3Q90A

Crystal structure of the ntf2 domain of ras gtpase-activating protein-binding protein 1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
121
Chain Sequence
SPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the NTF2 domain of Ras GTPase-activating protein-binding protein 1
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ras GTPase-activating protein-binding protein 1
total genus 36
structure length 121
sequence length 131
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3q90A00
3EN8A 5JPUA 1EG9B 4ORLA 5KP3A 2B24B 3RGRA 1BUQA 1Q40A 3MSOA 1NWWA 3B4PA 3JUMA 3HZPA 4OUQA 3FH1A 5AEUB 1OH0A 5HGRA 1OGZA 3JUNA 4X2HA 1AR0A 2XSHB 3IPTA 3K7CA 3FSDA 3F7XA 2F86B 2HMOB 3D9RA 3OXAA 5CLKA 5AIFA 4RZMA 5TGNA 5JPPA 1O7WB 1SJWA 3EX9A 1DMNA 1E3VA 3EHCA 4H3UA 3F7SA 7STDA 3FZWA 4FCJA 2RGQA 4R9KA 4XDWA 5IG3A 3K0ZA 1U5OA 2CKFB 3B8LA 3BLZA 2PZVA 1JB5A 3DXOA 3MG2A 4LMIA 4U13A 4WP5A 3RGAA 4L8OA 3NBRA 4XDVA 1OHPA 2UX0A 1WQLB 3GZBA 4HKVB 4R9LA 5EVHA 2GBXB 1TP6A 2F99A 3STDA 4HM0B 4HM4B 5IF6A 5CF2A 3F8XA 1W6YA 3NXJA 2QGUA 3CU3A 5IERA 4HVNA 2HMNB 3JUQA 2STDA 1Z1SA 3EJVA 3DZLA 3LZAA 2A15A 2Z7AA 1STDA 3MG1A 4HM8B 4OVMA 2I9WA 5IENA 2CHCA 2XSOB 1W00A 1ULIB 4LEHA 1OF5A 1O7GB 4WYKB 2QIYA 3CPOA 4XB5A 1W01A 3EQQB 5AIHA 5DREA 3BB9A 2RCDA 4HM6B 5BVBA 3MG3A 1O7HB 1IDPA 2Z76A 3GZYB 5CXOA 3ECFA 4HM7B 3E99A 3FF0A 1ASKA 3EC9A 4WYKA 3HK4A 3NV0B 5D82A 3UJMA 4LGQA 4L8PA 2BNGA 3SEDA 1OHSA 1QMAA 5BXQA 3GRDA 1S5AA 1HKXA 3B4OA 5IG4A 3F8HA 4GB5A 3EBYA 3ROBA 1DMQA 3M8CA 3OWSA 5CF1A 3NV0A 3LYGA 3MHEA 4KVHA 4STDA 4XBTA 4HM5B 1JN5A 2BMOB 3KSPA 5D81A 4FCMA 1E97A 3T8NA 5FW5A 2JQ5A 4J9AA 3I0YA 1TUHA 1GS3A 4HM3B 1OCVA 1OUNA 5KP4A 5IG5A 2YFJB 3F14A 1JKGB 5KP1A 1ULJB 2GEXA 3NUVA 1EA2A 2W2CA 5G2GA 2F98A 3FLJA 5IEOA 1GY7A 4CDLA 1Q40B 3ER7A 3G0KA 3A76A 3KZTA 1O7MB 2GBWB 4HM2B 1C7HA 1JB4A 1ZO2A 2HMLB 1NU3A 2GEYA 3NHXA 1OF5B 4J8TA 4R1KA 5DRVA 5IG0A 3T8UA 4IIAA 2HMMB 1OHOA 4I4KA 2K54A 4Q53A 1O7NB 1OGXA 3SOYA 4L7KA 3GZRA 3DUKA 1NDOB 1QJGA 2YFIB 5D83A 1OPYA 5AIGA 3KE7A 3G8ZA 4N3VA 5AI1A 4X2OA 3VGNA 2BMQB 3DMCA 2XRXB 5STDA 1UUWB 3FF2A 1UUVB 2IMJA 2Z77A 8CHOA 3CNMA 1K41A 5AEWB 3DM8A 3CNXA 3HX8A 5IEPA 3H3HA 1O7PB 1A2KA 4XBXA 1GY5A 4XBYA 4K1UA 1W02A 4K1VA 1JN5B 3GZXB 3SOAA 2BMRB 4HJLB 3EBTA 3F9SA 1ZX2A 3B7CA 3FGYA 3FKAA 2YFLB 4HZBB 1ISKA 3VSYA 3MYTA 2INXA 1DMMA 5AIIA 1JKGA 2HMKB 3EN1B 3GWRA 3OX9A 4XM4A 3NM2A 3JUOA 6STDA 2R4IA 3EF8A 3F40A 3UNLA 3OWUA 3G16A 1E3RA 4WWUC 1JB2A 2GXFA 4MJDA 1CQSA 1GY6A 1GYBA 1Q42A 1VZZA 2B1XB 2XR8B 5CK6A 2HMJB 3OV4A 3OWYA 3Q90A 4HZ9B 3S5CA 2OWPA 2RFRA 3JUPA 4HM1B 3H51A 3MKIA 4PEJA 3KKGA 3WMDA
chains in the Genus database with same CATH superfamily
1B2MA 1IV7A 2LYXA 3EN8A 1K9M4 5JPUA 1BUQA 5KP3A 2B24B 1JV2B 3SLUA 1Q40A 1I2FA 3BNCA 1BSAA 3HZPA 5AEUB 2CIUA 1OH0A 3CC23 2W03A 2K3DA 2D1WA 1EUIC 3OXAA 2WGQA 2F86B 2C10A 1AVKA 2HMOB 2F56A 4N6UA 1B3SA 1JZDA 2RGQA 3K63A 1RHLA 5IG3A 1OACA 1U5OA 2CKFB 2KRTA 1X1WA 2PZVA 3DXOA 4LMIA 1IK3A 4BTYA 1TRQA 2P05A 3WOFB 3STDA 1TP6A 2V1LA 3AGNA 5CF2A 2M7OA 3G6E3 1KWIA 3CCQ3 2HMNB 3EJVA 3LZAA 3MG1A 1X1UA 1STDA 1V58A 2Z6BA 3Q1CA 4LZIA 5IENA 2XSOB 3CD63 1RGFA 5AIHA 2L4VA 2QIYA 3VSYA 4GHOA 3EQQB 3BB9A 2RCDA 4HM6B 3ECFA 1IVVA 2IY2A 2F5MA 1BIRA 3S28A 3AHSA 4EYCA 1ASKA 1M1K4 1I70A 1IQ8A 3NV0B 3UJMA 1IYYA 1QMAA 1RKYA 1NNVA 5M1AA 3N9HA 2CFKA 1CYUA 3F8HA 1BRJA 3EBYA 1RRHA 3ROBA 3J7Yd 5CF1A 2OTL3 3IJEB 1VQK3 4JRFA 1FUSA 1GMPA 4O2HA 1E97A 4N6NB 1BNRA 4HM3B 1GS3A 1JBSA 1BRSA 1TIJA 5AYSC 1JZOA 1PU4A 1IQXA 1JKGB 1RNTA 1NJI4 1EA2A 5G2GA 2CC3A 1YIJ3 1YJN3 1FUWA 3ER7A 1T5YA 3A76A 4G1MB 1CH0A 4HM2B 2HMLB 2OOVA 3X3ZA 4BTXA 2QEX3 1K734 3T8UA 5EEOA 4IPBA 4I4KA 2K54A 3SOYA 4ILFA 1BRKA 4L7KA 3LTBA 3DUKA 1NDOB 1QJGA 2CX0A 2YFIB 1OPYA 5D83A 1W5ZA 3KIIA 1T2IA 3K5TA 3ZFZA 1B2UA 1BSCA 4ZM8A 1IV9A 4N3VA 2MF7A 1EQKA 2IA7A 2GU3A 3FF2A 1MGRA 1YJW3 2Z77A 1ROVA 4BIRA 3GAXA 5AEWB 3LT8A 1VQN3 4HYZA 2FXTA 2WOFA 3CPW2 1GSPA 2GU1A 3HX8A 2O9UX 1O7PB 2XF3A 7RNTA 1GY5A 4XBYA 3WA2X 3WHOA 1YIT3 4CJNA 1RSNA 1RJOA 4DKIA 3LTDA 3SOAA 1TU5A 4HJLB 4BU4A 1TFOA 1BNFA 2XGNA 3MPHA 3DH2A 3FGYA 8RNTA 3BU4A 2KCDA 3EB8A 3N8BA 1FGOA 1W6CA 3BNBA 3MYTA 2INXA 1DMMA 2W6JH 1MWSA 3SX1A 1JKGA 2H0GA 2XEPA 1UGIA 3GWRA 3OX9A 4FMAA 3S29A 3SXXA 3NM2A 3JUOA 1Q7Y4 1BAOA 4FMDA 2W9PA 1A67A 3CC73 4RNZA 1L5GB 2W56B 2ML5A 1YGEA 1GY6A 5ELUA 2RBIA 4AEQA 4BTWA 1MWTA 1VZZA 1B2ZA 2OQEC 3Q90A 3OV4A 3HI7A 1DVCA 3JUPA 3H51A 1CYVA 1Q9EA 1VQ43 4MMZB 1EG9B 5BIRA 1QALA 1NWWA 3D5IA 3FH1A 4IT7A 1MNLA 1OGZA 3X3XA 5LC7A 1FGTA 3JUNA 1AR0A 2XSHB 1UUGB 3QRDA 3PYJA 3WODG 5CLKA 2L1SA 1N9JA 4OK0A 1O7WB 3EHCA 1I2GA 4H3UA 3FZWA 4XDWA 1UCLA 4R9KA 1PYLA 2JDIH 2OCTA 3K0ZA 2RSXA 1JB5A 1BNIA 1MGWA 1T2HA 2CX1A 1N8QA 4L8OA 1U8CB 1RNBA 1OHPA 3GZBA 1IVWA 3BNEA 1YVBI 2F99A 3WOEB 6GSPA 5LC6A 1UCJA 2C4BA 4HM4B 3CCV3 2OTJ3 1W6YA 3N54B 1ZS7A 2QGUA 3NXJA 1WMNA 4HAAA 1G96A 1UCKA 1UDII 3JUQA 4CCVA 4EC6A 4OVMA 4FCZA 5IW9A 2BT3A 1ULIB 4LEHA 4XB5A 1O7GB 5DREA 3SVAA 1EEJA 1M1XB 1W01A 5BVBA 1NB5I 3GZYB 5CXOA 2CH9A 2OQEA 2WOHA 2AAEA 4MMXB 4WYKA 5D82A 1K8A4 1KSIA 4LGQA 5ELJA 4NHFA 2BNGA 1YVSA 5BXQA 2LQVA 1LQMB 3B4OA 1HKXA 4BL3A 1LQGC 1YI23 2XGLA 1QVG2 1Q824 5RNTA 1JN5A 3BIRA 3X3YA 3D4AA 4FCMA 2JQ5A 3X41A 3I0YA 1TUHA 1BRGA 3DGNA 1OCVA 1OUNA 2MC8A 3RDEA 5IG5A 2YFJB 1GMRA 3F14A 9RNTA 2UGIA 1W6GA 2W2CA 3K9MC 2CFLA 2F98A 2H0HA 1D6UA 3FLJA 2XFSA 4O3VA 1T3BA 1Q40B 3PXMA 7GSPA 1ISKA 3KZTA 1O7MB 3PS8A 3G4S3 1C7HA 2GEYA 1VQ93 1BSBA 1OF5B 1BUJA 3D79A 4IIAA 2HMMB 1LOWA 3ALAA 2YX9A 1O7NB 3WMDA 3HIGA 1Q864 4N6LA 3CME3 1JRQA 3LTAA 1LXEA 1DE3A 4X2OA 3VGNA 2BMQB 3DMCA 4QWTA 1UUWB 2BO9B 1UUVB 2IMJA 3LXUX 4EBGA 2Y74A 3U1WA 8CHOA 2CG0A 5BU4A 1GOVA 1JBRA 1QAFA 1A2KA 4R80A 4XBXA 1MOLA 4K1VA 3LT9A 3GZXB 3S27A 3UL5A 1W2ZA 3DGMA 2IYJA 1ZX2A 4LYLB 1B2XA 1RN1A 1Y4KA 3V99A 2WO0A 3V98A 1B21A 1G0TA 1VQQA 1HZ1A 3AMOB 1HYFA 4J5GA 4XM4A 3CCE3 1RCLA 3F40A 3KCHA 3G16A 3OWUA 1LNHA 5M19A 1J2BA 1Q7HA 2ZA4A 1UI7A 4WHAA 2XR8B 1BNJA 3OWYA 4HZ9B 4NREA 5GSPA 1US1A 3S5CA 1UI8A 3SYUA 3NX0A 3A5EA 3MKIA 3KKGA 4J9AA 1UGHI 3RNTA 1DYUA 1SARA 1YJ93 1C54A 3MSOA 3WA3A 3NQZA 4OUQA 2E2UA 1FZUA 3IPTA 3FSDA 3D9RA 5AIFA 1B27A 1SIIA 1K28A 2ZL8A 3PCSA 4RZMA 5TGNA 2BIRA 4AKYA 1BANA 1E3VA 7STDA 3LH4A 1AV4A 3NBJA 2GSPA 3BLZA 3TDGA 1A2PA 1NB3I 3AMOA 2P09A 4FR9A 4U13A 4WP5A 1FW7A 1B20A 4R4KA 3NBRA 2W9QA 4XDVA 1RGLA 2H0IA 2UX0A 4R9LA 4N6TA 5EVHA 1LOYA 1LNIA 3JVCA 1HU9A 4KFDA 4EV2A 3URPA 5IF6A 3F8XA 3PGBA 2BHMA 3NBBA 2SBLA 3CU3A 3LTCA 4HVNA 3V92A 2CFDA 2STDA 1BOXA 2A15A 4HM8B 1BRNL 2CHCA 1IVUA 1SPUA 1GD3A 1W00A 4EXRA 1RLSA 1Q814 2W0QA 4WYKB 3CPOA 1UW1A 3MG3A 3D5GA 1JNQA 2Z76A 3WDGB 2Q07A 3NM7A 1JBTA 4HM7B 3E99A 3T0UA 4BL2A 3CCM3 3FF0A 4CPKA 3IMAB 1BNGA 3EC9A 3HK4A 5I97A 1EKMA 4J5KA 1N5PA 4L8PA 1W2B2 3SEDA 3NQYA 2UUGC 5IG4A 1A90A 3VF1A 1N9EA 3OWSA 4TX4A 5M18A 3LYGA 4KVHA 4XBTA 1LOXA 4HM5B 2BMOB 3KSPA 1M904 1R4YA 1IQYA 3PCRA 1IT7A 3EE1A 1PFPA 1RN7A 5KP4A 4KFFA 1W4NA 3DGOA 1AVLA 1ULJB 2GEXA 1I3IA 4K61A 6RNTA 1VQL3 5IEOA 1GY7A 4CDLA 2ZHXB 3FG3A 1G02A 1AY7A 1NU3A 1RGAA 2AADA 2KF4A 4J8TA 4R1KA 5DRVA 2W56A 5IG0A 4RNTA 3U97A 1N5HA 2BU4A 3QK9A 3UL6A 1V74A 1I0XA 3FCSB 1GOUA 5STDA 2K0MA 3CNMA 1IT8A 1QAKA 1RCKA 2CWVA 2KF6A 2W04A 3D3LA 3CNXA 2P0MA 3AHWA 3ZG5A 1F8NA 1LRAA 1WNHA 2CW9A 4K1UA 1W02A 3Q2PA 1YHQ3 1SIHA 1VQM3 2BMRB 3EBTA 1FYSA 3F9SA 2C11A 2KXGA 1VQ83 3DGYA 2XH9A 1BGSA 2E2TA 2FNQA 3FKAA 2YFLB 4HZBB 1I8VA 4AKZA 1RGHA 1BSDA 5AIIA 2HMKB 2CK3H 3X42A 1BVIA 6STDA 2R4IA 3ZG0A 1KD14 4GSPA 2QA43 1JJ22 3CMA3 2PNCA 2CFGA 1Q42A 2R41A 3PZWA 2OWPA 3I553 1BRHA 1N8R4 3L0RA 2O3OA 1UCIA 2XFTA 4ORLA 1LVNA 1I3FA 1ZGXA 3RGRA 1KQS2 1VQ53 3B4PA 3JUMA 3CXC2 3WR2A 4N6MA 5HGRA 4X2HA 2KF3A 1WMOA 3K7CA 1M9GA 3F7XA 4KZ1A 3LOYA 5JPPA 1FGRA 2CWTA 1SJWA 1W7CA 2KAAA 1DMNA 2ZDJA 1FUTA 3EX9A 4JF8A 3F7SA 3CC43 4FCJA 3B8LA 1BU4A 1RGEA 2CG1A 1S723 3MG2A 3RGAA 1X1YA 4MMYB 4MEIA 1WMPA 2CFWA 3HOHA 1WQLB 4HKVB 2GBXB 4HM0B 1SQWA 2IUJA 3CCU3 1VQ73 1RMSA 3OW22 5IERA 1BRIA 1Z1SA 1MWRA 3DZLA 3G713 2Z7AA 3Q3FA 5G1LA 1FA3A 2I9WA 3DGLA 1PY3A 1RGGA 2FGTA 4N6OB 3FG1A 1OF5A 1YGWA 4N6V0 1BSEA 4FMBA 1O7HB 1IDPA 1D6YA 3MWZA 3I563 1V57A 1FGMA 1VQO3 2SARA 4FMCA 4KT3B 3CCL3 3O8YA 1OHSA 3GRDA 1S5AA 2KF5A 1NO3A 1RGCA 1DMQA 3M8CA 4GB5A 4EW5A 3KFQC 3NV0A 1R4CA 3DY5A 1B2SA 3MHEA 3KN4A 4STDA 5D81A 3LMLA 4KFEA 1I2EA 1BNSA 2RNTA 1WTHA 3T8NA 5JBSA 5FW5A 2OOVC 1TFKA 2J8XB 1GD4A 3UB1A 1DETA 1KC84 5KP1A 4HBRA 4RBNA 3NUVA 4EV5A 1ROAA 1QVF2 3G0KA 1AQZA 3CCJ3 1BNEA 2GBWB 2ML6A 1JB4A 1ZO2A 3NHXA 2P0XA 4RNYA 1RDSA 1TTOA 1RRLA 1OHOA 2E2VA 4Q53A 1OGXA 3GZRA 5AIGA 1GOYA 3KSED 3GSPA 4WFOA 3KE7A 3G8ZA 4LSOA 2F4YA 4I5QA 5AI1A 2Y73A 3X40A 1RGKA 2XRXB 2D42A 5AYRB 1I0VA 1DVDA 1STFI 1LOVA 1VQP3 1K41A 2F5WA 4H61A 4HOHA 3DM8A 5IEPA 1A2VA 1TRPA 3H3HA 1YNVX 5HOHA 1JN5B 1CEWI 1X1XA 4O02B 3CCS3 1IU7A 3B7CA 1VQ63 1GMQA 1MWUA 3HIIA 3CCR3 5G1KA 3EN1B 3AGOA 2HOHA 3BNDA 3FG4A 1RN4A 3EF8A 2WGOA 3UNLA 1TJDA 1E3RA 1RTUA 4WWUC 1JB2A 2CWUA 2GXFA 2P38A 5EQLA 3S67A 4MJDA 1CQSA 2IUKA 4NPBA 5FGOA 1GYBA 4GL6A 2B1XB 1D6ZA 5CK6A 2HMJB 4O8SA 2RFRA 4PEJA 4HM1B 5A0OB 1IVXA 4K90B 1FGQA
chains in the Genus database with same CATH topology
1IV7A 2LYXA 3EN8A 1K9M4 5JPUA 1BUQA 5KP3A 2B24B 1JV2B 3SLUA 1Q40A 3BNCA 3HZPA 5AEUB 2CIUA 1OH0A 3CC23 2W03A 2D1WA 3OXAA 2WGQA 2F86B 2C10A 1AVKA 2HMOB 4N6UA 2RGQA 3K63A 5IG3A 1OACA 1U5OA 2CKFB 2KRTA 2PZVA 3DXOA 4LMIA 1IK3A 4BTYA 3WOFB 2P05A 3STDA 1TP6A 2V1LA 5CF2A 2M7OA 3G6E3 1KWIA 3CCQ3 2HMNB 3EJVA 3LZAA 3MG1A 5IENA 1STDA 2Z6BA 4LZIA 3Q1CA 2XSOB 3CD63 5AIHA 2L4VA 2QIYA 3VSYA 3EQQB 3BB9A 2RCDA 4HM6B 3ECFA 1IVVA 3S28A 4EYCA 1ASKA 1M1K4 3NV0B 1IQ8A 3UJMA 1QMAA 1RKYA 3N9HA 2CFKA 1CYUA 3F8HA 3ROBA 3EBYA 1RRHA 3J7Yd 2OTL3 5CF1A 3IJEB 1VQK3 4JRFA 4O2HA 1E97A 4N6NB 4HM3B 1GS3A 1TIJA 5AYSC 1PU4A 1IQXA 1JKGB 1NJI4 1EA2A 5G2GA 2CC3A 1YIJ3 1YJN3 1FUWA 3ER7A 1T5YA 3A76A 4G1MB 4HM2B 3X3ZA 2HMLB 2OOVA 1K734 4BTXA 2QEX3 3T8UA 5EEOA 4IPBA 4I4KA 2K54A 3SOYA 4L7KA 3LTBA 3DUKA 1NDOB 1QJGA 2YFIB 5D83A 1OPYA 1W5ZA 3KIIA 4ZM8A 3K5TA 1IV9A 4N3VA 2MF7A 1EQKA 2IA7A 2GU3A 3FF2A 1YJW3 2Z77A 1ROVA 1VQN3 3GAXA 5AEWB 3LT8A 4HYZA 2FXTA 2WOFA 3CPW2 3HX8A 2GU1A 2O9UX 1O7PB 2XF3A 1GY5A 4XBYA 3WA2X 1YIT3 1RJOA 3LTDA 3SOAA 1TU5A 4HJLB 1TFOA 3MPHA 2XGNA 3FGYA 2KCDA 3EB8A 3N8BA 1FGOA 1W6CA 3BNBA 3MYTA 2INXA 1DMMA 2W6JH 3SX1A 1JKGA 2XEPA 3GWRA 3OX9A 4FMAA 1Q7Y4 3S29A 3SXXA 3NM2A 3JUOA 4FMDA 2W9PA 1A67A 3CC73 4RNZA 1L5GB 2W56B 2ML5A 1YGEA 1GY6A 5ELUA 4AEQA 4BTWA 1VZZA 2OQEC 3Q90A 3OV4A 3HI7A 1DVCA 3JUPA 3H51A 1CYVA 1VQ43 4MMZB 1EG9B 1QALA 1NWWA 3FH1A 4IT7A 1MNLA 1OGZA 3X3XA 5LC7A 1FGTA 3JUNA 1AR0A 2XSHB 3QRDA 3PYJA 3WODG 5CLKA 1N9JA 4OK0A 1O7WB 3EHCA 4H3UA 3FZWA 4XDWA 4R9KA 2JDIH 3K0ZA 2OCTA 2RSXA 1JB5A 1N8QA 4L8OA 1U8CB 1OHPA 3GZBA 1IVWA 3BNEA 1YVBI 2F99A 3WOEB 5LC6A 4HM4B 3CCV3 2OTJ3 1W6YA 3N54B 2QGUA 3NXJA 1WMNA 1G96A 3JUQA 4CCVA 4EC6A 4OVMA 4FCZA 5IW9A 2BT3A 1ULIB 4LEHA 4XB5A 1O7GB 5DREA 3SVAA 1M1XB 1W01A 5BVBA 1NB5I 3GZYB 5CXOA 2CH9A 2OQEA 2WOHA 4MMXB 4WYKA 5D82A 1K8A4 1KSIA 4LGQA 5ELJA 4NHFA 2BNGA 5BXQA 2LQVA 3B4OA 1HKXA 1YI23 2XGLA 1QVG2 1Q824 1JN5A 3X3YA 4FCMA 2JQ5A 3X41A 3I0YA 1TUHA 3DGNA 2MC8A 1OCVA 1OUNA 3RDEA 5IG5A 2YFJB 3F14A 1W6GA 2W2CA 3K9MC 2CFLA 2F98A 3FLJA 1D6UA 4O3VA 2XFSA 1Q40B 3PXMA 1ISKA 3KZTA 1O7MB 3PS8A 3G4S3 1C7HA 2GEYA 1VQ93 1OF5B 4IIAA 2HMMB 3ALAA 2YX9A 1O7NB 3WMDA 3HIGA 1Q864 4N6LA 3CME3 1JRQA 3LTAA 1LXEA 4X2OA 3VGNA 2BMQB 3DMCA 4QWTA 1UUWB 2BO9B 1UUVB 2IMJA 3LXUX 4EBGA 2Y74A 3U1WA 8CHOA 2CG0A 1QAFA 1A2KA 4R80A 4XBXA 1MOLA 4K1VA 3LT9A 3GZXB 3S27A 3UL5A 3DGMA 1W2ZA 1ZX2A 3V99A 1Y4KA 2WO0A 3V98A 3AMOB 4XM4A 3CCE3 3F40A 3OWUA 3G16A 1LNHA 1J2BA 1UI7A 4WHAA 2XR8B 3OWYA 4HZ9B 4NREA 3S5CA 1US1A 1UI8A 3NX0A 3MKIA 4J9AA 3KKGA 1DYUA 1YJ93 3MSOA 3WA3A 3NQZA 4OUQA 2E2UA 3IPTA 3FSDA 3D9RA 5AIFA 1SIIA 2ZL8A 1K28A 3PCSA 4RZMA 5TGNA 4AKYA 1E3VA 7STDA 3LH4A 1AV4A 3NBJA 3BLZA 3TDGA 1NB3I 3AMOA 4WP5A 2P09A 4FR9A 4U13A 4R4KA 3NBRA 2W9QA 4XDVA 2UX0A 4R9LA 5EVHA 4N6TA 3JVCA 1HU9A 4KFDA 4EV2A 5IF6A 3F8XA 3PGBA 2BHMA 3NBBA 2SBLA 3CU3A 3LTCA 4HVNA 3V92A 2CFDA 2STDA 2A15A 4HM8B 2CHCA 1IVUA 1SPUA 1GD3A 1W00A 4EXRA 1Q814 2W0QA 4WYKB 3CPOA 1UW1A 3MG3A 1JNQA 2Z76A 3WDGB 2Q07A 3NM7A 4HM7B 3E99A 3T0UA 3CCM3 3FF0A 3IMAB 3EC9A 3HK4A 5I97A 1EKMA 1N5PA 4L8PA 1W2B2 3SEDA 3NQYA 1A90A 5IG4A 3VF1A 1N9EA 3OWSA 4TX4A 3LYGA 4KVHA 4XBTA 1LOXA 4HM5B 2BMOB 3KSPA 1M904 1IQYA 3PCRA 1IT7A 3EE1A 1PFPA 1RN7A 5KP4A 4KFFA 1W4NA 3DGOA 1AVLA 1ULJB 2GEXA 4K61A 1VQL3 5IEOA 1GY7A 4CDLA 3FG3A 1NU3A 4J8TA 4R1KA 5IG0A 5DRVA 2W56A 3U97A 1N5HA 3QK9A 3UL6A 1V74A 3FCSB 5STDA 2K0MA 3CNMA 1IT8A 1QAKA 2CWVA 2W04A 3D3LA 3CNXA 2P0MA 1F8NA 2CW9A 1WNHA 1YHQ3 4K1UA 1W02A 3Q2PA 1SIHA 1VQM3 2BMRB 3EBTA 3F9SA 2C11A 2KXGA 1VQ83 2XH9A 2E2TA 2FNQA 3FKAA 2YFLB 4HZBB 4AKZA 5AIIA 2HMKB 2CK3H 3X42A 6STDA 2R4IA 1KD14 2QA43 1JJ22 3CMA3 2PNCA 2CFGA 1Q42A 3PZWA 2OWPA 3I553 1N8R4 3L0RA 2O3OA 2XFTA 4ORLA 1LVNA 1KQS2 3RGRA 1VQ53 3B4PA 3JUMA 3CXC2 4N6MA 5HGRA 4X2HA 1WMOA 3K7CA 1M9GA 3F7XA 4KZ1A 3LOYA 5JPPA 1FGRA 2CWTA 1SJWA 1W7CA 3EX9A 1DMNA 2ZDJA 3CC43 4JF8A 3F7SA 4FCJA 3B8LA 2CG1A 1S723 3MG2A 3RGAA 4MMYB 4MEIA 1WMPA 2CFWA 1WQLB 4HKVB 2GBXB 4HM0B 1SQWA 2IUJA 3CCU3 1VQ73 3OW22 5IERA 1Z1SA 3G713 3DZLA 2Z7AA 1FA3A 2I9WA 3DGLA 2FGTA 4N6OB 3FG1A 1OF5A 4N6V0 4FMBA 1O7HB 1IDPA 1D6YA 3MWZA 3I563 1FGMA 1VQO3 4FMCA 3CCL3 3O8YA 1OHSA 3GRDA 1S5AA 4GB5A 1NO3A 1DMQA 3M8CA 3KFQC 3NV0A 1R4CA 3DY5A 3MHEA 4STDA 3KN4A 5D81A 3LMLA 4KFEA 5JBSA 3T8NA 1WTHA 5FW5A 2OOVC 1TFKA 1GD4A 3UB1A 1KC84 5KP1A 4HBRA 4RBNA 3NUVA 4EV5A 1ROAA 1QVF2 3G0KA 3CCJ3 2GBWB 2ML6A 1JB4A 1ZO2A 3NHXA 2P0XA 4RNYA 1RRLA 1OHOA 2E2VA 4Q53A 1OGXA 3GZRA 5AIGA 3KSED 4WFOA 3KE7A 3G8ZA 4LSOA 5AI1A 2Y73A 3X40A 2XRXB 2D42A 5AYRB 1DVDA 1STFI 1VQP3 1K41A 4H61A 3DM8A 5IEPA 1A2VA 3H3HA 1JN5B 1CEWI 4O02B 3CCS3 1IU7A 3B7CA 1VQ63 3HIIA 3CCR3 3EN1B 3BNDA 3FG4A 3EF8A 3UNLA 2WGOA 1E3RA 4WWUC 1JB2A 2CWUA 2GXFA 2P38A 5EQLA 3S67A 4MJDA 1CQSA 2IUKA 5FGOA 1GYBA 4GL6A 2B1XB 1D6ZA 5CK6A 2HMJB 4O8SA 2RFRA 4PEJA 4HM1B 5A0OB 1IVXA 4K90B 1FGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EN8 A;  5JPU A;  1EG9 B;  4ORL A;  5KP3 A;  2B24 B;  3RGR A;  1BUQ A;  1Q40 A;  3MSO A;  1NWW A;  3B4P A;  3JUM A;  3HZP A;  4OUQ A;  3FH1 A;  5AEU B;  1OH0 A;  5HGR A;  1OGZ A;  3JUN A;  4X2H A;  1AR0 A;  2XSH B;  3IPT A;  3K7C A;  3FSD A;  3F7X A;  2F86 B;  2HMO B;  3D9R A;  3OXA A;  5CLK A;  5AIF A;  4RZM A;  5TGN A;  5JPP A;  1O7W B;  1SJW A;  3EX9 A;  1DMN A;  1E3V A;  3EHC A;  4H3U A;  3F7S A;  7STD A;  3FZW A;  4FCJ A;  2RGQ A;  4R9K A;  4XDW A;  5IG3 A;  3K0Z A;  1U5O A;  2CKF B;  3B8L A;  3BLZ A;  2PZV A;  1JB5 A;  3DXO A;  3MG2 A;  4LMI A;  4U13 A;  4WP5 A;  3RGA A;  4L8O A;  3NBR A;  4XDV A;  1OHP A;  2UX0 A;  1WQL B;  3GZB A;  4HKV B;  4R9L A;  5EVH A;  2GBX B;  1TP6 A;  2F99 A;  3STD A;  4HM0 B;  4HM4 B;  5IF6 A;  5CF2 A;  3F8X A;  1W6Y A;  3NXJ A;  2QGU A;  3CU3 A;  5IER A;  4HVN A;  2HMN B;  3JUQ A;  2STD A;  1Z1S A;  3EJV A;  3DZL A;  3LZA A;  2A15 A;  2Z7A A;  1STD A;  3MG1 A;  4HM8 B;  4OVM A;  2I9W A;  5IEN A;  2CHC A;  2XSO B;  1W00 A;  1ULI B;  4LEH A;  1OF5 A;  1O7G B;  4WYK B;  2QIY A;  3CPO A;  4XB5 A;  1W01 A;  3EQQ B;  5AIH A;  5DRE A;  3BB9 A;  2RCD A;  4HM6 B;  5BVB A;  3MG3 A;  1O7H B;  1IDP A;  2Z76 A;  3GZY B;  5CXO A;  3ECF A;  4HM7 B;  3E99 A;  3FF0 A;  1ASK A;  3EC9 A;  4WYK A;  3HK4 A;  3NV0 B;  5D82 A;  3UJM A;  4LGQ A;  4L8P A;  2BNG A;  3SED A;  1OHS A;  1QMA A;  5BXQ A;  3GRD A;  1S5A A;  1HKX A;  3B4O A;  5IG4 A;  3F8H A;  4GB5 A;  3EBY A;  3ROB A;  1DMQ A;  3M8C A;  3OWS A;  5CF1 A;  3NV0 A;  3LYG A;  3MHE A;  4KVH A;  4STD A;  4XBT A;  4HM5 B;  1JN5 A;  2BMO B;  3KSP A;  5D81 A;  4FCM A;  1E97 A;  3T8N A;  5FW5 A;  2JQ5 A;  4J9A A;  3I0Y A;  1TUH A;  1GS3 A;  4HM3 B;  1OCV A;  1OUN A;  5KP4 A;  5IG5 A;  2YFJ B;  3F14 A;  1JKG B;  5KP1 A;  1ULJ B;  2GEX A;  3NUV A;  1EA2 A;  2W2C A;  5G2G A;  2F98 A;  3FLJ A;  5IEO A;  1GY7 A;  4CDL A;  1Q40 B;  3ER7 A;  3G0K A;  3A76 A;  3KZT A;  1O7M B;  2GBW B;  4HM2 B;  1C7H A;  1JB4 A;  1ZO2 A;  2HML B;  1NU3 A;  2GEY A;  3NHX A;  1OF5 B;  4J8T A;  4R1K A;  5DRV A;  5IG0 A;  3T8U A;  4IIA A;  2HMM B;  1OHO A;  4I4K A;  2K54 A;  4Q53 A;  1O7N B;  1OGX A;  3SOY A;  4L7K A;  3GZR A;  3DUK A;  1NDO B;  1QJG A;  2YFI B;  5D83 A;  1OPY A;  5AIG A;  3KE7 A;  3G8Z A;  4N3V A;  5AI1 A;  4X2O A;  3VGN A;  2BMQ B;  3DMC A;  2XRX B;  5STD A;  1UUW B;  3FF2 A;  1UUV B;  2IMJ A;  2Z77 A;  8CHO A;  3CNM A;  1K41 A;  5AEW B;  3DM8 A;  3CNX A;  3HX8 A;  5IEP A;  3H3H A;  1O7P B;  1A2K A;  4XBX A;  1GY5 A;  4XBY A;  4K1U A;  1W02 A;  4K1V A;  1JN5 B;  3GZX B;  3SOA A;  2BMR B;  4HJL B;  3EBT A;  3F9S A;  1ZX2 A;  3B7C A;  3FGY A;  3FKA A;  2YFL B;  4HZB B;  1ISK A;  3VSY A;  3MYT A;  2INX A;  1DMM A;  5AII A;  1JKG A;  2HMK B;  3EN1 B;  3GWR A;  3OX9 A;  4XM4 A;  3NM2 A;  3JUO A;  6STD A;  2R4I A;  3EF8 A;  3F40 A;  3UNL A;  3OWU A;  3G16 A;  1E3R A;  4WWU C;  1JB2 A;  2GXF A;  4MJD A;  1CQS A;  1GY6 A;  1GYB A;  1Q42 A;  1VZZ A;  2B1X B;  2XR8 B;  5CK6 A;  2HMJ B;  3OV4 A;  3OWY A;  3Q90 A;  4HZ9 B;  3S5C A;  2OWP A;  2RFR A;  3JUP A;  4HM1 B;  3H51 A;  3MKI A;  4PEJ A;  3KKG A;  3WMD A; 
#chains in the Genus database with same CATH topology
 1B2M A;  1IV7 A;  2LYX A;  3EN8 A;  1K9M 4;  5JPU A;  1BUQ A;  5KP3 A;  2B24 B;  1JV2 B;  3SLU A;  1Q40 A;  1I2F A;  3BNC A;  1BSA A;  3HZP A;  5AEU B;  2CIU A;  1OH0 A;  3CC2 3;  2W03 A;  2K3D A;  2D1W A;  1EUI C;  3OXA A;  2WGQ A;  2F86 B;  2C10 A;  1AVK A;  2HMO B;  2F56 A;  4N6U A;  1B3S A;  1JZD A;  2RGQ A;  3K63 A;  1RHL A;  5IG3 A;  1OAC A;  1U5O A;  2CKF B;  2KRT A;  1X1W A;  2PZV A;  3DXO A;  4LMI A;  1IK3 A;  4BTY A;  1TRQ A;  2P05 A;  3WOF B;  3STD A;  1TP6 A;  2V1L A;  3AGN A;  5CF2 A;  2M7O A;  3G6E 3;  1KWI A;  3CCQ 3;  2HMN B;  3EJV A;  3LZA A;  3MG1 A;  1X1U A;  1STD A;  1V58 A;  2Z6B A;  3Q1C A;  4LZI A;  5IEN A;  2XSO B;  3CD6 3;  1RGF A;  5AIH A;  2L4V A;  2QIY A;  3VSY A;  4GHO A;  3EQQ B;  3BB9 A;  2RCD A;  4HM6 B;  3ECF A;  1IVV A;  2IY2 A;  2F5M A;  1BIR A;  3S28 A;  3AHS A;  4EYC A;  1ASK A;  1M1K 4;  1I70 A;  1IQ8 A;  3NV0 B;  3UJM A;  1IYY A;  1QMA A;  1RKY A;  1NNV A;  5M1A A;  3N9H A;  2CFK A;  1CYU A;  3F8H A;  1BRJ A;  3EBY A;  1RRH A;  3ROB A;  3J7Y d;  5CF1 A;  2OTL 3;  3IJE B;  1VQK 3;  4JRF A;  1FUS A;  1GMP A;  4O2H A;  1E97 A;  4N6N B;  1BNR A;  4HM3 B;  1GS3 A;  1JBS A;  1BRS A;  1TIJ A;  5AYS C;  1JZO A;  1PU4 A;  1IQX A;  1JKG B;  1RNT A;  1NJI 4;  1EA2 A;  5G2G A;  2CC3 A;  1YIJ 3;  1YJN 3;  1FUW A;  3ER7 A;  1T5Y A;  3A76 A;  4G1M B;  1CH0 A;  4HM2 B;  2HML B;  2OOV A;  3X3Z A;  4BTX A;  2QEX 3;  1K73 4;  3T8U A;  5EEO A;  4IPB A;  4I4K A;  2K54 A;  3SOY A;  4ILF A;  1BRK A;  4L7K A;  3LTB A;  3DUK A;  1NDO B;  1QJG A;  2CX0 A;  2YFI B;  1OPY A;  5D83 A;  1W5Z A;  3KII A;  1T2I A;  3K5T A;  3ZFZ A;  1B2U A;  1BSC A;  4ZM8 A;  1IV9 A;  4N3V A;  2MF7 A;  1EQK A;  2IA7 A;  2GU3 A;  3FF2 A;  1MGR A;  1YJW 3;  2Z77 A;  1ROV A;  4BIR A;  3GAX A;  5AEW B;  3LT8 A;  1VQN 3;  4HYZ A;  2FXT A;  2WOF A;  3CPW 2;  1GSP A;  2GU1 A;  3HX8 A;  2O9U X;  1O7P B;  2XF3 A;  7RNT A;  1GY5 A;  4XBY A;  3WA2 X;  3WHO A;  1YIT 3;  4CJN A;  1RSN A;  1RJO A;  4DKI A;  3LTD A;  3SOA A;  1TU5 A;  4HJL B;  4BU4 A;  1TFO A;  1BNF A;  2XGN A;  3MPH A;  3DH2 A;  3FGY A;  8RNT A;  3BU4 A;  2KCD A;  3EB8 A;  3N8B A;  1FGO A;  1W6C A;  3BNB A;  3MYT A;  2INX A;  1DMM A;  2W6J H;  1MWS A;  3SX1 A;  1JKG A;  2H0G A;  2XEP A;  1UGI A;  3GWR A;  3OX9 A;  4FMA A;  3S29 A;  3SXX A;  3NM2 A;  3JUO A;  1Q7Y 4;  1BAO A;  4FMD A;  2W9P A;  1A67 A;  3CC7 3;  4RNZ A;  1L5G B;  2W56 B;  2ML5 A;  1YGE A;  1GY6 A;  5ELU A;  2RBI A;  4AEQ A;  4BTW A;  1MWT A;  1VZZ A;  1B2Z A;  2OQE C;  3Q90 A;  3OV4 A;  3HI7 A;  1DVC A;  3JUP A;  3H51 A;  1CYV A;  1Q9E A;  1VQ4 3;  4MMZ B;  1EG9 B;  5BIR A;  1QAL A;  1NWW A;  3D5I A;  3FH1 A;  4IT7 A;  1MNL A;  1OGZ A;  3X3X A;  5LC7 A;  1FGT A;  3JUN A;  1AR0 A;  2XSH B;  1UUG B;  3QRD A;  3PYJ A;  3WOD G;  5CLK A;  2L1S A;  1N9J A;  4OK0 A;  1O7W B;  3EHC A;  1I2G A;  4H3U A;  3FZW A;  4XDW A;  1UCL A;  4R9K A;  1PYL A;  2JDI H;  2OCT A;  3K0Z A;  2RSX A;  1JB5 A;  1BNI A;  1MGW A;  1T2H A;  2CX1 A;  1N8Q A;  4L8O A;  1U8C B;  1RNB A;  1OHP A;  3GZB A;  1IVW A;  3BNE A;  1YVB I;  2F99 A;  3WOE B;  6GSP A;  5LC6 A;  1UCJ A;  2C4B A;  4HM4 B;  3CCV 3;  2OTJ 3;  1W6Y A;  3N54 B;  1ZS7 A;  2QGU A;  3NXJ A;  1WMN A;  4HAA A;  1G96 A;  1UCK A;  1UDI I;  3JUQ A;  4CCV A;  4EC6 A;  4OVM A;  4FCZ A;  5IW9 A;  2BT3 A;  1ULI B;  4LEH A;  4XB5 A;  1O7G B;  5DRE A;  3SVA A;  1EEJ A;  1M1X B;  1W01 A;  5BVB A;  1NB5 I;  3GZY B;  5CXO A;  2CH9 A;  2OQE A;  2WOH A;  2AAE A;  4MMX B;  4WYK A;  5D82 A;  1K8A 4;  1KSI A;  4LGQ A;  5ELJ A;  4NHF A;  2BNG A;  1YVS A;  5BXQ A;  2LQV A;  1LQM B;  3B4O A;  1HKX A;  4BL3 A;  1LQG C;  1YI2 3;  2XGL A;  1QVG 2;  1Q82 4;  5RNT A;  1JN5 A;  3BIR A;  3X3Y A;  3D4A A;  4FCM A;  2JQ5 A;  3X41 A;  3I0Y A;  1TUH A;  1BRG A;  3DGN A;  1OCV A;  1OUN A;  2MC8 A;  3RDE A;  5IG5 A;  2YFJ B;  1GMR A;  3F14 A;  9RNT A;  2UGI A;  1W6G A;  2W2C A;  3K9M C;  2CFL A;  2F98 A;  2H0H A;  1D6U A;  3FLJ A;  2XFS A;  4O3V A;  1T3B A;  1Q40 B;  3PXM A;  7GSP A;  1ISK A;  3KZT A;  1O7M B;  3PS8 A;  3G4S 3;  1C7H A;  2GEY A;  1VQ9 3;  1BSB A;  1OF5 B;  1BUJ A;  3D79 A;  4IIA A;  2HMM B;  1LOW A;  3ALA A;  2YX9 A;  1O7N B;  3WMD A;  3HIG A;  1Q86 4;  4N6L A;  3CME 3;  1JRQ A;  3LTA A;  1LXE A;  1DE3 A;  4X2O A;  3VGN A;  2BMQ B;  3DMC A;  4QWT A;  1UUW B;  2BO9 B;  1UUV B;  2IMJ A;  3LXU X;  4EBG A;  2Y74 A;  3U1W A;  8CHO A;  2CG0 A;  5BU4 A;  1GOV A;  1JBR A;  1QAF A;  1A2K A;  4R80 A;  4XBX A;  1MOL A;  4K1V A;  3LT9 A;  3GZX B;  3S27 A;  3UL5 A;  1W2Z A;  3DGM A;  2IYJ A;  1ZX2 A;  4LYL B;  1B2X A;  1RN1 A;  1Y4K A;  3V99 A;  2WO0 A;  3V98 A;  1B21 A;  1G0T A;  1VQQ A;  1HZ1 A;  3AMO B;  1HYF A;  4J5G A;  4XM4 A;  3CCE 3;  1RCL A;  3F40 A;  3KCH A;  3G16 A;  3OWU A;  1LNH A;  5M19 A;  1J2B A;  1Q7H A;  2ZA4 A;  1UI7 A;  4WHA A;  2XR8 B;  1BNJ A;  3OWY A;  4HZ9 B;  4NRE A;  5GSP A;  1US1 A;  3S5C A;  1UI8 A;  3SYU A;  3NX0 A;  3A5E A;  3MKI A;  3KKG A;  4J9A A;  1UGH I;  3RNT A;  1DYU A;  1SAR A;  1YJ9 3;  1C54 A;  3MSO A;  3WA3 A;  3NQZ A;  4OUQ A;  2E2U A;  1FZU A;  3IPT A;  3FSD A;  3D9R A;  5AIF A;  1B27 A;  1SII A;  1K28 A;  2ZL8 A;  3PCS A;  4RZM A;  5TGN A;  2BIR A;  4AKY A;  1BAN A;  1E3V A;  7STD A;  3LH4 A;  1AV4 A;  3NBJ A;  2GSP A;  3BLZ A;  3TDG A;  1A2P A;  1NB3 I;  3AMO A;  2P09 A;  4FR9 A;  4U13 A;  4WP5 A;  1FW7 A;  1B20 A;  4R4K A;  3NBR A;  2W9Q A;  4XDV A;  1RGL A;  2H0I A;  2UX0 A;  4R9L A;  4N6T A;  5EVH A;  1LOY A;  1LNI A;  3JVC A;  1HU9 A;  4KFD A;  4EV2 A;  3URP A;  5IF6 A;  3F8X A;  3PGB A;  2BHM A;  3NBB A;  2SBL A;  3CU3 A;  3LTC A;  4HVN A;  3V92 A;  2CFD A;  2STD A;  1BOX A;  2A15 A;  4HM8 B;  1BRN L;  2CHC A;  1IVU A;  1SPU A;  1GD3 A;  1W00 A;  4EXR A;  1RLS A;  1Q81 4;  2W0Q A;  4WYK B;  3CPO A;  1UW1 A;  3MG3 A;  3D5G A;  1JNQ A;  2Z76 A;  3WDG B;  2Q07 A;  3NM7 A;  1JBT A;  4HM7 B;  3E99 A;  3T0U A;  4BL2 A;  3CCM 3;  3FF0 A;  4CPK A;  3IMA B;  1BNG A;  3EC9 A;  3HK4 A;  5I97 A;  1EKM A;  4J5K A;  1N5P A;  4L8P A;  1W2B 2;  3SED A;  3NQY A;  2UUG C;  5IG4 A;  1A90 A;  3VF1 A;  1N9E A;  3OWS A;  4TX4 A;  5M18 A;  3LYG A;  4KVH A;  4XBT A;  1LOX A;  4HM5 B;  2BMO B;  3KSP A;  1M90 4;  1R4Y A;  1IQY A;  3PCR A;  1IT7 A;  3EE1 A;  1PFP A;  1RN7 A;  5KP4 A;  4KFF A;  1W4N A;  3DGO A;  1AVL A;  1ULJ B;  2GEX A;  1I3I A;  4K61 A;  6RNT A;  1VQL 3;  5IEO A;  1GY7 A;  4CDL A;  2ZHX B;  3FG3 A;  1G02 A;  1AY7 A;  1NU3 A;  1RGA A;  2AAD A;  2KF4 A;  4J8T A;  4R1K A;  5DRV A;  2W56 A;  5IG0 A;  4RNT A;  3U97 A;  1N5H A;  2BU4 A;  3QK9 A;  3UL6 A;  1V74 A;  1I0X A;  3FCS B;  1GOU A;  5STD A;  2K0M A;  3CNM A;  1IT8 A;  1QAK A;  1RCK A;  2CWV A;  2KF6 A;  2W04 A;  3D3L A;  3CNX A;  2P0M A;  3AHW A;  3ZG5 A;  1F8N A;  1LRA A;  1WNH A;  2CW9 A;  4K1U A;  1W02 A;  3Q2P A;  1YHQ 3;  1SIH A;  1VQM 3;  2BMR B;  3EBT A;  1FYS A;  3F9S A;  2C11 A;  2KXG A;  1VQ8 3;  3DGY A;  2XH9 A;  1BGS A;  2E2T A;  2FNQ A;  3FKA A;  2YFL B;  4HZB B;  1I8V A;  4AKZ A;  1RGH A;  1BSD A;  5AII A;  2HMK B;  2CK3 H;  3X42 A;  1BVI A;  6STD A;  2R4I A;  3ZG0 A;  1KD1 4;  4GSP A;  2QA4 3;  1JJ2 2;  3CMA 3;  2PNC A;  2CFG A;  1Q42 A;  2R41 A;  3PZW A;  2OWP A;  3I55 3;  1BRH A;  1N8R 4;  3L0R A;  2O3O A;  1UCI A;  2XFT A;  4ORL A;  1LVN A;  1I3F A;  1ZGX A;  3RGR A;  1KQS 2;  1VQ5 3;  3B4P A;  3JUM A;  3CXC 2;  3WR2 A;  4N6M A;  5HGR A;  4X2H A;  2KF3 A;  1WMO A;  3K7C A;  1M9G A;  3F7X A;  4KZ1 A;  3LOY A;  5JPP A;  1FGR A;  2CWT A;  1SJW A;  1W7C A;  2KAA A;  1DMN A;  2ZDJ A;  1FUT A;  3EX9 A;  4JF8 A;  3F7S A;  3CC4 3;  4FCJ A;  3B8L A;  1BU4 A;  1RGE A;  2CG1 A;  1S72 3;  3MG2 A;  3RGA A;  1X1Y A;  4MMY B;  4MEI A;  1WMP A;  2CFW A;  3HOH A;  1WQL B;  4HKV B;  2GBX B;  4HM0 B;  1SQW A;  2IUJ A;  3CCU 3;  1VQ7 3;  1RMS A;  3OW2 2;  5IER A;  1BRI A;  1Z1S A;  1MWR A;  3DZL A;  3G71 3;  2Z7A A;  3Q3F A;  5G1L A;  1FA3 A;  2I9W A;  3DGL A;  1PY3 A;  1RGG A;  2FGT A;  4N6O B;  3FG1 A;  1OF5 A;  1YGW A;  4N6V 0;  1BSE A;  4FMB A;  1O7H B;  1IDP A;  1D6Y A;  3MWZ A;  3I56 3;  1V57 A;  1FGM A;  1VQO 3;  2SAR A;  4FMC A;  4KT3 B;  3CCL 3;  3O8Y A;  1OHS A;  3GRD A;  1S5A A;  2KF5 A;  1NO3 A;  1RGC A;  1DMQ A;  3M8C A;  4GB5 A;  4EW5 A;  3KFQ C;  3NV0 A;  1R4C A;  3DY5 A;  1B2S A;  3MHE A;  3KN4 A;  4STD A;  5D81 A;  3LML A;  4KFE A;  1I2E A;  1BNS A;  2RNT A;  1WTH A;  3T8N A;  5JBS A;  5FW5 A;  2OOV C;  1TFK A;  2J8X B;  1GD4 A;  3UB1 A;  1DET A;  1KC8 4;  5KP1 A;  4HBR A;  4RBN A;  3NUV A;  4EV5 A;  1ROA A;  1QVF 2;  3G0K A;  1AQZ A;  3CCJ 3;  1BNE A;  2GBW B;  2ML6 A;  1JB4 A;  1ZO2 A;  3NHX A;  2P0X A;  4RNY A;  1RDS A;  1TTO A;  1RRL A;  1OHO A;  2E2V A;  4Q53 A;  1OGX A;  3GZR A;  5AIG A;  1GOY A;  3KSE D;  3GSP A;  4WFO A;  3KE7 A;  3G8Z A;  4LSO A;  2F4Y A;  4I5Q A;  5AI1 A;  2Y73 A;  3X40 A;  1RGK A;  2XRX B;  2D42 A;  5AYR B;  1I0V A;  1DVD A;  1STF I;  1LOV A;  1VQP 3;  1K41 A;  2F5W A;  4H61 A;  4HOH A;  3DM8 A;  5IEP A;  1A2V A;  1TRP A;  3H3H A;  1YNV X;  5HOH A;  1JN5 B;  1CEW I;  1X1X A;  4O02 B;  3CCS 3;  1IU7 A;  3B7C A;  1VQ6 3;  1GMQ A;  1MWU A;  3HII A;  3CCR 3;  5G1K A;  3EN1 B;  3AGO A;  2HOH A;  3BND A;  3FG4 A;  1RN4 A;  3EF8 A;  2WGO A;  3UNL A;  1TJD A;  1E3R A;  1RTU A;  4WWU C;  1JB2 A;  2CWU A;  2GXF A;  2P38 A;  5EQL A;  3S67 A;  4MJD A;  1CQS A;  2IUK A;  4NPB A;  5FGO A;  1GYB A;  4GL6 A;  2B1X B;  1D6Z A;  5CK6 A;  2HMJ B;  4O8S A;  2RFR A;  4PEJ A;  4HM1 B;  5A0O B;  1IVX A;  4K90 B;  1FGQ A; 
#chains in the Genus database with same CATH homology
 1IV7 A;  2LYX A;  3EN8 A;  1K9M 4;  5JPU A;  1BUQ A;  5KP3 A;  2B24 B;  1JV2 B;  3SLU A;  1Q40 A;  3BNC A;  3HZP A;  5AEU B;  2CIU A;  1OH0 A;  3CC2 3;  2W03 A;  2D1W A;  3OXA A;  2WGQ A;  2F86 B;  2C10 A;  1AVK A;  2HMO B;  4N6U A;  2RGQ A;  3K63 A;  5IG3 A;  1OAC A;  1U5O A;  2CKF B;  2KRT A;  2PZV A;  3DXO A;  4LMI A;  1IK3 A;  4BTY A;  3WOF B;  2P05 A;  3STD A;  1TP6 A;  2V1L A;  5CF2 A;  2M7O A;  3G6E 3;  1KWI A;  3CCQ 3;  2HMN B;  3EJV A;  3LZA A;  3MG1 A;  5IEN A;  1STD A;  2Z6B A;  4LZI A;  3Q1C A;  2XSO B;  3CD6 3;  5AIH A;  2L4V A;  2QIY A;  3VSY A;  3EQQ B;  3BB9 A;  2RCD A;  4HM6 B;  3ECF A;  1IVV A;  3S28 A;  4EYC A;  1ASK A;  1M1K 4;  3NV0 B;  1IQ8 A;  3UJM A;  1QMA A;  1RKY A;  3N9H A;  2CFK A;  1CYU A;  3F8H A;  3ROB A;  3EBY A;  1RRH A;  3J7Y d;  2OTL 3;  5CF1 A;  3IJE B;  1VQK 3;  4JRF A;  4O2H A;  1E97 A;  4N6N B;  4HM3 B;  1GS3 A;  1TIJ A;  5AYS C;  1PU4 A;  1IQX A;  1JKG B;  1NJI 4;  1EA2 A;  5G2G A;  2CC3 A;  1YIJ 3;  1YJN 3;  1FUW A;  3ER7 A;  1T5Y A;  3A76 A;  4G1M B;  4HM2 B;  3X3Z A;  2HML B;  2OOV A;  1K73 4;  4BTX A;  2QEX 3;  3T8U A;  5EEO A;  4IPB A;  4I4K A;  2K54 A;  3SOY A;  4L7K A;  3LTB A;  3DUK A;  1NDO B;  1QJG A;  2YFI B;  5D83 A;  1OPY A;  1W5Z A;  3KII A;  4ZM8 A;  3K5T A;  1IV9 A;  4N3V A;  2MF7 A;  1EQK A;  2IA7 A;  2GU3 A;  3FF2 A;  1YJW 3;  2Z77 A;  1ROV A;  1VQN 3;  3GAX A;  5AEW B;  3LT8 A;  4HYZ A;  2FXT A;  2WOF A;  3CPW 2;  3HX8 A;  2GU1 A;  2O9U X;  1O7P B;  2XF3 A;  1GY5 A;  4XBY A;  3WA2 X;  1YIT 3;  1RJO A;  3LTD A;  3SOA A;  1TU5 A;  4HJL B;  1TFO A;  3MPH A;  2XGN A;  3FGY A;  2KCD A;  3EB8 A;  3N8B A;  1FGO A;  1W6C A;  3BNB A;  3MYT A;  2INX A;  1DMM A;  2W6J H;  3SX1 A;  1JKG A;  2XEP A;  3GWR A;  3OX9 A;  4FMA A;  1Q7Y 4;  3S29 A;  3SXX A;  3NM2 A;  3JUO A;  4FMD A;  2W9P A;  1A67 A;  3CC7 3;  4RNZ A;  1L5G B;  2W56 B;  2ML5 A;  1YGE A;  1GY6 A;  5ELU A;  4AEQ A;  4BTW A;  1VZZ A;  2OQE C;  3Q90 A;  3OV4 A;  3HI7 A;  1DVC A;  3JUP A;  3H51 A;  1CYV A;  1VQ4 3;  4MMZ B;  1EG9 B;  1QAL A;  1NWW A;  3FH1 A;  4IT7 A;  1MNL A;  1OGZ A;  3X3X A;  5LC7 A;  1FGT A;  3JUN A;  1AR0 A;  2XSH B;  3QRD A;  3PYJ A;  3WOD G;  5CLK A;  1N9J A;  4OK0 A;  1O7W B;  3EHC A;  4H3U A;  3FZW A;  4XDW A;  4R9K A;  2JDI H;  3K0Z A;  2OCT A;  2RSX A;  1JB5 A;  1N8Q A;  4L8O A;  1U8C B;  1OHP A;  3GZB A;  1IVW A;  3BNE A;  1YVB I;  2F99 A;  3WOE B;  5LC6 A;  4HM4 B;  3CCV 3;  2OTJ 3;  1W6Y A;  3N54 B;  2QGU A;  3NXJ A;  1WMN A;  1G96 A;  3JUQ A;  4CCV A;  4EC6 A;  4OVM A;  4FCZ A;  5IW9 A;  2BT3 A;  1ULI B;  4LEH A;  4XB5 A;  1O7G B;  5DRE A;  3SVA A;  1M1X B;  1W01 A;  5BVB A;  1NB5 I;  3GZY B;  5CXO A;  2CH9 A;  2OQE A;  2WOH A;  4MMX B;  4WYK A;  5D82 A;  1K8A 4;  1KSI A;  4LGQ A;  5ELJ A;  4NHF A;  2BNG A;  5BXQ A;  2LQV A;  3B4O A;  1HKX A;  1YI2 3;  2XGL A;  1QVG 2;  1Q82 4;  1JN5 A;  3X3Y A;  4FCM A;  2JQ5 A;  3X41 A;  3I0Y A;  1TUH A;  3DGN A;  2MC8 A;  1OCV A;  1OUN A;  3RDE A;  5IG5 A;  2YFJ B;  3F14 A;  1W6G A;  2W2C A;  3K9M C;  2CFL A;  2F98 A;  3FLJ A;  1D6U A;  4O3V A;  2XFS A;  1Q40 B;  3PXM A;  1ISK A;  3KZT A;  1O7M B;  3PS8 A;  3G4S 3;  1C7H A;  2GEY A;  1VQ9 3;  1OF5 B;  4IIA A;  2HMM B;  3ALA A;  2YX9 A;  1O7N B;  3WMD A;  3HIG A;  1Q86 4;  4N6L A;  3CME 3;  1JRQ A;  3LTA A;  1LXE A;  4X2O A;  3VGN A;  2BMQ B;  3DMC A;  4QWT A;  1UUW B;  2BO9 B;  1UUV B;  2IMJ A;  3LXU X;  4EBG A;  2Y74 A;  3U1W A;  8CHO A;  2CG0 A;  1QAF A;  1A2K A;  4R80 A;  4XBX A;  1MOL A;  4K1V A;  3LT9 A;  3GZX B;  3S27 A;  3UL5 A;  3DGM A;  1W2Z A;  1ZX2 A;  3V99 A;  1Y4K A;  2WO0 A;  3V98 A;  3AMO B;  4XM4 A;  3CCE 3;  3F40 A;  3OWU A;  3G16 A;  1LNH A;  1J2B A;  1UI7 A;  4WHA A;  2XR8 B;  3OWY A;  4HZ9 B;  4NRE A;  3S5C A;  1US1 A;  1UI8 A;  3NX0 A;  3MKI A;  4J9A A;  3KKG A;  1DYU A;  1YJ9 3;  3MSO A;  3WA3 A;  3NQZ A;  4OUQ A;  2E2U A;  3IPT A;  3FSD A;  3D9R A;  5AIF A;  1SII A;  2ZL8 A;  1K28 A;  3PCS A;  4RZM A;  5TGN A;  4AKY A;  1E3V A;  7STD A;  3LH4 A;  1AV4 A;  3NBJ A;  3BLZ A;  3TDG A;  1NB3 I;  3AMO A;  4WP5 A;  2P09 A;  4FR9 A;  4U13 A;  4R4K A;  3NBR A;  2W9Q A;  4XDV A;  2UX0 A;  4R9L A;  5EVH A;  4N6T A;  3JVC A;  1HU9 A;  4KFD A;  4EV2 A;  5IF6 A;  3F8X A;  3PGB A;  2BHM A;  3NBB A;  2SBL A;  3CU3 A;  3LTC A;  4HVN A;  3V92 A;  2CFD A;  2STD A;  2A15 A;  4HM8 B;  2CHC A;  1IVU A;  1SPU A;  1GD3 A;  1W00 A;  4EXR A;  1Q81 4;  2W0Q A;  4WYK B;  3CPO A;  1UW1 A;  3MG3 A;  1JNQ A;  2Z76 A;  3WDG B;  2Q07 A;  3NM7 A;  4HM7 B;  3E99 A;  3T0U A;  3CCM 3;  3FF0 A;  3IMA B;  3EC9 A;  3HK4 A;  5I97 A;  1EKM A;  1N5P A;  4L8P A;  1W2B 2;  3SED A;  3NQY A;  1A90 A;  5IG4 A;  3VF1 A;  1N9E A;  3OWS A;  4TX4 A;  3LYG A;  4KVH A;  4XBT A;  1LOX A;  4HM5 B;  2BMO B;  3KSP A;  1M90 4;  1IQY A;  3PCR A;  1IT7 A;  3EE1 A;  1PFP A;  1RN7 A;  5KP4 A;  4KFF A;  1W4N A;  3DGO A;  1AVL A;  1ULJ B;  2GEX A;  4K61 A;  1VQL 3;  5IEO A;  1GY7 A;  4CDL A;  3FG3 A;  1NU3 A;  4J8T A;  4R1K A;  5IG0 A;  5DRV A;  2W56 A;  3U97 A;  1N5H A;  3QK9 A;  3UL6 A;  1V74 A;  3FCS B;  5STD A;  2K0M A;  3CNM A;  1IT8 A;  1QAK A;  2CWV A;  2W04 A;  3D3L A;  3CNX A;  2P0M A;  1F8N A;  2CW9 A;  1WNH A;  1YHQ 3;  4K1U A;  1W02 A;  3Q2P A;  1SIH A;  1VQM 3;  2BMR B;  3EBT A;  3F9S A;  2C11 A;  2KXG A;  1VQ8 3;  2XH9 A;  2E2T A;  2FNQ A;  3FKA A;  2YFL B;  4HZB B;  4AKZ A;  5AII A;  2HMK B;  2CK3 H;  3X42 A;  6STD A;  2R4I A;  1KD1 4;  2QA4 3;  1JJ2 2;  3CMA 3;  2PNC A;  2CFG A;  1Q42 A;  3PZW A;  2OWP A;  3I55 3;  1N8R 4;  3L0R A;  2O3O A;  2XFT A;  4ORL A;  1LVN A;  1KQS 2;  3RGR A;  1VQ5 3;  3B4P A;  3JUM A;  3CXC 2;  4N6M A;  5HGR A;  4X2H A;  1WMO A;  3K7C A;  1M9G A;  3F7X A;  4KZ1 A;  3LOY A;  5JPP A;  1FGR A;  2CWT A;  1SJW A;  1W7C A;  3EX9 A;  1DMN A;  2ZDJ A;  3CC4 3;  4JF8 A;  3F7S A;  4FCJ A;  3B8L A;  2CG1 A;  1S72 3;  3MG2 A;  3RGA A;  4MMY B;  4MEI A;  1WMP A;  2CFW A;  1WQL B;  4HKV B;  2GBX B;  4HM0 B;  1SQW A;  2IUJ A;  3CCU 3;  1VQ7 3;  3OW2 2;  5IER A;  1Z1S A;  3G71 3;  3DZL A;  2Z7A A;  1FA3 A;  2I9W A;  3DGL A;  2FGT A;  4N6O B;  3FG1 A;  1OF5 A;  4N6V 0;  4FMB A;  1O7H B;  1IDP A;  1D6Y A;  3MWZ A;  3I56 3;  1FGM A;  1VQO 3;  4FMC A;  3CCL 3;  3O8Y A;  1OHS A;  3GRD A;  1S5A A;  4GB5 A;  1NO3 A;  1DMQ A;  3M8C A;  3KFQ C;  3NV0 A;  1R4C A;  3DY5 A;  3MHE A;  4STD A;  3KN4 A;  5D81 A;  3LML A;  4KFE A;  5JBS A;  3T8N A;  1WTH A;  5FW5 A;  2OOV C;  1TFK A;  1GD4 A;  3UB1 A;  1KC8 4;  5KP1 A;  4HBR A;  4RBN A;  3NUV A;  4EV5 A;  1ROA A;  1QVF 2;  3G0K A;  3CCJ 3;  2GBW B;  2ML6 A;  1JB4 A;  1ZO2 A;  3NHX A;  2P0X A;  4RNY A;  1RRL A;  1OHO A;  2E2V A;  4Q53 A;  1OGX A;  3GZR A;  5AIG A;  3KSE D;  4WFO A;  3KE7 A;  3G8Z A;  4LSO A;  5AI1 A;  2Y73 A;  3X40 A;  2XRX B;  2D42 A;  5AYR B;  1DVD A;  1STF I;  1VQP 3;  1K41 A;  4H61 A;  3DM8 A;  5IEP A;  1A2V A;  3H3H A;  1JN5 B;  1CEW I;  4O02 B;  3CCS 3;  1IU7 A;  3B7C A;  1VQ6 3;  3HII A;  3CCR 3;  3EN1 B;  3BND A;  3FG4 A;  3EF8 A;  3UNL A;  2WGO A;  1E3R A;  4WWU C;  1JB2 A;  2CWU A;  2GXF A;  2P38 A;  5EQL A;  3S67 A;  4MJD A;  1CQS A;  2IUK A;  5FGO A;  1GYB A;  4GL6 A;  2B1X B;  1D6Z A;  5CK6 A;  2HMJ B;  4O8S A;  2RFR A;  4PEJ A;  4HM1 B;  5A0O B;  1IVX A;  4K90 B;  1FGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...