3Q94A

The crystal structure of fructose 1,6-bisphosphate aldolase from bacillus anthracis str. 'ames ancestor'
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
285
structure length
285
Chain Sequence
MPLVSMKEMLNKALEGKYAVGQFNMNNLEWTQAILAAAEEEKSPVILGVSEGAARHMTGFKTVVAMVKALIEEMNITVPVAIHLDHGSSFEKCKEAIDAGFTSVMIDASHHPFEENVETTKKVVEYAHARNVSVEAELGTVGGQEDDVIAEGVIYADPAECKHLVEATGIDCLAPALGSVHGPYKGEPNLGFAEMEQVRDFTGVPLVLHGGTGIPTADIEKAISLGTSKINVNTENQIEFTKAVREVLNKDQEVYDPRKFIGPGRDAIKATVIGKIREFGSNGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of fructose 1,6-bisphosphate aldolase from Bacillus anthracis str. 'Ames Ancestor'.
rcsb
source organism Bacillus anthracis
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase, class II
total genus 100
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3q94A00
5CZTA 3C2RA 2ZFAA 2CWNA 1EEPA 1M7PA 1QNVA 4GUJA 2ATMA 1EP3A 1FCQA 1NF0A 1V5XA 4LWWA 1W5NA 5K7JA 3T44A 1UCWA 3IIPA 3DU0A 2B7PA 5IBXA 1JRCA 4UNLA 3CM4A 3G1SA 3PAJA 2ABAA 3ATZA 1KFCA 4WJEA 3TKFA 4LNYA 4CQ8A 2YW4A 1Z41A 1FWSA 2G96A 5LNRA 3W3OA 1ME9A 1G7UA 4S2CA 1XL9A 1A5AA 4K7VA 4O57A 5EKYA 2QEZA 4MKNA 5D37A 4HN4A 4UTWC 3NPUA 2BWGA 2OX1A 3G18A 3KFTA 4LC8A 1H1ZA 2DZSA 4O52A 2ISSA 4IMFA 5DCBA 1NAL1 3SGUA 2CW6A 1F5ZA 2KZHA 1T8XA 3E49A 3UY7A 2RHGA 1FWWA 3QM3A 4E38A 3S1WA 1AK5A 4X22A 2A1YA 1FDZA 1XM3A 3E0IA 4O18A 2YSWA 5K9CA 5E0KA 3HPZA 5D2XA 3UWUA 1TB3A 2TSYA 1OX6A 1OABA 3S9YA 1YYAA 3GLCA 5D03A 3U6WA 1S5WA 2JGYA 4M6QA 4UTWA 4DPQA 4O16A 5CPNA 4LY8A 3F03K 4YXGA 3GDMA 4K8HA 3W70A 3M5VA 3F4NA 3IIVA 4AF0A 4MVAA 1SR9A 1JCMP 5A5WA 1F73A 2Y7DA 3GDRA 3TJLA 3NGJA 1GZGA 4LRTA 4MZ8A 1DV7A 1ZAHA 1Q6RA 4GUHA 4XKYA 3BO9A 3MHUA 5HR6A 3GXPA 3W1LA 2CLIA 3NXFA 3W1QA 1YADA 4AH7A 3B0PA 3TR2A 1M7OA 2CLOA 4RXFA 3ANYA 4GWEA 4PH6A 2E6FA 3OIXA 3W71A 1WBHA 3U2OA 4CQAA 2ZRYA 3W75A 2FQIA 3P74A 4HPJA 1KM6A 3ABQA 3BW4A 3NQVA 5AYYA 4NJIA 3RLUA 3KVLA 4PTNA 1WBJA 2CZFA 3DH7A 3S0CA 1LBFA 1YXYA 3STCA 3SR7A 3P7YA 3SECA 1YDOA 5I3GA 2EAWA 3A21A 3TQVA 5L6UA 7TIMA 1OFEA 4XUGA 4UFIA 4L4MA 1W56A 4R34A 1BTMA 1YXCA 1V7YA 3KAOA 5HJLA 1W54A 3P62A 3QW3A 4MFEA 5C55A 4YL2A 3LRLA 1LOSA 4RR4A 2BZNA 5F2MA 3LHTA 4GNJA 3MJYA 4GUGA 2Y7EA 3B06A 1VZWA 1EP1A 3K30A 1JRBA 3KX6A 3NQFA 3L2IA 3W1RA 5DXXA 2AGKA 1JCNA 1FWNA 2ISVA 5HR7A 1IXNA 4TU1A 1SZNA 2UV8G 5AHEA 3NQMA 3S1VA 3DFOA 2R14A 3BGGA 3P81A 4Y90A 5D02A 3W9ZA 5SWUA 1N55A 3B05A 3W1XA 3W2UA 3NA8A 3TCEA 1GTHA 3WK3A 4EWND 3QMRA 2GVLA 3NPXA 3W07A 1FCVA 4IGHA 4KFNA 4JTSA 5DY3A 2P10A 1TPB1 3DENA 1K7EA 5DCDA 1Q6OA 1VLWA 5TIMA 1KA9F 3PUDA 3QEZA 1HTIA 4ONVA 1F05A 1B9BA 3W72A 4LVAA 4AHPA 1YLVA 2ALDA 4I7VA 3LOTA 3W1MA 3S1UA 2YR1A 1GPWA 5F4XA 5I3FA 2ZZ2A 3GKFA 4C1LA 2YYUA 5KSWA 3BPWA 2NXGA 4LUJA 1UB3A 2VFHA 3GAKA 3H54A 3WK1A 3NL5A 4LUIA 4EIVA 1SW0A 2Y61A 3SJ3A 4CNNA 1W5MA 1I2OA 3NDOA 4K6AA 4NJKA 2NUXA 3NOEA 3W2NA 1TQJA 2V81A 3G3MA 4N6EA 2PURA 1ICQA 1YDNA 3HBLA 1ML1A 5I3JA 1LOLA 1LYXA 3EX6A 4EOUA 1DJQA 3CWNA 2QCMA 3W85A 5LNVA 4PL2A 1N8FA 5CPOA 1FCBA 2C14A 3E02A 5HUPA 3BK0A 1EUNA 3W23A 3N2MA 3B8DA 3NM3A 1XUZA 4ML9A 4O12A 1PS9A 1JCYA 4UR7A 3N9SA 1VCFA 1SSGA 5LZLA 3LCFA 3WK2A 3QMTA 2XN1A 1NSJA 3PBVA 3LV6A 5F4SA 3VKJA 1H7WA 5BOOA 3ATYA 4UR8A 3V75A 4N6FA 4WY0A 1TJPA 1B4KA 2B7QA 5D2YA 2VELA 3OVQA 3TFCA 2XFWA 2A2IA 3WFAA 5AHFA 3W7GA 3S42A 1F2JA 1HG3A 5I3KA 2B7NA 2PRHA 4D2JA 2Q8LA 2QUTA 3TXZA 2YZRA 3LDVA 4MY8A 3MHGA 3DI0A 4DO6A 2GQAA 5KITA 1T99A 1JJKA 5G4EA 1K8YA 3UWWA 4PODA 5G1TA 5G2WA 1OK4A 5F2GA 4GXMA 4JYDA 2ZRUA 4OU1A 3BW2A 1EUAA 1K8XA 3IV3A 1WAUA 1ZAJA 2E09A 4CCCA 2CFFA 1XBVA 3EWBX 4EVZA 5EPDA 1SFJA 2QCNA 2BSLA 2R91A 3TMQA 4QNEA 5I3HA 3L0KA 1G69A 5EYWA 2DZUA 4XKYB 1SQ7A 1W8SA 2Y63A 3FEMA 1K8ZA 4N9CA 2ZCGA 3KXQA 4NNBA 3LRMA 3LERA 4M7SA 2DZVA 4NUWA 1VCGA 4FNTA 3T4CA 1EB3A 2I14A 2QDGA 1SO4A 1L6WA 3FYOA 2AQWA 4TMCA 1B57A 2EKCA 3LX9A 2DZTA 4EF8A 5K9XA 1I4NA 4UTIA 4I7WA 4J9JA 4NXSA 3TC7A 3NYZA 3TA6A 1KM1A 2E68A 2R94A 3EX1A 3PBWA 5K2ZA 3YPIA 2TMDA 5K9DA 4EF9A 2QJHA 4JEQA 2NV1A 4AWUA 2RFGA 3KRUA 1KFBA 4Q4KA 2NXHA 4LU0A 5HWJA 3MW7A 1DKWA 3IVTA 5FEZA 4FNPA 2PRMA 1ZALA 3RLVA 2NX3A 2RDUA 4UCGA 1VYPX 4LV9A 1CW2A 3I7RA 1X6UA 4UFKA 4IXXA 2Z2UA 5LNSA 4CCEA 4IX0A 1FCUA 1LBLA 1TSIA 5D05A 5CPMA 4IX2A 1I2RA 4MY9A 3EWYA 4DO5A 1SSDA 1KBIA 1I2NA 1ZCOA 2FJKA 1GJPA 3P8JA 4NJHA 2F84A 3LCLA 3VCRA 5DBTA 2OJPA 3TNOA 3C8FA 4TR9A 1TPEA 4O28A 2ZYFA 4QITA 3O63A 3EKZA 4IWWA 2WKJA 3M5ZA 4AXKA 5HMSA 2E5BA 1QDSA 3G0SA 3CTLA 3IIZA 3PUOA 3RMJA 4BK9A 2XN0A 2QJIA 5HQEA 4K7YA 3QMSA 4UFJA 1VH7A 1A5CA 1PIIA 3QQ1A 2HS6A 4MJMA 3OEXA 4FNUA 4GUFA 4Z08A 3W7LA 4JTTA 3C56A 2JK2A 4PCFA 1YPIA 5LGZA 3RK8A 3EX2A 3NQAA 3W7EA 1W37A 2NXIA 3HGOA 1RR2A 3WJZA 5D38A 3TXVA 1O60A 1G7VA 3FIGA 3MP3A 1VCVA 2OT1A 3M7WA 3WJXA 5CGQA 4XZ9A 3UPWA 4A29A 3EWXA 1LOQA 4UUIA 3UXDA 4GRSA 5IM51 4RK8A 4XWUA 4LVGA 4M6VA 1KLYA 2FTPA 4JX5A 1P1XA 1P5BA 3JRKA 1LCOA 2H8XA 6TIMA 3HO8A 3W7JA 2QUUA 1ONRA 3NQ2A 2X2GA 1EP2A 1L6YA 4ADTA 1DQXA 4XTDA 2Z0IA 2V30A 5DLCA 2V2DA 5AYXA 3TV8A 4YWIA 4UIOA 4JX4A 4MOZA 2CLEA 1NVMA 2ABBA 3AO0A 4UTHA 3ELFA 2FB3A 4FF7A 1ICPA 4A21A 1KTNA 4ALDA 3U8GA 1QPOA 1XUUA 3IIOA 3PS7A 4I7UA 4C1KA 3LB0A 4GE8A 4NZFA 1Y0EA 4P61A 3IEBA 1JCJA 3W88A 4WXZA 1KW1A 5L9FA 4S1FA 4MUZA 3W1NA 1ADOA 4BI6A 1ME7A 1I8JA 2I1OA 1QFEA 2ZA1A 1W5OA 3TAKA 3S6DA 5KZEA 1I2PA 1XDMA 4O1CA 4RX0A 1AL7A 1GVOA 1H63A 3BV4A 2VFEA 2G95A 3PM6A 4WX2A 2ZZ3A 1TV5A 3STGA 1JCXA 4OE7A 4HNTA 1FXPA 4POCA 2H3BA 3HG5A 4JN6A 4LW7A 5HNRA 3PBUA 3A23A 4RXGA 1O5XA 2V5LA 2CLMA 2DU2A 1O94A 2DZWA 4ZQOA 1VS1A 2Y89A 4Z1AA 4UFLA 3DI1A 2NWSA 4R33A 2Q3OA 4M19A 1VQTA 3LHUA 4OWGA 4JDYA 3BG3A 1DORA 2W0UA 5FEPA 4O1DA 2ZZ6A 1OFDA 3C2FA 1KTCA 2C19A 1AMKA 4BR1A 4JR5A 4LS1A 3B0VC 3NEVA 3N9RA 4A22A 2QAFA 2W6RA 1FDJA 4TMBA 3W6YA 3PWAA 4UTTC 3SY5A 1GWJA 3GDKA 2A7NA 3SGZA 3G0XA 4LVFA 3BVJA 3A9IA 3ABSA 4WD0A 4O50A 3W2MA 1H7NA 5BRBA 4FHAA 1F74A 1SW3A 3NVTA 3G8EA 3FFSA 3FJ6A 2NUWA 1Z42A 3LXAA 3FKKA 1ZJIA 8TIMA 1GG1A 2DJLA 1Z48A 5D33A 2QAPA 3ZWSA 5H91A 3VI2A 1JULA 3NZ1A 1OFBA 2O7QA 3P5ZA 5F2IA 4LT9A 4NT0A 4IJBA 3UWYA 2J9ZA 2AAMA 4DF1A 3HGRA 5HWMA 1E51A 1FQ0A 3GIYA 3HPXA 3HOJA 1VJIA 4O19A 1T96A 4UTJA 3NPWA 1KFLA 3ZR4A 2GQ8A 3AJXA 4NNCA 2ZRVA 4DO4A 1EX5A 1R30A 1RQBA 2FFCA 3P84A 2E5DA 3THAA 5KMYA 4JYEA 3NR0A 1GVQA 1MSSA 1YXDA 4WZHA 5FEWA 2EHHA 2YDAA 2RH9A 4WOZA 1PV8A 5G4WA 3LLFA 3CPRA 4KWWA 4AAJA 4LS2A 3G1FA 1VPXA 4JTFA 1XFBA 4LRSA 1JUBA 4FNRA 4GFSA 1FDYA 1TMHA 3DXIA 4HSOA 4TO8A 4UTLA 3T7VA 3USBA 2C16A 1L2UA 2BTMA 3L0NA 3ZWTA 3BLEA 3GAYA 4DF2A 1W3NA 1IGSA 3NG3A 3F1QA 2NWRA 3KVKA 4RZ6A 4M6PA 4ZQRA 1G6CA 4WUIA 4KWVA 2QCGA 1XC4A 5AC8A 3E12A 3W87A 4FB7A 1TV8A 4OV9A 3TSBA 2QCDA 3PY2A 1GTEA 3C2EA 3NQ8A 4O4WA 3L66A 3I6RA 3BGJA 2X1TA 5AOUA 1AW5A 3GZ3A 1OK6A 2VKZG 1D3GA 3EX4A 4O17A 2VENA 1LRNA 1HFBA 3PSWA 1TIMA 4ZQNA 4N9EA 1A50A 2WSRA 4H3DA 4YLWA 4YCOA 5GVJA 3CIWA 3RFAA 4FEZA 3G1HA 4UFHA 5F2LA 1ZAIA 3PB2A 2DP3A 3CT7A 5E93A 1TV7A 4PL1A 4HPXA 1AW1A 3NNTA 1IXPA 4JTJA 1OYAA 2PCQA 3DBPA 4JS3A 5A8GA 2ZZ4A 4IPIA 5DXYA 5EA9A 2A85A 3HF3A 1SZEA 1MXSA 1A5BA 3O6DA 1A53A 1Q3NA 3PULA 3A5FA 3HIJA 4ICNA 4Y96A 3W76A 1ICSA 3PC0A 1TJRA 5D04C 5HWNA 3MHFA 2NUYA 5T26A 3IRDA 1XI3A 1TQXA 2GJLA 1TTPA 2GOUA 3GR8A 3IVSA 4WY0F 3QC3A 4ZQMA 3LXCA 3G1DA 1G4EA 4MFDA 3HMJG 3T78A 2P0OA 3DFPA 4K38A 2V82A 3LTSA 4XBKA 3O06A 1X8FA 1EWEA 2FPTA 4KFOA 4HT3A 3TC6A 2Y88A 1KBJA 2LLEA 4R53A 1GVRA 2HMCA 5AHMA 2X30A 3W7PA 2VEIA 3BG9A 4IMGA 5KINA 3A24A 1DQWA 1PHQA 3UWQA 5LNUA 1QPRA 2I9EA 4OGZA 1YTKA 1TTJA 1IXQA 2F7FA 5KTLA 1XBYA 3QQ0A 2Q8ZA 2VFDA 5J5RA 1XXXA 3GYEA 2H90A 2WO5A 4ZVJA 3T55A 3E9AA 2EGZA 1S3HA 4GC4A 1WX0A 5D2VA 3OBKA 1BWLA 2C1HA 4O1AA 2CZDA 5C2XA 3A5VA 1Q6LA 1YPFA 2YFNA 5FEXA 4NXKA 1MZHA 4H6KA 5AHLA 2BLEA 1SW7A 3EWZA 4AWTA 1FX6A 1BEUA 1VHNA 1JR1A 4IMDA 3HG3A 1M6JA 5DY2A 4NU7A 2ZZ5A 3IGXA 1XBZA 5G1YA 1W3IA 1VC4A 4RKAA 2DZXA 1VGAA 3W86A 2Z1BA 1TPC1 4PA8A 1KFJA 4NJJA 2GUUA 1P0KA 2WPBA 1R2RA 4YCPA 4JTUA 4UTKA 1NF7A 2X1SA 3GNDA 4TX9A 1X1OA 2ZA2A 3W83A 3EX3A 4E2BA 4Z1BA 1SZGA 2X1UA 3UXAA 1FXQA 3BG5A 3B03A 3B4UA 3MUXA 5LKYA 1OF6A 4LV4A 4UTTA 4IMCA 1P4CA 1QWGA 4E0CA 1OFQA 4DBDA 3C61A 3G1AA 3W1PA 3W7RA 2HS8A 4WY0B 1T0OA 1ALDA 2J6XA 1F6KA 1R2SA 3LV5A 4XTIA 4OBTA 5FESA 3SZ8A 1H61A 5G5IA 2ZTKA 3QW4B 1GOXA 1VR6A 3LRKA 4UMBA 3C2OA 3TE9A 4Z1CA 1CI1A 4JTLA 5HULA 3DHDA 1KM3A 3UD6A 1X1ZA 2ZZ7A 3VNDA 5G2IA 1PCKA 1W0MA 5DN1A 1OFRA 2GVJA 3EXTA 3IGSA 3IIXA 4UMCA 5BNKA 3SW6A 5U7SA 3EWWA 3WJYA 4UXDA 3UWVA 1H7OA 2VOMA 3L5LA 1JUKA 1PHWA 2J27A 3VE7A 1ZHAA 3H55A 4ZQPA 1GVFA 3V1PA 1O4UA 2WSYA 2OMAA 1KM2A 1LZOA 3N14A 3NQ6A 2GVGA 3W1AA 4OQVA 3NO5A 3M16A 1GG0A 1G4TA 1DOSA 1M5WA 3W2LA 3MP5A 2RKXA 2WNZA 3MBFA 1DVJA 1WDWA 2CLLA 4OV4A 1HO1A 1AW2A 2E6AA 4S2BA 5C5YA 3S5ZA 2YX0A 2BXVA 3KVMA 4DF0A 1S5TA 2P1FA 3LHWA 3NPVA 2VFIA 3MI3A 1R47A 1VYRA 3PB0A 1KM5A 3TW7A 1DJNA 1PL9A 3MI6A 5FF7A 4FX7A 3EXRA 5EY5A 3TMLA 3M0ZA 2OCZA 1PCWA 2NV2A 1QCWA 1BWKA 3MWAA 1L9WA 4UFMA 4UTMA 4Y9AA 3DKLA 2PRLA 3ABOA 3W7DA 3QFEA 3L0GA 3LHZA 4QISA 1OX4A 3OHIA 3UNDA 1F6PA 2G5WA 1H7XA 2Y7FA 5CG7A 4RJEA 3NQCA 1OYCA 1YDVA 5AB3A 5AC6A 3R2GA 1HL2A 1R46A 4DQWA 4JIPA 1KTBA 3W7MA 1GT8A 3W2JA 3LCWA 3LCHA 3L21A 1RQEA 2YGYA 1H7PA 1QOPA 2A7PA 3VE9A 3SI9A 4O1BA 1WOBA 3TAOA 3HGSA 2QCLA 2ZRXA 1H50A 4JY9A 3GNNA 2QR6A 1KV5A 4O15A 4ZL1A 4O8RA 3QRHA 4B5NA 2VXNA 3CEUA 1C29A 2J9YA 3DHFA 1HO4A 1WV2A 4N02A 3GXNA 4MPQA 3N2XA 3ZFHA 5EL1A 3UYCA 1JCLA 1TPFA 1Q6QA 5CKSA 4K8EA 4LS0A 1H1YA 2NX9A 3QZEA 1VLIA 1TPUA 5CZSA 4Z1DA 2FB2A 5LNWA 4AHQA 5AHIA 4AEOA 3QSRA 4JTIA 4NZJA 2O7SA 3C0JA 1F7BA 1EPXA 3DAQA 2CU0A 2YCEA 5LGXA 1U83A 5FF2A 1WYIA 4MIMA 4I9AA 2H8ZA 2ZA3A 2A0NA 2X1RA 2JBMA 1GQNA 4L4LA 3GR7A 3PG9A 2QF7A 4AF0B 1ME8A 3LBMA 3ZS4A 3DFSA 1THFD 3G3DA 4KFPA 2HSAA 2YFOA 3FA5A 1FY6A 2WSQA 3M1ZA 1DL3A 3LBCA 4U4MA 4MYXA 1OF8A 3S5YA 3QSTA 3UWZA 3TUUA 3HJZA 4QAIA 1SUXA 2Q3RA 3MO7A 4CLMA 3LI1A 2RDTA 2E5CA 2ZZ1A 2JKPA 4N9BA 3I7SA 3CLMA 4P2VA 3MP4A 3O1NA 2V0TA 4RZ5A 2VFGA 2J9XA 3M43A 3VFLA 4AWSA 1VYSX 1QMLA 2PC4A 3BLIA 6ALDA 2ZDRA 3HGJA 5DELA 4NJGA 2NZLA 3O6CA 2B7OA 4JTEA 4IQLA 4ZQCA 3D0CA 4WXYA 4ADSA 4DBEA 4E2DA 3L5AA 2FPVA 3QPYA 4MZ1A 3M41A 2E1DA 3G1XA 3TROA 3M6YA 3C6CA 5K4ZA 1ZFJA 1J4EA 2H3DA 3B0UX 3RU6A 3R13A 1C8VA 1IXOA 3KRZA 3O15A 3IGUA 3GX9A 4QIUA 4FIRA 1LP6A 3GXTA 1TCDA 1Q45A 3DZ1A 3EKLA 3G24A 3DKJA 3Q94A 4JICA 3TIMA 1UBSA 3NAVA 2GJNA 4IPJA 4LVBA 1FUYA 3N34A 2Z6JA 3JS3A 1QR7A 4X3ZA 2QCDB 3F4WA 1QO2A 2E6YA 3KRSA 2XN2A 4K36A 1D9EA 4W9TA 1LROA 4IUOA 2R8WA 2B0MA 3OA3A 2QUVA 3BLFA 4A2RA 1A5SA 4JDBA 3RF9A 4Q33A 4UTUA 1X7FA 1GEQA 4FXRA 2RDWA 3LGEA 3O07A 3P61A 3W73A 3NQ7A 1QO5A 4CQ9A 3L68A 3W22A 1H5YA 2J88A 4PC8A 2FIQA 1LTDA 3G0UA 3BARA 1MO0A 1W31A 4QJ1A 2FDSA 2CLFA 2WOQA 3QYQA 2A7RA 1UUOA 2QKFA 3P60A 5EBUA 3NL6A 1K7XA 5K4XA 1XBXA 2QCHA 4YMZA 3MYOA 2VC6A 3W7HA 4JY8A 3NM1A 1W1ZA 3NQDA 1FWTA 1SFLA 1QOQA 1EIXA 1BKSA 3Q2DA 2Y85A 1ZY9A 1QPQA 2OZ0A 1XKYA 3S1XA 2BX7A 3GK0A 5U4NA 4PEKA 3W7IA 3QF0A 3W7OA 1TO3A 3T40A 1J2WA 1H7RA 2V5BA 2QCCA 1ZNNA 3Q58A 4IXHA 2WV8A 3QH2A 3DFQA 3I65A 1IF2A 3DFTA 3S5OA 2NX1A 3L5MA 1OFAA 2QCFA 3G8RA 3W7CA 2OT0A 3P8IA 4HKPA 3KVJA 3N19B 1XDLA 3N73A 1RV8A 3HPSA 5C6MA 5AC7A 1MEWA 4Y6GA 4OT7A 2DORA 1AL8A 4FO4A 1H51A 3RNDA 3W84A 1F76A 4X2RA 1LLWA 4LC6A 1PVNA 3CB8A 3MI2A 5K3VA 3W2KA 3TH6A 3L65A 3MMTA 1OFPA 5CZ0A 5HUOA 1EWDA 3DGRA 1SU5A 4QNWA 1J5TA 2A5HA 4Y8FA 3LHYA 4FNQA 3CHVA 3N3MA 2V9DA 1JQXA 1SO6A 1W3TA 2IQTA 3JR2A 4O53A 3LLDA 3R5EA 1SO3A 3G1VA 2Y7GA 3C3NA 3GKAA 2C0AA 4FXSA 1K3UA 1W5QA 3UY8A 4MJZA 3G1YA 5BMWA 4GJ1A 3BW3A 4O11A 3NL2A 3I7QA 4GBUA 3Q37A 5HINA 4QM1A 3LTPA 2QDHA 5FF4A 4JYFA 1P0NA 3FS2A 4FX6M 4LOCA 5CSSA 5BW6A 5KZMA 3TSMA 2WQPA 4HNVA 1KFEA 4BI5A 1U5JA 1HUVA 3LM7A 5F4WA 4H4IA 4O0ZA 3PG8A 2W79A 4FNSA 5AYZA 4Q32A 3STEA 4Z0SA 1LBMA 3CC1A 4BWLA 4ZMGA 1NEYA 4DPPA 1OVDA 3HQ1A 3LCIA 1TPH1 3LHVA 2H6RA 1OX5A 1W5PA 3EXSA 3TU9A 1KFKA 3FJLA 1KV8A 4ZZ9A 1GYLA 4CNPA 1B4EA 5BMXA 3R89A 4HNNA 3INPA 2C6QA 2JKAA 1O5KA 3A22A 4M5PA 1SO5A 2ZRWA 3FYPA 2ATSA 3OG3A 2A4AA 4JX6A 1RD5A 3MYPA 4O10A 4GUIA 4MY1A 1H62A 5LHEA 3KHJA 1ZENA 3P82A 3LTYA 3OVRA 2C3ZA 4RV8A 2WNNA 3SIZA 4A3UA 1G4SA 4BFAA 1LRQA 1OHLA 1OX4B 3O16A 3OVPA 4N4QA 3C2VA 3C4UA 2Y70A 1UJPA 5LHFA 2G97A 1FBAA 4MYAA 3S5NA 2EPHA 1RPXA 3LCXA 4XQ6A 4AVFA 2DZPA 3I68A 1TREA 1WOAA 2ZRZA 5J5DA 3GDTA 2ZTJA 4AMAA 3TW6A 4JGDA 3EWUA 4Z0JA 2CZEA 4HHPA 4MLRA 2DJXA 1LRTA 1TYGA 3HB9A 4U28A 1TPVA 3P5YA 4X9SA 3HG2A 4LVDA 1D3HA 3W7QA 2E6DA 3TSDA 3P80A 5CZJA 3TK7A 1NFBA 3TFXA 2ZQ0A 2ZBTA 4M7TA 1OYBA 5IBXC 3CQ0A 4K39A 4ADUA 4AB4A 1FWRA 1IIHA 4UNKA 4DELA 4HNUA 3ABRA 3PUEA 3W1UA 4QSHA 4O4VA 2C18A 2CLHA 3GB6A 2A6LA 4XBSA 3EEGA 2CZ5A 3CWOX 2TYSA 3FOKA 1WXJA 3FKRA 3NQEA 4N4PA 1N7KA 4JD4A 4JTGA 4O54A 3R8RA 1KM0A 2E77A 5FF0A 5G2HA 3QJAA 2JKEA 5E1QA 4N9DA 1C9DA 5F1UA 3TX9A 3STFA 5DCEA 1K02A 3O8AA 2C13A 3G22A 5FI8A 5EMUA 3TDFA 2YYTA 1QPNA 1QAPA 3DFNA 4CCDA 1K7FA 3QPZA 1SPQA 2Y62A 2ISWA 1RVGA 3UPBA 5TQLA 5DBUA 3NL3A 4IOTA 4JIQA 4MLJA 4NX0A 1DBTA 1I2QA 2YW3A 4NX5A 3SFKA 2FLIA 4O0KA 3KOFA 4G1KA 1KLZA 1TPWA 1SZFA 2J24A 1OG0A 4RCXA 3E96A 3PVFA 2CLKA 1OJXA 2Z6IA 1LLZA 4JNMA 5CPLA 3W1TA 5D30A 1UUMA 3TQ0A 1G4PA 2YXGA 5CSRA 2VEPA 1YTDA 2QCEA 2YPIA 1H60A 3M44A 4RLIA 3M5YA 4WQ6A 1PE1A 2GPTA 3CIXA 1UASA 2A21A 3H53A 4QQ3A 3L9CA 1XCFA 4CNOA 3THQA 1LDCA 5H2ZA 3EB2A 4AHOA 4NNAA 1WQ5A 4NQ1A 3LXBA 3O6YX 3HG4A 1Z44A 3M47A 3O05A 1TTIA 4R7JA 2VEMA 4K37A 4NVTA 4TIMA 4UMAA 3M5XA 5FF3A 2EF9A 1RZMA 3LCGA 5LSMA 2TRSA 2D73A 1CX9A 3P67A 1K03A 4JTKA 5D09A 2B4GA 1TPDA 4PFMA 1EA0A 1LORA 3FLUA 4DXVA 1JUEA 2JGQA 3W7KA 2PE4A 4JTHA 3TJXA 4BI7A 1MEIA 5I3IA 1AG1O 2NLIA 3GDLA 1VRDA 3PF3A 2WJZA 1GVSA 3M9YA 1JVNA 3GVGA 2FPYA 5AN7A 3WK0A 1OFOA 4DEFA 1I45A 1JQVA 3W7NA 3IVUA 5KZDA 4MZYA 2A6NA 1TRDA 4FX8A 1IIGA 3C52A 2VFFA 3CEPA 4FIQA 3S8HA 1GYNA 2TPSA 3PBYA 3UZJA 4O14A 5D32A 5C54A 3NZRA 4ORIA 3UQNA 4HIBA 4WOQA 5F1VA 3CU2A 4UC5A 4HSNA 2X16A 4KKXA 4O13A 2V8ZA 1R2TA 4OHQA 3W74A 1RQHA 2GQ9A 4ORMA 1TRIA 3TQKA 2QJGA 1VHCA 5AHNA 3SSJA 5MHBA 1B3OA 2Y6ZA 3B04A 5ABTA 3LI0A 4A2SA 2WNQA 1MEHA 3L67A 5AFDA 1DHPA 5D2TA 5D2WA 4RZ4A 1L6SA 2V2HA 4BWLC 4JXCA 4N2YA 2V2CA 3UZ5A 3MBDA 3PR2A 1S5VA 1KM4A 3NQGA 4BF9A 1O95A 3WJSA 2C15A 3R12A 1G67A 4IMEA 1LM1A 1TTQA 3WJWA 1YTEA 2VEKA 3PSVA 1WA3A 2HTMA 5TBOA 4LTSA
chains in the Genus database with same CATH superfamily
1MNSA 3PWGA 1UWAA 1EEPA 3O3RA 1M7PA 5A8PA 2Y2WA 3GM8A 2R1MA 1FCQA 1V5XA 2AL2B 5A6KA 4GMEA 5K7JA 1TA3B 1UCWA 4K1GA 3OGRA 4E8DA 4DUVA 1JRCA 5I0DA 4AY8A 2ABAA 1K9FA 4CVWA 1PO9A 1BAGA 2G96A 4XD4A 4S3KA 1Q6FA 4ZB2A 3KEHA 1G7UA 4FI4A 1QRQA 3IS4A 2OU4A 1P0EA 4MKNA 1GJUA 1V8EA 1FP9A 4HN4A 2YL9A 4UTWC 1UD5A 3RCMA 2OX1A 4ZFMA 4F0KA 4RE2A 1H1ZA 4CNUA 4HZ6A 5DCBA 4MTVA 1NAL1 3SGUA 1T8XA 3VKAA 4LCQA 3BANA 4E38A 3SQMA 1AK5A 4X22A 2A1YA 1FDZA 1UD2A 2PDNA 3E0IA 4O18A 2YSWA 5K9CA 4H01A 3IUIA 3UWUA 2TSYA 3QZAA 4BKNA 5D03A 3KBJA 2VMFA 4M6QA 4O16A 1QNPA 1FH7A 3F03K 3OBEA 1MXGA 1K6WA 4G6CA 3M5VA 4PUEA 4AF0A 1K4HA 4RNIA 3A12A 1KRAC 4UZUA 1ODUA 1F73A 1TR1A 3GDRA 3TJLA 3WIJA 1GZGA 3BAXA 1ZUAX 3BO9A 4AG0A 5HR6A 3W1LA 4GIYA 2GSJA 2CLIA 3W1QA 3EMZA 1O68A 3W02A 5FA5A 3WNKA 1YADA 3UG3A 3B0PA 4AZCA 3MVIA 1UYQA 3UCCA 4QAWA 3OLDA 3BLKA 3TR2A 4CD8A 4RXFA 3ANYA 4GWEA 2QGHA 3WLLA 3W71A 3WLRA 2WLZA 1A3WA 3VIKA 3W75A 2FQIA 3VIJA 1ELSA 3DC8A 2WMFA 1KBBA 4XO6A 4B5WA 1YHTA 1SGJA 1ZJAA 2JQXA 1LBFA 5HMEA 3SECA 1YDOA 4G7EB 1AODA 3BQ5A 4U10A 3WD4A 3TQVA 2VX4A 5L6UA 2ONEA 3UR2A 7TIMA 1OFEA 2GUBA 4O0QA 1E6XM 1W54A 2VNCA 3AMGA 4XK2A 4MFEA 1LOSA 4LPCA 1GVEA 2BZNA 4RR4A 5F2MA 4DBUA 1R3WA 2FZNA 2Y7EA 1EP1A 1CXKA 1JRBA 7A3HA 3NQFA 4HZ8A 4E8GA 2G41A 4KERA 4DUXA 2AGKA 1JCNA 1E4NA 5HR7A 2DIEA 4IMAA 3N2OA 1CXIA 3EB3A 4CU8A 4C6BA 7REQA 1CGWA 4JKLA 2D20A 3VIMA 5A6BD 3IARA 1EDGA 3QMRA 3NPXA 4IGHA 2QPXA 5DY3A 2XH0A 2P10A 1PJ9A 3DENA 1K7EA 5TF0A 4LGXA 1Q6OA 2Q02A 2ZUUA 1VLWA 1V6VA 3U3HA 1Q4WA 3PUDA 1HTIA 4ONVA 4G2DA 3HQPA 3VDBA 1B9BA 3W72A 3FCPA 4I7VA 7XIMA 2J78A 3CWHA 5F4XA 5I3FA 4JHOA 4QLJA 3GKFA 3VOFA 2X2YA 2E28A 1BPLB 2FFIA 1UB3A 3BPWA 3GAKA 3H54A 3NL5A 1JI1A 1SW0A 4H9YA 3OGSA 4HPHA 1V02E 1XDJA 4K6AA 1UA7A 3UXKA 1PZ2A 1EL3A 3MPGA 4BEUA 4CQDA 4HVXA 2VD8A 2V81A 3G3MA 4N6EA 3HBLA 1LOLA 5EFDA 2GSEA 1FWJC 4A8NA 3TNBA 2WVSA 4ENLA 3CWNA 1FWAC 1QUMA 3VOIA 1I1XA 1HX0A 2F2KA 4PL2A 1EGMA 4PUNA 4L7ZA 4J3ZA 2PDXA 1HJSA 3NM3A 2CBVA 2XIIA 3N9SA 1I0DA 1RALA 1SSGA 3EB4A 5BWAA 1C7TA 3OIHA 3VKJA 1A5NC 5BOOA 1J0IA 1GOIA 3ATYA 4N6FA 1B4KA 1C8XA 1GKRA 3FAXA 3TFCA 3S42A 1W1IE 4BEQA 3TJ4A 3ZQ9A 3T42A 2B7NA 2IKHA 3IJIA 1LG1A 2J6VA 3FNDA 4Q6XA 5C0QA 1J18A 1DEDA 1JYXA 4Z2GA 2NQ9A 1T99A 1KXQA 1B3YA 4HMEA 5A6JA 2PTYA 4JIHA 4JYDA 2ZRUA 5FJRA 1Q13A 1PTGA 1ZAJA 1YBQA 1GKPA 4CCCA 1EF3A 1XBVA 4UNIA 2BSLA 4CGTA 4GACA 4DY1A 4ICMA 3RCYA 1JPMA 4NAEA 2DZUA 5EYWA 5A6LA 2Y63A 1CGYA 4EACA 4B5VA 3FEMA 1K8ZA 3IUHA 2PU0A 4C60A 3SUUA 4NUWA 4FNTA 1JD7A 3AYRA 4J5NA 1B0IA 2QDGA 2PWVA 3CQHA 4DJDD 1SO4A 2E7FA 3FYOA 4JFUA 1DWGM 3I4EA 1GQIA 4OUEA 3DIPA 4QBXA 1AQFA 5DT5A 4AQLA 4U2ZA 4UTIA 4RDYA 1TVNA 4NXSA 4C1NA 6XIAA 2E68A 3PBWA 5K2ZA 3ME3A 4HNCA 2GGHA 1UIPA 3HN3A 2NV1A 2HRWA 3IJLA 1H41A 1KFBA 3KRUA 4Q4KA 2NXHA 3AQUA 4D1IA 6REQA 2EPKX 2VR4A 4GKLA 2J75A 3MW7A 4B9YA 1DKWA 4Q8MA 2NX3A 4DBSA 1P48A 1ZBVA 1V3IA 2CWXA 1VYPX 2ASHA 1A4LA 2A3BA 5LNSA 2HBXA 1TE1A 3GBDA 1UR1A 1LBLA 2HVNA 4IX2A 3VMOA 1CWYA 2OOGA 2IPFA 2HNEA 1KBIA 3E74A 1I2NA 3VD9A 3UG8A 1X6LA 4MB3A 4ZXOA 4NJHA 4WR3A 5TD4A 3TN3A 5A2CA 5C8BB 5JH2A 3FA3A 3TNOA 1FWFC 2CBIA 4TR9A 3REQB 1W1VA 2ZYFA 4QITA 3O63A 3S1GA 1JYWA 3EOOA 3DFHA 3WQEA 2PTDA 1EJRC 2G3MA 4K7YA 1XH0A 1PIFA 1PIIA 4Q8PA 3CH0A 3H2EA 3ZJ7A 2HS6A 2HK1A 3AIRA 4PTDA 2XSBA 5JBDA 4JTTA 3ONCA 3MUCA 3ARYA 1VBRA 5CC5A 5LGZA 3DG6A 5CZKA 3VNZA 3P14A 1RR2A 4TX8A 5D38A 2D2JA 4JIRA 3KP1A 3EWXA 2PLMA 4PMQA 3UXDA 3SURA 1XWYA 3TLLA 3WDRA 4AZGA 4DIAA 3DHPA 1UHVA 3GWQA 1Q6EA 1KLYA 1P5BA 2JIWA 3HO8A 2C0HA 1XLFA 4V1YA 1FVPA 2P8BA 1ONRA 1KBLA 4EPKA 5H8PA 1EP2A 3OQEA 3LZ3A 3NFUA 4Z2JA 1GPFA 1HT6A 2PWDA 5AYXA 4JHZA 2WHKA 3S3GA 4MOZA 4NZ4A 2CLEA 4DWSC 2RJHA 1UUQA 1RK5A 3AO0A 1LT8A 4DVOA 1HKKA 3FW6A 4A21A 1Z69A 2VX6A 3U8GA 3M7SA 3PS7A 3RLGA 1KKOA 1JCJA 3GU9A 4WXZA 1Y5WA 1KW1A 1IWPA 5E5CA 3UGRA 5L9FA 4MUZA 1C92A 3TYEA 3W1NA 1NDWA 1I8JA 1R3RA 1EDTA 1QFEA 1XCWA 3EDDA 1S5NA 4ATWA 2YA1A 4DWDA 2ADAA 4RX0A 1K70A 2PTZA 4QE5A 1H63A 2VFEA 4GQ0A 4LYPA 5LIUX 3STGA 1OZQA 1S2UA 1KD0A 1UIOA 4JN6A 3VNIA 4C6FA 1B5TA 4UOJA 4B5TA 4ZGYA 2V5LA 2CLMA 1O94A 1VS1A 2Y89A 3DI1A 1UW9A 4R33A 2FHCA 1H4PA 2D0GA 5FEPA 2ZZ6A 5HPCA 3C2FA 3AIQA 3B3DA 3ORWA 2C19A 3QPEA 4EX4A 4A22A 2QAFA 2VVSA 1FDJA 4TMBA 3PWAA 4UTTC 3DDMA 1WNOA 3A9IA 2XIQA 3N6QA 4WD0A 4ZBCA 1G01A 5DMLA 3C2YA 2YCLB 3BXWA 3G8EA 3FJ6A 2NUWA 3FKKA 1BGAA 1ZJIA 8TIMA 4DJEA 3CV7A 2V63A 3ZWSA 1BXNA 4B4HA 3CO8A 1M41A 5F2IA 1G0CA 1A3HA 4DF1A 4E3VA 4CD6A 3HGRA 2PDMA 3RCNA 1MNZA 3HPXA 4C1NB 5C2GA 3AHVA 2C8NA 4C6JA 3NEHA 3ISIX 1UBPC 1LWJA 3AJXA 2WKGA 1M03A 4DO4A 1MVYA 1R30A 1SMDA 4JYEA 3RRXA 2FH8A 2WCAA 1MSSA 4TUFA 3CUJA 2YDAA 3SUSA 2RH9A 3QY6A 3CV2A 1K1DA 2OFJA 5BRPA 3LLFA 3CPRA 1XIDA 1J0YA 3G1FA 2FVMA 3CZLA 1VPXA 3L4XA 1XFBA 2BXZA 1KGUA 3UJRA 2G8ZA 4HSOA 1NWRA 3VABA 4UTLA 5XIMA 4AZ6A 2VWTA 4ZOCA 2CESA 3AIVA 3O9NA 3GAYA 4J27A 5LA1A 1KWGA 2NWRA 4HU0A 1V0LA 4M80A 2G3IA 1D7KA 4WUIA 1PEZA 4W85A 3E12A 4KCVA 3W87A 4GVHA 3A4WA 4B3ZA 2WMIB 3TSBA 4DZHA 3PY2A 3FDGA 3C2EA 4G5DA 3NQ8A 3QBUA 2V5DA 4PB5A 3L66A 3BGJA 2X1TA 2WKLA 1AW5A 5LA2A 4XAYA 1HNYA 3CZEA 1ZBWA 2FTWA 1RJQA 4H6RA 4YCOA 4PE8A 5EB8A 3E0FA 4ZOAA 3UR7A 4GQGA 5IHSA 3RN6A 4UFHA 3WQ6A 3PB2A 2MUCA 2DP3A 3R79A 5E93A 4B4FA 3FSUA 3W82A 1TV7A 1UC4A 4HPXA 1SFTA 2QVHA 3NO1A 3NNTA 1TUFA 1VIZA 3WDQA 1SZRA 2XWDA 2ACRA 1GEHA 3EAUA 5A8GA 1W1YA 5DXYA 3S5SA 1MXSA 5D9OA 3O6DA 1Q3NA 2WNWA 3PULA 4ICNA 1ICSA 3PC0A 1TJRA 2NUYA 4GG9A 3IRDA 2CETA 3F5LA 1TTPA 3IVSA 3QV7A 1QASA 1ZTVA 3LXCA 1ECQA 3IJ8A 3IANA 3T78A 2JEPA 1XYBA 3LTSA 1JDCA 2J7CA 4ZOBA 2LLEA 3URAA 4DZ5A 5AHMA 5A95A 4DYEA 3W7PA 5BYWA 4IMGA 2EXOA 2PLKA 1PHQA 1XSKA 3CUXA 1QPRA 3KL0A 2YKKA 1QI4A 2PU1A 1IXQA 3QQ0A 1HKIA 2NW0A 2VFDA 4F0MA 5J5RA 1ADDA 4LF2A 3T55A 2EGZA 3C3UA 2ZX9A 5D2VA 3UZWA 2ZUMA 2C1HA 4J3VA 4KETA 5C2XA 3QHOA 3ZR5A 3OU8A 1YPFA 2YFNA 3IJDA 4A8RA 2BLEA 1SW7A 1S2AA 4OKDA 4DJDA 3BL3A 4MHBA 2HXTA 3ARXA 3UJ2A 1IHIA 4IMDA 2ZWZA 3ZYZA 2VEGA 5DY2A 3TEVA 3CYVA 5HNTA 3IGXA 3WNLA 3SCUA 4EXAA 1S5MA 5G1YA 4YTQA 1UR4A 4RKAA 2WHJA 1TPC1 2BHYA 1KFJA 2WPBA 1R2RA 5I23A 1HJQA 4UTKA 3GNDA 1SZGA 2X1UA 1FXQA 1VEPA 5LKYA 3BAKA 4IMCA 1QWGA 2ZUSA 4DBDA 3W1PA 1BG9A 2VZOA 3Q67A 1ALDA 4GY0A 1R7OA 4GCAA 3ZSTA 1JFHA 4C6PA 4PTWA 4D6CA 3V36A 3VYLA 3UF9A 3LRKA 2YA0A 3MA8A 3T8LA 3TE9A 4HMCA 3CMJA 1XIHA 2XIBA 3UD6A 4AUBA 1NM9A 2C71A 5G2IA 1W0MA 2GVJA 3IGSA 3IIXA 4UMCA 3EDFA 3SW6A 4RE0A 2GFTA 4PUUA 6CGTA 3WJYA 4G7FA 3WH9A 1QT1A 2O9RA 3F2DA 1GOOA 2VT0A 3T05A 4P8UA 2YCLA 4H9MA 3MCNA 2J27A 1QI0A 1ZHAA 3HTWA 4ZQPA 2WSYA 3FXGA 1LZOA 4AYSA 2GVGA 3W1AA 3M16A 2PF8A 4DYKA 1GG0A 3WF2A 1DOSA 4LH8A 3MP5A 5FAGA 2RKXA 3CZJA 3MBFA 3QZ6A 2GL5A 1HKWA 3PZNA 4S2BA 3O0FA 2BXVA 5CG0A 3B9OA 4DF0A 1S5TA 3WG6A 1V3MA 1MUWA 3LHWA 2DSWA 3NPVA 1EHNA 1XLKA 1VFLA 3CV6A 3EEZA 3PB0A 1VBGA 1OGBA 1X96A 3DG7A 5EY5A 3AUJA 1QCWA 4F0RA 3R25A 1AMYA 1L9WA 4FZIA 2PRLA 2GJXA 7CGTA 2WZHA 3AIUA 1O1HA 4QISA 3PTDA 1E1FA 3UVAA 5CG7A 4RJEA 2D2GA 3VKDA 5AC6A 2DFAA 3GR4A 1HL2A 3CGTA 1KTBA 4NL1A 3W2JA 1UH2A 3FVMA 1WOBA 3TAOA 2ZRXA 2CKRA 1NQ6A 4ZL1A 4EP8C 1ISZA 2IPWA 3DHFA 3NDZA 4C6NA 4MPQA 3ZFHA 1TPFA 3RR4A 3KZPA 3NZPA 3DOPA 4HA4A 3EPOA 3GIQA 1WDDA 4MAVA 4Z1DA 1SYTA 1ZP3A 3QSRA 2O7SA 3C0JA 4I9JA 4V1XA 2ZVIA 4NILA 1EPXA 1JZ2A 3DAQA 4ZFCA 2CU0A 5LGXA 1IZJA 1BF2A 1EX1A 2DW6A 3H4GA 1UKOA 1TV3A 4L4LA 5CGTA 4JTQA 3PG9A 1TE6A 3O6AA 3S2CA 3MUAA 2CPUA 2QJMA 3RPDA 4RNFA 1S1PA 2HCVA 1YE6A 1FY6A 1TMLA 3FGCA 3T81A 2WSQA 3M1ZA 2FZBA 3ZVIA 1UQZA 1V6WA 2WVUA 5BZAA 3S5YA 4F9DA 3W0KA 3QY8A 3HJZA 5C7VA 2XPKA 5JUVA 1QI2A 3HPFA 2YBVA 3WQ4A 4NZ5A 3CLMA 4XZIA 1V93A 4ASTA 2A79A 4HU4A 2D3NA 2VFGA 1IT0A 1OC7A 1PX3A 3AFBA 1VYSX 5GQBA 2QQ6A 2ZDRA 5DELA 3KWSA 2NZLA 5C9UA 4IIEA 4JTEA 3B8WA 4WXYA 2DT2A 4DBEA 1RAKA 2QGYA 4E2DA 2J7HA 5A94A 4BCEA 2FPVA 1QU4A 3MB9A 3QPYA 1PBGA 1CDGA 3WNNA 3C6CA 2CXGA 4W5UA 3B0UX 3RPMA 3TOYA 2B81A 5I5RA 2V3GA 2PSNA 3O15A 3QV6A 3BJSA 4IGMA 3AWNA 4HZ7A 4EK7A 3DZ1A 3EKLA 3Q94A 1Y8BA 3TIMA 3NAVA 4IPJA 1UBSA 3JS3A 4X3ZA 3GTHA 1W1A1 1BSIA 4FP1A 4DYJA 3OLEA 2E6YA 4AZ7A 4K36A 3WZ0E 1OC5A 3HQOA 1C93A 4Q4RA 2IKIA 3BMVA 2FVKA 3VNKA 3H2FA 4TOQA 2QUNA 1CCWB 2RDWA 2Y24A 3LGEA 3MSYA 3O07A 3P61A 3GG1A 5I3DA 2YJQA 1W1PA 1GCYA 2IQ0A 2FYMA 4GA8A 1W31A 1L2QA 4GGBA 3NDYA 2CLFA 2WOQA 2QF8A 2A7RA 3P60A 5I00A 1NFPA 3WBAA 4RZBA 1UD4A 1F8IA 1FWTA 1SFLA 2QXWA 1FA2A 2PP3A 3Q2DA 1A80A 2CXEA 1KC7A 1U22A 4QEEA 3E5PA 3AHYA 1J2WA 2V5BA 3CZ8A 2QCCA 3GO2A 2UZ9A 4IXHA 2HE5A 4DZIA 2J74A 4CD7A 2NX1A 2QIIA 1C3FA 3L5MA 4PTXA 3NURA 2OT0A 3P8IA 3KVJA 1XDLA 3RM4A 3HPSA 2ZXDA 5AC7A 1MEWA 4Y6GA 4J2PA 2DORA 4X2RA 1LLWA 4AD0A 1GOMA 3WQ8A 3MI2A 1EJTC 4XD3A 4MM1A 4GIRA 3CHEA 1B54A 2PWHA 1OFPA 4YWSA 1WO2A 3PN8A 1EWDA 2Q8XA 1SU5A 2G3JA 3GHTA 2A5HA 4Y8FA 3LHYA 1B3VA 2DT0A 1E4MM 1TX0A 4XAFA 1SO6A 4DLFA 3R5EA 1M68A 2C1GA 4FXSA 1K3UA 1XIBA 3W53A 1JXJA 3UY8A 1EA9C 3PPHA 3RUBL 4IL0A 3KOYA 3Q37A 4QM1A 2QDHA 4JN8A 5CSSA 5BW6A 5KZMA 3TA9A 1IEXA 1U5JA 1MRAA 4MJ2A 4EXQA 5AKQA 1HJXA 3PG8A 1V02A 2VD9A 3VGFA 1R3SA 4PCPA 4QCEA 4Q32A 3BAIA 4R3UA 3WELA 1KWKA 5D9MA 4MWAB 4ZB0A 3LHVA 2W63A 1E3XA 1OX5A 4MNJA 2XYLA 3F4CA 1W9XA 1XIIA 2JKAA 1O5KA 4M5PA 3ITOA 1KRBC 4JX6A 4V2XA 2XSAA 2V5JA 1PDZA 1Q7QA 3VC6A 5LHEA 1V3HA 3LTYA 1XP3A 1O12A 3WLNA 3OZPA 3VOGA 4Q7BA 4EPBC 4ROPA 4N4QA 1UJPA 4NF7A 3WBWA 4LANA 1FBAA 4I5RA 4HCHA 3PAOA 4XQ6A 4XVDA 4NYYA 4F3HA 5ENLA 2DZPA 1WOAA 5A6TC 5J5DA 1UWIA 1EC7A 2A3AA 2CCRA 3TW6A 3M0YA 1MMFA 5H1WA 4MWAE 2Z2BA 3M0KA 5JVLA 2V5KA 3CASA 1MQRA 4FF5A 3I10A 3HB9A 4LUSA 3ECQA 3KBNA 2DVXA 4LVDA 1UH4A 1U5HA 4Q4QA 3W7QA 1BG4A 2IPJA 2WB5A 2X7VA 4PMDA 3VNYA 5IBXC 4D9PA 3CQ0A 4K39A 1IWBA 1FWRA 3TZFA 3SSZA 2CC0A 4HNUA 3TN4A 3COTA 3I6EA 1Y5VA 3AS2A 2CLHA 4HNOA 3GB6A 2A6LA 4XBSA 3VUPA 3CWOX 3WEOA 3FOKA 1WXJA 3LK6A 4QJ4B 3FJNA 4ATDA 4JD4A 4JTGA 3PZ9A 3KTXA 3ITYA 4PMOA 4KCWA 3VUSA 3LGDA 3QJAA 1TJ1A 3N18A 4N9DA 2FGBA 1L6GA 3TX9A 2C91A 2ICSA 4DAFA 1ZLPA 2R1KA 5FI8A 5EMUA 3CMFA 1C8QA 1PX8A 1D2KA 3SO7A 4PUMA 1A0CA 1MDLA 4MUPA 5DBUA 4IOTA 4NX0A 2O9TA 3K8KA 1Z9AA 4NX5A 4G1KA 4Q8TA 1SZFA 1UD8A 2J24A 3WY1A 1LQ2A 3PVFA 5ABHA 5CPLA 3W1TA 1V03A 3DFYA 3ZXWA 1E15A 1YTDA 4GY7A 5A6BA 3VIIA 2GWGA 4Q22A 4IT1A 2VURA 4LYQA 2GPTA 3CIXA 3V4BA 2WVVA 3AI0A 4IL2A 4KIRA 5E0FA 4QQ3A 3L9CA 3LPGA 1GHSA 2WVTA 1LL7A 3O6YX 1H09A 4L9XA 3M47A 3O05A 1TTIA 2Y1HA 2L5HA 4TIMA 4UMAA 3M5XA 1RZMA 5LSMA 2D73A 4YTTA 1HZYA 3ES7A 1EA0A 1IYXA 3FLUA 1F4HA 1GQLA 4X9YA 4JTHA 1KRCC 4LBUA 5A2AA 1TWSA 1VRDA 4GABA 2W5FA 4GI4A 4ZEPA 2PBGA 2PWGA 2OGJA 3AXIA 1M7XA 2FPYA 1OFOA 4P7LA 1JQVA 3C0LA 1JL8A 1T6MA 5CPTA 1F3EA 3W27A 3UZJA 3APGA 4O14A 5AECA 4P7QA 4Y9OA 3BMWA 4JEJA 1P1MA 5F1VA 1WDQA 3ZVHA 3I3EA 2YA2A 3QOMA 1VHCA 3B8SA 2Y6ZA 1MUMA 3O0KA 4MNLA 4RZ4A 3HMCA 3PK7A 4JFSA 2V2CA 3UZ5A 4BF9A 1RCOB 3KBVA 1O95A 4HOZA 2C15A 2G3NA 1DJGA 3R12A 1LM1A 1XPYA 2HTMA 2HEJA 3QKEA 3QR3A 3C2RA 3GG0A 3RG6A 5BXSA 1AZ2A 2ATMA 1EP3A 1XIEA 4L6OA 2VVNA 4E6MA 2EQDA 3EZ4A 3IIPA 2D3LA 4HJWA 3G1SA 2DW7A 1TZZA 2QMJA 3ATZA 1KFCA 1FWSA 3W3OA 1ME9A 1UP3A 5H8UA 1OD8A 3LPFA 3TVAA 4XZWA 4M82A 2J8GA 1V3JA 4LC8A 3KFTA 4AIBA 2E4TA 4IMFA 1XJBA 4EAYA 3PPFA 5IHRA 2V67A 1FWWA 3VAVA 2WSKA 3ZLGA 4FPSA 4GVFA 3ZT6A 2V3EA 1XH2A 1YBQB 4QE1A 5CSYA 5D2XA 2XVPA 2E40A 1B2YA 3VX0A 1YYAA 1NOWA 4DPQA 5CPNA 1P7TA 1C9WA 4YXGA 4JTAA 1WCGA 4GO8A 3W70A 2WW5A 4PMRA 5A5WA 3ITXA 1UWQA 3ZO9A 2DSKA 4OTKA 3PJXA 1DPMA 1JGIA 2UY3A 2WMJA 2WPGA 3LPPA 3NGJA 4MZ8A 3K5XA 4LCRA 3IUDA 1Q6RA 1N2VA 3MHUA 5GNYA 3GXPA 1CB2A 3NXFA 1W8GA 5LIXX 3IV8A 5BROA 4AH7A 3D46A 2EEXA 3IJ9A 4IPLA 1X7IA 3VD3A 1I6NA 2CLOA 2E6FA 1QI5A 1P7TB 3KL5A 3ABZA 3GD6A 1WBHA 3T09A 1IEVA 4JCMA 3SY1A 4Q8NA 4IIFA 3VVGA 4DUWA 1V6YA 4YVVA 2BB0A 4HPJA 3STPA 1RY0A 3BW4A 1YRRA 3WBXA 3BCJA 3USZA 2JFEX 4NJIA 2YCKX 4KWUA 4PTNA 3N1AA 1A5OC 1MYRA 3STCA 3SR7A 1R3QA 1KRMA 3S83A 1F4AA 4GYPC 3LQGA 3V16A 1Z32X 3A21A 2G0WA 3WQGA 1I9CB 3GH4A 1EOKA 4PFHA 3KOXA 2POZA 4GZJA 4KBXA 5JBFA 6XIMA 2XZ7A 1YXCA 3GG8A 3GH5A 2DSVA 5HJLA 3P62A 1P0BA 3ZOAA 3OW1A 4GNJA 4GZ7A 1KGXA 4PTMA 2VR5A 3GS6A 3BGAA 2XVLA 3L2IA 2D22A 3SUTA 3AS0A 4LBSA 3WH6A 1FWNA 2CLPA 2ISVA 3GNXA 4KIEA 4MADA 5JIPA 1SZNA 2UV8G 5AHEA 3E0VA 3S1VA 1WPCA 3GTNA 2CHNA 3M46A 1XH1A 4JQ4A 3P81A 1LL4A 3W1XA 5DO8A 3U4FA 1GQJA 4GJIA 1OCBA 1CEOA 4L65A 3RM9A 4LF1A 2Y5SA 2ZICA 3W07A 1FCVA 1UR0A 3TP4A 4PB4A 4JTSA 1IEQA 3N6HA 3WLHA 4AVOA 5DCDA 4OUIA 1KA9F 4QJ3B 4AHPA 4FR6A 4GYKA 4RNHA 1NQKA 4YYFA 3I3BA 2VQTA 3A64A 4NZCA 1FP8A 3MY9A 1UA3A 5CC7A 4FLSA 1MW1A 4WIWA 3T0BA 4GZIA 1FH9A 4S3DA 4GGHA 1P6CA 1XRFA 2NXGA 2VFHA 3M6DA 3WK1A 4LUIA 3GY1A 1UP2A 1AQMA 2Y61A 4GFIA 4E2OA 3SJ3A 1I2OA 3NDOA 4NJKA 1R6WA 2NUXA 2QYGA 3W2NA 3CJPA 1TQJA 4PBGA 5CH9A 2VCCA 4OJYA 3VDAA 1ML1A 4C6CA 3RO8A 4NRSA 4PUKA 4EOUA 4Z2HA 4FOJA 3W85A 5LNVA 3VNJA 1QNOA 1FCBA 3D3AA 2C14A 1HJUA 3E02A 1PDYA 3N2MA 2PUZA 4JZ5A 4DM1A 4O12A 1JCYA 1FFRA 3R11A 4B2DA 1Q85A 2WXDM 1MDRA 5LZLA 5GJNA 3LCFA 3WK2A 1XICA 4OOUA 3GVVA 3PBVA 5F4SA 3OLGA 2WZIA 4UR8A 3V75A 5A69A 4NI3A 5HXMA 4D6JA 3CUGA 4PMVA 4US5D 5D2YA 3VD5A 4M29A 4RE3A 4RL3A 3WFAA 3WDJA 2QV5A 1XRVA 2PC8A 5DQPA 3RO6A 1HF6A 4MY8A 1SVDA 2PDQA 3B8UA 2PTXA 4GX9A 2VGBA 4KEVA 4UBPC 1JJKA 1XLGA 4BA0A 1FKXA 5G1TA 2ODOA 1NTHA 5G2WA 1OK4A 1H0IA 3BW2A 3QLLA 1MW0A 4QRNA 3KDNA 2CFFA 4EVZA 1E9YB 3DYMA 3N17A 2PDHA 3TMQA 3KLKA 3KLLA 3RR1A 1SQ7A 4EWJA 1W8SA 1EDQA 2YDQA 5HJXA 1DJWA 4N9CA 2PP0A 2ZCGA 3KXQA 1RBLA 2YBTA 3BZJA 3LERA 3LRMA 1X6NA 3W6LA 3WCZA 1CNVA 1PX4A 3K4WA 3GVQA 3VINA 4M8UA 3SCSA 3TQPA 3LX9A 4S3GA 2PDYA 1ZBCA 5K9XA 4B5SA 4I7WA 4J9JA 3AICA 3NYZA 4ES4A 2FGLA 3MSGA 2PBOA 3YPIA 4EF9A 4B91A 3WLPA 2RFGA 9RUBA 5B7ZA 3R10A 2DGAA 3LQLA 5HWJA 3MQTA 3SCQA 4GOAA 1ZALA 3M0VA 3RLVA 4F2UA 3ZSSA 3MMDA 2FZDA 1CW2A 3V7PA 4TTGA 3LSBA 5H6HA 1E4LA 3VPLA 4CN1A 4I6KA 2XVGA 3V5CA 1EJVC 1JDEA 4CCEA 4XSMA 4H00A 2F9RA 3AALA 4TVUA 3PTKA 2Z25A 1I2RA 2Z1VA 4NP7A 1KCXA 4PMJA 1GJPA 2OJPA 4O28A 1RPKA 1J6PA 3UJSA 3EKZA 3A3HA 2WKJA 4IWWA 2WMKA 4Q4MA 1JZ5A 3S9IA 3VNMA 2E5BA 1Y65A 1QDSA 1H0GA 2FHFA 3CTLA 3SCNA 3RMJA 2VOTA 4BK9A 4ERIA 5HQEA 1B1YA 2ACQA 4AX7A 1VIWA 1VH7A 4D6DA 3EDKA 3MUZ1 4GUFA 4OZOA 3VX1A 1XS2A 2HROA 3GNRA 4Y2WA 1YPIA 3EX2A 3NQAA 2NXIA 3HGOA 3OTRA 3VILA 1NWUA 3WNOA 4JNZA 1JZ7A 3W01A 3M7WA 4HJFA 3BICA 4A29A 5AVNA 5IM51 3LNPA 4XWUA 1UZ4A 4LVGA 3PUGA 3MANA 4Q7IA 2D0HA 1KQZA 1WB0A 1P1XA 3JRKA 1GYMA 2H8XA 6TIMA 1EGVA 4XAPA 5I7GA 2QUUA 3NQ2A 2OLHA 2X2GA 4J3XA 1BFNA 5T8GA 5DLCA 3NQBA 2V2DA 3HZ3A 5FJJA 4UIOA 4JX4A 1KXHA 1S38A 2ABBA 1Q5MA 3A4AA 3ELFA 3FVDA 2PDBA 3WQVA 4MMWA 1NFGA 5F7UA 4ALDA 3IIOA 1NOUA 3N3TA 3P3BA 1R9ZA 3L4VA 5CPQA 4C1KA 4NZFA 2UY2A 5EMYA 5BU9A 3RJYA 3CHDA 1PKNA 4IISA 1B3WA 5LIWX 1XDMA 3K13A 2OYKA 1AL7A 1W3JA 3BV4A 3GFYA 2P76A 4WX2A 3VK5A 4AX6A 4FSAA 1TV5A 1JCXA 1OGSA 2H3BA 5HNRA 3PBUA 3OP2A 2RGLA 1O5XA 1QOXA 4BJHA 4AY1A 4E4UA 1HJVA 2QJNA 4Z1AA 3W24A 3OZOA 2NWSA 4XV0A 3Q4DA 4NASA 2Q3OA 4M19A 3LHUA 3VOJA 1H11A 1YNYA 3SQLA 2W0UA 4O1DA 1O5QA 2ZE3A 3S46A 5T9CE 3OQ8A 2UBPC 4ZA0A 3N9RA 4HCDA 2W6RA 4GI6A 1R86A 3IAPA 4PRWA 1OBAA 3GDKA 3L4YA 2A7NA 1J0JA 1NY1A 4LVFA 1OG6A 4ZODA 1QNQA 4O50A 5BRBA 1NARA 5LA0A 4J3WA 1QNRA 1Q65A 2ISFA 1Z42A 3LXAA 1GG1A 2DJLA 4DNHA 5D33A 3A4JA 3UETA 3CQKA 4GI9A 5H91A 3GXIA 3P5ZA 1OFBA 3BOLA 1DQUA 4NT0A 3UWYA 2J9ZA 5HWMA 5C2CA 3GIYA 1VJIA 3POHA 2ZX7A 3ZR4A 2GQ8A 2MANA 1YIXA 4NNCA 7ODCA 3PJUA 3THAA 2E5DA 2VC9A 3W29A 5KMYA 3WMBA 1ZGDA 3T4WA 1V3LA 3WQCA 2GVYA 2GDVA 4WJXA 4LXFA 5G4WA 4KWWA 4XO7A 1R3VA 3DHUA 4JTFA 4LRSA 4ILSA 1OC6A 4GFSA 1TMHA 3VD4A 1H3GA 2HNHA 1XW8A 4TO8A 1JEZA 3USBA 2DT1A 1R5YA 1JPKA 2BTMA 2J47A 2Y5JA 3VOHA 3BLEA 1TWWA 4XVEA 4EE9A 4H1ZA 3F1QA 4HTBA 3IK4A 3CL6A 2QPSA 2VM8A 4YJ5A 3LEPA 3ZVHB 9XIMA 5AC8A 4OV9A 4LSBA 2XVNA 3BLPX 2OYMA 3I6RA 3PP7A 3N4AA 1TV2A 2WBKA 4HYRA 3BJFA 4CU6A 1OK6A 4J35A 3RGTA 4BQ3A 4KQNA 2WSRA 4H3DA 3ARZA 3CIWA 4IPNB 2XUCA 4FEZA 3G1HA 4MB1A 3KDOA 3T2PA 1UG6A 2AKMA 3DCPA 4PCNA 3UA4A 4GI8A 2AL1A 5LIKX 1FFQA 2XFRA 4JTJA 3R7MA 3PFMA 3GFXA 3BLOA 1R85A 3TTSA 4IPIA 5EA9A 5EBAA 1S46A 4U33A 3SFWA 3VCCA 4S3AA 2X41A 4U5KA 5HWNA 5CAKA 5T26A 3N12A 3OLIA 1QPKA 4DX3A 4F0LA 2ZUTA 4ZQMA 1HN1A 1XLLA 1ITCA 5I79A 1MW2A 2FGZA 3DFPA 3O06A 3LMYA 4WGXA 1E71M 4P7RA 3THUA 2FPTA 4LAZA 3ZMRA 4R53A 1GVRA 6TAAA 2VEIA 3BG9A 3A24A 2GSHA 4L1WA 3H23A 3RPTA 2WJFA 4MSSA 3REQA 1O5RA 5LNUA 1PTAA 2I9EA 1A5KC 1YTKA 4OGZA 3GU1A 2XH7A 2F7FA 2P50A 4KEZA 4JCLA 3VCNA 2BOEX 4P8WA 1A0EA 1GNXA 2VC7A 3GYEA 2H90A 2WZMA 1S3HA 4GC4A 1WX0A 2ISDA 3OBKA 1BWLA 1KNWA 4H7VA 2CZDA 1Q6LA 4M1RA 4R85A 1W91A 3CB3A 1BLIA 3AUOA 3MZNA 3EWZA 4HK5A 4HOWA 3R1ZA 5FJOA 1BEUA 1IT7A 3HG3A 1OCJA 4NU7A 1XBZA 3T2QA 2V38A 1VENA 4R27A 1Q8JA 2GUUA 3FY1A 3VGDA 1P0KA 3BC9A 3UEQA 4PRTA 3KS6A 1NF7A 4TX9A 1X1OA 3EX3A 5REQB 1OEPA 1EBHA 4Z2KA 3B4UA 2VEFA 2VRQA 2VC5A 1P4CA 1UH3A 3G1AA 2HS8A 3SADA 3LV5A 4XTIA 5E09A 5AYBA 2WWDA 5FESA 1H61A 5G5IA 1ZRQA 4F2TA 1VR6A 1YPXA 3C2OA 2I7GA 4GC3A 2POTA 4JTLA 4KT2A 3WYZA 3DHDA 4HK6A 1KM3A 3KCLA 5TNVA 4L56A 1X1ZA 2ZZ7A 1PCKA 2YL5A 2YCJA 4N0RA 5DN1A 1SMAA 3WMSA 4L4OA 1Q8AA 3E6EA 1H7OA 3L5LA 1RLCL 1PHWA 1WKYA 3WD2A 3AU2A 3H55A 1MQQA 1O4UA 1AD4A 3NQ6A 4FALA 2Z1KA 3H22A 1KXTA 3W2LA 1E73M 1FWCC 5IDZA 3AHZA 1AW2A 2E6AA 2R6OA 2WJDA 1W3LA 4C5ZA 3KBMA 1W1B1 1REQA 2P1FA 2E9BA 2R9RA 2BOGX 4Q6JA 3MI3A 4KESA 3WF4A 1R47A 1KM5A 3VMPA 4L1XA 3TMLA 2KX9A 4S23A 1BWKA 3G6MA 5HJYA 4MNKA 1UZHA 1Q63A 4WGHA 1MW3A 4A4AA 4YN5A 4UTMA 2BVTA 1N8WA 1OQFA 4WVXA 1DIKA 4WCJA 4IFKA 2NT0A 3PZTA 1SFSA 1E1CA 3LHZA 5FOOA 3PJWA 3UNDA 2G5WA 2C1IA 3NQCA 1OYCA 4F0HA 2IQDA 1KCZA 4AEEA 2F6XA 4JIPA 3W7MA 3R0KA 3LCHA 2WANA 4D6IA 4MB4A 1IZCA 1K77A 1H7PA 4CVUA 4HHMA 2Q71A 2A7PA 3VE9A 3SI9A 1H1NA 1H50A 3OJGA 3A6OA 3GNNA 2QR6A 1KV5A 3F5KA 4B3LA 4B5NA 2VXNA 3P2VA 8RUCA 1EJUC 2QZRA 3GXNA 1JXKA 5DRCA 2WJEA 3PPCA 1PB0A 2OWWA 1OWQA 1H1YA 1EJXC 3FK4A 1TPUA 3QZEA 2FB2A 5JH1A 4AHQA 1DWAM 2O55A 4O1FA 2BODX 3BQ6A 4K1WA 2NQHA 2FVLA 3W26A 1RCQA 1U83A 1E5NA 2X1RA 4KEUA 3BSHA 1M53A 1J11A 1DJXA 3LBMA 3ZS4A 3EOUA 2XH2A 1BRLA 3KW3A 5D4YA 1WDRA 2TAAA 3S4TA 3LBCA 2F2HA 3QVQA 4MYXA 3SAZA 1SUXA 2FDMA 5I07A 1TCMA 1JD9A 3TTYA 4AYGA 2E5CA 1GZ1A 3L4ZA 4MWAC 2VJXA 1XIGA 3I7SA 4Q3MA 4F40A 3L12A 3GU2A 1UR9A 3M43A 4AWSA 1QMLA 1ZPTA 2PC4A 2VZSA 2VCBA 3I4KA 4JQAA 5E9AA 3H21A 1PZ3A 4NJGA 4HA1A 2ON3A 3TJIA 3L5AA 4YIWA 4JPGA 1OSEA 2E1DA 3DGBA 3N29A 3WDIA 3M6YA 5K4ZA 4Q8VA 3RU6A 1V51A 1C8VA 5G1MA 1IXOA 4PSRA 3IGUA 2WMHA 5GNZA 4FIRA 1LP6A 3WLSA 3GXTA 3PBMA 4I90A 4H8NA 3DKJA 2Z1XA 3ITCA 3M64A 4QFUA 1FWGC 2GJNA 2Z2AA 1FUYA 1WP6A 2OOFA 3N13A 1QR7A 4FLRA 1EQPA 3EPMA 3KRSA 3MC5A 4PSPA 3TN5A 4AZCB 1D9EA 3H12A 4W9TA 4C7GA 1PKMA 2OLAA 3WNPA 4I5UA 1CBGA 2Z26A 2PLJA 4UTUA 1X7FA 4P5UA 2IXVA 1QO5A 4LX4A 4CQ9A 5CBIA 3T07A 3W22A 2J88A 3BMXA 2FIQA 3LS9A 1LTDA 3G0UA 3MSDA 3DYOA 4OECA 1MO0A 4FXFA 4L6HA 4KS0A 3ZR6A 3GNOA 4ATLA 3KCJA 4GNKB 4NHVA 3UWEA 2BDQA 2HDJA 5K4XA 4GH1A 5D9NA 3PZUA 1JCTA 3EKGA 3NM1A 2FMNA 1W1ZA 3NQDA 3SDOA 1AH0A 3HV9A 2I16A 4LAKA 4Q4PA 1A47A 1XYMA 1BKSA 1QW9A 4IZGA 1IEIA 1QPQA 1QWKA 1XKYA 2BX7A 3V0UA 1BYCA 1QBAA 3W7IA 3WD0A 3C86A 2ZX6A 4PTVA 2ZVRA 3UNTA 1H7RA 4NIRA 5FKYA 3N4FA 1LJYA 3UW6A 3QH2A 3I65A 2OKOA 1IF2A 2WC7A 3DFTA 3S5OA 2F38A 4JNYA 1OFAA 2QCFA 3W7CA 4HKPA 3V35A 1CB7B 4MGGA 5HMDA 1XGZA 1AL8A 1J93A 4Y9PA 1SJCA 3BLLA 4HMNA 4INFA 3AYTA 4ACYA 3TYDA 1Q2RA 4QE4A 5ABGA 1PVNA 1RUSA 5K3VA 1CGXA 1O1ZA 1Q7MA 3W2KA 3AAMA 2Y8UA 4IP5A 4WHBA 2D69A 3B97A 2J7BA 3THDA 4ZXLA 5ABFA 1C90A 1J5TA 3NCOA 3BJTA 3VKCA 2BVDA 3N3MA 3JUGA 1ADSA 3OO2A 2IQTA 2WWCA 3U5UA 3EDEA 1SO3A 3C3NA 5I09A 1MI3A 4F79A 5I77A 3N11A 1W5QA 3UYIA 4GBUA 2ESCA 2VCAA 3LTPA 4JYFA 1P0NA 3FS2A 3MKCA 3TSMA 1KFEA 1IE7C 4BI5A 2DSUA 1NH6A 2VWSA 3NVDA 2JEQA 1TELA 3NZGA 4HD5A 4O0ZA 4NAFA 3QV9A 2A3CA 2RDXA 3STEA 3K4DA 3QGVA 1LBMA 4GVIA 4IG2A 4L80A 3H6OA 4ZMGA 3M0JA 3LCIA 1TPH1 1ZS2A 4GBDA 2X40A 2GLKA 2W4XA 1X8CA 3EXSA 1GVIA 3CAVA 5IFPA 1KFKA 5FL1A 2ALRA 1KV8A 4ZZ9A 4OVXA 5LYRA 1B4EA 3WQWA 2C6QA 4DUOA 1RH9A 1SO5A 3QXBA 4ZSTA 3E38A 1PYFA 4C6EA 3TR9A 3Q65A 4O10A 4XBJA 1IGWA 2P3EA 4EPEC 4MY1A 2P53A 1E6QM 3KHJA 3P82A 3OVRA 4M1BA 3SIZA 1UPMB 4BFAA 1LRQA 3O16A 1TJ2A 3C2VA 3C4UA 1HKVA 1DJHA 3LD5A 3MCMA 3S5NA 2CNCA 3I68A 1TREA 4LUSB 2ZRZA 4NAEB 1TKKA 3EYPA 2X8RA 3EWUA 4Z0JA 5A8QA 4MLRA 2OO6A 1AQ0A 4U28A 3TLQA 4URIA 4X9SA 1D3HA 5IFTA 1NFBA 2ZBTA 3OYZA 1NOFA 4M7TA 3VTRA 4ADUA 3CBWA 3B9DA 4DELA 3GXDA 3ABRA 3UPMA 1UWSA 2C18A 3NTYA 4L9YA 2W3ZA 3EA3A 3A3WA 3VOCA 2CZ5A 1QHOA 4N4PA 2O56A 1TV4A 3C0QA 5G2HA 4AISA 4FXJA 1DYSA 4IG2B 4H8HA 1C9DA 4F2BA 5DCEA 1POKA 2DZBA 3UG4A 4X61A 2C13A 2W27A 3FN9A 1QAPA 3TTEA 3MZ2A 2PDFA 3LUTA 4HSHA 1RVGA 4J4KA 4XAGA 1JNEA 2FZMA 3NL3A 1HVXA 4JIQA 1FWHC 1DXEA 2PWUA 3SFKA 4ZR8A 1J79A 3KOFA 5BCAA 3MS8A 1B3ZA 2DEPA 1OG0A 2A3HA 3H8AA 5D30A 1WUEA 3TQ0A 1G4PA 3TYZA 2YPIA 1H60A 4XIAA 2E8ZA 1HIZA 1RD6A 1PE1A 5EMKA 1KO0A 3EBVA 3WQDA 1XCFA 1MWOA 4CNOA 4K68A 1LDCA 1XHGA 5H2ZA 4AHOA 3AU6A 2E1WA 1TVPA 4CN6A 3HG4A 3SM0A 3M4HA 3ITTA 5M03A 1QNSA 4XZMX 3TYBA 4K37A 4NVTA 3WLTA 4AIEA 1WAWA 1Z7AA 4Y8EA 5CBJA 1OCQA 2B4GA 2J25A 5DMYA 3RMEA 4PFMA 2I5GA 4YTUA 2OELA 2CERA 2JGQA 4GXPA 3B4YA 4W89A 4BI7A 3LBOA 1NDVA 2NLIA 3OZMA 4MPKA 4LAOA 1GVSA 3M9YA 4H9ZA 1XIJA 3G77A 5XINA 4XB3A 1ONWA 3IVUA 5KZDA 2TODA 2A6NA 1L6FA 1TRDA 3KOZA 1IIGA 3UJFA 3PBYA 4CQCA 1E3ZA 2BHUA 5IOBA 3R6IA 5LIYX 5CLTA 4HSNA 1VF8A 1R2TA 1U5VA 3W74A 4IIHA 3GRIA 1TRIA 2QJGA 4I9MA 5FJTA 4XKMA 5MHBA 1B3OA 3NSMA 2DVUA 3LI0A 4C6LA 1ZZMA 4GQBA 2GDUA 1ITQA 1S2WA 1RA5A 3L67A 4IFOA 5D2TA 5D2WA 3BOFA 1ENUA 2GJPA 3G5EA 3HFYA 1XLMA 2Z7KA 3W28A 3ANUA 1XFCA 2IS7A 3HQNA 3D47A 4W7UA 4Z2IA 3N2CA 3LM3A 3R43A 3APYA 4IMEA 3MTWA 1GZJA 2VEKA 2NV9A 3QR1A 1Z3NA 3L2LA 4LTSA 4PUJA 4HOXA 2KAUC 4J3SA 4UOZA 2CWNA 1XSJA 5CC3A 4XZBA 5DEZA 1E0WA 4JKKA 3CH9A 1NF0A 1IEWA 1QATA 3VIOA 3CS2A 3T44A 4PCSA 3DECA 3DU0A 4HPNA 5IBXA 3A47A 4WJEA 1OT1A 4LNYA 4CQ8A 2YW4A 3U7VA 3L4TA 1J2BA 5FSEC 4MG4A 4S2CA 1A5AA 4FK9A 1LUCB 4O57A 5J04A 1NP2A 2AQVA 5EKYA 2QEZA 3CO4A 1W2PA 3CZGA 4K8GA 3S6OA 5D37A 3NPUA 1TUXA 2BWGA 1VFMA 3B0XA 5RUBA 2DZSA 2CW6A 2KZHA 2BOFX 4D8LA 4AY7A 3QFWA 3UY7A 3QM3A 5GNXA 1RY8A 3TYCA 1VFUA 5FJIA 5DANA 3HPZA 2DPEA 4PEEA 1TB3A 1BD0A 1OX6A 3S9YA 3GLCA 3M07A 4PRRA 2HV5A 4AWEA 2JGYA 2XHYA 3PNUA 4UTWA 4XIMA 4LY8A 1LG2A 3GDMA 4K8HA 8XIAA 4UQBA 3IIVA 4G8TA 2NQ5A 4EAMA 3T1GA 4A05A 4MVAA 1SR9A 1JCMP 2W67A 2EG7A 4AZIA 2Y7DA 5J8LA 1J6OA 1DV7A 1ZAHA 4W7VA 4XKYA 4WRHA 3SJNA 2YOCA 3VFCA 4AD5A 4DRSA 3CAKA 2PWEA 1HQTA 1V0KA 5CSUA 2PS2A 2G37A 2Z24A 2BBFA 4LY4A 3BCDA 1M7OA 2CIPA 4UOQA 4GINA 2WMIA 2QT3A 3RX3A 1RHCA 1A5MC 2GGIA 3AMKA 3U2OA 1PWLA 2ZRYA 3FGCB 1XLEA 3SCVA 5CGMA 1KM6A 3ABQA 4CNSA 1UKQA 3II1A 2G4FA 3S6TA 3KVLA 1WBJA 3DH7A 4KW2A 1EGZA 1YXYA 3TCSA 4RPPA 3P7YA 1GKQA 5I3GA 2GK1A 4AZ5A 3AIEA 4FS9A 4XUGA 3QC0A 4UFIA 1ZJHA 1XG4A 1KCKA 4R34A 3URBA 1BTMA 1BF6A 1V7YA 4ZENA 1J01A 3EOSA 2PGRA 1B3XA 3QW3A 5C55A 4ZTYA 2A3EA 1VBHA 4PCTA 2PLCA 3LHTA 2XIJA 4GUGA 3OBAA 4Q4OA 3B06A 3K30A 4H9TA 3KX6A 1NDZA 2EPLX 4QDWA 1AH4A 3GVWA 5ABEA 2SFPA 1IXNA 3EOEA 4XG1A 3NQMA 2GVEA 3DFOA 2HISA 2R14A 3GFZA 1RLDA 5SWUA 3B05A 1US3A 1GTHA 3HJEA 3WK3A 3AIWA 3E5BA 4EWND 1YE4A 3ICJA 1AQHA 2VDHA 5MKGA 4I8YA 2D0FA 3ZT5A 2VGFA 2X0SA 1TPB1 2ANUA 3AXHA 3VXGA 1HP5A 1F05A 5A6MA 1Q2SA 3B8IA 1W6TA 4LVAA 3CTTA 2J79A 1YLVA 3LOTA 1GPWA 4UQ9A 1JPDX 3NGFA 3L4WA 2ZZ2A 4GNVA 4Q8WA 4V15A 2YYUA 5JU6A 2J77A 4LUJA 2Q09A 4EIVA 2YZ5A 1JZ8A 1XLJA 2R24A 3AMLA 4CNNA 2PAJA 4B9ZA 4FOKA 4ZO7A 5D8ZA 2V3FA 5BU6A 1F9CA 3VGEA 4QCFA 2PURA 3SCRA 4ROQA 4FMVA 2C7FA 1LYXA 3WLJA 4DZAA 3VC5A 2W66A 1DTUA 4PGLA 1DJQA 2ZUNA 4L64A 5I06A 4DJED 2XTKA 4JIIX 1WKFA 3ARQA 1EUNA 3A13A 3W23A 2Y8VA 1ITUA 3NZQA 4ML9A 1PS9A 1VCFA 2CEQA 3NO3A 3SN0A 3QMTA 4G1NA 3R8GA 2YL8A 1NSJA 3KBWA 3LV6A 1JNDA 1H7WA 3SCWA 1UD6A 2EJ1A 4WY0A 1TJPA 1YMYA 4QROA 2Z00A 2VELA 2DIJA 2XFWA 2A2IA 2JE8A 5AHFA 2X0HA 1GVYA 3W7GA 1RBOB 5I3KA 3MVTA 4D2JA 2Q8LA 5AY7A 3TXZA 2YZRA 4DO6A 2GQAA 3LENA 5KITA 3TTOA 2D24A 3CHFA 3F2CA 1DJYA 3PFRA 1K8YA 3UWWA 2XM1A 4PODA 4TV6A 5F2GA 2NVDA 4US6A 4XZNX 1T8QA 4HPGA 7TAAA 4FAMA 3H7RA 1XLBA 1LUCA 1FTXA 2J66A 3SRHA 2QCNA 1HW6A 4QNEA 5I3HA 4XZHA 3L0KA 3P6LA 1G69A 4QP0A 4XKYB 4S39A 1GUVA 1WE5A 3VNLA 1CYGA 3APTA 4KCTA 4MWAA 1FWDC 1BYDA 4NNBA 2DZVA 1J96A 3T4CA 2ZXBA 1OINA 1L6WA 4PYSA 1UQYA 3HPAA 4EF8A 4AC1X 2I56A 5IDIA 4B3KA 3UXIA 1KM1A 2WAGA 1QJWA 2EO7A 2H9AB 1G1YA 2TMDA 1ZBKA 3VGGA 4UQCA 3WF0A 3H2MA 2X7WA 1GW9A 3IVTA 5FEZA 4FNPA 5ABFB 1AA1B 1E6PA 2RDUA 4UCGA 5BOEA 2J8FA 4LV9A 3I7RA 4F66A 1X6UA 1RJPA 2Z2UA 3LZ5A 2JF6A 1JFXA 2QDEA 2WK2A 4REQB 4GYFA 2VYOA 4XAZA 1FCUA 2INFA 5CPMA 4MY9A 3CL8A 2XGZA 4DO5A 1Y5XA 1E0VA 2BY2A 4D6FA 4A35A 2F84A 2E25A 3QR0A 4H83A 4H9UA 1Q7ZA 3UZYA 1QBBA 3KUMA 5I02A 3M5ZA 4AXKA 5HMSA 4AD4A 3D6NA 1PIGA 3N2BA 2XN0A 2QJIA 1TZ7A 1TG7A 3QMSA 4UFJA 3VKKA 8XIMA 1A5CA 4AVNA 3R0UA 4JQ1A 4D72A 4MJMA 5LXEA 5H8MA 3WLOA 5G4HC 3C56A 2JK2A 1ZU8A 1EXBA 3RK8A 2ZADA 3W7EA 1W37A 3GC5A 4IP7A 3WJZA 1NDYA 3TXVA 1G7VA 3FIGA 3MP3A 3HFTA 1RP8A 2XINA 4Y9MA 3WJXA 5CGQA 3CYJA 3UPWA 4UUIA 7PTDA 3R94A 4GRSA 4KWOA 4RK8A 5C9XA 4RDWA 5FD0A 4DAIA 2YBUA 3WDPP 1H49A 3EDJA 2FTPA 2D2OA 2D23A 4JX5A 3UR8A 3I3DA 1LCOA 3FDKA 1ZJBA 3SUWA 1FHVA 2O0TA 1L6YA 5HDRA 1DQXA 2Z0IA 4Z17A 2V30A 3SN1A 5MF5A 1GOQA 3TV8A 4QG9A 1TFVA 1NVMA 4UTHA 2R82A 1JIBA 1ICPA 3RU8X 1DIDA 1QPOA 1XUUA 1S2CA 3BE7A 2PDJA 4WDUA 3ITVA 5B7YA 1BSLA 3IJ6A 4P61A 3IEBA 3W88A 4S1FA 7REQB 1UWRA 4BHYA 2GOKA 4A8IA 4BI6A 1ME7A 2IKJA 2I1OA 1AJZA 2BVWA 2ZA1A 2ZX8A 1G9HA 1W5OA 2VDIA 4JFVA 3T6CA 5KZEA 1I2PA 2AL2A 4O1CA 1J12A 3R8HA 2VGIA 3ARSA 4Z1YA 2G95A 1L8PA 4OE7A 3RM8A 3XISA 4HNTA 1FXPA 3LYEA 4LW7A 3A23A 1N8IA 4XX6A 1JAKA 2DU2A 2DZWA 4X0VA 1CGUA 1J0KA 3A3XA 2PWFA 2G4JA 4JHMA 4KWSA 4HK7A 1VQTA 4OWGA 2EPMX 3BG3A 3SRFA 1OFDA 1KTCA 5D8WA 1Q6GA 2E8YA 1AMKA 3FSTA 4BR1A 1V6TA 4JR5A 4LS1A 1IQ8A 3NEVA 2DUZA 3OA5A 3SY5A 1GWJA 2DSZA 3WUEA 2QMKA 3BVJA 3W2MA 4FHAA 5HATA 3NVTA 4QS5A 2Q6ZA 3FFSA 3IK2A 4H9VA 2QAPA 3VI2A 4WK9A 2VX7A 1NU5A 2O7QA 1FWBC 4GQRA 4HN8A 4IJBA 2INZA 1E51A 3POCA 1JZ4A 2DY3A 3NPWA 1KFLA 3L2MA 1RVKA 2EG8A 3P84A 1CGTA 1W9BM 3MDUA 3H4WA 2EHHA 3NXLA 2PTWA 1XD0A 1CENA 4WOZA 4IIBA 4A3HA 4ZOEA 1UKSA 2DQXA 2DZAA 2Z29A 3BOXA 2RAGA 3LA4A 1JUBA 3LGGA 1FDYA 2VRJA 5HOSA 4FLOA 4JQ3A 2Y4SA 2C16A 1GOKA 1BGGA 5GJPA 4NAFB 3SCPA 4P7OA 1VBUA 3QYSA 3IACA 3KVKA 4RZ6A 4M6PA 1U2YA 2PDWA 3GUGA 1G6CA 4KWVA 1R38A 4IPPA 2NVCA 1D7FA 4S3BA 1EO7A 4GZEA 3MU7A 4FB7A 1TV8A 2GQ3A 3LSCA 1GTEA 3PZOA 3WQ5A 4O4WA 4IFKB 2BHZA 3GC2A 3VA8A 4F48A 4GPNA 5AOUA 3GZ3A 2VKZG 1D3GA 2BY1A 1CIUA 1JF6A 1LRNA 1HFBA 3PSWA 4ZQNA 3OB8A 2WHLA 3GYCA 3U2CA 1X1NA 1A50A 4YLWA 4YS1A 5GVJA 4LALA 2MNRA 4ERGA 4LFYA 5F2LA 2ZDSA 2ZUVA 2I57A 3IRSA 2Z1WA 4PL1A 2RGMA 1AW1A 3QQWA 4BF5A 1DHKA 4WKFA 3T0TA