HMNB 1VQ93 2IMJA 4U13A 3VGNA 3JUQA 5CF2A 2LYXA 3NBJA 5RNTA 1UCLA 1I0XA 2BIRA 4O8SA 3Q1CA 4Q53A 3LTBA 5IEPA 1IYYA 4KFEA 4O3VA 3RGRA 2WOFA 2K3DA 9RNTA 1JV2B 2BT3A 2H0IA 1N5PA 4WHAA 1UDII 2XR8B 4GSPA 2CFKA 1M1XB 4O02B 2B1XB 1UW1A 5BVBA 1SARA 1M904 3CCV3 4IT7A 1V57A 4LMIA 1N8QA 5AIIA 5D81A 3LT9A 3ER7A 1LNHA 1J2BA 2WGOA 1JNQA 3DMCA 5D82A 1Q9EA 2MC8A 3BNBA 5JPPA 2Z6BA 1PY3A 1FGOA 2Y73A 1CH0A 3I553 1X1WA 3MSOA 3O8YA 1CYUA 3FCSB 3EBTA 2H0HA 3CCR3 1A2KA 3CCU3 4HM7B 3CC43 1K28A 7GSPA 5JPUA 2GU1A 4XM4A 3E99A 3QK9A 3CNMA 2XGLA 1AV4A 2OTL3 1YI23 1BNEA 1U8CB 3N9HA 5AEUB 1A2VA 2R4IA 1ISKA 2JQ5A 3DGOA 1OCVA 1B2ZA 1HKXA 1W4NA 1RGEA 1RN4A 2CIUA 3MWZA 4RNZA 2A15A 1O7GB 1RCLA 4ORLA 1B2SA 1VQP3 1OF5B 3EQQB 4X2HA 1FZUA 1OHOA 3ECFA 3CCQ3 1VQ83 1SIHA 3HX8A 2ML6A 1WTHA 5D83A 1MNLA 2CG0A 4BTXA 5M19A 4J9AA 1HZ1A 4STDA 1CEWI 2E2TA 2UUGC 3EF8A 4QWTA 2WOHA 1E3RA 1O7WB 1ZS7A 1B20A 3Q3FA 5TGNA 1RGFA 2OQEC 1B2UA 1IDPA 3KKGA 1PFPA 1AQZA 1Z1SA 1OHSA 1TFOA 1CQSA 2RFRA 1BRSA 3PCSA 3FH1A 1BSDA 2AAEA 3JUPA 1IT7A 2P0MA 3F8XA 1Q7HA 3A5EA 4WP5A 2C11A 1OACA 5DRVA 5IG0A 3X40A 1AR0A 2HMMB 1R4CA 2AADA 3SLUA 2QEX3 4XBYA 2P38A 4EW5A 3BNDA 3CPOA 3VSYA 3NXJA 3G16A 1VQL3 5ELUA 3CC73 1BIRA 3X41A 4BL3A 3FKAA 2IUJA 2UX0A 1BNJA 2Z76A 4MEIA 2GBWB 1RN7A 1QVF2 3ALAA 3X3XA 3LTDA 1UCJA 2B24B 2KF3A 1WMOA 1C54A 2YFJB 3KCHA 2CWUA 1IT8A 1JN5A 7RNTA 1M9GA 1VQK3 3K7CA 1RHLA 1G96A 1WMNA 1AVLA 4K1UA 2ZDJA 3B4PA 3B7CA 4JRFA 1GY5A 1I3FA 1VQM3 1Q814 3CU3A 3DY5A 3LZAA 4BTYA 3GZRA 3S28A 1BAOA 1RLSA 6RNTA 2RSXA 1IVXA 1V58A 5HGRA 2CWVA 2CW9A 4BTWA 2INXA 3OWYA 3OWSA 1JN5B 2GU3A 3WHOA 5IG3A 1Q824 4R1KA 1BUJA 1T2IA 3H51A 3SOAA 1BOXA 3V92A 2C10A 3LOYA 1Q40B 4KT3B 5EEOA 5HOHA 3CC23 1Q864 3GRDA 1FUWA 4GL6A 3AHWA 5M18A 1QAKA 4HYZA 1ZO2A 1GD3A 2QA43 4HBRA 2Z7AA 4RNYA 3T8UA 3N54B 1B21A 4H3UA 2CFGA
chains in the Genus database with same CATH topology
4L8PA 4NHFA 4ZM8A 1LVNA 1UI7A 1D6UA 1KWIA 1N9JA 4R9LA 3CCJ3 5A0OB 1O7MB 5CLKA 3WOEB 4K1VA 3STDA 5IG5A 3EE1A 1EQKA 4FCZA 2XF3A 3I0YA 1GS3A 3EB8A 3PCRA 1O7NB 1NU3A 3JUMA 1OGZA 3U97A 4HM5B 1A90A 2BHMA 1FA3A 5IENA 3G713 1RRHA 1SPUA 3M8CA 2JDIH 2XEPA 1JB2A 4HM8B 3K5TA 2P05A 1LXEA 3S27A 2YFIB 1STFI 2GEYA 4TX4A 1QJGA 2PNCA 4J8TA 5EVHA 1W01A 3GZYB 1W6YA 3OV4A 3G6E3 5ELJA 4XBXA 4EC6A 1K734 1KC84 1QMAA 2CH9A 1DVDA 2ML5A 3NQYA 3V98A 3WODG 5CF1A 1ULIB 3NX0A 4H61A 1OF5A 2STDA 1YJ93 1IVUA 3OW22 3X42A 1W6GA 1RJOA 4RBNA 2CKFB 1ULJB 3MKIA 3X3YA 3OXAA 3LTCA 2CK3H 2IUKA 3DUKA 3G0KA 1Y4KA 4KFFA 2CHCA 5FGOA 2W0QA 3EN1B 3CD63 4O2HA 1O7PB 4K61A 1ASKA 3D9RA 1WNHA 2ZL8A 1S5AA 3EX9A 2D42A 5AI1A 1FGMA 1DMMA 4R80A 3EC9A 2LQVA 3N8BA 3GAXA 1Q42A 5AIHA 5KP4A 3UJMA 3WMDA 1TU5A 1ZX2A 2XSHB 3CXC2 3MPHA 2XFTA 2K54A 3BNCA 3G8ZA 3KFQC 3U1WA 4EV2A 1N5HA 4WFOA 4OK0A 2OQEA 2XGNA 3S67A 3B8LA 1IV9A 2RCDA 4AKZA 5LC7A 3LXUX 2CG1A 3DGMA 3OWUA 4HM4B 1JJ22 3T8NA 3SXXA 2OTJ3 1W02A 3BLZA 2P0XA 3NBBA 1E3VA 3LTAA 4OVMA 4WWUC 5DREA 4EV5A 5JBSA 2OCTA 4WYKB 1O7HB 2FGTA 3FG1A 1YJW3 3F7SA 3WA3A 1D6ZA 1EG9B 2Q07A 2IA7A 3DXOA 4FMCA 4JF8A 3V99A 1VQ53 1VQ43 3MG1A 3NHXA 1SIIA 1WQLB 1Q40A 3NM7A 2OOVC 5IW9A 1M1K4 1IQYA 1QALA 7STDA 2BMRB 1GD4A 2F86B 3I563 1V74A 4N6LA 3K0ZA 1W2B2 1YJN3 2W9QA 1ROVA 2BNGA 1BUQA 2F99A 3CME3 4GB5A 1TP6A 1VQO3 3BNEA 1TUHA 1OPYA 2HMKB 1JKGA 4EYCA 3CCS3 4FMBA 1SQWA 3LT8A 3H3HA 2BO9B 1DMNA 3X3ZA 5AEWB 5IF6A 1C7HA 1EKMA 1JRQA 3UB1A 2XFSA 4CDLA 3CCM3 3CPW2 1E97A 4AEQA 3WOFB 4FR9A 3F9SA 1FGRA 3JUOA 3PYJA 3MG3A 4N6V0 1JKGB 3DM8A 3MHEA 2CWTA 2I9WA 2W2CA 6STDA 1T5YA 1U5OA 3HIIA 3NV0B 3MG2A 3HIGA 3JVCA 3QRDA 1GY7A 4HJLB 1IK3A 2WO0A 2WGQA 3K63A 4FMAA 1NB3I 2W6JH 1VZZA 3FLJA 1GY6A 3T0UA 1QVG2 4L7KA 4XDVA 1RKYA 1W7CA 4KFDA 2XH9A 5CK6A 1VQ63 3F7XA 4IIAA 3UL5A 4XBTA 3G4S3 1WMPA 3K9MC 1TIJA 1K41A 3AMOB 3LH4A 2F98A 4MMYB 2L4VA 3Q2PA 1GYBA 1QAFA 1YHQ3 3FF2A 3KSED 4OUQA 3WA2X 3CMA3 1UUVB 3KSPA 1W00A 1N9EA 1DMQA 2BMOB 2RGQA 3SOYA 4N6OB 3FSDA 3FG3A 2O3OA 5KP1A 3GWRA 1MOLA 3MYTA 1SJWA 1DYUA 2KCDA 5AIGA 2FXTA 3EN8A 1OH0A 3IJEB 2HMOB 4G1MB 1LOXA 4MJDA 2SBLA 1OGXA 3UL6A 4FMDA 2YFLB 5BXQA 4I4KA 3BB9A 3DGNA 4LGQA 1DVCA 1Q7Y4 2HMLB 4LEHA 4LSOA 1YGEA 3F8HA 3EJVA 3CCE3 3LMLA 1JB5A 4N6NB 1N8R4 2OWPA 4HM3B 2CFWA 2GBXB 5KP3A 5IERA 1YIT3 1UUWB 2V1LA 1A67A 2KRTA 3D3LA 3A76A 1IQXA 3EBYA 5AYRB 5IEOA 1KD14 2K0MA 1K9M4 3SEDA 1PU4A 3KZTA 1W5ZA 2QGUA 3LYGA 5G2GA 2GEXA 3KIIA 1IVWA 4XDWA 3J7Yd 3FF0A 5CXOA 1TFKA 1NO3A 3NBRA 1W6CA 3VF1A 3SVAA 4MMZB 2KXGA 4WYKA 2HMJB 1YIJ3 2W03A 3NM2A 2CFDA 1HU9A 3S29A 4N6MA 3FGYA 4RZMA 3F14A 4N3VA 4HM0B 1US1A 1UI8A 1S723 2BMQB 3DGLA 4K90B 5STDA 1FGQA 1OUNA 2Y74A 4HM6B 1IU7A 1CYVA 1NB5I 3KE7A 1FGTA 2W56A 3PZWA 1IQ8A 1JB4A 1F8NA 3UNLA 2E2UA 3NUVA 3IMAB 3JUNA 2MF7A 4HZ9B 3GZBA 1RRLA 2FNQA 1AVKA 1NJI4 4HM1B 4HZBB 1VQN3 4KVHA 2CFLA 2W56B 1IV7A 3FZWA 3RDEA 2W9PA 2XRXB 5AYSC 1K8A4 1VQ73 4R9KA 2OOVA 3OX9A 3PS8A 3HK4A 4N6UA 3CNXA 4HKVB 8CHOA 3IPTA 3EHCA 5EQLA 5I97A 3CCL3 5AIFA 3RGAA 4AKYA 5FW5A 3PGBA 1KQS2 4R4KA 3S5CA 3NV0A 4HVNA 4FCMA 2M7OA 3KN4A 1OHPA 2YX9A 1IVVA 2Z77A 3B4OA 3SX1A 4L8OA 3NQZA 5LC6A 4FCJA 3ROBA 4XB5A 2D1WA 1STDA 1EA2A 4EXRA 3HZPA 1YVBI 4HM2B 3AMOA 4LZIA 3HI7A 3Q90A 2O9UX 4NREA 4N6TA 3L0RA 2P09A 1ROAA 4EBGA 4X2OA 1KSIA 2PZVA 5IG4A 3GZXB 2XSOB 3FG4A 4IPBA 2W04A 4CCVA 4PEJA 1NDOB 1D6YA 4KZ1A 1L5GB 2E2VA 2QIYA 3PXMA 3F40A 3TDGA 3DZLA 3WDGB 1NWWA 2GXFA 4MMXB 2CC3A 1W2ZA 2HMNB 1VQ93 2IMJA 4U13A 3VGNA 3JUQA 5CF2A 2LYXA 3NBJA 4O8SA 3Q1CA 4Q53A 3LTBA 5IEPA 4KFEA 4O3VA 3RGRA 2WOFA 1JV2B 2BT3A 4WHAA 1N5PA 2XR8B 2CFKA 1M1XB 4O02B 2B1XB 1UW1A 5BVBA 1M904 3CCV3 4IT7A 4LMIA 1N8QA 5AIIA 5D81A 3LT9A 3ER7A 1LNHA 1J2BA 2WGOA 1JNQA 3DMCA 5D82A 2MC8A 3BNBA 5JPPA 2Z6BA 1FGOA 2Y73A 3I553 3MSOA 3O8YA 1CYUA 3FCSB 3EBTA 3CCR3 1A2KA 3CCU3 4HM7B 3CC43 1K28A 5JPUA 2GU1A 4XM4A 3E99A 3QK9A 3CNMA 2XGLA 1AV4A 2OTL3 1YI23 1U8CB 3N9HA 5AEUB 1A2VA 2R4IA 1ISKA 2JQ5A 3DGOA 1OCVA 1HKXA 1W4NA 2CIUA 3MWZA 4RNZA 2A15A 1O7GB 4ORLA 1VQP3 1OF5B 3EQQB 4X2HA 1OHOA 3ECFA 3CCQ3 1VQ83 1SIHA 3HX8A 2ML6A 1WTHA 5D83A 1MNLA 2CG0A 4BTXA 4J9AA 4STDA 1CEWI 2E2TA 3EF8A 4QWTA 2WOHA 1E3RA 1O7WB 5TGNA 2OQEC 1IDPA 3KKGA 1PFPA 1Z1SA 1OHSA 1TFOA 1CQSA 2RFRA 3PCSA 3FH1A 3JUPA 1IT7A 2P0MA 3F8XA 4WP5A 2C11A 1OACA 5DRVA 5IG0A 3X40A 1AR0A 2HMMB 1R4CA 3SLUA 2QEX3 4XBYA 2P38A 3BNDA 3CPOA 3VSYA 3NXJA 3G16A 1VQL3 5ELUA 3CC73 3X41A 3FKAA 2IUJA 2UX0A 2Z76A 4MEIA 2GBWB 1RN7A 1QVF2 3ALAA 3X3XA 3LTDA 2B24B 1WMOA 2YFJB 2CWUA 1IT8A 1JN5A 1M9GA 1VQK3 3K7CA 1WMNA 1G96A 1AVLA 4K1UA 2ZDJA 3B4PA 3B7CA 4JRFA 1GY5A 1VQM3 1Q814 3CU3A 3DY5A 3LZAA 4BTYA 3GZRA 3S28A 2RSXA 1IVXA 5HGRA 2CWVA 2CW9A 4BTWA 2INXA 3OWYA 3OWSA 1JN5B 2GU3A 1Q824 5IG3A 4R1KA 3H51A 3SOAA 3V92A 2C10A 3LOYA 1Q40B 5EEOA 3CC23 1Q864 3GRDA 1FUWA 4GL6A 1QAKA 4HYZA 1ZO2A 1GD3A 2QA43 4HBRA 2Z7AA 4RNYA 3T8UA 3N54B 4H3UA 2CFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L8P A;  4R9L A;  1O7M B;  5CLK A;  4K1V A;  3STD A;  5IG5 A;  3I0Y A;  1GS3 A;  1O7N B;  1NU3 A;  3JUM A;  1OGZ A;  4HM5 B;  5IEN A;  3M8C A;  1JB2 A;  4HM8 B;  2YFI B;  2GEY A;  5EVH A;  1QJG A;  4J8T A;  1W01 A;  3GZY B;  1W6Y A;  3OV4 A;  4XBX A;  1QMA A;  5CF1 A;  1ULI B;  1OF5 A;  2STD A;  2CKF B;  1ULJ B;  3MKI A;  3OXA A;  3DUK A;  3G0K A;  2CHC A;  3EN1 B;  1O7P B;  1ASK A;  3D9R A;  1S5A A;  3EX9 A;  5AI1 A;  1DMM A;  3EC9 A;  1Q42 A;  5AIH A;  5KP4 A;  3UJM A;  3WMD A;  1ZX2 A;  2XSH B;  2K54 A;  3G8Z A;  3B8L A;  2RCD A;  3OWU A;  4HM4 B;  3T8N A;  1W02 A;  3BLZ A;  5DRE A;  1E3V A;  4OVM A;  4WWU C;  4WYK B;  1O7H B;  3F7S A;  1EG9 B;  3DXO A;  3MG1 A;  3NHX A;  1WQL B;  1Q40 A;  7STD A;  2BMR B;  2F86 B;  3K0Z A;  2BNG A;  1BUQ A;  2F99 A;  4GB5 A;  1TP6 A;  1TUH A;  1OPY A;  2HMK B;  1JKG A;  3H3H A;  1DMN A;  5AEW B;  5IF6 A;  1C7H A;  4CDL A;  1E97 A;  3F9S A;  3JUO A;  3MG3 A;  1JKG B;  3DM8 A;  3MHE A;  2I9W A;  2W2C A;  6STD A;  1U5O A;  3NV0 B;  3MG2 A;  1GY7 A;  4HJL B;  1VZZ A;  3FLJ A;  1GY6 A;  4L7K A;  4XDV A;  5CK6 A;  3F7X A;  4IIA A;  4XBT A;  1K41 A;  2F98 A;  1GYB A;  3FF2 A;  4OUQ A;  1UUV B;  3KSP A;  1W00 A;  1DMQ A;  2BMO B;  2RGQ A;  3SOY A;  3FSD A;  5KP1 A;  3GWR A;  3MYT A;  1SJW A;  5AIG A;  3EN8 A;  1OH0 A;  2HMO B;  4MJD A;  1OGX A;  2YFL B;  5BXQ A;  4I4K A;  3BB9 A;  4LGQ A;  2HML B;  4LEH A;  3F8H A;  3EJV A;  1JB5 A;  2OWP A;  4HM3 B;  2GBX B;  5KP3 A;  5IER A;  1UUW B;  3A76 A;  3EBY A;  5IEO A;  3SED A;  3KZT A;  2QGU A;  5G2G A;  3LYG A;  2GEX A;  4XDW A;  3FF0 A;  5CXO A;  3NBR A;  4WYK A;  2HMJ B;  3NM2 A;  3FGY A;  4RZM A;  3F14 A;  4N3V A;  4HM0 B;  2BMQ B;  5STD A;  1OUN A;  4HM6 B;  3KE7 A;  1JB4 A;  3UNL A;  3NUV A;  3JUN A;  4HZ9 B;  3GZB A;  4HM1 B;  4HZB B;  4KVH A;  3FZW A;  2XRX B;  4R9K A;  3OX9 A;  3HK4 A;  3CNX A;  4HKV B;  8CHO A;  3IPT A;  3EHC A;  5AIF A;  3RGA A;  5FW5 A;  3S5C A;  3NV0 A;  4HVN A;  4FCM A;  1OHP A;  2Z77 A;  3B4O A;  4L8O A;  4FCJ A;  3ROB A;  4XB5 A;  1STD A;  1EA2 A;  3HZP A;  4HM2 B;  3Q90 A;  4X2O A;  2PZV A;  5IG4 A;  3GZX B;  2XSO B;  4PEJ A;  1NDO B;  2QIY A;  3F40 A;  3DZL A;  1NWW A;  2GXF A;  2HMN B;  2IMJ A;  4U13 A;  3VGN A;  3JUQ A;  5CF2 A;  4Q53 A;  5IEP A;  3RGR A;  2XR8 B;  2B1X B;  5BVB A;  4LMI A;  5AII A;  5D81 A;  3ER7 A;  3DMC A;  5D82 A;  5JPP A;  3MSO A;  3EBT A;  1A2K A;  4HM7 B;  5JPU A;  4XM4 A;  3E99 A;  3CNM A;  5AEU B;  1ISK A;  2R4I A;  2JQ5 A;  1OCV A;  1HKX A;  2A15 A;  1O7G B;  4ORL A;  1OF5 B;  3EQQ B;  4X2H A;  1OHO A;  3ECF A;  3HX8 A;  5D83 A;  4J9A A;  4STD A;  3EF8 A;  1E3R A;  1O7W B;  5TGN A;  1IDP A;  3KKG A;  1Z1S A;  1OHS A;  1CQS A;  2RFR A;  3FH1 A;  3JUP A;  3F8X A;  4WP5 A;  5DRV A;  5IG0 A;  1AR0 A;  2HMM B;  4XBY A;  3CPO A;  3VSY A;  3NXJ A;  3G16 A;  3FKA A;  2UX0 A;  2Z76 A;  2GBW B;  2B24 B;  2YFJ B;  1JN5 A;  3K7C A;  4K1U A;  3B4P A;  3B7C A;  1GY5 A;  3CU3 A;  3LZA A;  3GZR A;  5HGR A;  2INX A;  3OWY A;  3OWS A;  1JN5 B;  5IG3 A;  4R1K A;  3H51 A;  3SOA A;  1Q40 B;  3GRD A;  1ZO2 A;  2Z7A A;  3T8U A;  4H3U A; 
#chains in the Genus database with same CATH topology
 4L8P A;  4NHF A;  4ZM8 A;  3D5I A;  4J5K A;  1LVN A;  1UI7 A;  1D6U A;  4HAA A;  1KWI A;  1N9J A;  4R9L A;  3CCJ 3;  5A0O B;  1O7M B;  5CLK A;  3WOE B;  4K1V A;  3STD A;  5IG5 A;  3EE1 A;  1EQK A;  4BIR A;  4FCZ A;  2XF3 A;  3I0Y A;  1GS3 A;  3EB8 A;  1G02 A;  3PCR A;  1O7N B;  1BRN L;  1NU3 A;  3JUM A;  1OGZ A;  3U97 A;  4HM5 B;  1A90 A;  2BHM A;  1FA3 A;  5IEN A;  3G71 3;  1RRH A;  1SPU A;  3M8C A;  2JDI H;  2XEP A;  1BNR A;  1JB2 A;  4HM8 B;  3K5T A;  1RGG A;  2P05 A;  1LXE A;  3S27 A;  2YFI B;  1STF I;  2GEY A;  4TX4 A;  1QJG A;  1RGC A;  2PNC A;  4J8T A;  5EVH A;  1R4Y A;  1W01 A;  3GZY B;  1W6Y A;  3OV4 A;  1BNI A;  1MGW A;  2CX0 A;  3G6E 3;  5ELJ A;  4XBX A;  4EC6 A;  1K73 4;  2CX1 A;  1I0V A;  1QMA A;  2CH9 A;  2ML5 A;  1KC8 4;  3NQY A;  3V98 A;  3WOD G;  5CF1 A;  1ULI B;  3NX0 A;  4H61 A;  1OF5 A;  2STD A;  1YJ9 3;  1IVU A;  1LOV A;  3OW2 2;  3X42 A;  1W6G A;  1RJO A;  1BRJ A;  4RBN A;  1GOU A;  2CKF B;  1ULJ B;  3MKI A;  3X3Y A;  3OXA A;  3LTC A;  4J5G A;  2CK3 H;  2IUK A;  3DUK A;  3G0K A;  1Y4K A;  1YNV X;  4KFF A;  4NPB A;  2CHC A;  1RDS A;  5FGO A;  2W0Q A;  3EN1 B;  1B2M A;  3CD6 3;  4O2H A;  1O7P B;  4K61 A;  1ASK A;  3D9R A;  1WNH A;  2ZL8 A;  2BU4 A;  1S5A A;  1TTO A;  2L1S A;  2KF4 A;  3EX9 A;  2D42 A;  5AI1 A;  1FGM A;  2KF6 A;  1DMM A;  1MWU A;  4R80 A;  3EC9 A;  2LQV A;  3N8B A;  3GAX A;  1YGW A;  1Q42 A;  5AIH A;  1LOW A;  1FUT A;  5KP4 A;  3UJM A;  3WMD A;  1TU5 A;  1ZX2 A;  1MGR A;  2XSH B;  3CXC 2;  3MPH A;  2XFT A;  2K54 A;  3BNC A;  3G8Z A;  3KFQ C;  1X1Y A;  3U1W A;  4EV2 A;  1N5H A;  4WFO A;  4OK0 A;  2OQE A;  2XGN A;  2ZHX B;  3S67 A;  3DGY A;  3B8L A;  1MWS A;  1IV9 A;  2RCD A;  1BSB A;  5LC7 A;  3AGN A;  3LXU X;  3ZG0 A;  4AKZ A;  2CG1 A;  3DGM A;  3OWU A;  4HM4 B;  1JJ2 2;  2ZA4 A;  3T8N A;  1EUI C;  3SXX A;  8RNT A;  1W02 A;  3BLZ A;  2OTJ 3;  1FUS A;  2P0X A;  1E3V A;  3LTA A;  3NBB A;  4OVM A;  2HOH A;  4WWU C;  1UCI A;  5DRE A;  3WR2 A;  2OCT A;  1PYL A;  4WYK B;  5JBS A;  1O7H B;  2FGT A;  3FG1 A;  1YJW 3;  2F5W A;  3F7S A;  3WA3 A;  1EG9 B;  1D6Z A;  2Q07 A;  2IA7 A;  3DXO A;  4FMC A;  4JF8 A;  3V99 A;  5BIR A;  1VQ5 3;  2RBI A;  1VQ4 3;  3MG1 A;  3NHX A;  1SII A;  1WQL B;  1I70 A;  1I2E A;  1Q40 A;  3NM7 A;  4RNT A;  2OOV C;  5IW9 A;  1M1K 4;  1IQY A;  1QAL A;  7STD A;  2BMR B;  1GD4 A;  2J8X B;  1RGK A;  4CJN A;  2F86 B;  3I56 3;  1V74 A;  4LYL B;  4N6L A;  3K0Z A;  1W2B 2;  1YJN 3;  2W9Q A;  1JZO A;  1ROV A;  2BNG A;  1BUQ A;  2F4Y A;  1UGH I;  2F99 A;  1UGI A;  1GOV A;  4GB5 A;  3CME 3;  1RN1 A;  1TP6 A;  1DE3 A;  1VQO 3;  3BNE A;  4CPK A;  1TUH A;  1OPY A;  2HMK B;  1JKG A;  1VQQ A;  4EYC A;  3CCS 3;  4FMB A;  1SQW A;  3LT8 A;  3H3H A;  2BO9 B;  1DMN A;  3X3Z A;  5AEW B;  1AY7 A;  1BAN A;  5IF6 A;  4BU4 A;  1BRK A;  2F5M A;  1C7H A;  1EKM A;  1JRQ A;  3UB1 A;  2XFS A;  4CDL A;  3CCM 3;  3CPW 2;  1E97 A;  4AEQ A;  4DKI A;  1RMS A;  3WOF B;  4FR9 A;  3F9S A;  1FGR A;  3JUO A;  3PYJ A;  2SAR A;  3MG3 A;  4N6V 0;  1JKG B;  3DM8 A;  3MHE A;  2CWT A;  5G1K A;  2I9W A;  2W2C A;  6STD A;  1T5Y A;  1U5O A;  3HII A;  3NV0 B;  3MG2 A;  3HIG A;  3JVC A;  3QRD A;  1GY7 A;  2R41 A;  4HJL B;  1BU4 A;  1IK3 A;  2WO0 A;  2WGQ A;  3K63 A;  3HOH A;  1NB3 I;  2W6J H;  4FMA A;  1TRP A;  1VZZ A;  3FLJ A;  1GY6 A;  3T0U A;  1QVG 2;  1JBS A;  4L7K A;  4XDV A;  1RKY A;  1A2P A;  1W7C A;  4KFD A;  2XH9 A;  5CK6 A;  1VQ6 3;  1BSA A;  3F7X A;  4IIA A;  1T3B A;  4XBT A;  3UL5 A;  1GMQ A;  1YVS A;  3G4S 3;  1WMP A;  3K9M C;  4BL2 A;  1TIJ A;  1X1X A;  1K41 A;  3AMO B;  3LH4 A;  2F98 A;  4MMY B;  1RNB A;  3AGO A;  3ZG5 A;  1UUG B;  2L4V A;  3Q2P A;  1GYB A;  1QAF A;  1YHQ 3;  3FF2 A;  3KSE D;  4OUQ A;  3WA2 X;  3ZFZ A;  1UUV B;  3BIR A;  2F56 A;  3KSP A;  3CMA 3;  1X1U A;  1W00 A;  1N9E A;  3D4A A;  1DMQ A;  2BMO B;  1G0T A;  1I8V A;  1LQM B;  2RGQ A;  3SOY A;  4N6O B;  3FSD A;  4HOH A;  3FG3 A;  2O3O A;  5KP1 A;  3GWR A;  1MOL A;  3MYT A;  1SJW A;  1DYU A;  1JBR A;  2KCD A;  5AIG A;  2FXT A;  3EN8 A;  1OH0 A;  3IJE B;  2HMO B;  4G1M B;  1LOX A;  4ILF A;  1TJD A;  5G1L A;  4MJD A;  2SBL A;  1OGX A;  3UL6 A;  1B27 A;  4FMD A;  2YFL B;  5BXQ A;  1LNI A;  4I4K A;  1FYS A;  3BB9 A;  3DGN A;  4LGQ A;  1DVC A;  1BRI A;  1Q7Y 4;  1TRQ A;  2HML B;  4LEH A;  4LSO A;  4GHO A;  1YGE A;  1GMR A;  2KAA A;  1HYF A;  3F8H A;  3EJV A;  3CCE 3;  1JBT A;  3LML A;  1JB5 A;  4N6N B;  1N8R 4;  2OWP A;  4HM3 B;  2CFW A;  2GBX B;  5KP3 A;  4I5Q A;  5IER A;  1YIT 3;  1BVI A;  1UUW B;  2V1L A;  1FW7 A;  1A67 A;  3AHS A;  2KRT A;  3D3L A;  5BU4 A;  3A76 A;  1IQX A;  3EBY A;  5AYR B;  5IEO A;  1RNT A;  1KD1 4;  2K0M A;  1K9M 4;  3SED A;  1PU4 A;  3KZT A;  3D79 A;  1W5Z A;  2QGU A;  1I2G A;  3LYG A;  5G2G A;  2GEX A;  3KII A;  1GSP A;  1IVW A;  4XDW A;  1BNS A;  3FF0 A;  3J7Y d;  5CXO A;  1MWT A;  1TFK A;  1BRH A;  1NO3 A;  1W6C A;  3NBR A;  3VF1 A;  1UCK A;  3SVA A;  4MMZ B;  2KXG A;  4WYK A;  1GOY A;  2HMJ B;  1YIJ 3;  2W03 A;  3NM2 A;  2CFD A;  1HU9 A;  3S29 A;  1BSC A;  4N6M A;  1LOY A;  3FGY A;  1BNF A;  3F14 A;  4N3V A;  4RZM A;  4HM0 B;  1US1 A;  1UI8 A;  1S72 3;  2BMQ B;  1RGA A;  3DGL A;  1LRA A;  4K90 B;  5STD A;  1FGQ A;  1OUN A;  2KF5 A;  2Y74 A;  4HM6 B;  5GSP A;  1IU7 A;  1CYV A;  3D5G A;  1NB5 I;  3KE7 A;  4EV5 A;  1FGT A;  2W56 A;  1GMP A;  3PZW A;  1IQ8 A;  1JB4 A;  1B3S A;  1F8N A;  3UNL A;  1DVD A;  1I2F A;  2E2U A;  3NUV A;  3IMA B;  3JUN A;  2MF7 A;  4HZ9 B;  3GZB A;  1RRL A;  2FNQ A;  1AVK A;  1NNV A;  1NJI 4;  2H0G A;  4HM1 B;  2C4B A;  2UGI A;  4HZB B;  1EEJ A;  1VQN 3;  4KVH A;  1RTU A;  2CFL A;  3RNT A;  2W56 B;  1IV7 A;  3FZW A;  3RDE A;  2W9P A;  2XRX B;  5AYS C;  1K8A 4;  1VQ7 3;  1LQG C;  4R9K A;  1JZD A;  2OOV A;  3OX9 A;  3PS8 A;  3HK4 A;  4N6U A;  1RSN A;  1DET A;  3CNX A;  4HKV B;  8CHO A;  3IPT A;  3EHC A;  5EQL A;  5I97 A;  3CCL 3;  5AIF A;  1B2X A;  3RGA A;  4AKY A;  5FW5 A;  3PGB A;  1KQS 2;  4R4K A;  3S5C A;  1I3I A;  3NV0 A;  1BRG A;  4FCM A;  2M7O A;  1BNG A;  1OHP A;  2YX9 A;  3KN4 A;  4HVN A;  1IVV A;  2Z77 A;  6GSP A;  2RNT A;  1ZGX A;  3B4O A;  3SX1 A;  4L8O A;  3NQZ A;  1BSE A;  5LC6 A;  4FCJ A;  3ROB A;  4XB5 A;  2D1W A;  3URP A;  1STD A;  1EA2 A;  4EXR A;  1MWR A;  1RGL A;  2IYJ A;  3HZP A;  1YVB I;  3GSP A;  4HM2 B;  3AMO A;  5M1A A;  1T2H A;  3HI7 A;  2GSP A;  2O9U X;  3Q90 A;  2IY2 A;  4LZI A;  4N6T A;  3L0R A;  2P09 A;  1ROA A;  4NRE A;  4EBG A;  4X2O A;  1KSI A;  2PZV A;  5IG4 A;  1RGH A;  1RCK A;  3GZX B;  2XSO B;  3FG4 A;  4IPB A;  2W04 A;  4CCV A;  4PEJ A;  1NDO B;  1D6Y A;  1BGS A;  4KZ1 A;  2E2V A;  2QIY A;  1L5G B;  3SYU A;  3PXM A;  3F40 A;  3TDG A;  3DZL A;  3WDG B;  1NWW A;  2GXF A;  4MMX B;  3BU4 A;  2CC3 A;  3DH2 A;  1W2Z A;  2HMN B;  1VQ9 3;  2IMJ A;  4U13 A;  3VGN A;  3JUQ A;  5CF2 A;  2LYX A;  3NBJ A;  5RNT A;  1UCL A;  1I0X A;  2BIR A;  4O8S A;  3Q1C A;  4Q53 A;  3LTB A;  5IEP A;  1IYY A;  4KFE A;  4O3V A;  3RGR A;  2WOF A;  2K3D A;  9RNT A;  1JV2 B;  2BT3 A;  2H0I A;  1N5P A;  4WHA A;  1UDI I;  2XR8 B;  4GSP A;  2CFK A;  1M1X B;  4O02 B;  2B1X B;  1UW1 A;  5BVB A;  1SAR A;  1M90 4;  3CCV 3;  4IT7 A;  1V57 A;  4LMI A;  1N8Q A;  5AII A;  5D81 A;  3LT9 A;  3ER7 A;  1LNH A;  1J2B A;  2WGO A;  1JNQ A;  3DMC A;  5D82 A;  1Q9E A;  2MC8 A;  3BNB A;  5JPP A;  2Z6B A;  1PY3 A;  1FGO A;  2Y73 A;  1CH0 A;  3I55 3;  1X1W A;  3MSO A;  3O8Y A;  1CYU A;  3FCS B;  3EBT A;  2H0H A;  3CCR 3;  1A2K A;  3CCU 3;  4HM7 B;  3CC4 3;  1K28 A;  7GSP A;  5JPU A;  2GU1 A;  4XM4 A;  3E99 A;  3QK9 A;  3CNM A;  2XGL A;  1AV4 A;  2OTL 3;  1YI2 3;  1BNE A;  1U8C B;  3N9H A;  5AEU B;  1A2V A;  2R4I A;  1ISK A;  2JQ5 A;  3DGO A;  1OCV A;  1B2Z A;  1HKX A;  1W4N A;  1RGE A;  1RN4 A;  2CIU A;  3MWZ A;  4RNZ A;  2A15 A;  1O7G B;  1RCL A;  4ORL A;  1B2S A;  1VQP 3;  1OF5 B;  3EQQ B;  4X2H A;  1FZU A;  1OHO A;  3ECF A;  3CCQ 3;  1VQ8 3;  1SIH A;  3HX8 A;  2ML6 A;  1WTH A;  5D83 A;  1MNL A;  2CG0 A;  4BTX A;  5M19 A;  4J9A A;  1HZ1 A;  4STD A;  1CEW I;  2E2T A;  2UUG C;  3EF8 A;  4QWT A;  2WOH A;  1E3R A;  1O7W B;  1ZS7 A;  1B20 A;  3Q3F A;  5TGN A;  1RGF A;  2OQE C;  1B2U A;  1IDP A;  3KKG A;  1PFP A;  1AQZ A;  1Z1S A;  1OHS A;  1TFO A;  1CQS A;  2RFR A;  1BRS A;  3PCS A;  3FH1 A;  1BSD A;  2AAE A;  3JUP A;  1IT7 A;  2P0M A;  3F8X A;  1Q7H A;  3A5E A;  4WP5 A;  2C11 A;  1OAC A;  5DRV A;  5IG0 A;  3X40 A;  1AR0 A;  2HMM B;  1R4C A;  2AAD A;  3SLU A;  2QEX 3;  4XBY A;  2P38 A;  4EW5 A;  3BND A;  3CPO A;  3VSY A;  3NXJ A;  3G16 A;  1VQL 3;  5ELU A;  3CC7 3;  1BIR A;  3X41 A;  4BL3 A;  3FKA A;  2IUJ A;  2UX0 A;  1BNJ A;  2Z76 A;  4MEI A;  2GBW B;  1RN7 A;  1QVF 2;  3ALA A;  3X3X A;  3LTD A;  1UCJ A;  2B24 B;  2KF3 A;  1WMO A;  1C54 A;  2YFJ B;  3KCH A;  2CWU A;  1IT8 A;  1JN5 A;  7RNT A;  1M9G A;  1VQK 3;  3K7C A;  1RHL A;  1G96 A;  1WMN A;  1AVL A;  4K1U A;  2ZDJ A;  3B4P A;  3B7C A;  4JRF A;  1GY5 A;  1I3F A;  1VQM 3;  1Q81 4;  3CU3 A;  3DY5 A;  3LZA A;  4BTY A;  3GZR A;  3S28 A;  1BAO A;  1RLS A;  6RNT A;  2RSX A;  1IVX A;  1V58 A;  5HGR A;  2CWV A;  2CW9 A;  4BTW A;  2INX A;  3OWY A;  3OWS A;  1JN5 B;  2GU3 A;  3WHO A;  5IG3 A;  1Q82 4;  4R1K A;  1BUJ A;  1T2I A;  3H51 A;  3SOA A;  1BOX A;  3V92 A;  2C10 A;  3LOY A;  1Q40 B;  4KT3 B;  5EEO A;  5HOH A;  3CC2 3;  1Q86 4;  3GRD A;  1FUW A;  4GL6 A;  3AHW A;  5M18 A;  1QAK A;  4HYZ A;  1ZO2 A;  1GD3 A;  2QA4 3;  4HBR A;  2Z7A A;  4RNY A;  3T8U A;  3N54 B;  1B21 A;  4H3U A;  2CFG A; 
#chains in the Genus database with same CATH homology
 4L8P A;  4NHF A;  4ZM8 A;  1LVN A;  1UI7 A;  1D6U A;  1KWI A;  1N9J A;  4R9L A;  3CCJ 3;  5A0O B;  1O7M B;  5CLK A;  3WOE B;  4K1V A;  3STD A;  5IG5 A;  3EE1 A;  1EQK A;  4FCZ A;  2XF3 A;  3I0Y A;  1GS3 A;  3EB8 A;  3PCR A;  1O7N B;  1NU3 A;  3JUM A;  1OGZ A;  3U97 A;  4HM5 B;  1A90 A;  2BHM A;  1FA3 A;  5IEN A;  3G71 3;  1RRH A;  1SPU A;  3M8C A;  2JDI H;  2XEP A;  1JB2 A;  4HM8 B;  3K5T A;  2P05 A;  1LXE A;  3S27 A;  2YFI B;  1STF I;  2GEY A;  4TX4 A;  1QJG A;  2PNC A;  4J8T A;  5EVH A;  1W01 A;  3GZY B;  1W6Y A;  3OV4 A;  3G6E 3;  5ELJ A;  4XBX A;  4EC6 A;  1K73 4;  1KC8 4;  1QMA A;  2CH9 A;  1DVD A;  2ML5 A;  3NQY A;  3V98 A;  3WOD G;  5CF1 A;  1ULI B;  3NX0 A;  4H61 A;  1OF5 A;  2STD A;  1YJ9 3;  1IVU A;  3OW2 2;  3X42 A;  1W6G A;  1RJO A;  4RBN A;  2CKF B;  1ULJ B;  3MKI A;  3X3Y A;  3OXA A;  3LTC A;  2CK3 H;  2IUK A;  3DUK A;  3G0K A;  1Y4K A;  4KFF A;  2CHC A;  5FGO A;  2W0Q A;  3EN1 B;  3CD6 3;  4O2H A;  1O7P B;  4K61 A;  1ASK A;  3D9R A;  1WNH A;  2ZL8 A;  1S5A A;  3EX9 A;  2D42 A;  5AI1 A;  1FGM A;  1DMM A;  4R80 A;  3EC9 A;  2LQV A;  3N8B A;  3GAX A;  1Q42 A;  5AIH A;  5KP4 A;  3UJM A;  3WMD A;  1TU5 A;  1ZX2 A;  2XSH B;  3CXC 2;  3MPH A;  2XFT A;  2K54 A;  3BNC A;  3G8Z A;  3KFQ C;  3U1W A;  4EV2 A;  1N5H A;  4WFO A;  4OK0 A;  2OQE A;  2XGN A;  3S67 A;  3B8L A;  1IV9 A;  2RCD A;  4AKZ A;  5LC7 A;  3LXU X;  2CG1 A;  3DGM A;  3OWU A;  4HM4 B;  1JJ2 2;  3T8N A;  3SXX A;  2OTJ 3;  1W02 A;  3BLZ A;  2P0X A;  3NBB A;  1E3V A;  3LTA A;  4OVM A;  4WWU C;  5DRE A;  4EV5 A;  5JBS A;  2OCT A;  4WYK B;  1O7H B;  2FGT A;  3FG1 A;  1YJW 3;  3F7S A;  3WA3 A;  1D6Z A;  1EG9 B;  2Q07 A;  2IA7 A;  3DXO A;  4FMC A;  4JF8 A;  3V99 A;  1VQ5 3;  1VQ4 3;  3MG1 A;  3NHX A;  1SII A;  1WQL B;  1Q40 A;  3NM7 A;  2OOV C;  5IW9 A;  1M1K 4;  1IQY A;  1QAL A;  7STD A;  2BMR B;  1GD4 A;  2F86 B;  3I56 3;  1V74 A;  4N6L A;  3K0Z A;  1W2B 2;  1YJN 3;  2W9Q A;  1ROV A;  2BNG A;  1BUQ A;  2F99 A;  3CME 3;  4GB5 A;  1TP6 A;  1VQO 3;  3BNE A;  1TUH A;  1OPY A;  2HMK B;  1JKG A;  4EYC A;  3CCS 3;  4FMB A;  1SQW A;  3LT8 A;  3H3H A;  2BO9 B;  1DMN A;  3X3Z A;  5AEW B;  5IF6 A;  1C7H A;  1EKM A;  1JRQ A;  3UB1 A;  2XFS A;  4CDL A;  3CCM 3;  3CPW 2;  1E97 A;  4AEQ A;  3WOF B;  4FR9 A;  3F9S A;  1FGR A;  3JUO A;  3PYJ A;  3MG3 A;  4N6V 0;  1JKG B;  3DM8 A;  3MHE A;  2CWT A;  2I9W A;  2W2C A;  6STD A;  1T5Y A;  1U5O A;  3HII A;  3NV0 B;  3MG2 A;  3HIG A;  3JVC A;  3QRD A;  1GY7 A;  4HJL B;  1IK3 A;  2WO0 A;  2WGQ A;  3K63 A;  4FMA A;  1NB3 I;  2W6J H;  1VZZ A;  3FLJ A;  1GY6 A;  3T0U A;  1QVG 2;  4L7K A;  4XDV A;  1RKY A;  1W7C A;  4KFD A;  2XH9 A;  5CK6 A;  1VQ6 3;  3F7X A;  4IIA A;  3UL5 A;  4XBT A;  3G4S 3;  1WMP A;  3K9M C;  1TIJ A;  1K41 A;  3AMO B;  3LH4 A;  2F98 A;  4MMY B;  2L4V A;  3Q2P A;  1GYB A;  1QAF A;  1YHQ 3;  3FF2 A;  3KSE D;  4OUQ A;  3WA2 X;  3CMA 3;  1UUV B;  3KSP A;  1W00 A;  1N9E A;  1DMQ A;  2BMO B;  2RGQ A;  3SOY A;  4N6O B;  3FSD A;  3FG3 A;  2O3O A;  5KP1 A;  3GWR A;  1MOL A;  3MYT A;  1SJW A;  1DYU A;  2KCD A;  5AIG A;  2FXT A;  3EN8 A;  1OH0 A;  3IJE B;  2HMO B;  4G1M B;  1LOX A;  4MJD A;  2SBL A;  1OGX A;  3UL6 A;  4FMD A;  2YFL B;  5BXQ A;  4I4K A;  3BB9 A;  3DGN A;  4LGQ A;  1DVC A;  1Q7Y 4;  2HML B;  4LEH A;  4LSO A;  1YGE A;  3F8H A;  3EJV A;  3CCE 3;  3LML A;  1JB5 A;  4N6N B;  1N8R 4;  2OWP A;  4HM3 B;  2CFW A;  2GBX B;  5KP3 A;  5IER A;  1YIT 3;  1UUW B;  2V1L A;  1A67 A;  2KRT A;  3D3L A;  3A76 A;  1IQX A;  3EBY A;  5AYR B;  5IEO A;  1KD1 4;  2K0M A;  1K9M 4;  3SED A;  1PU4 A;  3KZT A;  1W5Z A;  2QGU A;  3LYG A;  5G2G A;  2GEX A;  3KII A;  1IVW A;  4XDW A;  3J7Y d;  3FF0 A;  5CXO A;  1TFK A;  1NO3 A;  3NBR A;  1W6C A;  3VF1 A;  3SVA A;  4MMZ B;  2KXG A;  4WYK A;  2HMJ B;  1YIJ 3;  2W03 A;  3NM2 A;  2CFD A;  1HU9 A;  3S29 A;  4N6M A;  3FGY A;  4RZM A;  3F14 A;  4N3V A;  4HM0 B;  1US1 A;  1UI8 A;  1S72 3;  2BMQ B;  3DGL A;  4K90 B;  5STD A;  1FGQ A;  1OUN A;  2Y74 A;  4HM6 B;  1IU7 A;  1CYV A;  1NB5 I;  3KE7 A;  1FGT A;  2W56 A;  3PZW A;  1IQ8 A;  1JB4 A;  1F8N A;  3UNL A;  2E2U A;  3NUV A;  3IMA B;  3JUN A;  2MF7 A;  4HZ9 B;  3GZB A;  1RRL A;  2FNQ A;  1AVK A;  1NJI 4;  4HM1 B;  4HZB B;  1VQN 3;  4KVH A;  2CFL A;  2W56 B;  1IV7 A;  3FZW A;  3RDE A;  2W9P A;  2XRX B;  5AYS C;  1K8A 4;  1VQ7 3;  4R9K A;  2OOV A;  3OX9 A;  3PS8 A;  3HK4 A;  4N6U A;  3CNX A;  4HKV B;  8CHO A;  3IPT A;  3EHC A;  5EQL A;  5I97 A;  3CCL 3;  5AIF A;  3RGA A;  4AKY A;  5FW5 A;  3PGB A;  1KQS 2;  4R4K A;  3S5C A;  3NV0 A;  4HVN A;  4FCM A;  2M7O A;  3KN4 A;  1OHP A;  2YX9 A;  1IVV A;  2Z77 A;  3B4O A;  3SX1 A;  4L8O A;  3NQZ A;  5LC6 A;  4FCJ A;  3ROB A;  4XB5 A;  2D1W A;  1STD A;  1EA2 A;  4EXR A;  3HZP A;  1YVB I;  4HM2 B;  3AMO A;  4LZI A;  3HI7 A;  3Q90 A;  2O9U X;  4NRE A;  4N6T A;  3L0R A;  2P09 A;  1ROA A;  4EBG A;  4X2O A;  1KSI A;  2PZV A;  5IG4 A;  3GZX B;  2XSO B;  3FG4 A;  4IPB A;  2W04 A;  4CCV A;  4PEJ A;  1NDO B;  1D6Y A;  4KZ1 A;  1L5G B;  2E2V A;  2QIY A;  3PXM A;  3F40 A;  3TDG A;  3DZL A;  3WDG B;  1NWW A;  2GXF A;  4MMX B;  2CC3 A;  1W2Z A;  2HMN B;  1VQ9 3;  2IMJ A;  4U13 A;  3VGN A;  3JUQ A;  5CF2 A;  2LYX A;  3NBJ A;  4O8S A;  3Q1C A;  4Q53 A;  3LTB A;  5IEP A;  4KFE A;  4O3V A;  3RGR A;  2WOF A;  1JV2 B;  2BT3 A;  4WHA A;  1N5P A;  2XR8 B;  2CFK A;  1M1X B;  4O02 B;  2B1X B;  1UW1 A;  5BVB A;  1M90 4;  3CCV 3;  4IT7 A;  4LMI A;  1N8Q A;  5AII A;  5D81 A;  3LT9 A;  3ER7 A;  1LNH A;  1J2B A;  2WGO A;  1JNQ A;  3DMC A;  5D82 A;  2MC8 A;  3BNB A;  5JPP A;  2Z6B A;  1FGO A;  2Y73 A;  3I55 3;  3MSO A;  3O8Y A;  1CYU A;  3FCS B;  3EBT A;  3CCR 3;  1A2K A;  3CCU 3;  4HM7 B;  3CC4 3;  1K28 A;  5JPU A;  2GU1 A;  4XM4 A;  3E99 A;  3QK9 A;  3CNM A;  2XGL A;  1AV4 A;  2OTL 3;  1YI2 3;  1U8C B;  3N9H A;  5AEU B;  1A2V A;  2R4I A;  1ISK A;  2JQ5 A;  3DGO A;  1OCV A;  1HKX A;  1W4N A;  2CIU A;  3MWZ A;  4RNZ A;  2A15 A;  1O7G B;  4ORL A;  1VQP 3;  1OF5 B;  3EQQ B;  4X2H A;  1OHO A;  3ECF A;  3CCQ 3;  1VQ8 3;  1SIH A;  3HX8 A;  2ML6 A;  1WTH A;  5D83 A;  1MNL A;  2CG0 A;  4BTX A;  4J9A A;  4STD A;  1CEW I;  2E2T A;  3EF8 A;  4QWT A;  2WOH A;  1E3R A;  1O7W B;  5TGN A;  2OQE C;  1IDP A;  3KKG A;  1PFP A;  1Z1S A;  1OHS A;  1TFO A;  1CQS A;  2RFR A;  3PCS A;  3FH1 A;  3JUP A;  1IT7 A;  2P0M A;  3F8X A;  4WP5 A;  2C11 A;  1OAC A;  5DRV A;  5IG0 A;  3X40 A;  1AR0 A;  2HMM B;  1R4C A;  3SLU A;  2QEX 3;  4XBY A;  2P38 A;  3BND A;  3CPO A;  3VSY A;  3NXJ A;  3G16 A;  1VQL 3;  5ELU A;  3CC7 3;  3X41 A;  3FKA A;  2IUJ A;  2UX0 A;  2Z76 A;  4MEI A;  2GBW B;  1RN7 A;  1QVF 2;  3ALA A;  3X3X A;  3LTD A;  2B24 B;  1WMO A;  2YFJ B;  2CWU A;  1IT8 A;  1JN5 A;  1M9G A;  1VQK 3;  3K7C A;  1WMN A;  1G96 A;  1AVL A;  4K1U A;  2ZDJ A;  3B4P A;  3B7C A;  4JRF A;  1GY5 A;  1VQM 3;  1Q81 4;  3CU3 A;  3DY5 A;  3LZA A;  4BTY A;  3GZR A;  3S28 A;  2RSX A;  1IVX A;  5HGR A;  2CWV A;  2CW9 A;  4BTW A;  2INX A;  3OWY A;  3OWS A;  1JN5 B;  2GU3 A;  1Q82 4;  5IG3 A;  4R1K A;  3H51 A;  3SOA A;  3V92 A;  2C10 A;  3LOY A;  1Q40 B;  5EEO A;  3CC2 3;  1Q86 4;  3GRD A;  1FUW A;  4GL6 A;  1QAK A;  4HYZ A;  1ZO2 A;  1GD3 A;  2QA4 3;  4HBR A;  2Z7A A;  4RNY A;  3T8U A;  3N54 B;  4H3U A;  2CFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...