3Q93A

Crystal structure of human 8-oxo-dgtpase (mth1)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
154
structure length
154
Chain Sequence
ASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-dihydro-8-oxoguanine triphosphatase
publication title Crystal Structure of Human 8-oxo-dGTPase (MTH1)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 41
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3q93A00
3Q2SA 3X0NA 2QJTA 3A6TA 4JZVA 3FCMA 4JZUA 3A6VA 1VCDA 2A8TA 3BHOA 5GHQA 3X0SA 4C9WA 1IRYA 1NFZA 1V8UA 3FFUA 4N1UA 1VRLA 1U20A 1MP2A 1QVJA 3EXQA 3I7UA 4MPOA 4V14A 2DHOA 2QKMB 4S2VA 3O8SA 3GZ8A 3DKUA 3X0IA 2I8UA 3GZ5A 4YPHA 3ZR1A 3EF5A 4KG4A 3Q4IA 5DPKA 5FSIA 1VC8A 2CL3A 2DSBA 1PPWA 3CNGA 3EEUA 2KDWA 3P5TA 3X0RA 3ID9A 2FVVA 3J7Ye 3DUPA 1NQZA 1VC9A 2YVOA 5GHNA 1VIQA 2YYHA 5I8UA 3X0OA 2DUKA 2G73A 3COUA 2JVBA 2YVPA 1K26A 3BAPA 5FSKA 5GHJA 5FSNA 1K2EA 3Q91A 3GG6A 2GT4A 2J8QA 3F6AA 2A8PA 1MQWA 1V8SA 2PNYA 1KTGA 3A6UA 4K6EA 5LPGA 4HFQA 1PUQA 1NFSA 1PVFA 3N9UA 1G9QA 1V8YA 1X51A 1HX3A 4KTBA 4NFXA 3GWYA 3ZR0A 4HVYA 1VK6A 3MDGA 1V8LA 2A8QA 4S2WA 3SMDA 1TUMA 3I9XA 3OGAA 1OW2A 2I6KA 2B0VA 5C8LA 1R67A 1RRQA 5IW5A 2VNPA 2B2KA 3EESA 3X0LA 1F3YA 3HHJA 3BM4A 4JZSA 3O6ZA 1G0SA 4C9XA 1MK1A 2PQVA 5GHMA 3MGMA 3RH7A 1SU2A 3R03A 2ICJA 1Q54A 3KVHA 1KHZA 4KYXA 1JRKA 2G74A 1X84A 5GHPA 4S2XA 3U53A 1VIUA 1KT9A 3P6YA 5ANTA 1PUSA 5ISYA 1NQYA 3MDIA 4NFWA 3FJYA 2I8TA 5DD4A 5C7TA 5C7QA 1I9AA 1V8NA 3O61A 1PUNA 2DSCA 5ANUA 2RRKA 5ANWA 3FSPA 3AC9A 3O52A 2VNQA 1MR2A 1XSBA 3I7VA 2AZWA 1Q27A 3X0PA 2O5FA 2FKBA 3MCFA 3Q93A 3X0KA 1SJYA 1V8TA 1V8IA 2B06A 4ZG0A 3X0MA 4S2YA 2DSDA 3GRNA 5HZXA 1RRSA 1XSCA 2KDVA 1V8MA 2A6TA 5ANSA 2QJOA 1SZ3A 2XSQA 5GHOA 3SONA 4KG3A 2R5WA 3H95A 4YOQA 1V8WA 2GB5A 1JKNA 1VHZA 3FK9A 3X0JA 1GA7A 1VHGA 4N1TA 2A8SA 1HZTA 3X0QA 5BONA 5GHIA 2O1CA 3E57A 3N77A 3G0QA 5FSLA 5DEQA 1MQEA 5ANVA 1PPXA 3Q2TA 4ICKA 1XSAA 2YVNA 1X83A 3A6SA 2YVMA 4ILQA 1MUTA 3F13A 3L85A 2FMLA 3QSJA 1V8VA 5BS6A 5FSOA 2O5WA 2ICKA 1Q33A 2Q9PA 2A8RA 1PPVA 5CFIA 5CFJA 1V8RA 5FSMA 1SOIA 2GT2A 4DYWA 1RYAA 3Q1PA 3WHWA 5DDGA 2W4EA 3ACAA 4YPRA 3HYQA 3O69A 3SHDA 5IW4A 4IJXA 3GZ6A 4JZTA
chains in the Genus database with same CATH superfamily
3Q2SA 3X0NA 2QJTA 3A6TA 4JZVA 3FCMA 4JZUA 3A6VA 1VCDA 2A8TA 3BHOA 5GHQA 3X0SA 4C9WA 1IRYA 1NFZA 1V8UA 3FFUA 4N1UA 1VRLA 1U20A 1MP2A 1QVJA 3EXQA 3I7UA 4MPOA 4V14A 2DHOA 2QKMB 4S2VA 3O8SA 3GZ8A 3DKUA 3X0IA 2I8UA 3GZ5A 4YPHA 3ZR1A 3EF5A 4KG4A 3Q4IA 5DPKA 5FSIA 1VC8A 2CL3A 2DSBA 1PPWA 3CNGA 4J7HA 3EEUA 2KDWA 3P5TA 3X0RA 4J7GA 3ID9A 2FVVA 3J7Ye 3DUPA 1NQZA 1VC9A 2YVOA 5GHNA 1VIQA 2YYHA 5I8UA 3X0OA 2DUKA 2G73A 3COUA 2JVBA 2YVPA 1K26A 3BAPA 5FSKA 5GHJA 5FSNA 1K2EA 3Q91A 3GG6A 2GT4A 2J8QA 3F6AA 2A8PA 1MQWA 1V8SA 2PNYA 1KTGA 3A6UA 4K6EA 5LPGA 4HFQA 1PUQA 1NFSA 1PVFA 3N9UA 1G9QA 1V8YA 1X51A 1HX3A 4KTBA 4NFXA 3GWYA 3ZR0A 4HVYA 1VK6A 3MDGA 1V8LA 2A8QA 4S2WA 3SMDA 1TUMA 3I9XA 3OGAA 1OW2A 2I6KA 2B0VA 5C8LA 1R67A 1RRQA 5IW5A 2VNPA 2B2KA 3EESA 3X0LA 1F3YA 3HHJA 3BM4A 4JZSA 3O6ZA 1G0SA 4C9XA 1MK1A 2PQVA 5GHMA 3MGMA 3RH7A 1SU2A 3R03A 2ICJA 1Q54A 3KVHA 1KHZA 4KYXA 1JRKA 2G74A 1X84A 5GHPA 4S2XA 3U53A 1VIUA 1KT9A 3P6YA 5ANTA 1PUSA 5ISYA 1NQYA 3MDIA 4NFWA 3FJYA 2I8TA 5DD4A 5C7TA 5C7QA 1I9AA 1V8NA 3O61A 1PUNA 2DSCA 5ANUA 2RRKA 5ANWA 3FSPA 3AC9A 3O52A 2VNQA 1MR2A 2CZRA 1XSBA 3I7VA 2AZWA 1Q27A 3X0PA 2O5FA 2FKBA 3MCFA 3Q93A 3X0KA 1SJYA 1V8TA 1V8IA 2B06A 4ZG0A 3X0MA 4S2YA 2DSDA 3GRNA 5HZXA 1RRSA 1XSCA 2KDVA 1V8MA 2A6TA 5ANSA 2QJOA 1SZ3A 2XSQA 5GHOA 3SONA 4KG3A 2R5WA 3H95A 4YOQA 1V8WA 2GB5A 1JKNA 1VHZA 3FK9A 3X0JA 1GA7A 1VHGA 4N1TA 2A8SA 1HZTA 3X0QA 5BONA 5GHIA 2O1CA 3E57A 3N77A 3G0QA 5FSLA 5DEQA 1MQEA 5ANVA 1PPXA 3Q2TA 4ICKA 1XSAA 2YVNA 1X83A 3A6SA 2YVMA 4ILQA 1MUTA 3F13A 3L85A 2FMLA 3QSJA 1V8VA 5BS6A 5FSOA 2O5WA 2ICKA 1Q33A 2Q9PA 2A8RA 1PPVA 5CFIA 5CFJA 1V8RA 5FSMA 1SOIA 2GT2A 4DYWA 1RYAA 3Q1PA 3WHWA 5DDGA 2W4EA 3ACAA 4YPRA 3HYQA 3O69A 3SHDA 5IW4A 4IJXA 3GZ6A 4JZTA
chains in the Genus database with same CATH topology
3Q2SA 3X0NA 2QJTA 3A6TA 4JZVA 3FCMA 4JZUA 3A6VA 1VCDA 2A8TA 3BHOA 5GHQA 3X0SA 4C9WA 1IRYA 1NFZA 1V8UA 3FFUA 4N1UA 1VRLA 1U20A 1MP2A 1QVJA 3EXQA 3I7UA 4MPOA 4V14A 2DHOA 2QKMB 4S2VA 3O8SA 3GZ8A 3DKUA 3X0IA 2I8UA 3GZ5A 4YPHA 3ZR1A 3EF5A 4KG4A 3Q4IA 5DPKA 5FSIA 1VC8A 2CL3A 2DSBA 1PPWA 3CNGA 4J7HA 3EEUA 2KDWA 3P5TA 3X0RA 4J7GA 3ID9A 2FVVA 3J7Ye 3DUPA 1NQZA 1VC9A 2YVOA 5GHNA 1VIQA 2YYHA 5I8UA 3X0OA 2DUKA 2G73A 3COUA 2JVBA 2YVPA 1K26A 3BAPA 5FSKA 5GHJA 5FSNA 1K2EA 3Q91A 3GG6A 2GT4A 2J8QA 3F6AA 2A8PA 1MQWA 1V8SA 2PNYA 1KTGA 3A6UA 4K6EA 5LPGA 4HFQA 1PUQA 1NFSA 1PVFA 3N9UA 1G9QA 1V8YA 1X51A 1HX3A 4KTBA 4NFXA 3GWYA 3ZR0A 4HVYA 1VK6A 3MDGA 1V8LA 2A8QA 4S2WA 3SMDA 1TUMA 3I9XA 3OGAA 1OW2A 2I6KA 2B0VA 5C8LA 1R67A 1RRQA 5IW5A 2VNPA 2B2KA 3EESA 3X0LA 1F3YA 3HHJA 3BM4A 4JZSA 3O6ZA 1G0SA 4C9XA 1MK1A 2PQVA 5GHMA 3MGMA 3RH7A 1SU2A 3R03A 2ICJA 1Q54A 3KVHA 1KHZA 4KYXA 1JRKA 2G74A 1X84A 5GHPA 4S2XA 3U53A 1VIUA 1KT9A 3P6YA 5ANTA 1PUSA 5ISYA 1NQYA 3MDIA 4NFWA 3FJYA 2I8TA 5DD4A 5C7TA 5C7QA 1I9AA 1V8NA 3O61A 1PUNA 2DSCA 5ANUA 2RRKA 5ANWA 3FSPA 3AC9A 3O52A 2VNQA 1MR2A 2CZRA 1XSBA 3I7VA 2AZWA 1Q27A 3X0PA 2O5FA 2FKBA 3MCFA 3Q93A 3X0KA 1SJYA 1V8TA 1V8IA 2B06A 4ZG0A 3X0MA 4S2YA 2DSDA 3GRNA 5HZXA 1RRSA 1XSCA 2KDVA 1V8MA 2A6TA 5ANSA 2QJOA 1SZ3A 2XSQA 5GHOA 3SONA 4KG3A 2R5WA 3H95A 4YOQA 1V8WA 2GB5A 1JKNA 1VHZA 3FK9A 3X0JA 1GA7A 1VHGA 4N1TA 2A8SA 1HZTA 3X0QA 5BONA 5GHIA 2O1CA 3E57A 3N77A 3G0QA 5FSLA 5DEQA 1MQEA 5ANVA 1PPXA 3Q2TA 4ICKA 1XSAA 2YVNA 1X83A 3A6SA 2YVMA 4ILQA 1MUTA 3F13A 3L85A 2FMLA 3QSJA 1V8VA 5BS6A 5FSOA 2O5WA 2ICKA 1Q33A 2Q9PA 2A8RA 1PPVA 5CFIA 5CFJA 1V8RA 5FSMA 1SOIA 2GT2A 4DYWA 1RYAA 3Q1PA 3WHWA 5DDGA 2W4EA 3ACAA 4YPRA 3HYQA 3O69A 3SHDA 5IW4A 4IJXA 3GZ6A 4JZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2S A;  3X0N A;  2QJT A;  3A6T A;  4JZV A;  3FCM A;  4JZU A;  3A6V A;  1VCD A;  2A8T A;  3BHO A;  5GHQ A;  3X0S A;  4C9W A;  1IRY A;  1NFZ A;  1V8U A;  3FFU A;  4N1U A;  1VRL A;  1U20 A;  1MP2 A;  1QVJ A;  3EXQ A;  3I7U A;  4MPO A;  4V14 A;  2DHO A;  2QKM B;  4S2V A;  3O8S A;  3GZ8 A;  3DKU A;  3X0I A;  2I8U A;  3GZ5 A;  4YPH A;  3ZR1 A;  3EF5 A;  4KG4 A;  3Q4I A;  5DPK A;  5FSI A;  1VC8 A;  2CL3 A;  2DSB A;  1PPW A;  3CNG A;  3EEU A;  2KDW A;  3P5T A;  3X0R A;  3ID9 A;  2FVV A;  3J7Y e;  3DUP A;  1NQZ A;  1VC9 A;  2YVO A;  5GHN A;  1VIQ A;  2YYH A;  5I8U A;  3X0O A;  2DUK A;  2G73 A;  3COU A;  2JVB A;  2YVP A;  1K26 A;  3BAP A;  5FSK A;  5GHJ A;  5FSN A;  1K2E A;  3Q91 A;  3GG6 A;  2GT4 A;  2J8Q A;  3F6A A;  2A8P A;  1MQW A;  1V8S A;  2PNY A;  1KTG A;  3A6U A;  4K6E A;  5LPG A;  4HFQ A;  1PUQ A;  1NFS A;  1PVF A;  3N9U A;  1G9Q A;  1V8Y A;  1X51 A;  1HX3 A;  4KTB A;  4NFX A;  3GWY A;  3ZR0 A;  4HVY A;  1VK6 A;  3MDG A;  1V8L A;  2A8Q A;  4S2W A;  3SMD A;  1TUM A;  3I9X A;  3OGA A;  1OW2 A;  2I6K A;  2B0V A;  5C8L A;  1R67 A;  1RRQ A;  5IW5 A;  2VNP A;  2B2K A;  3EES A;  3X0L A;  1F3Y A;  3HHJ A;  3BM4 A;  4JZS A;  3O6Z A;  1G0S A;  4C9X A;  1MK1 A;  2PQV A;  5GHM A;  3MGM A;  3RH7 A;  1SU2 A;  3R03 A;  2ICJ A;  1Q54 A;  3KVH A;  1KHZ A;  4KYX A;  1JRK A;  2G74 A;  1X84 A;  5GHP A;  4S2X A;  3U53 A;  1VIU A;  1KT9 A;  3P6Y A;  5ANT A;  1PUS A;  5ISY A;  1NQY A;  3MDI A;  4NFW A;  3FJY A;  2I8T A;  5DD4 A;  5C7T A;  5C7Q A;  1I9A A;  1V8N A;  3O61 A;  1PUN A;  2DSC A;  5ANU A;  2RRK A;  5ANW A;  3FSP A;  3AC9 A;  3O52 A;  2VNQ A;  1MR2 A;  1XSB A;  3I7V A;  2AZW A;  1Q27 A;  3X0P A;  2O5F A;  2FKB A;  3MCF A;  3Q93 A;  3X0K A;  1SJY A;  1V8T A;  1V8I A;  2B06 A;  4ZG0 A;  3X0M A;  4S2Y A;  2DSD A;  3GRN A;  5HZX A;  1RRS A;  1XSC A;  2KDV A;  1V8M A;  2A6T A;  5ANS A;  2QJO A;  1SZ3 A;  2XSQ A;  5GHO A;  3SON A;  4KG3 A;  2R5W A;  3H95 A;  4YOQ A;  1V8W A;  2GB5 A;  1JKN A;  1VHZ A;  3FK9 A;  3X0J A;  1GA7 A;  1VHG A;  4N1T A;  2A8S A;  1HZT A;  3X0Q A;  5BON A;  5GHI A;  2O1C A;  3E57 A;  3N77 A;  3G0Q A;  5FSL A;  5DEQ A;  1MQE A;  5ANV A;  1PPX A;  3Q2T A;  4ICK A;  1XSA A;  2YVN A;  1X83 A;  3A6S A;  2YVM A;  4ILQ A;  1MUT A;  3F13 A;  3L85 A;  2FML A;  3QSJ A;  1V8V A;  5BS6 A;  5FSO A;  2O5W A;  2ICK A;  1Q33 A;  2Q9P A;  2A8R A;  1PPV A;  5CFI A;  5CFJ A;  1V8R A;  5FSM A;  1SOI A;  2GT2 A;  4DYW A;  1RYA A;  3Q1P A;  3WHW A;  5DDG A;  2W4E A;  3ACA A;  4YPR A;  3HYQ A;  3O69 A;  3SHD A;  5IW4 A;  4IJX A;  3GZ6 A;  4JZT A; 
#chains in the Genus database with same CATH topology
 3Q2S A;  3X0N A;  2QJT A;  3A6T A;  4JZV A;  3FCM A;  4JZU A;  3A6V A;  1VCD A;  2A8T A;  3BHO A;  5GHQ A;  3X0S A;  4C9W A;  1IRY A;  1NFZ A;  1V8U A;  3FFU A;  4N1U A;  1VRL A;  1U20 A;  1MP2 A;  1QVJ A;  3EXQ A;  3I7U A;  4MPO A;  4V14 A;  2DHO A;  2QKM B;  4S2V A;  3O8S A;  3GZ8 A;  3DKU A;  3X0I A;  2I8U A;  3GZ5 A;  4YPH A;  3ZR1 A;  3EF5 A;  4KG4 A;  3Q4I A;  5DPK A;  5FSI A;  1VC8 A;  2CL3 A;  2DSB A;  1PPW A;  3CNG A;  4J7H A;  3EEU A;  2KDW A;  3P5T A;  3X0R A;  4J7G A;  3ID9 A;  2FVV A;  3J7Y e;  3DUP A;  1NQZ A;  1VC9 A;  2YVO A;  5GHN A;  1VIQ A;  2YYH A;  5I8U A;  3X0O A;  2DUK A;  2G73 A;  3COU A;  2JVB A;  2YVP A;  1K26 A;  3BAP A;  5FSK A;  5GHJ A;  5FSN A;  1K2E A;  3Q91 A;  3GG6 A;  2GT4 A;  2J8Q A;  3F6A A;  2A8P A;  1MQW A;  1V8S A;  2PNY A;  1KTG A;  3A6U A;  4K6E A;  5LPG A;  4HFQ A;  1PUQ A;  1NFS A;  1PVF A;  3N9U A;  1G9Q A;  1V8Y A;  1X51 A;  1HX3 A;  4KTB A;  4NFX A;  3GWY A;  3ZR0 A;  4HVY A;  1VK6 A;  3MDG A;  1V8L A;  2A8Q A;  4S2W A;  3SMD A;  1TUM A;  3I9X A;  3OGA A;  1OW2 A;  2I6K A;  2B0V A;  5C8L A;  1R67 A;  1RRQ A;  5IW5 A;  2VNP A;  2B2K A;  3EES A;  3X0L A;  1F3Y A;  3HHJ A;  3BM4 A;  4JZS A;  3O6Z A;  1G0S A;  4C9X A;  1MK1 A;  2PQV A;  5GHM A;  3MGM A;  3RH7 A;  1SU2 A;  3R03 A;  2ICJ A;  1Q54 A;  3KVH A;  1KHZ A;  4KYX A;  1JRK A;  2G74 A;  1X84 A;  5GHP A;  4S2X A;  3U53 A;  1VIU A;  1KT9 A;  3P6Y A;  5ANT A;  1PUS A;  5ISY A;  1NQY A;  3MDI A;  4NFW A;  3FJY A;  2I8T A;  5DD4 A;  5C7T A;  5C7Q A;  1I9A A;  1V8N A;  3O61 A;  1PUN A;  2DSC A;  5ANU A;  2RRK A;  5ANW A;  3FSP A;  3AC9 A;  3O52 A;  2VNQ A;  1MR2 A;  2CZR A;  1XSB A;  3I7V A;  2AZW A;  1Q27 A;  3X0P A;  2O5F A;  2FKB A;  3MCF A;  3Q93 A;  3X0K A;  1SJY A;  1V8T A;  1V8I A;  2B06 A;  4ZG0 A;  3X0M A;  4S2Y A;  2DSD A;  3GRN A;  5HZX A;  1RRS A;  1XSC A;  2KDV A;  1V8M A;  2A6T A;  5ANS A;  2QJO A;  1SZ3 A;  2XSQ A;  5GHO A;  3SON A;  4KG3 A;  2R5W A;  3H95 A;  4YOQ A;  1V8W A;  2GB5 A;  1JKN A;  1VHZ A;  3FK9 A;  3X0J A;  1GA7 A;  1VHG A;  4N1T A;  2A8S A;  1HZT A;  3X0Q A;  5BON A;  5GHI A;  2O1C A;  3E57 A;  3N77 A;  3G0Q A;  5FSL A;  5DEQ A;  1MQE A;  5ANV A;  1PPX A;  3Q2T A;  4ICK A;  1XSA A;  2YVN A;  1X83 A;  3A6S A;  2YVM A;  4ILQ A;  1MUT A;  3F13 A;  3L85 A;  2FML A;  3QSJ A;  1V8V A;  5BS6 A;  5FSO A;  2O5W A;  2ICK A;  1Q33 A;  2Q9P A;  2A8R A;  1PPV A;  5CFI A;  5CFJ A;  1V8R A;  5FSM A;  1SOI A;  2GT2 A;  4DYW A;  1RYA A;  3Q1P A;  3WHW A;  5DDG A;  2W4E A;  3ACA A;  4YPR A;  3HYQ A;  3O69 A;  3SHD A;  5IW4 A;  4IJX A;  3GZ6 A;  4JZT A; 
#chains in the Genus database with same CATH homology
 3Q2S A;  3X0N A;  2QJT A;  3A6T A;  4JZV A;  3FCM A;  4JZU A;  3A6V A;  1VCD A;  2A8T A;  3BHO A;  5GHQ A;  3X0S A;  4C9W A;  1IRY A;  1NFZ A;  1V8U A;  3FFU A;  4N1U A;  1VRL A;  1U20 A;  1MP2 A;  1QVJ A;  3EXQ A;  3I7U A;  4MPO A;  4V14 A;  2DHO A;  2QKM B;  4S2V A;  3O8S A;  3GZ8 A;  3DKU A;  3X0I A;  2I8U A;  3GZ5 A;  4YPH A;  3ZR1 A;  3EF5 A;  4KG4 A;  3Q4I A;  5DPK A;  5FSI A;  1VC8 A;  2CL3 A;  2DSB A;  1PPW A;  3CNG A;  4J7H A;  3EEU A;  2KDW A;  3P5T A;  3X0R A;  4J7G A;  3ID9 A;  2FVV A;  3J7Y e;  3DUP A;  1NQZ A;  1VC9 A;  2YVO A;  5GHN A;  1VIQ A;  2YYH A;  5I8U A;  3X0O A;  2DUK A;  2G73 A;  3COU A;  2JVB A;  2YVP A;  1K26 A;  3BAP A;  5FSK A;  5GHJ A;  5FSN A;  1K2E A;  3Q91 A;  3GG6 A;  2GT4 A;  2J8Q A;  3F6A A;  2A8P A;  1MQW A;  1V8S A;  2PNY A;  1KTG A;  3A6U A;  4K6E A;  5LPG A;  4HFQ A;  1PUQ A;  1NFS A;  1PVF A;  3N9U A;  1G9Q A;  1V8Y A;  1X51 A;  1HX3 A;  4KTB A;  4NFX A;  3GWY A;  3ZR0 A;  4HVY A;  1VK6 A;  3MDG A;  1V8L A;  2A8Q A;  4S2W A;  3SMD A;  1TUM A;  3I9X A;  3OGA A;  1OW2 A;  2I6K A;  2B0V A;  5C8L A;  1R67 A;  1RRQ A;  5IW5 A;  2VNP A;  2B2K A;  3EES A;  3X0L A;  1F3Y A;  3HHJ A;  3BM4 A;  4JZS A;  3O6Z A;  1G0S A;  4C9X A;  1MK1 A;  2PQV A;  5GHM A;  3MGM A;  3RH7 A;  1SU2 A;  3R03 A;  2ICJ A;  1Q54 A;  3KVH A;  1KHZ A;  4KYX A;  1JRK A;  2G74 A;  1X84 A;  5GHP A;  4S2X A;  3U53 A;  1VIU A;  1KT9 A;  3P6Y A;  5ANT A;  1PUS A;  5ISY A;  1NQY A;  3MDI A;  4NFW A;  3FJY A;  2I8T A;  5DD4 A;  5C7T A;  5C7Q A;  1I9A A;  1V8N A;  3O61 A;  1PUN A;  2DSC A;  5ANU A;  2RRK A;  5ANW A;  3FSP A;  3AC9 A;  3O52 A;  2VNQ A;  1MR2 A;  2CZR A;  1XSB A;  3I7V A;  2AZW A;  1Q27 A;  3X0P A;  2O5F A;  2FKB A;  3MCF A;  3Q93 A;  3X0K A;  1SJY A;  1V8T A;  1V8I A;  2B06 A;  4ZG0 A;  3X0M A;  4S2Y A;  2DSD A;  3GRN A;  5HZX A;  1RRS A;  1XSC A;  2KDV A;  1V8M A;  2A6T A;  5ANS A;  2QJO A;  1SZ3 A;  2XSQ A;  5GHO A;  3SON A;  4KG3 A;  2R5W A;  3H95 A;  4YOQ A;  1V8W A;  2GB5 A;  1JKN A;  1VHZ A;  3FK9 A;  3X0J A;  1GA7 A;  1VHG A;  4N1T A;  2A8S A;  1HZT A;  3X0Q A;  5BON A;  5GHI A;  2O1C A;  3E57 A;  3N77 A;  3G0Q A;  5FSL A;  5DEQ A;  1MQE A;  5ANV A;  1PPX A;  3Q2T A;  4ICK A;  1XSA A;  2YVN A;  1X83 A;  3A6S A;  2YVM A;  4ILQ A;  1MUT A;  3F13 A;  3L85 A;  2FML A;  3QSJ A;  1V8V A;  5BS6 A;  5FSO A;  2O5W A;  2ICK A;  1Q33 A;  2Q9P A;  2A8R A;  1PPV A;  5CFI A;  5CFJ A;  1V8R A;  5FSM A;  1SOI A;  2GT2 A;  4DYW A;  1RYA A;  3Q1P A;  3WHW A;  5DDG A;  2W4E A;  3ACA A;  4YPR A;  3HYQ A;  3O69 A;  3SHD A;  5IW4 A;  4IJX A;  3GZ6 A;  4JZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...