3Q91A

Crystal structure of human uridine diphosphate glucose pyrophosphatase (nudt14)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
182
structure length
145
Chain Sequence
b'THDSVTVLLFNSSRRSLVLVKQFRPAVYAGEVEAGVTVELCAGLVDQPGLSLEEVACKEAWEECGYHLAPSDLRRVATYWSGTGSRQTMFYTEVTDAQRSGELIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLSQVAPNLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine diphosphate glucose pyrophosphatase
publication title Crystal Structure of Human Uridine Diphosphate Glucose Pyrophosphatase (NUDT14)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 39
structure length 145
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.45: UDP-sugar diphosphatase.
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3q91A00
3X0RA 3COUA 5ANVA 5GHQA 5DDGA 3P6YA 2AZWA 5GHJA 1V8RA 5HZXA 2YVOA 2I8TA 2A8TA 2PNYA 5GHPA 1R67A 2VNQA 3QSJA 5FSNA 5GHIA 3O52A 1V8NA 1VIUA 3A6TA 2YVPA 3O69A 5DD4A 1JKNA 1GA7A 1NFSA 3H95A 3ID9A 4KTBA 2W4EA 4ILQA 4JZSA 2YYHA 1V8YA 1KHZA 2B0VA 4JZUA 3A6SA 2O5FA 5FSOA 3GWYA 2YVNA 3RH7A 3X0LA 1PUNA 5LPGA 4C9WA 3EEUA 1VC9A 4S2XA 3O6ZA 2A8SA 2VNPA 3A6UA 1G0SA 3BAPA 1HZTA 3MGMA 1Q27A 5ANSA 5ANWA 1PVFA 3ZR1A 1VHZA 3Q91A 3GZ6A 3ACAA 3DUPA 2G73A 1V8WA 3I7VA 1PPXA 2CL3A 2QJOA 2DSBA 3WHWA 3G0QA 3ZR0A 4V14A 2PQVA 1SU2A 2DSCA 4KG4A 3X0SA 3OGAA 1V8SA 1SJYA 2O5WA 1PUQA 3FFUA 3X0JA 3GZ5A 3U53A 2R5WA 2XSQA 3J7Ye 3HHJA 3N9UA 5FSKA 1PPWA 1Q54A 2GB5A 1IRYA 2QJTA 3I7UA 1F3YA 1VC8A 1K2EA 3X0MA 5DEQA 3EF5A 5ANTA 2O1CA 1VHGA 5IW4A 5I8UA 3GRNA 5DPKA 2DUKA 3X0NA 1I9AA 2B2KA 3I9XA 5CFIA 5C7TA 1OW2A 3O8SA 5CFJA 1NQYA 1G9QA 1RRQA 3N77A 2ICJA 1HX3A 4MPOA 1V8VA 5FSMA 2J8QA 1NFZA 4HFQA 4ICKA 3X0OA 1TUMA 1MUTA 3EXQA 2G74A 5ISYA 3KVHA 1XSAA 3SMDA 1V8TA 1V8LA 3R03A 3Q2SA 4KYXA 3F6AA 1V8MA 1SOIA 2B06A 2Q9PA 4NFWA 5BONA 2FMLA 3Q2TA 1MQWA 5BS6A 5FSIA 3SONA 3MDIA 2A6TA 2I8UA 4DYWA 1JRKA 3HYQA 1PPVA 4KG3A 1X51A 3L85A 3P5TA 5C7QA 5IW5A 1RYAA 1PUSA 4N1TA 2FKBA 3DKUA 1K26A 2RRKA 1VIQA 3X0PA 1V8UA 4C9XA 1QVJA 4ZG0A 5ANUA 2I6KA 3F13A 3O61A 1MP2A 3FJYA 4YOQA 1X84A 2A8PA 3AC9A 3BM4A 4YPRA 3A6VA 4JZVA 1NQZA 4N1UA 1V8IA 3FSPA 4NFXA 5C8LA 3BHOA 3SHDA 3X0IA 3X0QA 1KT9A 2JVBA 4JZTA 1MK1A 2KDVA 3Q93A 3MDGA 3E57A 2YVMA 4YPHA 2DHOA 5GHOA 3GZ8A 3EESA 1U20A 3FK9A 5FSLA 4HVYA 1VCDA 3CNGA 1VK6A 1MR2A 3MCFA 3Q4IA 4S2WA 2GT2A 1XSCA 1Q33A 1XSBA 2KDWA 3Q1PA 1SZ3A 2DSDA 2FVVA 2GT4A 2A8QA 2A8RA 2ICKA 2QKMB 3GG6A 4K6EA 1RRSA 3FCMA 5GHMA 3X0KA 4IJXA 5GHNA 4S2YA 1KTGA 4S2VA 1VRLA 1MQEA 1X83A
chains in the Genus database with same CATH superfamily
3X0RA 3COUA 5ANVA 5GHQA 5DDGA 3P6YA 2AZWA 5GHJA 1V8RA 5HZXA 2YVOA 2I8TA 2A8TA 2PNYA 5GHPA 1R67A 2VNQA 3QSJA 5FSNA 5GHIA 3O52A 1V8NA 1VIUA 3A6TA 2YVPA 3O69A 5DD4A 1JKNA 1GA7A 1NFSA 3H95A 3ID9A 4KTBA 2W4EA 4ILQA 4JZSA 2YYHA 1V8YA 1KHZA 2B0VA 4JZUA 3A6SA 2O5FA 5FSOA 3GWYA 2YVNA 3RH7A 3X0LA 1PUNA 5LPGA 4C9WA 3EEUA 1VC9A 4S2XA 3O6ZA 2A8SA 2VNPA 3A6UA 1G0SA 3BAPA 1HZTA 3MGMA 1Q27A 5ANSA 5ANWA 1PVFA 3ZR1A 1VHZA 3Q91A 3GZ6A 3ACAA 3DUPA 2G73A 1V8WA 3I7VA 1PPXA 2CL3A 2QJOA 2DSBA 3WHWA 3G0QA 3ZR0A 4V14A 2PQVA 1SU2A 2DSCA 4KG4A 3X0SA 3OGAA 4J7HA 1V8SA 1SJYA 2O5WA 1PUQA 3FFUA 3X0JA 3GZ5A 3U53A 2R5WA 2XSQA 3J7Ye 3HHJA 3N9UA 5FSKA 1PPWA 1Q54A 2GB5A 1IRYA 2QJTA 3I7UA 1F3YA 1VC8A 1K2EA 3X0MA 5DEQA 3EF5A 5ANTA 2O1CA 1VHGA 5IW4A 5I8UA 3GRNA 5DPKA 2DUKA 3X0NA 1I9AA 2B2KA 3I9XA 5CFIA 5C7TA 1OW2A 3O8SA 5CFJA 1NQYA 1G9QA 1RRQA 3N77A 2ICJA 1HX3A 4MPOA 1V8VA 5FSMA 2J8QA 1NFZA 4HFQA 4ICKA 3X0OA 1TUMA 1MUTA 3EXQA 2G74A 5ISYA 3KVHA 1XSAA 3SMDA 1V8TA 1V8LA 3R03A 3Q2SA 4KYXA 3F6AA 1V8MA 1SOIA 2B06A 2Q9PA 4NFWA 5BONA 2FMLA 3Q2TA 1MQWA 5BS6A 5FSIA 3SONA 3MDIA 2A6TA 2I8UA 4DYWA 1JRKA 3HYQA 1PPVA 4KG3A 1X51A 3L85A 3P5TA 5C7QA 5IW5A 1RYAA 1PUSA 4N1TA 2FKBA 3DKUA 1K26A 2RRKA 1VIQA 3X0PA 1V8UA 4C9XA 1QVJA 4ZG0A 5ANUA 2I6KA 3F13A 3O61A 1MP2A 3FJYA 4YOQA 1X84A 2A8PA 3AC9A 3BM4A 4YPRA 3A6VA 4JZVA 1NQZA 4N1UA 1V8IA 4J7GA 4NFXA 5C8LA 3FSPA 3BHOA 3SHDA 3X0IA 3X0QA 1KT9A 2JVBA 4JZTA 1MK1A 2KDVA 3Q93A 3MDGA 3E57A 2YVMA 4YPHA 2DHOA 5GHOA 3GZ8A 3EESA 1U20A 2CZRA 3FK9A 5FSLA 4HVYA 1VCDA 3CNGA 1VK6A 1MR2A 3MCFA 3Q4IA 4S2WA 2GT2A 1XSCA 1Q33A 1XSBA 2KDWA 3Q1PA 1SZ3A 2DSDA 2FVVA 2GT4A 2A8QA 2A8RA 2ICKA 2QKMB 3GG6A 4K6EA 1RRSA 3FCMA 5GHMA 3X0KA 4IJXA 5GHNA 4S2YA 1KTGA 4S2VA 1VRLA 1MQEA 1X83A
chains in the Genus database with same CATH topology
3X0RA 3COUA 5ANVA 5GHQA 5DDGA 3P6YA 2AZWA 5GHJA 1V8RA 5HZXA 2YVOA 2I8TA 2A8TA 2PNYA 5GHPA 1R67A 2VNQA 3QSJA 5FSNA 5GHIA 3O52A 1V8NA 1VIUA 3A6TA 2YVPA 3O69A 5DD4A 1JKNA 1GA7A 1NFSA 3H95A 3ID9A 4KTBA 2W4EA 4ILQA 4JZSA 2YYHA 1V8YA 1KHZA 2B0VA 4JZUA 3A6SA 2O5FA 5FSOA 3GWYA 2YVNA 3RH7A 3X0LA 1PUNA 5LPGA 4C9WA 3EEUA 1VC9A 4S2XA 3O6ZA 2A8SA 2VNPA 3A6UA 1G0SA 3BAPA 1HZTA 3MGMA 1Q27A 5ANSA 5ANWA 1PVFA 3ZR1A 1VHZA 3Q91A 3GZ6A 3ACAA 3DUPA 2G73A 1V8WA 3I7VA 1PPXA 2CL3A 2QJOA 2DSBA 3WHWA 3G0QA 3ZR0A 4V14A 2PQVA 1SU2A 2DSCA 4KG4A 3X0SA 3OGAA 4J7HA 1V8SA 1SJYA 2O5WA 1PUQA 3FFUA 3X0JA 3GZ5A 3U53A 2R5WA 2XSQA 3J7Ye 3HHJA 3N9UA 5FSKA 1PPWA 1Q54A 2GB5A 1IRYA 2QJTA 3I7UA 1F3YA 1VC8A 1K2EA 3X0MA 5DEQA 3EF5A 5ANTA 2O1CA 1VHGA 5IW4A 5I8UA 3GRNA 5DPKA 2DUKA 3X0NA 1I9AA 2B2KA 3I9XA 5CFIA 5C7TA 1OW2A 3O8SA 5CFJA 1NQYA 1G9QA 1RRQA 3N77A 2ICJA 1HX3A 4MPOA 1V8VA 5FSMA 2J8QA 1NFZA 4HFQA 4ICKA 3X0OA 1TUMA 1MUTA 3EXQA 2G74A 5ISYA 3KVHA 1XSAA 3SMDA 1V8TA 1V8LA 3R03A 3Q2SA 4KYXA 3F6AA 1V8MA 1SOIA 2B06A 2Q9PA 4NFWA 5BONA 2FMLA 3Q2TA 1MQWA 5BS6A 5FSIA 3SONA 3MDIA 2A6TA 2I8UA 4DYWA 1JRKA 3HYQA 1PPVA 4KG3A 1X51A 3L85A 3P5TA 5C7QA 5IW5A 1RYAA 1PUSA 4N1TA 2FKBA 3DKUA 1K26A 2RRKA 1VIQA 3X0PA 1V8UA 4C9XA 1QVJA 4ZG0A 5ANUA 2I6KA 3F13A 3O61A 1MP2A 3FJYA 4YOQA 1X84A 2A8PA 3AC9A 3BM4A 4YPRA 3A6VA 4JZVA 1NQZA 4N1UA 1V8IA 4J7GA 4NFXA 5C8LA 3FSPA 3BHOA 3SHDA 3X0IA 3X0QA 1KT9A 2JVBA 4JZTA 1MK1A 2KDVA 3Q93A 3MDGA 3E57A 2YVMA 4YPHA 2DHOA 5GHOA 3GZ8A 3EESA 1U20A 2CZRA 3FK9A 5FSLA 4HVYA 1VCDA 3CNGA 1VK6A 1MR2A 3MCFA 3Q4IA 4S2WA 2GT2A 1XSCA 1Q33A 1XSBA 2KDWA 3Q1PA 1SZ3A 2DSDA 2FVVA 2GT4A 2A8QA 2A8RA 2ICKA 2QKMB 3GG6A 4K6EA 1RRSA 3FCMA 5GHMA 3X0KA 4IJXA 5GHNA 4S2YA 1KTGA 4S2VA 1VRLA 1MQEA 1X83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X0R A;  3COU A;  5ANV A;  5GHQ A;  5DDG A;  3P6Y A;  2AZW A;  5GHJ A;  1V8R A;  5HZX A;  2YVO A;  2I8T A;  2A8T A;  2PNY A;  5GHP A;  1R67 A;  2VNQ A;  3QSJ A;  5FSN A;  5GHI A;  3O52 A;  1V8N A;  1VIU A;  3A6T A;  2YVP A;  3O69 A;  5DD4 A;  1JKN A;  1GA7 A;  1NFS A;  3H95 A;  3ID9 A;  4KTB A;  2W4E A;  4ILQ A;  4JZS A;  2YYH A;  1V8Y A;  1KHZ A;  2B0V A;  4JZU A;  3A6S A;  2O5F A;  5FSO A;  3GWY A;  2YVN A;  3RH7 A;  3X0L A;  1PUN A;  5LPG A;  4C9W A;  3EEU A;  1VC9 A;  4S2X A;  3O6Z A;  2A8S A;  2VNP A;  3A6U A;  1G0S A;  3BAP A;  1HZT A;  3MGM A;  1Q27 A;  5ANS A;  5ANW A;  1PVF A;  3ZR1 A;  1VHZ A;  3Q91 A;  3GZ6 A;  3ACA A;  3DUP A;  2G73 A;  1V8W A;  3I7V A;  1PPX A;  2CL3 A;  2QJO A;  2DSB A;  3WHW A;  3G0Q A;  3ZR0 A;  4V14 A;  2PQV A;  1SU2 A;  2DSC A;  4KG4 A;  3X0S A;  3OGA A;  1V8S A;  1SJY A;  2O5W A;  1PUQ A;  3FFU A;  3X0J A;  3GZ5 A;  3U53 A;  2R5W A;  2XSQ A;  3J7Y e;  3HHJ A;  3N9U A;  5FSK A;  1PPW A;  1Q54 A;  2GB5 A;  1IRY A;  2QJT A;  3I7U A;  1F3Y A;  1VC8 A;  1K2E A;  3X0M A;  5DEQ A;  3EF5 A;  5ANT A;  2O1C A;  1VHG A;  5IW4 A;  5I8U A;  3GRN A;  5DPK A;  2DUK A;  3X0N A;  1I9A A;  2B2K A;  3I9X A;  5CFI A;  5C7T A;  1OW2 A;  3O8S A;  5CFJ A;  1NQY A;  1G9Q A;  1RRQ A;  3N77 A;  2ICJ A;  1HX3 A;  4MPO A;  1V8V A;  5FSM A;  2J8Q A;  1NFZ A;  4HFQ A;  4ICK A;  3X0O A;  1TUM A;  1MUT A;  3EXQ A;  2G74 A;  5ISY A;  3KVH A;  1XSA A;  3SMD A;  1V8T A;  1V8L A;  3R03 A;  3Q2S A;  4KYX A;  3F6A A;  1V8M A;  1SOI A;  2B06 A;  2Q9P A;  4NFW A;  5BON A;  2FML A;  3Q2T A;  1MQW A;  5BS6 A;  5FSI A;  3SON A;  3MDI A;  2A6T A;  2I8U A;  4DYW A;  1JRK A;  3HYQ A;  1PPV A;  4KG3 A;  1X51 A;  3L85 A;  3P5T A;  5C7Q A;  5IW5 A;  1RYA A;  1PUS A;  4N1T A;  2FKB A;  3DKU A;  1K26 A;  2RRK A;  1VIQ A;  3X0P A;  1V8U A;  4C9X A;  1QVJ A;  4ZG0 A;  5ANU A;  2I6K A;  3F13 A;  3O61 A;  1MP2 A;  3FJY A;  4YOQ A;  1X84 A;  2A8P A;  3AC9 A;  3BM4 A;  4YPR A;  3A6V A;  4JZV A;  1NQZ A;  4N1U A;  1V8I A;  3FSP A;  4NFX A;  5C8L A;  3BHO A;  3SHD A;  3X0I A;  3X0Q A;  1KT9 A;  2JVB A;  4JZT A;  1MK1 A;  2KDV A;  3Q93 A;  3MDG A;  3E57 A;  2YVM A;  4YPH A;  2DHO A;  5GHO A;  3GZ8 A;  3EES A;  1U20 A;  3FK9 A;  5FSL A;  4HVY A;  1VCD A;  3CNG A;  1VK6 A;  1MR2 A;  3MCF A;  3Q4I A;  4S2W A;  2GT2 A;  1XSC A;  1Q33 A;  1XSB A;  2KDW A;  3Q1P A;  1SZ3 A;  2DSD A;  2FVV A;  2GT4 A;  2A8Q A;  2A8R A;  2ICK A;  2QKM B;  3GG6 A;  4K6E A;  1RRS A;  3FCM A;  5GHM A;  3X0K A;  4IJX A;  5GHN A;  4S2Y A;  1KTG A;  4S2V A;  1VRL A;  1MQE A;  1X83 A; 
#chains in the Genus database with same CATH topology
 3X0R A;  3COU A;  5ANV A;  5GHQ A;  5DDG A;  3P6Y A;  2AZW A;  5GHJ A;  1V8R A;  5HZX A;  2YVO A;  2I8T A;  2A8T A;  2PNY A;  5GHP A;  1R67 A;  2VNQ A;  3QSJ A;  5FSN A;  5GHI A;  3O52 A;  1V8N A;  1VIU A;  3A6T A;  2YVP A;  3O69 A;  5DD4 A;  1JKN A;  1GA7 A;  1NFS A;  3H95 A;  3ID9 A;  4KTB A;  2W4E A;  4ILQ A;  4JZS A;  2YYH A;  1V8Y A;  1KHZ A;  2B0V A;  4JZU A;  3A6S A;  2O5F A;  5FSO A;  3GWY A;  2YVN A;  3RH7 A;  3X0L A;  1PUN A;  5LPG A;  4C9W A;  3EEU A;  1VC9 A;  4S2X A;  3O6Z A;  2A8S A;  2VNP A;  3A6U A;  1G0S A;  3BAP A;  1HZT A;  3MGM A;  1Q27 A;  5ANS A;  5ANW A;  1PVF A;  3ZR1 A;  1VHZ A;  3Q91 A;  3GZ6 A;  3ACA A;  3DUP A;  2G73 A;  1V8W A;  3I7V A;  1PPX A;  2CL3 A;  2QJO A;  2DSB A;  3WHW A;  3G0Q A;  3ZR0 A;  4V14 A;  2PQV A;  1SU2 A;  2DSC A;  4KG4 A;  3X0S A;  3OGA A;  4J7H A;  1V8S A;  1SJY A;  2O5W A;  1PUQ A;  3FFU A;  3X0J A;  3GZ5 A;  3U53 A;  2R5W A;  2XSQ A;  3J7Y e;  3HHJ A;  3N9U A;  5FSK A;  1PPW A;  1Q54 A;  2GB5 A;  1IRY A;  2QJT A;  3I7U A;  1F3Y A;  1VC8 A;  1K2E A;  3X0M A;  5DEQ A;  3EF5 A;  5ANT A;  2O1C A;  1VHG A;  5IW4 A;  5I8U A;  3GRN A;  5DPK A;  2DUK A;  3X0N A;  1I9A A;  2B2K A;  3I9X A;  5CFI A;  5C7T A;  1OW2 A;  3O8S A;  5CFJ A;  1NQY A;  1G9Q A;  1RRQ A;  3N77 A;  2ICJ A;  1HX3 A;  4MPO A;  1V8V A;  5FSM A;  2J8Q A;  1NFZ A;  4HFQ A;  4ICK A;  3X0O A;  1TUM A;  1MUT A;  3EXQ A;  2G74 A;  5ISY A;  3KVH A;  1XSA A;  3SMD A;  1V8T A;  1V8L A;  3R03 A;  3Q2S A;  4KYX A;  3F6A A;  1V8M A;  1SOI A;  2B06 A;  2Q9P A;  4NFW A;  5BON A;  2FML A;  3Q2T A;  1MQW A;  5BS6 A;  5FSI A;  3SON A;  3MDI A;  2A6T A;  2I8U A;  4DYW A;  1JRK A;  3HYQ A;  1PPV A;  4KG3 A;  1X51 A;  3L85 A;  3P5T A;  5C7Q A;  5IW5 A;  1RYA A;  1PUS A;  4N1T A;  2FKB A;  3DKU A;  1K26 A;  2RRK A;  1VIQ A;  3X0P A;  1V8U A;  4C9X A;  1QVJ A;  4ZG0 A;  5ANU A;  2I6K A;  3F13 A;  3O61 A;  1MP2 A;  3FJY A;  4YOQ A;  1X84 A;  2A8P A;  3AC9 A;  3BM4 A;  4YPR A;  3A6V A;  4JZV A;  1NQZ A;  4N1U A;  1V8I A;  4J7G A;  4NFX A;  5C8L A;  3FSP A;  3BHO A;  3SHD A;  3X0I A;  3X0Q A;  1KT9 A;  2JVB A;  4JZT A;  1MK1 A;  2KDV A;  3Q93 A;  3MDG A;  3E57 A;  2YVM A;  4YPH A;  2DHO A;  5GHO A;  3GZ8 A;  3EES A;  1U20 A;  2CZR A;  3FK9 A;  5FSL A;  4HVY A;  1VCD A;  3CNG A;  1VK6 A;  1MR2 A;  3MCF A;  3Q4I A;  4S2W A;  2GT2 A;  1XSC A;  1Q33 A;  1XSB A;  2KDW A;  3Q1P A;  1SZ3 A;  2DSD A;  2FVV A;  2GT4 A;  2A8Q A;  2A8R A;  2ICK A;  2QKM B;  3GG6 A;  4K6E A;  1RRS A;  3FCM A;  5GHM A;  3X0K A;  4IJX A;  5GHN A;  4S2Y A;  1KTG A;  4S2V A;  1VRL A;  1MQE A;  1X83 A; 
#chains in the Genus database with same CATH homology
 3X0R A;  3COU A;  5ANV A;  5GHQ A;  5DDG A;  3P6Y A;  2AZW A;  5GHJ A;  1V8R A;  5HZX A;  2YVO A;  2I8T A;  2A8T A;  2PNY A;  5GHP A;  1R67 A;  2VNQ A;  3QSJ A;  5FSN A;  5GHI A;  3O52 A;  1V8N A;  1VIU A;  3A6T A;  2YVP A;  3O69 A;  5DD4 A;  1JKN A;  1GA7 A;  1NFS A;  3H95 A;  3ID9 A;  4KTB A;  2W4E A;  4ILQ A;  4JZS A;  2YYH A;  1V8Y A;  1KHZ A;  2B0V A;  4JZU A;  3A6S A;  2O5F A;  5FSO A;  3GWY A;  2YVN A;  3RH7 A;  3X0L A;  1PUN A;  5LPG A;  4C9W A;  3EEU A;  1VC9 A;  4S2X A;  3O6Z A;  2A8S A;  2VNP A;  3A6U A;  1G0S A;  3BAP A;  1HZT A;  3MGM A;  1Q27 A;  5ANS A;  5ANW A;  1PVF A;  3ZR1 A;  1VHZ A;  3Q91 A;  3GZ6 A;  3ACA A;  3DUP A;  2G73 A;  1V8W A;  3I7V A;  1PPX A;  2CL3 A;  2QJO A;  2DSB A;  3WHW A;  3G0Q A;  3ZR0 A;  4V14 A;  2PQV A;  1SU2 A;  2DSC A;  4KG4 A;  3X0S A;  3OGA A;  4J7H A;  1V8S A;  1SJY A;  2O5W A;  1PUQ A;  3FFU A;  3X0J A;  3GZ5 A;  3U53 A;  2R5W A;  2XSQ A;  3J7Y e;  3HHJ A;  3N9U A;  5FSK A;  1PPW A;  1Q54 A;  2GB5 A;  1IRY A;  2QJT A;  3I7U A;  1F3Y A;  1VC8 A;  1K2E A;  3X0M A;  5DEQ A;  3EF5 A;  5ANT A;  2O1C A;  1VHG A;  5IW4 A;  5I8U A;  3GRN A;  5DPK A;  2DUK A;  3X0N A;  1I9A A;  2B2K A;  3I9X A;  5CFI A;  5C7T A;  1OW2 A;  3O8S A;  5CFJ A;  1NQY A;  1G9Q A;  1RRQ A;  3N77 A;  2ICJ A;  1HX3 A;  4MPO A;  1V8V A;  5FSM A;  2J8Q A;  1NFZ A;  4HFQ A;  4ICK A;  3X0O A;  1TUM A;  1MUT A;  3EXQ A;  2G74 A;  5ISY A;  3KVH A;  1XSA A;  3SMD A;  1V8T A;  1V8L A;  3R03 A;  3Q2S A;  4KYX A;  3F6A A;  1V8M A;  1SOI A;  2B06 A;  2Q9P A;  4NFW A;  5BON A;  2FML A;  3Q2T A;  1MQW A;  5BS6 A;  5FSI A;  3SON A;  3MDI A;  2A6T A;  2I8U A;  4DYW A;  1JRK A;  3HYQ A;  1PPV A;  4KG3 A;  1X51 A;  3L85 A;  3P5T A;  5C7Q A;  5IW5 A;  1RYA A;  1PUS A;  4N1T A;  2FKB A;  3DKU A;  1K26 A;  2RRK A;  1VIQ A;  3X0P A;  1V8U A;  4C9X A;  1QVJ A;  4ZG0 A;  5ANU A;  2I6K A;  3F13 A;  3O61 A;  1MP2 A;  3FJY A;  4YOQ A;  1X84 A;  2A8P A;  3AC9 A;  3BM4 A;  4YPR A;  3A6V A;  4JZV A;  1NQZ A;  4N1U A;  1V8I A;  4J7G A;  4NFX A;  5C8L A;  3FSP A;  3BHO A;  3SHD A;  3X0I A;  3X0Q A;  1KT9 A;  2JVB A;  4JZT A;  1MK1 A;  2KDV A;  3Q93 A;  3MDG A;  3E57 A;  2YVM A;  4YPH A;  2DHO A;  5GHO A;  3GZ8 A;  3EES A;  1U20 A;  2CZR A;  3FK9 A;  5FSL A;  4HVY A;  1VCD A;  3CNG A;  1VK6 A;  1MR2 A;  3MCF A;  3Q4I A;  4S2W A;  2GT2 A;  1XSC A;  1Q33 A;  1XSB A;  2KDW A;  3Q1P A;  1SZ3 A;  2DSD A;  2FVV A;  2GT4 A;  2A8Q A;  2A8R A;  2ICK A;  2QKM B;  3GG6 A;  4K6E A;  1RRS A;  3FCM A;  5GHM A;  3X0K A;  4IJX A;  5GHN A;  4S2Y A;  1KTG A;  4S2V A;  1VRL A;  1MQE A;  1X83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...