3Q90A

Crystal structure of the ntf2 domain of ras gtpase-activating protein-binding protein 1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
121
Chain Sequence
SPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the NTF2 domain of Ras GTPase-activating protein-binding protein 1
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ras GTPase-activating protein-binding protein 1
total genus 36
structure length 121
sequence length 131
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3q90A00
2JQ5A 1TUHA 3BB9A 2BMQB 3KZTA 2HMOB 4HM2B 5KP3A 5FW5A 4XB5A 2YFIB 3OV4A 3JUNA 3STDA 2HMMB 3MKIA 4HJLB 3T8UA 2BMRB 1ZX2A 5JPUA 1JB2A 4HM6B 4XBYA 2K54A 1K41A 3GZYB 5HGRA 5AIHA 2Z77A 3MSOA 1UUWB 2RFRA 5CF2A 2F86B 3MG3A 3NXJA 3OX9A 5CK6A 3DXOA 3JUQA 3NV0A 3F7XA 3F9SA 1OHSA 3EBYA 1GYBA 3GWRA 1JN5B 3I0YA 4OUQA 3JUPA 4J9AA 5IG0A 4STDA 3HZPA 5D81A 3B8LA 3FZWA 2HMKB 3BLZA 1ULIB 1IDPA 1OPYA 1STDA 3F8HA 3Q90A 4HZBB 4L8OA 1A2KA 2GEXA 3EN8A 4FCMA 1JKGB 3A76A 5AI1A 3EN1B 1Q40A 4ORLA 3F8XA 1E97A 3CPOA 5CLKA 3FF2A 3G16A 4XM4A 6STDA 3B4PA 3EF8A 3SOAA 3EHCA 4X2HA 3F7SA 1Z1SA 4I4KA 5IEOA 3VSYA 1W6YA 3K7CA 2HMNB 2GEYA 4FCJA 5D82A 2UX0A 3DZLA 2HMJB 3NV0B 4HM4B 1O7NB 3H51A 1W00A 4HZ9B 5AEUB 5JPPA 1Q42A 7STDA 5KP4A 3GRDA 5KP1A 1AR0A 2QIYA 5STDA 5IG3A 2R4IA 4K1VA 3H3HA 2BNGA 5AIGA 1GS3A 2BMOB 2XSOB 1JKGA 1ZO2A 2Z76A 3JUOA 4LMIA 3UNLA 3FF0A 3FGYA 1QMAA 3MG2A 3EBTA 3NBRA 4OVMA 3VGNA 4XDVA 4XBTA 4CDLA 1GY6A 3G8ZA 4GB5A 2W2CA 2YFLB 3CNXA 3B7CA 3GZXB 3KKGA 3RGAA 3OWYA 1BUQA 4U13A 4WP5A 1JN5A 1O7PB 3NHXA 5DREA 5CF1A 4HKVB 1VZZA 5AEWB 2F98A 3K0ZA 4K1UA 5CXOA 5IG4A 5IENA 1W02A 2CHCA 2HMLB 2OWPA 3UJMA 3HK4A 3HX8A 5IF6A 2Z7AA 5IG5A 5BXQA 3T8NA 3D9RA 3LYGA 3EC9A 3EQQB 3EX9A 2XR8B 3M8CA 3MHEA 4J8TA 4N3VA 1OH0A 1WQLB 3ECFA 3G0KA 1S5AA 3ROBA 3E99A 4XBXA 3B4OA 3DMCA 1DMNA 1O7MB 3ER7A 1OUNA 3F14A 4HM5B 4X2OA 5DRVA 1EG9B 2XSHB 3MG1A 4XDWA 3SOYA 5AIFA 1Q40B 3OWSA 4HM8B 1OHPA 4KVHA 5IERA 3DUKA 1E3RA 1NDOB 3JUMA 2B24B 3OWUA 2IMJA 4R9KA 1O7HB 4R1KA 2F99A 1GY7A 2GBWB 4PEJA 1OGXA 4IIAA 3WMDA 3EJVA 1JB4A 3CNMA 4RZMA 4L8PA 5AIIA 8CHOA 1ISKA 3KSPA 5G2GA 1UUVB 4WWUC 1SJWA 1ULJB 2GBXB 1OF5A 1W01A 2INXA 2GXFA 3FH1A 3KE7A 2XRXB 3GZRA 4HM7B 3S5CA 2STDA 4R9LA 2RCDA 3NUVA 3MYTA 1U5OA 4WYKA 5BVBA 1NU3A 1O7WB 3LZAA 3NM2A 4H3UA 4Q53A 4L7KA 3F40A 1QJGA 3FSDA 3GZBA 1EA2A 1OF5B 2I9WA 1E3VA 1OCVA 2B1XB 2PZVA 2RGQA 3OXAA 4HM3B 4HM1B 1DMQA 1ASKA 1JB5A 5D83A 3SEDA 4WYKB 5IEPA 2YFJB 1O7GB 1GY5A 4LGQA 5TGNA 3FLJA 1NWWA 1TP6A 4LEHA 4HM0B 1C7HA 3RGRA 3DM8A 1OHOA 1DMMA 2CKFB 3FKAA 4HVNA 4MJDA 2QGUA 3IPTA 1HKXA 2A15A 1CQSA 5EVHA 3CU3A 1OGZA
chains in the Genus database with same CATH superfamily
3Q3FA 1BRGA 1TUHA 3AGNA 1LRAA 1MWSA 1UUGB 3STDA 3MKIA 1JV2B 3V98A 4EYCA 3K63A 1YGWA 4HM6B 4XBYA 1K41A 2M7OA 3SXXA 2KF3A 2C4BA 1R4YA 3DXOA 1RGKA 1HZ1A 4EC6A 2H0GA 1RMSA 1I2EA 2LQVA 3EBYA 3N54B 3JUPA 4J9AA 4OUQA 1D6ZA 3L0RA 5D81A 1IQYA 1BSEA 3S29A 3HIGA 3G4S3 1IDPA 1FGRA 1A2KA 1RGGA 1UCJA 2GEXA 1GSPA 3EN8A 1B2MA 3BNCA 3FG3A 3CPOA 3ZG5A 3FF2A 3LTDA 4BU4A 1IK3A 2R41A 4X2HA 1JZDA 1W6YA 1B2SA 2CH9A 4KT3B 3WOEB 1A67A 2ZA4A 1W2ZA 2HMJB 3NV0B 4IPBA 3AHWA 5AEUB 4KFEA 1UGHI 5KP4A 1VQK3 1MWTA 1AR0A 5IG3A 1Q814 3CMA3 2R4IA 1B2ZA 2KF5A 2BNGA 3WHOA 3OW22 2BMOB 1JKGA 1Y4KA 1A2PA 3IJEB 3FF0A 4KZ1A 2SARA 3G713 1B2UA 4MMYB 4XDVA 4XBTA 4CDLA 4GB5A 5JBSA 2W2CA 1I3IA 2YFLB 1EKMA 2XF3A 4DKIA 1MOLA 3PZWA 3RGAA 1IVWA 3OWYA 4WP5A 4EV5A 3NHXA 4HKVB 3S28A 3K0ZA 4K1UA 3O8YA 1C54A 2OWPA 1TTOA 1G0TA 4QWTA 2W0QA 2Z7AA 5AYSC 5BXQA 4N3VA 1RGFA 3CME3 2XR8B 1FGTA 1FUSA 3G0KA 3ROBA 1BSAA 3AMOA 2QA43 3DMCA 1N9EA 1O7MB 3DGMA 1NB5I 3SOYA 1K8A4 2XSHB 3X3XA 1DYUA 1Q40B 4HM8B 3EE1A 4OK0A 2YX9A 1VQM3 2GSPA 2O9UX 1NDOB 2Q07A 4O02B 4R9KA 2FNQA 7RNTA 3QK9A 1R4CA 4PEJA 3WODG 1QVG2 1I0XA 4IIAA 2XEPA 1NNVA 8CHOA 3GAXA 3HI7A 3PGBA 5G2GA 2CIUA 1SARA 1TRPA 2GBXB 3I553 2INXA 3KE7A 1RGEA 4O8SA 1BNRA 3CPW2 3S5CA 4WYKA 2F5MA 2RCDA 3NUVA 3MYTA 1U5OA 1PFPA 3NQYA 3D5IA 1FZUA 1BSBA 2H0IA 1M1XB 3I563 3GZBA 1OF5B 1K28A 1OCVA 2PZVA 1RHLA 1IVVA 1UDII 4HM3B 4HM1B 4I4KA 4O3VA 1YIJ3 1ROAA 4HYZA 3BNDA 1T2IA 1PU4A 2YFJB 4LGQA 4G1MB 1N8QA 4TX4A 4HOHA 2E2TA 1UGIA 1A2VA 1GD4A 1WMPA 2CC3A 1VQN3 3DM8A 1DMMA 4AEQA 1JRQA 1FGOA 4NPBA 2AADA 1B27A 5EVHA 1NO3A 4EBGA 1TFKA 4FMBA 3KZTA 1NB3I 1RLSA 4HM2B 1AY7A 1YJ93 4AKZA 2FXTA 1BVIA 2HMMB 3T8UA 2BMRB 1JB2A 3KFQC 1BNGA 2MC8A 1RRHA 5HGRA 1IQXA 1W4NA 1UUWB 2RFRA 1KD14 3SLUA 1F8NA 4NHFA 3DGOA 1IYYA 2WGOA 1LNIA 3F7XA 1V57A 3NQZA 5G1LA 5IG0A 3DGNA 3IMAB 3RDEA 3HZPA 2JDIH 1T2HA 3B8LA 3GSPA 2HMKB 1ULIB 3FG4A 1OPYA 1CYUA 3SX1A 1LQGC 1WTHA 4L8OA 3CCE3 4FCZA 3V92A 3DH2A 4FCMA 1IVUA 2CW9A 3EN1B 1Q40A 1BIRA 1MGRA 2CWUA 6STDA 2KCDA 1RNTA 2PNCA 4I5QA 5IEOA 1RGCA 2MF7A 4HM4B 2E2UA 5JPPA 1DETA 1IT8A 1Q42A 2BU4A 4GHOA 1N5PA 1YVSA 1BNEA 2GU3A 4WHAA 1QAKA 2C10A 1M1K4 1SQWA 4N6MA 1GS3A 3JUOA 5M1AA 1VQ43 3LH4A 3VGNA 4BTXA 4OVMA 1RCLA 1JBSA 2P0XA 1BRNL 5EQLA 3B7CA 3GZXB 1JN5A 2F4YA 4WFOA 3U1WA 1IQ8A 2IUKA 4GSPA 5AEWB 5IG4A 5CXOA 5IENA 1W02A 2CHCA 2HMLB 4CCVA 3CCU3 1GOYA 2CX0A 2OCTA 4N6NB 1M904 5IG5A 4LZIA 3T8NA 3LYGA 4J8TA 1I8VA 1W7CA 1A90A 3ECFA 1S5AA 1I0VA 3U97A 1SIIA 3B4OA 3ER7A 4XBXA 1OUNA 4HM5B 5EEOA 1B3SA 1YJN3 3MG1A 1LOXA 1SPUA 5RNTA 3CC73 3D3LA 1W6CA 3OWSA 5ELUA 5IERA 3ALAA 1E3RA 1VQ53 2SBLA 3JUMA 3LXUX 1RGLA 3QRDA 2IMJA 3ZG0A 3WR2A 2F99A 1B21A 2OQEC 6RNTA 1G02A 3LOYA 4N6V0 1YNVX 1ISKA 3FCSB 1BSCA 4KFFA 1KQS2 1UUVB 1BNIA 1JZOA 1SJWA 1RSNA 1W01A 1GMPA 2CFDA 2CK3H 2CFWA 3CCQ3 3FH1A 4HM7B 2RSXA 3GZRA 2ZL8A 1V74A 3Q1CA 1KSIA 2XFTA 1O7WB 3SYUA 3N8BA 4L7KA 3F40A 1VQ93 3K5TA 2CWTA 1CYVA 1X1WA 3WOFB 2B1XB 2RGQA 1TFOA 3OXAA 1HU9A 5D83A 1DMQA 3S67A 3URPA 2W56A 2KXGA 4CPKA 1GY5A 5IW9A 2W9QA 5LC6A 2P09A 1TP6A 4LEHA 1AV4A 1JBRA 4HM0B 3RGRA 2W03A 3CCV3 2BIRA 3FKAA 1VQO3 1I2FA 9RNTA 5I97A 1YI23 4EW5A 2A15A 1CQSA 4R80A 1LVNA 3NBBA 2BMQB 2D42A 1EEJA 2L1SA 5FW5A 4XB5A 2YFIB 3BU4A 1LNHA 3CCS3 4HJLB 1KWIA 1YVBI 3N9HA 3A5EA 5JPUA 3CC23 1GOUA 1I3FA 2K54A 1L5GB 3X3ZA 2Z77A 3MSOA 1Q824 1BOXA 2FGTA 3NM7A 2F86B 2HOHA 3MG3A 3NXJA 1JNQA 5CK6A 4RNZA 3UB1A 3JUQA 3V99A 1FUWA 2KF4A 1X1UA 1K9M4 3GWRA 1JN5B 1BAOA 2XFSA 3FZWA 1BRSA 1UI7A 2UGIA 3F8HA 3FG1A 3Q90A 4HZBB 2XGLA 2IA7A 2LYXA 1JKGB 1ROVA 5AI1A 3DGLA 1TIJA 4ORLA 4R4KA 5CLKA 3KSED 1BU4A 3G16A 4J5GA 4AKYA 3EF8A 1RJOA 1RTUA 2Y73A 3EHCA 1Z1SA 3SOAA 3VSYA 1CEWI 3WA2X 1TU5A 4LYLB 3DZLA 2W04A 5GSPA 7STDA 1YHQ3 1FGMA 3GRDA 1BANA 5KP1A 5STDA 4BL3A 1WNHA 4JF8A 1G96A 3RNTA 1MWRA 1LOWA 3MPHA 4JRFA 5AIGA 2BHMA 2XSOB 1ZO2A 3PXMA 1LXEA 1IT7A 3EBTA 3CXC2 2WGQA 1GY6A 2GU1A 1UCIA 3G8ZA 3CNXA 2OTL3 3KKGA 4H61A 5ELJA 2KF6A 1O7PB 1IVXA 3X41A 1VQ63 2P38A 3UJMA 2WOHA 3HX8A 5IF6A 1AQZA 3LTCA 3D9RA 1RDSA 3EC9A 3EQQB 3EX9A 4HBRA 4BL2A 2CFLA 2CWVA 2K0MA 3PCRA 1BSDA 3PYJA 1FA3A 2IUJA 3MWZA 5KP3A 3F14A 3KCHA 1EG9B 4XDWA 2H0HA 4HAAA 1RNBA 5HOHA 1RN4A 1OHPA 4KVHA 1RN7A 3X3YA 3LTAA 3LMLA 1RGHA 1FGQA 1D6UA 2B24B 3CD63 2XGNA 4R1KA 4O2HA 2GBWB 3PCSA 3EJVA 1JB4A 2C11A 4J5KA 4RZMA 5AIIA 4RBNA 2OQEA 2CFKA 3SVAA 4WWUC 3NBJA 1JJ22 1ULJB 3X40A 1OF5A 3BIRA 3S27A 4BTYA 1YJW3 3UNLA 4CJNA 2XRXB 3X42A 4R9LA 1UCLA 2ML5A 3UL5A 2RBIA 1HYFA 3LZAA 4MMXB 5AYRB 1VQ73 4MEIA 1Q7HA 1S723 1J2BA 1BUJA 3HIIA 1QAFA 1UI8A 3D4AA 1E3VA 2RNTA 2D1WA 4MMZB 4ZM8A 1JB5A 3TDGA 2P05A 2QEX3 4WYKB 1FYSA 7GSPA 1O7GB 4LSOA 1VQP3 1AVKA 1LOYA 1N8R4 3FLJA 3CC43 4N6OB 1C7HA 2OOVA 1IV9A 1UCKA 3CCJ3 1Q7Y4 4RNTA 4HVNA 4MJDA 4EXRA 2QGUA 2AAEA 1HKXA 3IPTA 1T5YA 2O3OA 5M18A 1Q864 1RGAA 2XH9A 2JQ5A 3G6E3 3BB9A 1ZGXA 1M9GA 2HMOB 3OV4A 3JUNA 3AMOB 3WDGB 1ZX2A 3WA3A 1W2B2 2K3DA 1JBTA 2L4VA 3GZYB 5AIHA 4KFDA 1BNSA 3AHSA 1GMQA 4N6UA 5CF2A 3VF1A 3OX9A 1RCKA 2UUGC 3NV0A 3F9SA 3Q2PA 4FMCA 1OHSA 2Z6BA 1NJI4 1BGSA 1QVF2 1GYBA 2WOFA 3I0YA 1I2GA 1UW1A 4STDA 3BLZA 3D5GA 1B2XA 1BRIA 1STDA 1U8CB 1US1A 2BO9B 1X1YA 4BTWA 3A76A 2W9PA 1BNFA 3F8XA 1E97A 3DY5A 2ML6A 4XM4A 1QALA 3B4PA 3J7Yd 1LQMB 3F7SA 1ZS7A 2W6JH 3K7CA 3K9MC 2HMNB 2GEYA 2J8XB 3EB8A 3LT9A 2UX0A 2WO0A 4FCJA 5D82A 4HZ9B 1EUIC 1B20A 1O7NB 1W00A 3H51A 2OTJ3 1DE3A 1MNLA 1I70A 1W5ZA 4FMDA 4ILFA 2ZHXB 2QIYA 3CCM3 4K1VA 3H3HA 3LTBA 4N6LA 1YIT3 5BIRA 1BRKA 2Z76A 4LMIA 4K90B 1X1XA 3AGOA 1QMAA 2CX1A 3BNBA 1D6YA 1N5HA 3FGYA 3MG2A 3NBRA 1CH0A 5M19A 1WMNA 3T0UA 1BUQA 4IT7A 4U13A 1BRHA 5G1KA 4FR9A 5DREA 5CF1A 2CG0A 1VZZA 2F56A 2F98A 2OOVC 5A0OB 1IU7A 5FGOA 2V1LA 1MGWA 3HK4A 3KN4A 1RN1A 1PYLA 3ZFZA 2CG1A 3MHEA 3DGYA 3M8CA 1GMRA 1WMOA 1OH0A 1Q9EA 1FUTA 1WQLB 3D79A 1SIHA 2KRTA 3E99A 3KIIA 2F5WA 1DMNA 4X2OA 5DRVA 5LC7A 3LT8A 3JVCA 1OACA 1TJDA 1TRQA 5AIFA 3PS8A 2BT3A 4NREA 1RRLA 3DUKA 1VQL3 6GSPA 3OWUA 1O7HB 1YGEA 1GY7A 1AVLA 1VQ83 1OGXA 1MWUA 3WMDA 3UL6A 1GD3A 3CNMA 4L8PA 4EV2A 1PY3A 3BNEA 3KSPA 4RNYA 1STFI 1GOVA 1N9JA 2CFGA 4N6TA 1IV7A 1VQQA 2GXFA 3CCL3 4GL6A 1BNJA 2STDA 2W56B 5BVBA 8RNTA 1RKYA 1BRJA 2Y74A 1NU3A 3NM2A 1FW7A 4H3UA 4Q53A 1EQKA 1QJGA 3FSDA 1EA2A 2KAAA 2ZDJA 1KC84 2I9WA 1W6GA 3SEDA 2IYJA 3CCR3 1ASKA 1T3BA 2IY2A 3NX0A 5IEPA 5TGNA 4K61A 1NWWA 2P0MA 1K734 1DVDA 1OHOA 1V58A 2CKFB 1DVCA 5BU4A 3HOHA 1LOVA 2E2VA 4BIRA 3CU3A 4FMAA 1OGZA
chains in the Genus database with same CATH topology
1TUHA 3STDA 3MKIA 1JV2B 3V98A 4EYCA 3K63A 4HM6B 4XBYA 1K41A 2M7OA 3SXXA 3DXOA 4EC6A 2LQVA 3EBYA 3N54B 3JUPA 4J9AA 4OUQA 1D6ZA 3L0RA 5D81A 1IQYA 3S29A 3HIGA 3G4S3 1IDPA 1FGRA 1A2KA 2GEXA 3EN8A 3BNCA 3FG3A 3CPOA 3FF2A 3LTDA 1IK3A 4X2HA 1W6YA 2CH9A 3WOEB 1A67A 1W2ZA 2HMJB 3NV0B 4IPBA 5AEUB 4KFEA 5KP4A 1VQK3 1AR0A 5IG3A 1Q814 3CMA3 2R4IA 2BNGA 3OW22 2BMOB 1JKGA 1Y4KA 3IJEB 3FF0A 4KZ1A 3G713 4MMYB 4XDVA 4XBTA 4CDLA 4GB5A 5JBSA 2W2CA 2YFLB 1EKMA 2XF3A 1MOLA 3PZWA 3RGAA 1IVWA 3OWYA 4WP5A 4EV5A 3NHXA 4HKVB 3S28A 3K0ZA 4K1UA 3O8YA 2OWPA 4QWTA 2W0QA 2Z7AA 5AYSC 5BXQA 4N3VA 2XR8B 1FGTA 3G0KA 3ROBA 3AMOA 2QA43 3DMCA 1N9EA 1O7MB 3DGMA 1NB5I 3SOYA 1K8A4 2XSHB 3X3XA 1DYUA 1Q40B 4HM8B 3EE1A 4OK0A 2YX9A 1VQM3 2O9UX 1NDOB 2Q07A 4O02B 4R9KA 2FNQA 3QK9A 1R4CA 4PEJA 3WODG 1QVG2 4IIAA 2XEPA 8CHOA 3GAXA 3HI7A 3PGBA 5G2GA 2CIUA 3I553 2GBXB 2INXA 3KE7A 4O8SA 3CPW2 3S5CA 4WYKA 2RCDA 3NUVA 3MYTA 1U5OA 1PFPA 3NQYA 1M1XB 3I563 3GZBA 1OF5B 1K28A 2PZVA 1OCVA 4HM3B 1IVVA 4HM1B 4I4KA 1YIJ3 4O3VA 1ROAA 4HYZA 3BNDA 1PU4A 2YFJB 4LGQA 4G1MB 1N8QA 4TX4A 2E2TA 1A2VA 1GD4A 1WMPA 2CC3A 1VQN3 3DM8A 1DMMA 4AEQA 1JRQA 1FGOA 5EVHA 1NO3A 4EBGA 1TFKA 4FMBA 3KZTA 1NB3I 4HM2B 1YJ93 4AKZA 2FXTA 2HMMB 3T8UA 2BMRB 1JB2A 3KFQC 2MC8A 1RRHA 5HGRA 1IQXA 1W4NA 1UUWB 2RFRA 1KD14 3SLUA 1F8NA 4NHFA 3DGOA 2WGOA 3F7XA 3NQZA 5IG0A 3DGNA 3IMAB 3RDEA 3HZPA 2JDIH 3B8LA 2HMKB 1ULIB 3FG4A 1OPYA 1CYUA 3SX1A 1WTHA 4L8OA 3CCE3 4FCZA 3V92A 4FCMA 1IVUA 2CW9A 3EN1B 1Q40A 2CWUA 6STDA 2KCDA 2PNCA 5IEOA 2MF7A 4HM4B 2E2UA 5JPPA 1IT8A 1Q42A 1N5PA 2GU3A 4WHAA 1QAKA 2C10A 1M1K4 1SQWA 4N6MA 1GS3A 3JUOA 1VQ43 3LH4A 3VGNA 4BTXA 4OVMA 2P0XA 5EQLA 3B7CA 3GZXB 1JN5A 4WFOA 3U1WA 1IQ8A 2IUKA 5AEWB 5IG4A 5IENA 5CXOA 1W02A 2CHCA 2HMLB 4CCVA 3CCU3 2OCTA 4N6NB 1M904 5IG5A 4LZIA 3T8NA 3LYGA 4J8TA 1W7CA 1A90A 3ECFA 1S5AA 3U97A 1SIIA 3B4OA 3ER7A 4XBXA 1OUNA 4HM5B 5EEOA 1YJN3 3MG1A 1LOXA 1SPUA 3CC73 3D3LA 1W6CA 3OWSA 5ELUA 5IERA 3ALAA 1E3RA 1VQ53 2SBLA 3JUMA 3LXUX 3QRDA 2IMJA 2F99A 2OQEC 3LOYA 4N6V0 1ISKA 3FCSB 4KFFA 1KQS2 1UUVB 1SJWA 2CFDA 1W01A 2CK3H 2CFWA 3CCQ3 3FH1A 4HM7B 2RSXA 3GZRA 2ZL8A 1V74A 3Q1CA 1KSIA 2XFTA 1O7WB 3N8BA 4L7KA 3F40A 1VQ93 3K5TA 2CWTA 1CYVA 3WOFB 2RGQA 2B1XB 1TFOA 3OXAA 1HU9A 5D83A 1DMQA 3S67A 2W56A 2KXGA 1GY5A 5IW9A 2W9QA 5LC6A 2P09A 1TP6A 4LEHA 1AV4A 4HM0B 3RGRA 2W03A 3CCV3 3FKAA 1VQO3 1YI23 5I97A 2A15A 1CQSA 4R80A 1LVNA 3NBBA 2BMQB 2D42A 5FW5A 4XB5A 2YFIB 1LNHA 3CCS3 4HJLB 1KWIA 1YVBI 3N9HA 5JPUA 3CC23 2K54A 1L5GB 3X3ZA 2Z77A 3MSOA 1Q824 2FGTA 3NM7A 2F86B 3MG3A 3NXJA 1JNQA 5CK6A 4RNZA 3UB1A 3JUQA 3V99A 1FUWA 1K9M4 3GWRA 1JN5B 2XFSA 3FZWA 1UI7A 3F8HA 3Q90A 3FG1A 4HZBB 2XGLA 2IA7A 2LYXA 1JKGB 1ROVA 5AI1A 3DGLA 1TIJA 4ORLA 4R4KA 5CLKA 3KSED 3G16A 4AKYA 3EF8A 1RJOA 2Y73A 3EHCA 3SOAA 1Z1SA 3VSYA 1TU5A 1CEWI 3WA2X 3DZLA 2W04A 7STDA 1YHQ3 1FGMA 3GRDA 5KP1A 5STDA 1WNHA 4JF8A 1G96A 3MPHA 4JRFA 5AIGA 2BHMA 2XSOB 1ZO2A 3PXMA 1LXEA 1IT7A 3EBTA 3CXC2 2WGQA 1GY6A 2GU1A 3G8ZA 3CNXA 2OTL3 3KKGA 4H61A 5ELJA 1O7PB 1IVXA 3X41A 1VQ63 2P38A 3UJMA 2WOHA 3HX8A 5IF6A 3LTCA 3D9RA 3EC9A 3EQQB 3EX9A 4HBRA 2CFLA 2CWVA 2K0MA 3PCRA 3PYJA 1FA3A 2IUJA 3MWZA 5KP3A 3F14A 1EG9B 4XDWA 1OHPA 4KVHA 1RN7A 3X3YA 3LTAA 3LMLA 1FGQA 1D6UA 2B24B 3CD63 2XGNA 4R1KA 4O2HA 2GBWB 3PCSA 3EJVA 1JB4A 2C11A 4RZMA 5AIIA 4RBNA 2OQEA 2CFKA 3SVAA 4WWUC 3NBJA 1JJ22 1ULJB 1OF5A 3S27A 4BTYA 1YJW3 3UNLA 2XRXB 3X42A 4R9LA 2ML5A 3UL5A 3LZAA 4MMXB 5AYRB 1VQ73 4MEIA 1S723 1J2BA 3HIIA 1QAFA 1UI8A 1E3VA 2D1WA 4MMZB 4ZM8A 1JB5A 3TDGA 2P05A 2QEX3 4WYKB 3CC43 1O7GB 4LSOA 1VQP3 1AVKA 1N8R4 3FLJA 4N6OB 1C7HA 2OOVA 1IV9A 3CCJ3 1Q7Y4 4HVNA 4MJDA 4EXRA 2QGUA 3IPTA 1HKXA 1T5YA 2O3OA 1Q864 2XH9A 2JQ5A 3G6E3 3BB9A 1M9GA 2HMOB 3OV4A 3JUNA 3AMOB 3WDGB 1ZX2A 3WA3A 1W2B2 2L4VA 3GZYB 5AIHA 4KFDA 4N6UA 5CF2A 3VF1A 3OX9A 3Q2PA 4FMCA 3NV0A 3F9SA 1OHSA 2Z6BA 1NJI4 1QVF2 1GYBA 2WOFA 3I0YA 1UW1A 4STDA 3BLZA 1STDA 1U8CB 1US1A 2BO9B 4BTWA 3A76A 2W9PA 3F8XA 1E97A 3DY5A 2ML6A 4XM4A 1QALA 3B4PA 3J7Yd 3F7SA 3K9MC 2W6JH 3K7CA 2HMNB 2GEYA 3EB8A 4FCJA 3LT9A 2UX0A 2WO0A 5D82A 3X40A 4HZ9B 1O7NB 3H51A 1W00A 2OTJ3 1MNLA 1W5ZA 4FMDA 2QIYA 3CCM3 4K1VA 3H3HA 3LTBA 4N6LA 1YIT3 2Z76A 4LMIA 1RKYA 4K90B 3CME3 3FGYA 1QMAA 3BNBA 3MG2A 1N5HA 1D6YA 3NBRA 1WMNA 3T0UA 1BUQA 4IT7A 4U13A 4FR9A 5DREA 5CF1A 2CG0A 1VZZA 2OOVC 2F98A 5A0OB 1IU7A 5FGOA 2V1LA 3HK4A 3KN4A 2CG1A 3MHEA 3M8CA 1WMOA 1OH0A 1WQLB 1SIHA 2KRTA 3E99A 3KIIA 4X2OA 1DMNA 5DRVA 5LC7A 3LT8A 3JVCA 1OACA 5AIFA 3PS8A 2BT3A 4NREA 1RRLA 3DUKA 1VQL3 3OWUA 1O7HB 1YGEA 1GY7A 1AVLA 1VQ83 1OGXA 3WMDA 3UL6A 1GD3A 3CNMA 4L8PA 4EV2A 3BNEA 3KSPA 4RNYA 1STFI 1N9JA 2CFGA 4N6TA 1IV7A 3CCL3 2GXFA 4GL6A 2STDA 2W56B 5BVBA 2Y74A 1NU3A 3NM2A 4H3UA 4Q53A 1EQKA 1QJGA 3FSDA 1EA2A 2ZDJA 1KC84 2I9WA 1W6GA 3SEDA 3CCR3 1ASKA 3NX0A 5IEPA 5TGNA 4K61A 1NWWA 2P0MA 1K734 1DVDA 1OHOA 2CKFB 1DVCA 2E2VA 3CU3A 4FMAA 1OGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQ5 A;  1TUH A;  3BB9 A;  2BMQ B;  3KZT A;  2HMO B;  4HM2 B;  5KP3 A;  5FW5 A;  4XB5 A;  2YFI B;  3OV4 A;  3JUN A;  3STD A;  2HMM B;  3MKI A;  4HJL B;  3T8U A;  2BMR B;  1ZX2 A;  5JPU A;  1JB2 A;  4HM6 B;  4XBY A;  2K54 A;  1K41 A;  3GZY B;  5HGR A;  5AIH A;  2Z77 A;  3MSO A;  1UUW B;  2RFR A;  5CF2 A;  2F86 B;  3MG3 A;  3NXJ A;  3OX9 A;  5CK6 A;  3DXO A;  3JUQ A;  3NV0 A;  3F7X A;  3F9S A;  1OHS A;  3EBY A;  1GYB A;  3GWR A;  1JN5 B;  3I0Y A;  4OUQ A;  3JUP A;  4J9A A;  5IG0 A;  4STD A;  3HZP A;  5D81 A;  3B8L A;  3FZW A;  2HMK B;  3BLZ A;  1ULI B;  1IDP A;  1OPY A;  1STD A;  3F8H A;  3Q90 A;  4HZB B;  4L8O A;  1A2K A;  2GEX A;  3EN8 A;  4FCM A;  1JKG B;  3A76 A;  5AI1 A;  3EN1 B;  1Q40 A;  4ORL A;  3F8X A;  1E97 A;  3CPO A;  5CLK A;  3FF2 A;  3G16 A;  4XM4 A;  6STD A;  3B4P A;  3EF8 A;  3SOA A;  3EHC A;  4X2H A;  3F7S A;  1Z1S A;  4I4K A;  5IEO A;  3VSY A;  1W6Y A;  3K7C A;  2HMN B;  2GEY A;  4FCJ A;  5D82 A;  2UX0 A;  3DZL A;  2HMJ B;  3NV0 B;  4HM4 B;  1O7N B;  3H51 A;  1W00 A;  4HZ9 B;  5AEU B;  5JPP A;  1Q42 A;  7STD A;  5KP4 A;  3GRD A;  5KP1 A;  1AR0 A;  2QIY A;  5STD A;  5IG3 A;  2R4I A;  4K1V A;  3H3H A;  2BNG A;  5AIG A;  1GS3 A;  2BMO B;  2XSO B;  1JKG A;  1ZO2 A;  2Z76 A;  3JUO A;  4LMI A;  3UNL A;  3FF0 A;  3FGY A;  1QMA A;  3MG2 A;  3EBT A;  3NBR A;  4OVM A;  3VGN A;  4XDV A;  4XBT A;  4CDL A;  1GY6 A;  3G8Z A;  4GB5 A;  2W2C A;  2YFL B;  3CNX A;  3B7C A;  3GZX B;  3KKG A;  3RGA A;  3OWY A;  1BUQ A;  4U13 A;  4WP5 A;  1JN5 A;  1O7P B;  3NHX A;  5DRE A;  5CF1 A;  4HKV B;  1VZZ A;  5AEW B;  2F98 A;  3K0Z A;  4K1U A;  5CXO A;  5IG4 A;  5IEN A;  1W02 A;  2CHC A;  2HML B;  2OWP A;  3UJM A;  3HK4 A;  3HX8 A;  5IF6 A;  2Z7A A;  5IG5 A;  5BXQ A;  3T8N A;  3D9R A;  3LYG A;  3EC9 A;  3EQQ B;  3EX9 A;  2XR8 B;  3M8C A;  3MHE A;  4J8T A;  4N3V A;  1OH0 A;  1WQL B;  3ECF A;  3G0K A;  1S5A A;  3ROB A;  3E99 A;  4XBX A;  3B4O A;  3DMC A;  1DMN A;  1O7M B;  3ER7 A;  1OUN A;  3F14 A;  4HM5 B;  4X2O A;  5DRV A;  1EG9 B;  2XSH B;  3MG1 A;  4XDW A;  3SOY A;  5AIF A;  1Q40 B;  3OWS A;  4HM8 B;  1OHP A;  4KVH A;  5IER A;  3DUK A;  1E3R A;  1NDO B;  3JUM A;  2B24 B;  3OWU A;  2IMJ A;  4R9K A;  1O7H B;  4R1K A;  2F99 A;  1GY7 A;  2GBW B;  4PEJ A;  1OGX A;  4IIA A;  3WMD A;  3EJV A;  1JB4 A;  3CNM A;  4RZM A;  4L8P A;  5AII A;  8CHO A;  1ISK A;  3KSP A;  5G2G A;  1UUV B;  4WWU C;  1SJW A;  1ULJ B;  2GBX B;  1OF5 A;  1W01 A;  2INX A;  2GXF A;  3FH1 A;  3KE7 A;  2XRX B;  3GZR A;  4HM7 B;  3S5C A;  2STD A;  4R9L A;  2RCD A;  3NUV A;  3MYT A;  1U5O A;  4WYK A;  5BVB A;  1NU3 A;  1O7W B;  3LZA A;  3NM2 A;  4H3U A;  4Q53 A;  4L7K A;  3F40 A;  1QJG A;  3FSD A;  3GZB A;  1EA2 A;  1OF5 B;  2I9W A;  1E3V A;  1OCV A;  2B1X B;  2PZV A;  2RGQ A;  3OXA A;  4HM3 B;  4HM1 B;  1DMQ A;  1ASK A;  1JB5 A;  5D83 A;  3SED A;  4WYK B;  5IEP A;  2YFJ B;  1O7G B;  1GY5 A;  4LGQ A;  5TGN A;  3FLJ A;  1NWW A;  1TP6 A;  4LEH A;  4HM0 B;  1C7H A;  3RGR A;  3DM8 A;  1OHO A;  1DMM A;  2CKF B;  3FKA A;  4HVN A;  4MJD A;  2QGU A;  3IPT A;  1HKX A;  2A15 A;  1CQS A;  5EVH A;  3CU3 A;  1OGZ A; 
#chains in the Genus database with same CATH topology
 3Q3F A;  1BRG A;  1TUH A;  3AGN A;  1LRA A;  1MWS A;  1UUG B;  3STD A;  3MKI A;  1JV2 B;  3V98 A;  4EYC A;  3K63 A;  1YGW A;  4HM6 B;  4XBY A;  1K41 A;  2M7O A;  3SXX A;  2KF3 A;  2C4B A;  1R4Y A;  3DXO A;  1RGK A;  1HZ1 A;  4EC6 A;  2H0G A;  1RMS A;  1I2E A;  2LQV A;  3EBY A;  3N54 B;  3JUP A;  4J9A A;  4OUQ A;  1D6Z A;  3L0R A;  5D81 A;  1IQY A;  1BSE A;  3S29 A;  3HIG A;  3G4S 3;  1IDP A;  1FGR A;  1A2K A;  1RGG A;  1UCJ A;  2GEX A;  1GSP A;  3EN8 A;  1B2M A;  3BNC A;  3FG3 A;  3CPO A;  3ZG5 A;  3FF2 A;  3LTD A;  4BU4 A;  1IK3 A;  2R41 A;  4X2H A;  1JZD A;  1W6Y A;  1B2S A;  2CH9 A;  4KT3 B;  3WOE B;  1A67 A;  2ZA4 A;  1W2Z A;  2HMJ B;  3NV0 B;  4IPB A;  3AHW A;  5AEU B;  4KFE A;  1UGH I;  5KP4 A;  1VQK 3;  1MWT A;  1AR0 A;  5IG3 A;  1Q81 4;  3CMA 3;  2R4I A;  1B2Z A;  2KF5 A;  2BNG A;  3WHO A;  3OW2 2;  2BMO B;  1JKG A;  1Y4K A;  1A2P A;  3IJE B;  3FF0 A;  4KZ1 A;  2SAR A;  3G71 3;  1B2U A;  4MMY B;  4XDV A;  4XBT A;  4CDL A;  4GB5 A;  5JBS A;  2W2C A;  1I3I A;  2YFL B;  1EKM A;  2XF3 A;  4DKI A;  1MOL A;  3PZW A;  3RGA A;  1IVW A;  3OWY A;  4WP5 A;  4EV5 A;  3NHX A;  4HKV B;  3S28 A;  3K0Z A;  4K1U A;  3O8Y A;  1C54 A;  2OWP A;  1TTO A;  1G0T A;  4QWT A;  2W0Q A;  2Z7A A;  5AYS C;  5BXQ A;  4N3V A;  1RGF A;  3CME 3;  2XR8 B;  1FGT A;  1FUS A;  3G0K A;  3ROB A;  1BSA A;  3AMO A;  2QA4 3;  3DMC A;  1N9E A;  1O7M B;  3DGM A;  1NB5 I;  3SOY A;  1K8A 4;  2XSH B;  3X3X A;  1DYU A;  1Q40 B;  4HM8 B;  3EE1 A;  4OK0 A;  2YX9 A;  1VQM 3;  2GSP A;  2O9U X;  1NDO B;  2Q07 A;  4O02 B;  4R9K A;  2FNQ A;  7RNT A;  3QK9 A;  1R4C A;  4PEJ A;  3WOD G;  1QVG 2;  1I0X A;  4IIA A;  2XEP A;  1NNV A;  8CHO A;  3GAX A;  3HI7 A;  3PGB A;  5G2G A;  2CIU A;  1SAR A;  1TRP A;  2GBX B;  3I55 3;  2INX A;  3KE7 A;  1RGE A;  4O8S A;  1BNR A;  3CPW 2;  3S5C A;  4WYK A;  2F5M A;  2RCD A;  3NUV A;  3MYT A;  1U5O A;  1PFP A;  3NQY A;  3D5I A;  1FZU A;  1BSB A;  2H0I A;  1M1X B;  3I56 3;  3GZB A;  1OF5 B;  1K28 A;  1OCV A;  2PZV A;  1RHL A;  1IVV A;  1UDI I;  4HM3 B;  4HM1 B;  4I4K A;  4O3V A;  1YIJ 3;  1ROA A;  4HYZ A;  3BND A;  1T2I A;  1PU4 A;  2YFJ B;  4LGQ A;  4G1M B;  1N8Q A;  4TX4 A;  4HOH A;  2E2T A;  1UGI A;  1A2V A;  1GD4 A;  1WMP A;  2CC3 A;  1VQN 3;  3DM8 A;  1DMM A;  4AEQ A;  1JRQ A;  1FGO A;  4NPB A;  2AAD A;  1B27 A;  5EVH A;  1NO3 A;  4EBG A;  1TFK A;  4FMB A;  3KZT A;  1NB3 I;  1RLS A;  4HM2 B;  1AY7 A;  1YJ9 3;  4AKZ A;  2FXT A;  1BVI A;  2HMM B;  3T8U A;  2BMR B;  1JB2 A;  3KFQ C;  1BNG A;  2MC8 A;  1RRH A;  5HGR A;  1IQX A;  1W4N A;  1UUW B;  2RFR A;  1KD1 4;  3SLU A;  1F8N A;  4NHF A;  3DGO A;  1IYY A;  2WGO A;  1LNI A;  3F7X A;  1V57 A;  3NQZ A;  5G1L A;  5IG0 A;  3DGN A;  3IMA B;  3RDE A;  3HZP A;  2JDI H;  1T2H A;  3B8L A;  3GSP A;  2HMK B;  1ULI B;  3FG4 A;  1OPY A;  1CYU A;  3SX1 A;  1LQG C;  1WTH A;  4L8O A;  3CCE 3;  4FCZ A;  3V92 A;  3DH2 A;  4FCM A;  1IVU A;  2CW9 A;  3EN1 B;  1Q40 A;  1BIR A;  1MGR A;  2CWU A;  6STD A;  2KCD A;  1RNT A;  2PNC A;  4I5Q A;  5IEO A;  1RGC A;  2MF7 A;  4HM4 B;  2E2U A;  5JPP A;  1DET A;  1IT8 A;  1Q42 A;  2BU4 A;  4GHO A;  1N5P A;  1YVS A;  1BNE A;  2GU3 A;  4WHA A;  1QAK A;  2C10 A;  1M1K 4;  1SQW A;  4N6M A;  1GS3 A;  3JUO A;  5M1A A;  1VQ4 3;  3LH4 A;  3VGN A;  4BTX A;  4OVM A;  1RCL A;  1JBS A;  2P0X A;  1BRN L;  5EQL A;  3B7C A;  3GZX B;  1JN5 A;  2F4Y A;  4WFO A;  3U1W A;  1IQ8 A;  2IUK A;  4GSP A;  5AEW B;  5IG4 A;  5CXO A;  5IEN A;  1W02 A;  2CHC A;  2HML B;  4CCV A;  3CCU 3;  1GOY A;  2CX0 A;  2OCT A;  4N6N B;  1M90 4;  5IG5 A;  4LZI A;  3T8N A;  3LYG A;  4J8T A;  1I8V A;  1W7C A;  1A90 A;  3ECF A;  1S5A A;  1I0V A;  3U97 A;  1SII A;  3B4O A;  3ER7 A;  4XBX A;  1OUN A;  4HM5 B;  5EEO A;  1B3S A;  1YJN 3;  3MG1 A;  1LOX A;  1SPU A;  5RNT A;  3CC7 3;  3D3L A;  1W6C A;  3OWS A;  5ELU A;  5IER A;  3ALA A;  1E3R A;  1VQ5 3;  2SBL A;  3JUM A;  3LXU X;  1RGL A;  3QRD A;  2IMJ A;  3ZG0 A;  3WR2 A;  2F99 A;  1B21 A;  2OQE C;  6RNT A;  1G02 A;  3LOY A;  4N6V 0;  1YNV X;  1ISK A;  3FCS B;  1BSC A;  4KFF A;  1KQS 2;  1UUV B;  1BNI A;  1JZO A;  1SJW A;  1RSN A;  1W01 A;  1GMP A;  2CFD A;  2CK3 H;  2CFW A;  3CCQ 3;  3FH1 A;  4HM7 B;  2RSX A;  3GZR A;  2ZL8 A;  1V74 A;  3Q1C A;  1KSI A;  2XFT A;  1O7W B;  3SYU A;  3N8B A;  4L7K A;  3F40 A;  1VQ9 3;  3K5T A;  2CWT A;  1CYV A;  1X1W A;  3WOF B;  2B1X B;  2RGQ A;  1TFO A;  3OXA A;  1HU9 A;  5D83 A;  1DMQ A;  3S67 A;  3URP A;  2W56 A;  2KXG A;  4CPK A;  1GY5 A;  5IW9 A;  2W9Q A;  5LC6 A;  2P09 A;  1TP6 A;  4LEH A;  1AV4 A;  1JBR A;  4HM0 B;  3RGR A;  2W03 A;  3CCV 3;  2BIR A;  3FKA A;  1VQO 3;  1I2F A;  9RNT A;  5I97 A;  1YI2 3;  4EW5 A;  2A15 A;  1CQS A;  4R80 A;  1LVN A;  3NBB A;  2BMQ B;  2D42 A;  1EEJ A;  2L1S A;  5FW5 A;  4XB5 A;  2YFI B;  3BU4 A;  1LNH A;  3CCS 3;  4HJL B;  1KWI A;  1YVB I;  3N9H A;  3A5E A;  5JPU A;  3CC2 3;  1GOU A;  1I3F A;  2K54 A;  1L5G B;  3X3Z A;  2Z77 A;  3MSO A;  1Q82 4;  1BOX A;  2FGT A;  3NM7 A;  2F86 B;  2HOH A;  3MG3 A;  3NXJ A;  1JNQ A;  5CK6 A;  4RNZ A;  3UB1 A;  3JUQ A;  3V99 A;  1FUW A;  2KF4 A;  1X1U A;  1K9M 4;  3GWR A;  1JN5 B;  1BAO A;  2XFS A;  3FZW A;  1BRS A;  1UI7 A;  2UGI A;  3F8H A;  3FG1 A;  3Q90 A;  4HZB B;  2XGL A;  2IA7 A;  2LYX A;  1JKG B;  1ROV A;  5AI1 A;  3DGL A;  1TIJ A;  4ORL A;  4R4K A;  5CLK A;  3KSE D;  1BU4 A;  3G16 A;  4J5G A;  4AKY A;  3EF8 A;  1RJO A;  1RTU A;  2Y73 A;  3EHC A;  1Z1S A;  3SOA A;  3VSY A;  1CEW I;  3WA2 X;  1TU5 A;  4LYL B;  3DZL A;  2W04 A;  5GSP A;  7STD A;  1YHQ 3;  1FGM A;  3GRD A;  1BAN A;  5KP1 A;  5STD A;  4BL3 A;  1WNH A;  4JF8 A;  1G96 A;  3RNT A;  1MWR A;  1LOW A;  3MPH A;  4JRF A;  5AIG A;  2BHM A;  2XSO B;  1ZO2 A;  3PXM A;  1LXE A;  1IT7 A;  3EBT A;  3CXC 2;  2WGQ A;  1GY6 A;  2GU1 A;  1UCI A;  3G8Z A;  3CNX A;  2OTL 3;  3KKG A;  4H61 A;  5ELJ A;  2KF6 A;  1O7P B;  1IVX A;  3X41 A;  1VQ6 3;  2P38 A;  3UJM A;  2WOH A;  3HX8 A;  5IF6 A;  1AQZ A;  3LTC A;  3D9R A;  1RDS A;  3EC9 A;  3EQQ B;  3EX9 A;  4HBR A;  4BL2 A;  2CFL A;  2CWV A;  2K0M A;  3PCR A;  1BSD A;  3PYJ A;  1FA3 A;  2IUJ A;  3MWZ A;  5KP3 A;  3F14 A;  3KCH A;  1EG9 B;  4XDW A;  2H0H A;  4HAA A;  1RNB A;  5HOH A;  1RN4 A;  1OHP A;  4KVH A;  1RN7 A;  3X3Y A;  3LTA A;  3LML A;  1RGH A;  1FGQ A;  1D6U A;  2B24 B;  3CD6 3;  2XGN A;  4R1K A;  4O2H A;  2GBW B;  3PCS A;  3EJV A;  1JB4 A;  2C11 A;  4J5K A;  4RZM A;  5AII A;  4RBN A;  2OQE A;  2CFK A;  3SVA A;  4WWU C;  3NBJ A;  1JJ2 2;  1ULJ B;  3X40 A;  1OF5 A;  3BIR A;  3S27 A;  4BTY A;  1YJW 3;  3UNL A;  4CJN A;  2XRX B;  3X42 A;  4R9L A;  1UCL A;  2ML5 A;  3UL5 A;  2RBI A;  1HYF A;  3LZA A;  4MMX B;  5AYR B;  1VQ7 3;  4MEI A;  1Q7H A;  1S72 3;  1J2B A;  1BUJ A;  3HII A;  1QAF A;  1UI8 A;  3D4A A;  1E3V A;  2RNT A;  2D1W A;  4MMZ B;  4ZM8 A;  1JB5 A;  3TDG A;  2P05 A;  2QEX 3;  4WYK B;  1FYS A;  7GSP A;  1O7G B;  4LSO A;  1VQP 3;  1AVK A;  1LOY A;  1N8R 4;  3FLJ A;  3CC4 3;  4N6O B;  1C7H A;  2OOV A;  1IV9 A;  1UCK A;  3CCJ 3;  1Q7Y 4;  4RNT A;  4HVN A;  4MJD A;  4EXR A;  2QGU A;  2AAE A;  1HKX A;  3IPT A;  1T5Y A;  2O3O A;  5M18 A;  1Q86 4;  1RGA A;  2XH9 A;  2JQ5 A;  3G6E 3;  3BB9 A;  1ZGX A;  1M9G A;  2HMO B;  3OV4 A;  3JUN A;  3AMO B;  3WDG B;  1ZX2 A;  3WA3 A;  1W2B 2;  2K3D A;  1JBT A;  2L4V A;  3GZY B;  5AIH A;  4KFD A;  1BNS A;  3AHS A;  1GMQ A;  4N6U A;  5CF2 A;  3VF1 A;  3OX9 A;  1RCK A;  2UUG C;  3NV0 A;  3F9S A;  3Q2P A;  4FMC A;  1OHS A;  2Z6B A;  1NJI 4;  1BGS A;  1QVF 2;  1GYB A;  2WOF A;  3I0Y A;  1I2G A;  1UW1 A;  4STD A;  3BLZ A;  3D5G A;  1B2X A;  1BRI A;  1STD A;  1U8C B;  1US1 A;  2BO9 B;  1X1Y A;  4BTW A;  3A76 A;  2W9P A;  1BNF A;  3F8X A;  1E97 A;  3DY5 A;  2ML6 A;  4XM4 A;  1QAL A;  3B4P A;  3J7Y d;  1LQM B;  3F7S A;  1ZS7 A;  2W6J H;  3K7C A;  3K9M C;  2HMN B;  2GEY A;  2J8X B;  3EB8 A;  3LT9 A;  2UX0 A;  2WO0 A;  4FCJ A;  5D82 A;  4HZ9 B;  1EUI C;  1B20 A;  1O7N B;  1W00 A;  3H51 A;  2OTJ 3;  1DE3 A;  1MNL A;  1I70 A;  1W5Z A;  4FMD A;  4ILF A;  2ZHX B;  2QIY A;  3CCM 3;  4K1V A;  3H3H A;  3LTB A;  4N6L A;  1YIT 3;  5BIR A;  1BRK A;  2Z76 A;  4LMI A;  4K90 B;  1X1X A;  3AGO A;  1QMA A;  2CX1 A;  3BNB A;  1D6Y A;  1N5H A;  3FGY A;  3MG2 A;  3NBR A;  1CH0 A;  5M19 A;  1WMN A;  3T0U A;  1BUQ A;  4IT7 A;  4U13 A;  1BRH A;  5G1K A;  4FR9 A;  5DRE A;  5CF1 A;  2CG0 A;  1VZZ A;  2F56 A;  2F98 A;  2OOV C;  5A0O B;  1IU7 A;  5FGO A;  2V1L A;  1MGW A;  3HK4 A;  3KN4 A;  1RN1 A;  1PYL A;  3ZFZ A;  2CG1 A;  3MHE A;  3DGY A;  3M8C A;  1GMR A;  1WMO A;  1OH0 A;  1Q9E A;  1FUT A;  1WQL B;  3D79 A;  1SIH A;  2KRT A;  3E99 A;  3KII A;  2F5W A;  1DMN A;  4X2O A;  5DRV A;  5LC7 A;  3LT8 A;  3JVC A;  1OAC A;  1TJD A;  1TRQ A;  5AIF A;  3PS8 A;  2BT3 A;  4NRE A;  1RRL A;  3DUK A;  1VQL 3;  6GSP A;  3OWU A;  1O7H B;  1YGE A;  1GY7 A;  1AVL A;  1VQ8 3;  1OGX A;  1MWU A;  3WMD A;  3UL6 A;  1GD3 A;  3CNM A;  4L8P A;  4EV2 A;  1PY3 A;  3BNE A;  3KSP A;  4RNY A;  1STF I;  1GOV A;  1N9J A;  2CFG A;  4N6T A;  1IV7 A;  1VQQ A;  2GXF A;  3CCL 3;  4GL6 A;  1BNJ A;  2STD A;  2W56 B;  5BVB A;  8RNT A;  1RKY A;  1BRJ A;  2Y74 A;  1NU3 A;  3NM2 A;  1FW7 A;  4H3U A;  4Q53 A;  1EQK A;  1QJG A;  3FSD A;  1EA2 A;  2KAA A;  2ZDJ A;  1KC8 4;  2I9W A;  1W6G A;  3SED A;  2IYJ A;  3CCR 3;  1ASK A;  1T3B A;  2IY2 A;  3NX0 A;  5IEP A;  5TGN A;  4K61 A;  1NWW A;  2P0M A;  1K73 4;  1DVD A;  1OHO A;  1V58 A;  2CKF B;  1DVC A;  5BU4 A;  3HOH A;  1LOV A;  2E2V A;  4BIR A;  3CU3 A;  4FMA A;  1OGZ A; 
#chains in the Genus database with same CATH homology
 1TUH A;  3STD A;  3MKI A;  1JV2 B;  3V98 A;  4EYC A;  3K63 A;  4HM6 B;  4XBY A;  1K41 A;  2M7O A;  3SXX A;  3DXO A;  4EC6 A;  2LQV A;  3EBY A;  3N54 B;  3JUP A;  4J9A A;  4OUQ A;  1D6Z A;  3L0R A;  5D81 A;  1IQY A;  3S29 A;  3HIG A;  3G4S 3;  1IDP A;  1FGR A;  1A2K A;  2GEX A;  3EN8 A;  3BNC A;  3FG3 A;  3CPO A;  3FF2 A;  3LTD A;  1IK3 A;  4X2H A;  1W6Y A;  2CH9 A;  3WOE B;  1A67 A;  1W2Z A;  2HMJ B;  3NV0 B;  4IPB A;  5AEU B;  4KFE A;  5KP4 A;  1VQK 3;  1AR0 A;  5IG3 A;  1Q81 4;  3CMA 3;  2R4I A;  2BNG A;  3OW2 2;  2BMO B;  1JKG A;  1Y4K A;  3IJE B;  3FF0 A;  4KZ1 A;  3G71 3;  4MMY B;  4XDV A;  4XBT A;  4CDL A;  4GB5 A;  5JBS A;  2W2C A;  2YFL B;  1EKM A;  2XF3 A;  1MOL A;  3PZW A;  3RGA A;  1IVW A;  3OWY A;  4WP5 A;  4EV5 A;  3NHX A;  4HKV B;  3S28 A;  3K0Z A;  4K1U A;  3O8Y A;  2OWP A;  4QWT A;  2W0Q A;  2Z7A A;  5AYS C;  5BXQ A;  4N3V A;  2XR8 B;  1FGT A;  3G0K A;  3ROB A;  3AMO A;  2QA4 3;  3DMC A;  1N9E A;  1O7M B;  3DGM A;  1NB5 I;  3SOY A;  1K8A 4;  2XSH B;  3X3X A;  1DYU A;  1Q40 B;  4HM8 B;  3EE1 A;  4OK0 A;  2YX9 A;  1VQM 3;  2O9U X;  1NDO B;  2Q07 A;  4O02 B;  4R9K A;  2FNQ A;  3QK9 A;  1R4C A;  4PEJ A;  3WOD G;  1QVG 2;  4IIA A;  2XEP A;  8CHO A;  3GAX A;  3HI7 A;  3PGB A;  5G2G A;  2CIU A;  3I55 3;  2GBX B;  2INX A;  3KE7 A;  4O8S A;  3CPW 2;  3S5C A;  4WYK A;  2RCD A;  3NUV A;  3MYT A;  1U5O A;  1PFP A;  3NQY A;  1M1X B;  3I56 3;  3GZB A;  1OF5 B;  1K28 A;  2PZV A;  1OCV A;  4HM3 B;  1IVV A;  4HM1 B;  4I4K A;  1YIJ 3;  4O3V A;  1ROA A;  4HYZ A;  3BND A;  1PU4 A;  2YFJ B;  4LGQ A;  4G1M B;  1N8Q A;  4TX4 A;  2E2T A;  1A2V A;  1GD4 A;  1WMP A;  2CC3 A;  1VQN 3;  3DM8 A;  1DMM A;  4AEQ A;  1JRQ A;  1FGO A;  5EVH A;  1NO3 A;  4EBG A;  1TFK A;  4FMB A;  3KZT A;  1NB3 I;  4HM2 B;  1YJ9 3;  4AKZ A;  2FXT A;  2HMM B;  3T8U A;  2BMR B;  1JB2 A;  3KFQ C;  2MC8 A;  1RRH A;  5HGR A;  1IQX A;  1W4N A;  1UUW B;  2RFR A;  1KD1 4;  3SLU A;  1F8N A;  4NHF A;  3DGO A;  2WGO A;  3F7X A;  3NQZ A;  5IG0 A;  3DGN A;  3IMA B;  3RDE A;  3HZP A;  2JDI H;  3B8L A;  2HMK B;  1ULI B;  3FG4 A;  1OPY A;  1CYU A;  3SX1 A;  1WTH A;  4L8O A;  3CCE 3;  4FCZ A;  3V92 A;  4FCM A;  1IVU A;  2CW9 A;  3EN1 B;  1Q40 A;  2CWU A;  6STD A;  2KCD A;  2PNC A;  5IEO A;  2MF7 A;  4HM4 B;  2E2U A;  5JPP A;  1IT8 A;  1Q42 A;  1N5P A;  2GU3 A;  4WHA A;  1QAK A;  2C10 A;  1M1K 4;  1SQW A;  4N6M A;  1GS3 A;  3JUO A;  1VQ4 3;  3LH4 A;  3VGN A;  4BTX A;  4OVM A;  2P0X A;  5EQL A;  3B7C A;  3GZX B;  1JN5 A;  4WFO A;  3U1W A;  1IQ8 A;  2IUK A;  5AEW B;  5IG4 A;  5IEN A;  5CXO A;  1W02 A;  2CHC A;  2HML B;  4CCV A;  3CCU 3;  2OCT A;  4N6N B;  1M90 4;  5IG5 A;  4LZI A;  3T8N A;  3LYG A;  4J8T A;  1W7C A;  1A90 A;  3ECF A;  1S5A A;  3U97 A;  1SII A;  3B4O A;  3ER7 A;  4XBX A;  1OUN A;  4HM5 B;  5EEO A;  1YJN 3;  3MG1 A;  1LOX A;  1SPU A;  3CC7 3;  3D3L A;  1W6C A;  3OWS A;  5ELU A;  5IER A;  3ALA A;  1E3R A;  1VQ5 3;  2SBL A;  3JUM A;  3LXU X;  3QRD A;  2IMJ A;  2F99 A;  2OQE C;  3LOY A;  4N6V 0;  1ISK A;  3FCS B;  4KFF A;  1KQS 2;  1UUV B;  1SJW A;  2CFD A;  1W01 A;  2CK3 H;  2CFW A;  3CCQ 3;  3FH1 A;  4HM7 B;  2RSX A;  3GZR A;  2ZL8 A;  1V74 A;  3Q1C A;  1KSI A;  2XFT A;  1O7W B;  3N8B A;  4L7K A;  3F40 A;  1VQ9 3;  3K5T A;  2CWT A;  1CYV A;  3WOF B;  2RGQ A;  2B1X B;  1TFO A;  3OXA A;  1HU9 A;  5D83 A;  1DMQ A;  3S67 A;  2W56 A;  2KXG A;  1GY5 A;  5IW9 A;  2W9Q A;  5LC6 A;  2P09 A;  1TP6 A;  4LEH A;  1AV4 A;  4HM0 B;  3RGR A;  2W03 A;  3CCV 3;  3FKA A;  1VQO 3;  1YI2 3;  5I97 A;  2A15 A;  1CQS A;  4R80 A;  1LVN A;  3NBB A;  2BMQ B;  2D42 A;  5FW5 A;  4XB5 A;  2YFI B;  1LNH A;  3CCS 3;  4HJL B;  1KWI A;  1YVB I;  3N9H A;  5JPU A;  3CC2 3;  2K54 A;  1L5G B;  3X3Z A;  2Z77 A;  3MSO A;  1Q82 4;  2FGT A;  3NM7 A;  2F86 B;  3MG3 A;  3NXJ A;  1JNQ A;  5CK6 A;  4RNZ A;  3UB1 A;  3JUQ A;  3V99 A;  1FUW A;  1K9M 4;  3GWR A;  1JN5 B;  2XFS A;  3FZW A;  1UI7 A;  3F8H A;  3Q90 A;  3FG1 A;  4HZB B;  2XGL A;  2IA7 A;  2LYX A;  1JKG B;  1ROV A;  5AI1 A;  3DGL A;  1TIJ A;  4ORL A;  4R4K A;  5CLK A;  3KSE D;  3G16 A;  4AKY A;  3EF8 A;  1RJO A;  2Y73 A;  3EHC A;  3SOA A;  1Z1S A;  3VSY A;  1TU5 A;  1CEW I;  3WA2 X;  3DZL A;  2W04 A;  7STD A;  1YHQ 3;  1FGM A;  3GRD A;  5KP1 A;  5STD A;  1WNH A;  4JF8 A;  1G96 A;  3MPH A;  4JRF A;  5AIG A;  2BHM A;  2XSO B;  1ZO2 A;  3PXM A;  1LXE A;  1IT7 A;  3EBT A;  3CXC 2;  2WGQ A;  1GY6 A;  2GU1 A;  3G8Z A;  3CNX A;  2OTL 3;  3KKG A;  4H61 A;  5ELJ A;  1O7P B;  1IVX A;  3X41 A;  1VQ6 3;  2P38 A;  3UJM A;  2WOH A;  3HX8 A;  5IF6 A;  3LTC A;  3D9R A;  3EC9 A;  3EQQ B;  3EX9 A;  4HBR A;  2CFL A;  2CWV A;  2K0M A;  3PCR A;  3PYJ A;  1FA3 A;  2IUJ A;  3MWZ A;  5KP3 A;  3F14 A;  1EG9 B;  4XDW A;  1OHP A;  4KVH A;  1RN7 A;  3X3Y A;  3LTA A;  3LML A;  1FGQ A;  1D6U A;  2B24 B;  3CD6 3;  2XGN A;  4R1K A;  4O2H A;  2GBW B;  3PCS A;  3EJV A;  1JB4 A;  2C11 A;  4RZM A;  5AII A;  4RBN A;  2OQE A;  2CFK A;  3SVA A;  4WWU C;  3NBJ A;  1JJ2 2;  1ULJ B;  1OF5 A;  3S27 A;  4BTY A;  1YJW 3;  3UNL A;  2XRX B;  3X42 A;  4R9L A;  2ML5 A;  3UL5 A;  3LZA A;  4MMX B;  5AYR B;  1VQ7 3;  4MEI A;  1S72 3;  1J2B A;  3HII A;  1QAF A;  1UI8 A;  1E3V A;  2D1W A;  4MMZ B;  4ZM8 A;  1JB5 A;  3TDG A;  2P05 A;  2QEX 3;  4WYK B;  3CC4 3;  1O7G B;  4LSO A;  1VQP 3;  1AVK A;  1N8R 4;  3FLJ A;  4N6O B;  1C7H A;  2OOV A;  1IV9 A;  3CCJ 3;  1Q7Y 4;  4HVN A;  4MJD A;  4EXR A;  2QGU A;  3IPT A;  1HKX A;  1T5Y A;  2O3O A;  1Q86 4;  2XH9 A;  2JQ5 A;  3G6E 3;  3BB9 A;  1M9G A;  2HMO B;  3OV4 A;  3JUN A;  3AMO B;  3WDG B;  1ZX2 A;  3WA3 A;  1W2B 2;  2L4V A;  3GZY B;  5AIH A;  4KFD A;  4N6U A;  5CF2 A;  3VF1 A;  3OX9 A;  3Q2P A;  4FMC A;  3NV0 A;  3F9S A;  1OHS A;  2Z6B A;  1NJI 4;  1QVF 2;  1GYB A;  2WOF A;  3I0Y A;  1UW1 A;  4STD A;  3BLZ A;  1STD A;  1U8C B;  1US1 A;  2BO9 B;  4BTW A;  3A76 A;  2W9P A;  3F8X A;  1E97 A;  3DY5 A;  2ML6 A;  4XM4 A;  1QAL A;  3B4P A;  3J7Y d;  3F7S A;  3K9M C;  2W6J H;  3K7C A;  2HMN B;  2GEY A;  3EB8 A;  4FCJ A;  3LT9 A;  2UX0 A;  2WO0 A;  5D82 A;  3X40 A;  4HZ9 B;  1O7N B;  3H51 A;  1W00 A;  2OTJ 3;  1MNL A;  1W5Z A;  4FMD A;  2QIY A;  3CCM 3;  4K1V A;  3H3H A;  3LTB A;  4N6L A;  1YIT 3;  2Z76 A;  4LMI A;  1RKY A;  4K90 B;  3CME 3;  3FGY A;  1QMA A;  3BNB A;  3MG2 A;  1N5H A;  1D6Y A;  3NBR A;  1WMN A;  3T0U A;  1BUQ A;  4IT7 A;  4U13 A;  4FR9 A;  5DRE A;  5CF1 A;  2CG0 A;  1VZZ A;  2OOV C;  2F98 A;  5A0O B;  1IU7 A;  5FGO A;  2V1L A;  3HK4 A;  3KN4 A;  2CG1 A;  3MHE A;  3M8C A;  1WMO A;  1OH0 A;  1WQL B;  1SIH A;  2KRT A;  3E99 A;  3KII A;  4X2O A;  1DMN A;  5DRV A;  5LC7 A;  3LT8 A;  3JVC A;  1OAC A;  5AIF A;  3PS8 A;  2BT3 A;  4NRE A;  1RRL A;  3DUK A;  1VQL 3;  3OWU A;  1O7H B;  1YGE A;  1GY7 A;  1AVL A;  1VQ8 3;  1OGX A;  3WMD A;  3UL6 A;  1GD3 A;  3CNM A;  4L8P A;  4EV2 A;  3BNE A;  3KSP A;  4RNY A;  1STF I;  1N9J A;  2CFG A;  4N6T A;  1IV7 A;  3CCL 3;  2GXF A;  4GL6 A;  2STD A;  2W56 B;  5BVB A;  2Y74 A;  1NU3 A;  3NM2 A;  4H3U A;  4Q53 A;  1EQK A;  1QJG A;  3FSD A;  1EA2 A;  2ZDJ A;  1KC8 4;  2I9W A;  1W6G A;  3SED A;  3CCR 3;  1ASK A;  3NX0 A;  5IEP A;  5TGN A;  4K61 A;  1NWW A;  2P0M A;  1K73 4;  1DVD A;  1OHO A;  2CKF B;  1DVC A;  2E2V A;  3CU3 A;  4FMA A;  1OGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...