3Q91A

Crystal structure of human uridine diphosphate glucose pyrophosphatase (nudt14)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
182
structure length
145
Chain Sequence
THDSVTVLLFNSSRRSLVLVKQFRPAVYAGEVEAGVTVELCAGLVDQPGLSLEEVACKEAWEECGYHLAPSDLRRVATYWSGTGSRQTMFYTEVTDAQRSGELIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLSQVAPNLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine diphosphate glucose pyrophosphatase
publication title Crystal Structure of Human Uridine Diphosphate Glucose Pyrophosphatase (NUDT14)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 39
structure length 145
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.45: UDP-sugar diphosphatase.
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3q91A00
1VIUA 3GZ8A 3SONA 3E57A 1PUSA 1V8TA 1RRQA 2XSQA 1MK1A 4KG3A 5ANUA 3X0MA 1XSCA 2AZWA 1RRSA 3A6VA 5ANTA 2G73A 5DD4A 1V8VA 4S2WA 1NFSA 5ISYA 3CNGA 3P6YA 3G0QA 3SHDA 1Q54A 3N9UA 3U53A 5CFIA 3Q2TA 4JZUA 1V8SA 1U20A 2B06A 2ICJA 2O5FA 1VIQA 3MDIA 3J7Ye 3ZR0A 3MDGA 3O61A 4HFQA 2I8UA 1X83A 1RYAA 2FKBA 3Q1PA 3X0PA 3I7UA 1MQEA 3QSJA 2KDVA 1VK6A 3KVHA 3X0SA 1QVJA 1IRYA 3O69A 3A6UA 1Q33A 2CL3A 1V8RA 2J8QA 4C9WA 4YPRA 2YVMA 1SU2A 2FMLA 2YVPA 5C7TA 1KTGA 5GHOA 1GA7A 3R03A 1V8YA 3DUPA 2R5WA 5ANSA 1NQZA 2B0VA 1G9QA 3COUA 1V8IA 3GZ5A 5GHPA 3EEUA 5C7QA 4ICKA 4KTBA 1V8NA 2I8TA 3EXQA 3Q4IA 3GZ6A 4IJXA 3A6TA 2O5WA 1VHGA 1PPVA 3DKUA 1I9AA 3EESA 2GT2A 3ACAA 2JVBA 3F13A 1SZ3A 3GG6A 2A8TA 3O6ZA 1F3YA 3BHOA 4JZSA 3RH7A 3X0JA 1NQYA 2DSBA 4NFWA 5LPGA 2QJOA 1TUMA 3EF5A 5FSKA 5DPKA 1PPXA 1V8MA 2A8RA 1R67A 4K6EA 1MP2A 3GWYA 1PVFA 2RRKA 3A6SA 1PUNA 2DSCA 3O52A 4JZTA 4MPOA 2DUKA 3Q93A 2I6KA 2GB5A 1MUTA 2Q9PA 3OGAA 3HHJA 4NFXA 5IW5A 2B2KA 2A6TA 1HX3A 4KYXA 3X0OA 4ILQA 5GHJA 4S2VA 2O1CA 2GT4A 3FJYA 2DSDA 5HZXA 3X0LA 1V8LA 2KDWA 1KHZA 2QJTA 2VNPA 1K2EA 1PUQA 1Q27A 2YVOA 3GRNA 3I9XA 1MR2A 2VNQA 3O8SA 4YOQA 3X0KA 3AC9A 1NFZA 3BM4A 5FSIA 4C9XA 1V8UA 4DYWA 1KT9A 5GHMA 3FCMA 2YVNA 3H95A 4N1TA 2DHOA 3WHWA 2G74A 3HYQA 3X0QA 1SOIA 1MQWA 5GHNA 5ANVA 1V8WA 2A8QA 5BS6A 1X84A 5FSNA 3L85A 3N77A 2A8PA 3P5TA 1XSAA 1VC8A 1G0SA 3FK9A 3ZR1A 2QKMB 3MCFA 2PNYA 4N1UA 4YPHA 1HZTA 5C8LA 5DDGA 4V14A 1VC9A 1JRKA 3Q91A 3FSPA 1JKNA 1XSBA 1OW2A 3SMDA 2YYHA 5FSOA 1VCDA 5FSLA 4JZVA 2A8SA 1PPWA 2ICKA 3X0RA 4HVYA 3X0NA 3FFUA 5GHQA 1X51A 3I7VA 5DEQA 5IW4A 3X0IA 1SJYA 2PQVA 4ZG0A 5FSMA 4S2XA 5ANWA 3ID9A 1VRLA 5I8UA 3MGMA 4KG4A 5BONA 5CFJA 3BAPA 1K26A 2FVVA 3F6AA 3Q2SA 1VHZA 5GHIA 4S2YA 2W4EA
chains in the Genus database with same CATH superfamily
1VIUA 3GZ8A 4J7HA 3SONA 3E57A 1PUSA 1V8TA 1RRQA 2XSQA 1MK1A 4KG3A 5ANUA 3X0MA 1XSCA 2AZWA 4J7GA 1RRSA 3A6VA 5ANTA 2G73A 5DD4A 1V8VA 4S2WA 1NFSA 5ISYA 3CNGA 3P6YA 3G0QA 3SHDA 1Q54A 3N9UA 3U53A 5CFIA 3Q2TA 4JZUA 1V8SA 1U20A 2B06A 2ICJA 2O5FA 1VIQA 3MDIA 3J7Ye 3ZR0A 3MDGA 3O61A 4HFQA 2I8UA 1X83A 1RYAA 2FKBA 3Q1PA 3X0PA 3I7UA 1MQEA 3QSJA 2KDVA 1VK6A 3KVHA 3X0SA 1QVJA 1IRYA 3O69A 3A6UA 1Q33A 2CL3A 1V8RA 2J8QA 4C9WA 4YPRA 2YVMA 1SU2A 2FMLA 2YVPA 5C7TA 1KTGA 5GHOA 1GA7A 3R03A 1V8YA 2CZRA 3DUPA 2R5WA 5ANSA 1NQZA 2B0VA 1G9QA 3COUA 1V8IA 3GZ5A 5GHPA 3EEUA 5C7QA 4ICKA 4KTBA 1V8NA 2I8TA 3EXQA 3Q4IA 3GZ6A 4IJXA 3A6TA 2O5WA 1VHGA 1PPVA 3DKUA 1I9AA 3EESA 2GT2A 3ACAA 2JVBA 3F13A 1SZ3A 3GG6A 2A8TA 3O6ZA 1F3YA 3BHOA 4JZSA 3RH7A 3X0JA 1NQYA 2DSBA 4NFWA 5LPGA 2QJOA 1TUMA 3EF5A 5FSKA 5DPKA 1PPXA 1V8MA 2A8RA 1R67A 4K6EA 1MP2A 3GWYA 1PVFA 2RRKA 3A6SA 1PUNA 2DSCA 3O52A 4JZTA 4MPOA 2DUKA 3Q93A 2I6KA 2GB5A 1MUTA 2Q9PA 3OGAA 3HHJA 4NFXA 5IW5A 2B2KA 2A6TA 1HX3A 4KYXA 3X0OA 4ILQA 5GHJA 4S2VA 2O1CA 2GT4A 3FJYA 2DSDA 5HZXA 3X0LA 1V8LA 2KDWA 1KHZA 2QJTA 2VNPA 1K2EA 1PUQA 1Q27A 2YVOA 3GRNA 3I9XA 1MR2A 2VNQA 3O8SA 4YOQA 3X0KA 3AC9A 1NFZA 3BM4A 5FSIA 4C9XA 1V8UA 4DYWA 1KT9A 5GHMA 3FCMA 2YVNA 3H95A 4N1TA 2DHOA 3WHWA 2G74A 3HYQA 3X0QA 1SOIA 1MQWA 5GHNA 5ANVA 1V8WA 2A8QA 5BS6A 1X84A 5FSNA 3L85A 3N77A 2A8PA 3P5TA 1XSAA 1VC8A 1G0SA 3FK9A 3ZR1A 2QKMB 3MCFA 2PNYA 4N1UA 4YPHA 1HZTA 5C8LA 5DDGA 4V14A 1VC9A 1JRKA 3Q91A 3FSPA 1JKNA 1XSBA 1OW2A 3SMDA 2YYHA 5FSOA 1VCDA 5FSLA 4JZVA 2A8SA 1PPWA 2ICKA 3X0RA 4HVYA 3X0NA 3FFUA 5GHQA 1X51A 3I7VA 5DEQA 5IW4A 3X0IA 1SJYA 2PQVA 4ZG0A 5FSMA 4S2XA 5ANWA 3ID9A 1VRLA 5I8UA 3MGMA 4KG4A 5BONA 5CFJA 3BAPA 1K26A 2FVVA 3F6AA 3Q2SA 1VHZA 5GHIA 4S2YA 2W4EA
chains in the Genus database with same CATH topology
1VIUA 3GZ8A 4J7HA 3SONA 3E57A 1PUSA 1V8TA 1RRQA 2XSQA 1MK1A 4KG3A 5ANUA 3X0MA 1XSCA 2AZWA 4J7GA 1RRSA 3A6VA 5ANTA 2G73A 5DD4A 1V8VA 4S2WA 1NFSA 5ISYA 3CNGA 3P6YA 3G0QA 3SHDA 1Q54A 3N9UA 3U53A 5CFIA 3Q2TA 4JZUA 1V8SA 1U20A 2B06A 2ICJA 2O5FA 1VIQA 3MDIA 3J7Ye 3ZR0A 3MDGA 3O61A 4HFQA 2I8UA 1X83A 1RYAA 2FKBA 3Q1PA 3X0PA 3I7UA 1MQEA 3QSJA 2KDVA 1VK6A 3KVHA 3X0SA 1QVJA 1IRYA 3O69A 3A6UA 1Q33A 2CL3A 1V8RA 2J8QA 4C9WA 4YPRA 2YVMA 1SU2A 2FMLA 2YVPA 5C7TA 1KTGA 5GHOA 1GA7A 3R03A 1V8YA 2CZRA 3DUPA 2R5WA 5ANSA 1NQZA 2B0VA 1G9QA 3COUA 1V8IA 3GZ5A 5GHPA 3EEUA 5C7QA 4ICKA 4KTBA 1V8NA 2I8TA 3EXQA 3Q4IA 3GZ6A 4IJXA 3A6TA 2O5WA 1VHGA 1PPVA 3DKUA 1I9AA 3EESA 2GT2A 3ACAA 2JVBA 3F13A 1SZ3A 3GG6A 2A8TA 3O6ZA 1F3YA 3BHOA 4JZSA 3RH7A 3X0JA 1NQYA 2DSBA 4NFWA 5LPGA 2QJOA 1TUMA 3EF5A 5FSKA 5DPKA 1PPXA 1V8MA 2A8RA 1R67A 4K6EA 1MP2A 3GWYA 1PVFA 2RRKA 3A6SA 1PUNA 2DSCA 3O52A 4JZTA 4MPOA 2DUKA 3Q93A 2I6KA 2GB5A 1MUTA 2Q9PA 3OGAA 3HHJA 4NFXA 5IW5A 2B2KA 2A6TA 1HX3A 4KYXA 3X0OA 4ILQA 5GHJA 4S2VA 2O1CA 2GT4A 3FJYA 2DSDA 5HZXA 3X0LA 1V8LA 2KDWA 1KHZA 2QJTA 2VNPA 1K2EA 1PUQA 1Q27A 2YVOA 3GRNA 3I9XA 1MR2A 2VNQA 3O8SA 4YOQA 3X0KA 3AC9A 1NFZA 3BM4A 5FSIA 4C9XA 1V8UA 4DYWA 1KT9A 5GHMA 3FCMA 2YVNA 3H95A 4N1TA 2DHOA 3WHWA 2G74A 3HYQA 3X0QA 1SOIA 1MQWA 5GHNA 5ANVA 1V8WA 2A8QA 5BS6A 1X84A 5FSNA 3L85A 3N77A 2A8PA 3P5TA 1XSAA 1VC8A 1G0SA 3FK9A 3ZR1A 2QKMB 3MCFA 2PNYA 4N1UA 4YPHA 1HZTA 5C8LA 5DDGA 4V14A 1VC9A 1JRKA 3Q91A 3FSPA 1JKNA 1XSBA 1OW2A 3SMDA 2YYHA 5FSOA 1VCDA 5FSLA 4JZVA 2A8SA 1PPWA 2ICKA 3X0RA 4HVYA 3X0NA 3FFUA 5GHQA 1X51A 3I7VA 5DEQA 5IW4A 3X0IA 1SJYA 2PQVA 4ZG0A 5FSMA 4S2XA 5ANWA 3ID9A 1VRLA 5I8UA 3MGMA 4KG4A 5BONA 5CFJA 3BAPA 1K26A 2FVVA 3F6AA 3Q2SA 1VHZA 5GHIA 4S2YA 2W4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIU A;  3GZ8 A;  3SON A;  3E57 A;  1PUS A;  1V8T A;  1RRQ A;  2XSQ A;  1MK1 A;  4KG3 A;  5ANU A;  3X0M A;  1XSC A;  2AZW A;  1RRS A;  3A6V A;  5ANT A;  2G73 A;  5DD4 A;  1V8V A;  4S2W A;  1NFS A;  5ISY A;  3CNG A;  3P6Y A;  3G0Q A;  3SHD A;  1Q54 A;  3N9U A;  3U53 A;  5CFI A;  3Q2T A;  4JZU A;  1V8S A;  1U20 A;  2B06 A;  2ICJ A;  2O5F A;  1VIQ A;  3MDI A;  3J7Y e;  3ZR0 A;  3MDG A;  3O61 A;  4HFQ A;  2I8U A;  1X83 A;  1RYA A;  2FKB A;  3Q1P A;  3X0P A;  3I7U A;  1MQE A;  3QSJ A;  2KDV A;  1VK6 A;  3KVH A;  3X0S A;  1QVJ A;  1IRY A;  3O69 A;  3A6U A;  1Q33 A;  2CL3 A;  1V8R A;  2J8Q A;  4C9W A;  4YPR A;  2YVM A;  1SU2 A;  2FML A;  2YVP A;  5C7T A;  1KTG A;  5GHO A;  1GA7 A;  3R03 A;  1V8Y A;  3DUP A;  2R5W A;  5ANS A;  1NQZ A;  2B0V A;  1G9Q A;  3COU A;  1V8I A;  3GZ5 A;  5GHP A;  3EEU A;  5C7Q A;  4ICK A;  4KTB A;  1V8N A;  2I8T A;  3EXQ A;  3Q4I A;  3GZ6 A;  4IJX A;  3A6T A;  2O5W A;  1VHG A;  1PPV A;  3DKU A;  1I9A A;  3EES A;  2GT2 A;  3ACA A;  2JVB A;  3F13 A;  1SZ3 A;  3GG6 A;  2A8T A;  3O6Z A;  1F3Y A;  3BHO A;  4JZS A;  3RH7 A;  3X0J A;  1NQY A;  2DSB A;  4NFW A;  5LPG A;  2QJO A;  1TUM A;  3EF5 A;  5FSK A;  5DPK A;  1PPX A;  1V8M A;  2A8R A;  1R67 A;  4K6E A;  1MP2 A;  3GWY A;  1PVF A;  2RRK A;  3A6S A;  1PUN A;  2DSC A;  3O52 A;  4JZT A;  4MPO A;  2DUK A;  3Q93 A;  2I6K A;  2GB5 A;  1MUT A;  2Q9P A;  3OGA A;  3HHJ A;  4NFX A;  5IW5 A;  2B2K A;  2A6T A;  1HX3 A;  4KYX A;  3X0O A;  4ILQ A;  5GHJ A;  4S2V A;  2O1C A;  2GT4 A;  3FJY A;  2DSD A;  5HZX A;  3X0L A;  1V8L A;  2KDW A;  1KHZ A;  2QJT A;  2VNP A;  1K2E A;  1PUQ A;  1Q27 A;  2YVO A;  3GRN A;  3I9X A;  1MR2 A;  2VNQ A;  3O8S A;  4YOQ A;  3X0K A;  3AC9 A;  1NFZ A;  3BM4 A;  5FSI A;  4C9X A;  1V8U A;  4DYW A;  1KT9 A;  5GHM A;  3FCM A;  2YVN A;  3H95 A;  4N1T A;  2DHO A;  3WHW A;  2G74 A;  3HYQ A;  3X0Q A;  1SOI A;  1MQW A;  5GHN A;  5ANV A;  1V8W A;  2A8Q A;  5BS6 A;  1X84 A;  5FSN A;  3L85 A;  3N77 A;  2A8P A;  3P5T A;  1XSA A;  1VC8 A;  1G0S A;  3FK9 A;  3ZR1 A;  2QKM B;  3MCF A;  2PNY A;  4N1U A;  4YPH A;  1HZT A;  5C8L A;  5DDG A;  4V14 A;  1VC9 A;  1JRK A;  3Q91 A;  3FSP A;  1JKN A;  1XSB A;  1OW2 A;  3SMD A;  2YYH A;  5FSO A;  1VCD A;  5FSL A;  4JZV A;  2A8S A;  1PPW A;  2ICK A;  3X0R A;  4HVY A;  3X0N A;  3FFU A;  5GHQ A;  1X51 A;  3I7V A;  5DEQ A;  5IW4 A;  3X0I A;  1SJY A;  2PQV A;  4ZG0 A;  5FSM A;  4S2X A;  5ANW A;  3ID9 A;  1VRL A;  5I8U A;  3MGM A;  4KG4 A;  5BON A;  5CFJ A;  3BAP A;  1K26 A;  2FVV A;  3F6A A;  3Q2S A;  1VHZ A;  5GHI A;  4S2Y A;  2W4E A; 
#chains in the Genus database with same CATH topology
 1VIU A;  3GZ8 A;  4J7H A;  3SON A;  3E57 A;  1PUS A;  1V8T A;  1RRQ A;  2XSQ A;  1MK1 A;  4KG3 A;  5ANU A;  3X0M A;  1XSC A;  2AZW A;  4J7G A;  1RRS A;  3A6V A;  5ANT A;  2G73 A;  5DD4 A;  1V8V A;  4S2W A;  1NFS A;  5ISY A;  3CNG A;  3P6Y A;  3G0Q A;  3SHD A;  1Q54 A;  3N9U A;  3U53 A;  5CFI A;  3Q2T A;  4JZU A;  1V8S A;  1U20 A;  2B06 A;  2ICJ A;  2O5F A;  1VIQ A;  3MDI A;  3J7Y e;  3ZR0 A;  3MDG A;  3O61 A;  4HFQ A;  2I8U A;  1X83 A;  1RYA A;  2FKB A;  3Q1P A;  3X0P A;  3I7U A;  1MQE A;  3QSJ A;  2KDV A;  1VK6 A;  3KVH A;  3X0S A;  1QVJ A;  1IRY A;  3O69 A;  3A6U A;  1Q33 A;  2CL3 A;  1V8R A;  2J8Q A;  4C9W A;  4YPR A;  2YVM A;  1SU2 A;  2FML A;  2YVP A;  5C7T A;  1KTG A;  5GHO A;  1GA7 A;  3R03 A;  1V8Y A;  2CZR A;  3DUP A;  2R5W A;  5ANS A;  1NQZ A;  2B0V A;  1G9Q A;  3COU A;  1V8I A;  3GZ5 A;  5GHP A;  3EEU A;  5C7Q A;  4ICK A;  4KTB A;  1V8N A;  2I8T A;  3EXQ A;  3Q4I A;  3GZ6 A;  4IJX A;  3A6T A;  2O5W A;  1VHG A;  1PPV A;  3DKU A;  1I9A A;  3EES A;  2GT2 A;  3ACA A;  2JVB A;  3F13 A;  1SZ3 A;  3GG6 A;  2A8T A;  3O6Z A;  1F3Y A;  3BHO A;  4JZS A;  3RH7 A;  3X0J A;  1NQY A;  2DSB A;  4NFW A;  5LPG A;  2QJO A;  1TUM A;  3EF5 A;  5FSK A;  5DPK A;  1PPX A;  1V8M A;  2A8R A;  1R67 A;  4K6E A;  1MP2 A;  3GWY A;  1PVF A;  2RRK A;  3A6S A;  1PUN A;  2DSC A;  3O52 A;  4JZT A;  4MPO A;  2DUK A;  3Q93 A;  2I6K A;  2GB5 A;  1MUT A;  2Q9P A;  3OGA A;  3HHJ A;  4NFX A;  5IW5 A;  2B2K A;  2A6T A;  1HX3 A;  4KYX A;  3X0O A;  4ILQ A;  5GHJ A;  4S2V A;  2O1C A;  2GT4 A;  3FJY A;  2DSD A;  5HZX A;  3X0L A;  1V8L A;  2KDW A;  1KHZ A;  2QJT A;  2VNP A;  1K2E A;  1PUQ A;  1Q27 A;  2YVO A;  3GRN A;  3I9X A;  1MR2 A;  2VNQ A;  3O8S A;  4YOQ A;  3X0K A;  3AC9 A;  1NFZ A;  3BM4 A;  5FSI A;  4C9X A;  1V8U A;  4DYW A;  1KT9 A;  5GHM A;  3FCM A;  2YVN A;  3H95 A;  4N1T A;  2DHO A;  3WHW A;  2G74 A;  3HYQ A;  3X0Q A;  1SOI A;  1MQW A;  5GHN A;  5ANV A;  1V8W A;  2A8Q A;  5BS6 A;  1X84 A;  5FSN A;  3L85 A;  3N77 A;  2A8P A;  3P5T A;  1XSA A;  1VC8 A;  1G0S A;  3FK9 A;  3ZR1 A;  2QKM B;  3MCF A;  2PNY A;  4N1U A;  4YPH A;  1HZT A;  5C8L A;  5DDG A;  4V14 A;  1VC9 A;  1JRK A;  3Q91 A;  3FSP A;  1JKN A;  1XSB A;  1OW2 A;  3SMD A;  2YYH A;  5FSO A;  1VCD A;  5FSL A;  4JZV A;  2A8S A;  1PPW A;  2ICK A;  3X0R A;  4HVY A;  3X0N A;  3FFU A;  5GHQ A;  1X51 A;  3I7V A;  5DEQ A;  5IW4 A;  3X0I A;  1SJY A;  2PQV A;  4ZG0 A;  5FSM A;  4S2X A;  5ANW A;  3ID9 A;  1VRL A;  5I8U A;  3MGM A;  4KG4 A;  5BON A;  5CFJ A;  3BAP A;  1K26 A;  2FVV A;  3F6A A;  3Q2S A;  1VHZ A;  5GHI A;  4S2Y A;  2W4E A; 
#chains in the Genus database with same CATH homology
 1VIU A;  3GZ8 A;  4J7H A;  3SON A;  3E57 A;  1PUS A;  1V8T A;  1RRQ A;  2XSQ A;  1MK1 A;  4KG3 A;  5ANU A;  3X0M A;  1XSC A;  2AZW A;  4J7G A;  1RRS A;  3A6V A;  5ANT A;  2G73 A;  5DD4 A;  1V8V A;  4S2W A;  1NFS A;  5ISY A;  3CNG A;  3P6Y A;  3G0Q A;  3SHD A;  1Q54 A;  3N9U A;  3U53 A;  5CFI A;  3Q2T A;  4JZU A;  1V8S A;  1U20 A;  2B06 A;  2ICJ A;  2O5F A;  1VIQ A;  3MDI A;  3J7Y e;  3ZR0 A;  3MDG A;  3O61 A;  4HFQ A;  2I8U A;  1X83 A;  1RYA A;  2FKB A;  3Q1P A;  3X0P A;  3I7U A;  1MQE A;  3QSJ A;  2KDV A;  1VK6 A;  3KVH A;  3X0S A;  1QVJ A;  1IRY A;  3O69 A;  3A6U A;  1Q33 A;  2CL3 A;  1V8R A;  2J8Q A;  4C9W A;  4YPR A;  2YVM A;  1SU2 A;  2FML A;  2YVP A;  5C7T A;  1KTG A;  5GHO A;  1GA7 A;  3R03 A;  1V8Y A;  2CZR A;  3DUP A;  2R5W A;  5ANS A;  1NQZ A;  2B0V A;  1G9Q A;  3COU A;  1V8I A;  3GZ5 A;  5GHP A;  3EEU A;  5C7Q A;  4ICK A;  4KTB A;  1V8N A;  2I8T A;  3EXQ A;  3Q4I A;  3GZ6 A;  4IJX A;  3A6T A;  2O5W A;  1VHG A;  1PPV A;  3DKU A;  1I9A A;  3EES A;  2GT2 A;  3ACA A;  2JVB A;  3F13 A;  1SZ3 A;  3GG6 A;  2A8T A;  3O6Z A;  1F3Y A;  3BHO A;  4JZS A;  3RH7 A;  3X0J A;  1NQY A;  2DSB A;  4NFW A;  5LPG A;  2QJO A;  1TUM A;  3EF5 A;  5FSK A;  5DPK A;  1PPX A;  1V8M A;  2A8R A;  1R67 A;  4K6E A;  1MP2 A;  3GWY A;  1PVF A;  2RRK A;  3A6S A;  1PUN A;  2DSC A;  3O52 A;  4JZT A;  4MPO A;  2DUK A;  3Q93 A;  2I6K A;  2GB5 A;  1MUT A;  2Q9P A;  3OGA A;  3HHJ A;  4NFX A;  5IW5 A;  2B2K A;  2A6T A;  1HX3 A;  4KYX A;  3X0O A;  4ILQ A;  5GHJ A;  4S2V A;  2O1C A;  2GT4 A;  3FJY A;  2DSD A;  5HZX A;  3X0L A;  1V8L A;  2KDW A;  1KHZ A;  2QJT A;  2VNP A;  1K2E A;  1PUQ A;  1Q27 A;  2YVO A;  3GRN A;  3I9X A;  1MR2 A;  2VNQ A;  3O8S A;  4YOQ A;  3X0K A;  3AC9 A;  1NFZ A;  3BM4 A;  5FSI A;  4C9X A;  1V8U A;  4DYW A;  1KT9 A;  5GHM A;  3FCM A;  2YVN A;  3H95 A;  4N1T A;  2DHO A;  3WHW A;  2G74 A;  3HYQ A;  3X0Q A;  1SOI A;  1MQW A;  5GHN A;  5ANV A;  1V8W A;  2A8Q A;  5BS6 A;  1X84 A;  5FSN A;  3L85 A;  3N77 A;  2A8P A;  3P5T A;  1XSA A;  1VC8 A;  1G0S A;  3FK9 A;  3ZR1 A;  2QKM B;  3MCF A;  2PNY A;  4N1U A;  4YPH A;  1HZT A;  5C8L A;  5DDG A;  4V14 A;  1VC9 A;  1JRK A;  3Q91 A;  3FSP A;  1JKN A;  1XSB A;  1OW2 A;  3SMD A;  2YYH A;  5FSO A;  1VCD A;  5FSL A;  4JZV A;  2A8S A;  1PPW A;  2ICK A;  3X0R A;  4HVY A;  3X0N A;  3FFU A;  5GHQ A;  1X51 A;  3I7V A;  5DEQ A;  5IW4 A;  3X0I A;  1SJY A;  2PQV A;  4ZG0 A;  5FSM A;  4S2X A;  5ANW A;  3ID9 A;  1VRL A;  5I8U A;  3MGM A;  4KG4 A;  5BON A;  5CFJ A;  3BAP A;  1K26 A;  2FVV A;  3F6A A;  3Q2S A;  1VHZ A;  5GHI A;  4S2Y A;  2W4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...