3Q94A

The crystal structure of fructose 1,6-bisphosphate aldolase from bacillus anthracis str. 'ames ancestor'
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
285
structure length
285
Chain Sequence
b'MPLVSMKEMLNKALEGKYAVGQFNMNNLEWTQAILAAAEEEKSPVILGVSEGAARHMTGFKTVVAMVKALIEEMNITVPVAIHLDHGSSFEKCKEAIDAGFTSVMIDASHHPFEENVETTKKVVEYAHARNVSVEAELGTVGGQEDDVIAEGVIYADPAECKHLVEATGIDCLAPALGSVHGPYKGEPNLGFAEMEQVRDFTGVPLVLHGGTGIPTADIEKAISLGTSKINVNTENQIEFTKAVREVLNKDQEVYDPRKFIGPGRDAIKATVIGKIREFGSNGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase, class II
publication title The crystal structure of fructose 1,6-bisphosphate aldolase from Bacillus anthracis str. 'Ames Ancestor'.
rcsb
source organism Bacillus anthracis
molecule tags Lyase
total genus 100
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3q94A00
3NOEA 4K8EA 2A0NA 1H7OA 3GYEA 3S5OA 4X22A 1P5BA 1G7VA 4OHQA 5KZMA 3MO7A 1YDOA 1MEWA 1V5XA 5KMYA 1B4KA 1FUYA 1IGSA 3IGUA 2NUYA 4A22A 4KFPA 3QZEA 3L66A 5MHBA 3FKKA 1XDMA 4X2RA 1PL9A 1SZGA 2AQWA 1JUEA 2GUUA 4LUIA 5D2WA 3S1WA 1LRNA 1WOAA 4IUOA 4WY0F 2PRMA 3WK0A 3W88A 2VC6A 5FF7A 2ZTJA 5J5RA 1L6SA 3R13A 4HPJA 2JGQA 2LLEA 5LNUA 2QCNA 1YPIA 5D02A 3O16A 3U6WA 1V7YA 3W7IA 2Y88A 3E9AA 5HULA 2QCMA 2ZRXA 3TSBA 4MFEA 3G1FA 2E5BA 5HMSA 4JIQA 1F6KA 2G96A 4RV8A 4LS2A 1YXYA 1XL9A 3VI2A 1KLYA 1NAL1 4QIUA 4ZQMA 3LHYA 2BSLA 5F1UA 4JTSA 1IXPA 4X3ZA 3S6DA 5FI8A 3TA6A 1MZHA 3QM3A 2UV8G 1IXOA 4UFMA 3TXVA 1Q3NA 3QRHA 5U4NA 1XCFA 3VE7A 1ZCOA 3W87A 3CWNA 1VYPX 2A4AA 4N4PA 4QISA 2C6QA 3N9SA 1MSSA 3GDKA 4QQ3A 4BK9A 4U28A 5D2TA 1OX6A 3PBWA 2DZWA 4MYXA 3T4CA 3ABSA 3THAA 1YDVA 3GNNA 3PG9A 1IIHA 1H60A 5DBUA 1A53A 1QFEA 2VELA 2PC4A 3R12A 4JGDA 1EIXA 2XN1A 3H53A 4RCXA 1WAUA 4JR5A 5HNRA 1EPXA 3TXZA 2X1SA 4UMAA 1I45A 1A5AA 4L4MA 3CLMA 3LLFA 3O15A 3PBYA 5AYXA 4GUHA 2VFDA 4O57A 3B0PA 1JUKA 3TR2A 3ATYA 3ZR4A 3PWAA 3WJYA 3NPUA 4MFDA 1GQNA 3MWAA 1KM2A 5K3VA 1KTBA 1FY6A 2C1HA 1PS9A 2JKPA 1UCWA 3LXBA 3P62A 4LVDA 2J27A 3MBFA 3BARA 4AH7A 4ORIA 4BWLC 2XN0A 4PL1A 4NNCA 4GWEA 4JX5A 4MPQA 2KZHA 3NQ2A 1RVGA 3G8EA 1PV8A 1NF0A 4IX0A 3GLCA 1XDLA 3HMJG 5K2ZA 4JYFA 3RLUA 5CSRA 1SO3A 2JBMA 3RLVA 5CG7A 2YSWA 2A5HA 2B7PA 4JN6A 3W7OA 1TSIA 2IQTA 2V2HA 2CZDA 2YGYA 1MEHA 4O15A 4RX0A 3P67A 2C18A 3FS2A 3VCRA 4LOCA 3G1YA 3HJZA 3P8JA 1R2RA 1P0NA 4LV9A 1WXJA 3Q37A 1XXXA 1XI3A 2OZ0A 3B4UA 3GK0A 5K9CA 1M7OA 4K38A 3DXIA 3GR8A 1JULA 3S42A 1SZFA 3LCXA 4HNVA 2ZRWA 4IGHA 1R46A 2YYTA 3NNTA 1LLWA 3FEMA 1FQ0A 2ZDRA 1ZAIA 1CW2A 2HTMA 1OYBA 1SQ7A 1UASA 4C1LA 2EKCA 4K6AA 3B04A 3W70A 1F05A 3W2MA 4MKNA 3PY2A 1K02A 5LZLA 3RFAA 1HO1A 1ZALA 1SZNA 2ZA1A 3C2FA 3M5ZA 2QCLA 2Z6JA 3GXTA 3F4WA 4XUGA 5BOOA 3R8RA 3BW2A 3GKAA 2P0OA 1L6YA 2CZFA 2E77A 4KWVA 3CQ0A 4WOQA 1BWKA 2ISVA 3GNDA 3MP4A 1J4EA 1D3HA 3PR2A 4OV4A 5AC8A 2J6XA 2CZ5A 1WV2A 2NLIA 2YW4A 2VFFA 2V81A 1GVOA 1AW5A 3RF9A 2ZTKA 3A24A 1YYAA 1I2OA 2GJLA 4IOTA 1H7PA 3TQKA 2A6LA 3W75A 2WJZA 1FCBA 1A5BA 4NJIA 3NM3A 3O6DA 2ZZ4A 3E12A 1LBMA 3BW4A 4K7YA 3T7VA 5FEWA 4FNSA 5K4XA 4NUWA 4O0ZA 1AW1A 4AMAA 3PG8A 4LWWA 3W2JA 5SWUA 5H91A 5U7SA 3PSWA 2WSQA 8TIMA 4OQVA 1QO2A 2A21A 1TRIA 4GJ1A 2Q3OA 3S1XA 1TPVA 3NL2A 3W1PA 1QWGA 2DZPA 4UTHA 3NPWA 3RNDA 1YLVA 4NXSA 3T78A 1IXNA 1RD5A 5TIMA 4NQ1A 3M9YA 2G95A 4M7TA 3BO9A 3UZJA 3PBVA 3TAOA 3S1VA 3W2LA 3PC0A 3LV6A 2VEIA 3I68A 1TRDA 4JIPA 5CPLA 3K30A 5HINA 1NSJA 1ZNNA 3IGXA 1QPNA 2X1RA 1T96A 1ME9A 4GUFA 1VPXA 3HG5A 4DBDA 4WY0A 5KITA 3UXDA 4KKXA 2FLIA 5LNWA 1JCLA 4WOZA 2Z6IA 4HN4A 4N6EA 3E96A 1OK4A 3NM1A 3W7CA 4CQAA 3WJSA 2X2GA 4XQ6A 3EXRA 2P1FA 2WNNA 4UFIA 2EGZA 5LNVA 4MY1A 4U4MA 3NL3A 5K7JA 3W73A 1X1OA 4JD4A 4JTKA 1GJPA 1VYSX 3PM6A 3FOKA 2BLEA 3SFKA 1VCVA 3N73A 1BKSA 5CPOA 5AC7A 1TYGA 5D04C 3SIZA 4OV9A 3W7NA 5CZSA 2YR1A 1FWNA 2CLEA 3LRMA 1W3TA 4JTHA 4Q33A 2F84A 1KW1A 2FJKA 1TJRA 3LHVA 4RLIA 4O52A 4Z1AA 2ZRZA 3M1ZA 5K9DA 5HUPA 1OFEA 2C3ZA 3EWUA 6ALDA 3S9YA 3GZ3A 1I8JA 4EVZA 3TV8A 1LP6A 4IX2A 3L68A 1EWDA 1TPH1 1BEUA 2FB2A 2J24A 4N9EA 3IEBA 4Y90A 3N3MA 1ICSA 3D0CA 3GX9A 4Z1CA 4BR1A 4LVFA 4BFAA 1XBVA 3QMTA 4Q4KA 2B7NA 3BK0A 4Z1DA 1KLZA 1UB3A 1EP3A 1ALDA 4K7VA 1BWLA 3TU9A 4J9JA 4Z1BA 4HSNA 3W1TA 4E38A 1EWEA 2ISSA 3O8AA 4IXXA 2NUXA 5KINA 1OYAA 4RZ4A 3BLIA 5L6UA 4G1KA 3ABOA 5G2IA 1KFEA 3P82A 5G2HA 1YTKA 2Q8LA 5C5YA 3NA8A 2OCZA 5AYZA 1CX9A 4B5NA 5J5DA 1DQXA 3G0UA 3BVJA 5G4WA 4JEQA 3M5YA 4FIQA 2PCQA 1GOXA 2R91A 3LHWA 4H4IA 1QPOA 1IXQA 3DKJA 2GPTA 4RZ6A 3SSJA 5DCEA 3NQGA 1FDJA 2CLFA 3OA3A 2TRSA 3SY5A 4JY9A 1TTQA 1SUXA 3W23A 2EAWA 2CFFA 2QUUA 3I7RA 5D09A 5HWNA 3MJYA 2OT0A 1TB3A 3HG2A 4UTLA 4O1AA 6TIMA 1W3NA 3LCGA 3SR7A 1WBHA 3S1UA 4CQ9A 3L0GA 1TTIA 5EMUA 4TO8A 3KOFA 3P60A 3LV5A 3HPZA 2V2CA 1LZOA 2BZNA 4WX2A 3PUOA 3AJXA 3NR0A 4UFJA 3IIOA 1ZJIA 1LLZA 3NQ8A 1Q6LA 2CZEA 3TK7A 3G3MA 3TSDA 2VFEA 1X8FA 1H5YA 2AAMA 2YZRA 4UMCA 3WJWA 2WOQA 1LTDA 3I65A 4HSOA 2YFNA 3ABQA 3USBA 4TMBA 3KFTA 1J2WA 3A23A 1F74A 4FNTA 1H62A 1DOSA 3GR7A 4O28A 4I7VA 4GE8A 1FCVA 4JYDA 5CZTA 2VOMA 3L0KA 1J5TA 3TFCA 3QMSA 4XWUA 1RV8A 1TTPA 3IIVA 3L0NA 4FXSA 1OJXA 3S5NA 4RXGA 1K7FA 3G1AA 1QDSA 1XBXA 2DORA 2YCEA 4WJEA 1TV8A 3KRUA 3LDVA 4NJKA 4POCA 4R33A 2NV1A 1H1ZA 3BW3A 4O0KA 4FEZA 3CWOX 1SFLA 1UUMA 1GVRA 1DBTA 2ZRVA 5I3KA 1FWTA 1OF6A 3KVLA 3W2KA 5DY3A 5D2VA 5D03A 3QPZA 4LVAA 4ADUA 2VXNA 3L5LA 3GXNA 1H50A 5FEZA 4GUIA 3DI1A 4OU1A 4O54A 5LKYA 3CHVA 4PODA 3I7QA 1EA0A 4O4WA 3HOJA 4CCEA 2NV2A 2W6RA 4DQWA 4O4VA 4CNNA 1K8ZA 5AN7A 3O07A 4JDBA 3C2VA 3N34A 3LBCA 3NZRA 3W84A 1W5PA 2TPSA 3CPRA 4K8HA 2W0UA 1ZAHA 4Y96A 1VGAA 4N2YA 5DLCA 2FPYA 1GYLA 2ISWA 3TE9A 3ANYA 3V1PA 1UUOA 2QDGA 4ZQRA 5EYWA 4NJHA 5LNRA 5TQLA 3MW7A 3GDRA 4O17A 1ICQA 1LRTA 2QCFA 3C6CA 3UWUA 4WXYA 2NZLA 3L21A 3QW4B 4JY8A 5DELA 4AF0B 1GPWA 3MBDA 1Z44A 3M43A 3UYCA 3LM7A 1D3GA 1NEYA 5HWJA 4CNOA 5DY2A 5L9FA 3P74A 1WYIA 3A5VA 2CW6A 1TQXA 4DF0A 1K3UA 2GVLA 4AHPA 3CB8A 4GUJA 5FEXA 3W1LA 2GQAA 1DORA 5LHFA 1N7KA 3LHUA 2ZFAA 4DO5A 5FESA 3CC1A 3O6YX 3IVSA 3OG3A 4M19A 1F2JA 2GVGA 1SR9A 1LRQA 3LCLA 1ME7A 3NPXA 4L4LA 3EWZA 1PIIA 2ZZ6A 2HS6A 4YLWA 3LHTA 4AB4A 4IPIA 1RR2A 4LV4A 5C55A 1QCWA 1L9WA 3N19B 4KFNA 1QOQA 3FIGA 3QYQA 1C29A 5LHEA 1I2RA 2ZZ3A 3W7LA 2V9DA 2YPIA 4MIMA 2TYSA 2ZZ1A 1EP1A 1I2NA 3F4NA 4QNWA 4LRSA 1P1XA 3G8RA 3LOTA 3HG4A 3M6YA 3UD6A 3QFEA 3QQ1A 3QF0A 5DCBA 4O12A 2A6NA 3W7JA 2A1YA 2CWNA 4UTTA 2NWRA 3QJAA 1Z41A 4WY0B 3NQVA 3W7RA 4LUJA 3H54A 1LOLA 2QCHA 1I2QA 1NFBA 2V5LA 3C4UA 4NXKA 5D05A 2OT1A 1F6PA 1B4EA 3HIJA 5AYYA 1FCQA 4NVTA 4TU1A 1RPXA 1OX5A 5BMWA 1OFDA 3C0JA 2VEMA 1FWRA 3P8IA 3UPWA 4DBEA 4OGZA 3UZ5A 1VYRA 3MP5A 3Q94A 1SO5A 1JCNA 4EOUA 5F2MA 3DFTA 3NQFA 4LY8A 1VCGA 1FBAA 4LTSA 1JQXA 2GQ8A 3IIZA 1GEQA 1OF8A 2C19A 1PHQA 4LW7A 3ZFHA 2YW3A 5A5WA 4O14A 3NXFA 5KSWA 3OVPA 3W7QA 4K39A 4O19A 5FF0A 3KXQA 2A85A 5F2IA 1Q45A 3W7KA 3S8HA 3M16A 3A9IA 4JTTA 2EHHA 3NQDA 1TPEA 1EUNA 2VENA 3P61A 3S0CA 1LCOA 3DBPA 1VC4A 1W5MA 1W1ZA 1SSGA 4UR8A 3NG3A 4O1CA 1GTHA 3TIMA 5DN1A 3TC7A 4E0CA 1FCUA 3YPIA 4IMCA 2B4GA 2OMAA 3MHUA 4R53A 1G67A 3P7YA 1H61A 3O06A 4ORMA 3W7PA 3C2EA 3TROA 4TX9A 4LNYA 2A7PA 1A50A 4UNLA 1KV8A 1W54A 3H55A 3CIWA 4NT0A 4AHOA 3A22A 3PS7A 1H7WA 1MEIA 5D2YA 2FPVA 4JICA 3TUUA 2DZVA 1JCXA 1DQWA 4PA8A 4MJMA 1L6WA 3U8GA 4DO6A 1B9BA 3M41A 3DI0A 5DBTA 3EX3A 3LI1A 4DO4A 4XKYB 1DL3A 3C2OA 1AMKA 4IPJA 2NX9A 3B0VC 3F03K 5F2GA 4N9DA 3SGUA 5E0KA 3NQCA 4XTDA 4ZQOA 2NXHA 1ZY9A 3TDFA 1X1ZA 2V2DA 3W7HA 4AF0A 4HPXA 1A5SA 1SW3A 3OVQA 3SI9A 1W5NA 3TAKA 1TTJA 3C52A 1TPB1 2BXVA 4TR9A 3P81A 3NGJA 5CPNA 3TX9A 3C2RA 1YDNA 3NYZA 5I3FA 3ATZA 3QW3A 4RZ5A 4A2RA 4PCFA 1AG1O 3JS3A 5KZEA 3QSRA 4UTUA 5AHNA 2DZSA 4JYEA 2B0MA 3HGOA 1K03A 1QO5A 3GB6A 1LM1A 4IMDA 3DGRA 3WJXA 4UFHA 3UWWA 3BPWA 3HB9A 3W1RA 3QEZA 1GVSA 3EWBX 1Q6RA 3KRSA 3TSMA 1TREA 3TQVA 1ME8A 1SFJA 3P5ZA 4TMCA 4IMFA 1G6CA 2X16A 2NUWA 1BTMA 5IBXA 4ZQNA 3GDMA 1CI1A 1HL2A 2O7QA 1K8XA 2D73A 2XFWA 1R47A 4Y6GA 3R5EA 3TNOA 3HGSA 4QAIA 1GG0A 4QITA 3SECA 3I6RA 2O7SA 5FF2A 1OFQA 2ZQ0A 2VFGA 4Y8FA 2VFHA 2ZRYA 4TIMA 1O95A 3QQ0A 3DHFA 4S2BA 2X1TA 3LCIA 4IXHA 3N2MA 3SGZA 1PVNA 1WQ5A 4FNRA 2QCCA 3GVGA 1KV5A 3IV3A 1HO4A 1WX0A 3IVTA 5ABTA 1W56A 1XUZA 2VFIA 4E2BA 3C8FA 3BGGA 4DF2A 1R2TA 2G5WA 5BNKA 2FPTA 3W1XA 1R30A 2CLIA 3A5FA 3QPYA 4MZ1A 3EEGA 2FTPA 2VEKA 2RFGA 4JXCA 1X6UA 3T44A 2E09A 3EWYA 3GKFA 4FF7A 2FQIA 2JGYA 3TW6A 3NL6A 1GTEA 3DZ1A 4YCPA 1P4CA 3LCHA 3GDLA 2QJIA 3L2IA 4HKPA 3UWVA 4JTLA 3DHDA 2WO5A 3IIXA 5CGQA 3IRDA 3LTPA 2EF9A 1F73A 1OFOA 5E1QA 2RKXA 2AGKA 4FIRA 2XN2A 4Z0JA 1MXSA 1OK6A 1O4UA 3HBLA 3TKFA 5F4SA 4ZMGA 1YPFA 3BG3A 4O53A 3DH7A 2PE4A 3M7WA 2V82A 3TFXA 4UTWC 1W3IA 1AL7A 4FX7A 3TJXA 1AL8A 3QMRA 1KM1A 4LT9A 1SSDA 4ALDA 2C13A 2PRHA 1KFBA 2Y7DA 3E0IA 3W6YA 3W83A 3WJZA 4O50A 2A2IA 2J88A 2QAFA 3NPVA 3PSVA 4R34A 3G18A 3HPSA 5G1YA 1W5QA 3FFSA 2DU2A 5AHMA 4ZQCA 1KFKA 4UUIA 1EUAA 1QPRA 3LI0A 4GBUA 5DXYA 3EX2A 1DJNA 3ABRA 3P5YA 5F4WA 3PF3A 2Y70A 3W86A 5CZ0A 4XKYA 2CLOA 5K4ZA 3P84A 2J9XA 1PCWA 4QJ1A 1VLIA 3E02A 4WQ6A 5AHIA 3MI3A 2CU0A 4RJEA 2NX1A 1WDWA 3LB0A 4UTKA 1QNVA 2ABAA 4LS1A 4X9SA 2Y62A 4MJZA 1NVMA 1RQHA 5CPMA 1M6JA 5C6MA 3UY7A 1JRBA 1ZAJA 2TMDA 3CU2A 2ZRUA 1EEPA 2C14A 3KX6A 3W71A 3W9ZA 2WKJA 1ONRA 1QMLA 3B06A 1TO3A 2BWGA 2VEPA 3G1VA 1TV5A 2YXGA 1THFD 1S3HA 4JTEA 3NL5A 1OX4B 4DEFA 3UWYA 1HG3A 2E1DA 2ZBTA 4FHAA 1ADOA 5G4EA 3PUEA 4PH6A 3OEXA 2Y7GA 3GIYA 1TQJA 2DZUA 3B05A 2CLMA 2FB3A 3MHGA 1QPQA 4LC6A 1TPFA 1QOPA 5F2LA 1WA3A 2ZZ2A 1AK5A 4Z0SA 3WK1A 3MI6A 4UXDA 3FJ6A 4YMZA 3EB2A 1B57A 1VH7A 3W74A 2ATMA 3DFOA 1TCDA 4RK8A 1JCJA 1JVNA 3DFPA 1KBIA 4NU7A 4M6PA 4UFLA 3BV4A 1DVJA 2Y85A 5FEPA 1TJPA 1IIGA 1Q6QA 1I4NA 4JNMA 4O10A 5I3IA 1KTCA 3R89A 4EF8A 5AC6A 1ZHAA 4YWIA 1D9EA 4H3DA 3AO0A 4HHPA 1G7UA 1T8XA 4XZ9A 4I7WA 5FF3A 4O13A 1TPWA 2Y7EA 3FJLA 3KVJA 1KA9F 5HR7A 2ZZ7A 1F5ZA 4UNKA 3W7MA 4P2VA 4MYAA 1XFBA 4OE7A 1FWSA 3VE9A 5D33A 5EBUA 3PB2A 1Q6OA 1U5JA 3OIXA 4M6VA 1B3OA 4JTFA 2QCEA 3B0UX 2QUVA 4BF9A 1YXDA 1SW0A 2Q3RA 3MHFA 4LVBA 3M47A 3L65A 3NQMA 3LX9A 2QCGA 1H63A 2TSYA 2GQ9A 4LVGA 3I7SA 4XTIA 4UCGA 1YXCA 4EF9A 1JCYA 1O94A 5DXXA 3W2NA 3W07A 3VNDA 4AHQA 4LRTA 3HG3A 2QDHA 3CTLA 1GYNA 3VKJA 1OYCA 4FNQA 3RK8A 3L5MA 3FLUA 3TJLA 5G2WA 3TW7A 4O18A 3LXAA 3HQ1A 4HIBA 3NO5A 1R2SA 5C2XA 3SZ8A 4UMBA 5CSSA 4CNPA 4A29A 5AHLA 2CLLA 2HS8A 3UPBA 1AW2A 3CM4A 3LLDA 3W7DA 1I2PA 2A7NA 3W1QA 4JX4A 4JTJA 3U2OA 4DXVA 4O1DA 1HFBA 3RMJA 4LU0A 1PCKA 3S5ZA 1GVQA 4UR7A 3Q2DA 4WXZA 3FYPA 4HT3A 1KM3A 5AOUA 1H1YA 3W1MA 4GC4A 4UTMA 3UXAA 3W7GA 2RDWA 2ZA2A 1L2UA 2WNQA 4ZQPA 4OBTA 3WK2A 1TPUA 2QCDB 1S5WA 2GOUA 3N2XA 1NF7A 1K7EA 1G4SA 3KRZA 2V8ZA 1JRCA 1H7NA 3BLFA 1LYXA 2BX7A 3QSTA 3L67A 3TH6A 3EX1A 5EA9A 4FXRA 2H8ZA 1N8FA 3NEVA 1RZMA 4GFSA 4FNUA 3B03A 5LGZA 4GUGA 4S2CA 4AWUA 4I9AA 5LNSA 1LOQA 1SO6A 2NX3A 3W7EA 2E5DA 4HNUA 5LGXA 4GXMA 4QM1A 1KBJA 4IQLA 1MO0A 5I3GA 4Q32A 4WZHA 1OABA 4GNJA 3MYPA 1GT8A 2Y61A 1WOBA 3Q58A 2DJLA 3W1AA 4NNAA 2QJHA 4MOZA 3CEPA 1OX4A 4JS3A 5F4XA 4DELA 1DKWA 4XBSA 4YL2A 3NQAA 5AB3A 3GDTA 3G0XA 1E51A 3EKLA 2RDUA 3GAYA 2R8WA 3NZ1A 4R7JA 1Z42A 3HF3A 1VS1A 2DZTA 2QR6A 1SO4A 2C0AA 5HR6A 3C61A 2GVJA 4AEOA 1G4EA 1KM0A 2F7FA 3HGJA 3EX6A 4QSHA 2QUTA 4ONVA 4HNNA 3LTSA 4FO4A 3W1NA 4Z08A 4ZL1A 3ZWTA 2WSRA 1JQVA 3GAKA 3BG9A 3DFSA 1KFJA 4AVFA 3CT7A 4A3UA 2I1OA 3M5VA 5IBXC 2QAPA 5D30A 2H8XA 2HMCA 3TMQA 3S5YA 2J9YA 3SJ3A 3PUDA 5HUOA 1PHWA 2G97A 2ZA3A 3BLEA 1DHPA 4ADTA 1ZENA 4IWWA 3F1QA 4PFMA 1F76A 2CLKA 2E68A 1YTEA 2R94A 1FXPA 4AWSA 4MY9A 3O05A 4AWTA 1JR1A 4JTIA 2V0TA 3O63A 4IJBA 4C1KA 2OJPA 1KFCA 1OVDA 3KVKA 1TPDA 3VFLA 4RR4A 5I3JA 1GWJA 1O60A 3O1NA 3W3OA 3E49A 3KAOA 4FNPA 4OT7A 1TV7A 2FIQA 3G1SA 3TC6A 4NZFA 2Z1BA 1SW7A 3DKLA 3M44A 3W22A 3LHZA 3EXSA 1VR6A 3ELFA 3G1XA 1QAPA 2ATSA 3INPA 5BMXA 4PC8A 3BG5A 3MMTA 5AHEA 2H90A 3G0SA 3DFNA 1TIMA 2W79A 4NX5A 1XM3A 1EX5A 3MI2A 3B8DA 3WFAA 4O11A 1EB3A 5CKSA 1HTIA 4MZ8A 5EY5A 2X30A 5EKYA 2E6YA 3MYOA 4P61A 1G4TA 1O5XA 4MLJA 1JJKA 3JR2A 5IM51 5EPDA 4YXGA 2GJNA 5D37A 1G4PA 1YTDA 2J9ZA 5AHFA 2E6FA 3G22A 3G3DA 4M6QA 1JUBA 3OHIA 1FX6A 3A21A 3C56A 3W72A 4DF1A 3KHJA 2P10A 4XBKA 3NDOA 3PB0A 1U83A 3L5AA 4H6KA 1W37A 1H7RA 2Z0IA 3HGRA 3STGA 4UC5A 1HUVA 2JKAA 2Z2UA 5HQEA 1UJPA 4N02A 1TMHA 1EP2A 3PVFA 1QR7A 4YCOA 1ML1A 3DU0A 4N9BA 3SW6A 1ZFJA 3NVTA 2WSYA 3LTYA 4BWLA 3G1HA 4JTUA 1LORA 1FWWA 1KM5A 2Y7FA 4LS0A 2FDSA 2RDTA 1W8SA 4E2DA 4MY8A 4D2JA 1KFLA 2QCDA 4MVAA 4EWND 1VJIA 4ADSA 3HO8A 3T40A 4CQ8A 2WQPA 4S1FA 5C54A 2CLHA 4JDYA 5FF4A 1XC4A 3ZWSA 4BI7A 1XKYA 4NNBA 3BGJA 2E6AA 1N55A 2ALDA 2Y89A 3V75A 1LOSA 1F7BA 3G24A 3IIPA 1FDZA 4PL2A 4QNEA 3TCEA 2E6DA 3M5XA 4AXKA 5T26A 5BRBA 4IMGA 2ABBA 3IGSA 1KM6A 2VKZG 3ZS4A 3PULA 3PBUA 4A21A 4WD0A 4BI5A 4O16A 4CCCA 4I7UA 2JK2A 2I14A 2OX1A 2H6RA 4UTJA 5HWMA 3LRLA 3OVRA 4OWGA 3EWXA 5CZJA 1VHCA 5D38A 4ICNA 4FX8A 4M7SA 1LDCA 3TQ0A 1Y0EA 4HNTA 3DFQA 4N9CA 1W5OA 1XBZA 3EXTA 2PRLA 1JCMP 4ZVJA 5GVJA 3QH2A 4ML9A 5I3HA 2A7RA 3NQ7A 1IF2A 3IVUA 3N14A 3P80A 5DCDA 3LRKA 4JTGA 3STFA 2B7OA 3UQNA 2H3DA 4WUIA 3LGEA 1VQTA 1OFRA 2HSAA 1GG1A 1OFAA 1A5CA 1P0KA 5F1VA 3UWZA 3JRKA 1T99A 3GXPA 4MUZA 2PURA 4UFKA 2DJXA 1LBLA 1VCFA 3TMLA 1WBJA 4JX6A 3W2UA 4W9TA 1LROA 4RXFA 2FFCA 5K9XA 4CCDA 1DV7A 2Y6ZA 5AFDA 1SPQA 2Y63A 3FYOA 4PEKA 1FXQA 4O1BA 3FKRA 1H51A 2QF7A 4M5PA 3UNDA 2YDAA 1W31A 2NXGA 2ZZ5A 2C16A 1PE1A 4UIOA 3W1UA 5G1TA 2R14A 3WK3A 4MLRA 1VLWA 2QKFA 2YYUA 1M5WA 5D2XA 4KWWA 1C9DA 5G5IA 3L9CA 1G69A 2DP3A 1RQEA 7TIMA 4NJJA 4ZZ9A 1VHNA 2YX0A 3LXCA 3LERA 2E5CA 4KFOA 1KTNA 5H2ZA 4O8RA 5KTLA 2RHGA 4GRSA 5EL1A 3THQA 1VRDA 2DZXA 1W0MA 3W85A 3UY8A 1C8VA 2WPBA 4K36A 4FX6M 1T0OA 1GZGA 4N4QA 1OFPA 2JKEA 4MZYA 5BW6A 3STCA 1K7XA 1K8YA 2ZYFA 3MP3A 1LBFA 1SU5A 1RQBA 4LC8A 1OFBA 2QJGA 1X7FA 3KVMA 4AAJA 1YADA 5D32A 2C15A 2ZCGA 3LCWA 4EIVA 1S5TA 2YFOA 3C3NA 4RKAA 3UWQA 3QC3A 3STEA 1UBSA 4N6FA 4UTIA 3FA5A 3NQ6A 4NZJA 1OHLA 1Z48A 3G1DA 3MUXA 2NWSA 3N9RA 4DPPA 3O6CA 2RH9A 5LSMA 1ICPA 1S5VA 3M0ZA 4CLMA 1SZEA 4A2SA 2NXIA 3HPXA 5TBOA 1H7XA 2I9EA 1OG0A 2X1UA 5A8GA 1GVFA 2H3BA 4BI6A 3DAQA 3OBKA 1XBYA 1FDYA 4Y9AA 2Q8ZA 1VZWA 1M7PA 1O5KA 2V5BA 3DENA 4UTTC 3RU6A 5HJLA 3T55A 5KZDA 4PTNA 3EWWA 1TPC1 4NX0A 3CEUA 4UTWA 3NQEA 4NJGA 4FB7A 2BTMA 3LBMA 2EPHA 3EKZA 2WV8A 1XUUA 3W76A 4DPQA 2WNZA 5E93A 3NAVA 2QEZA 3PAJA 3LCFA 1KM4A 4IMEA 3EX4A 2V30A 1DJQA 3R2GA 3CIXA 2B7QA 4K37A
chains in the Genus database with same CATH superfamily
3LD5A 1EOKA 4K8EA 2A0NA 5EBAA 3AS0A 3CH0A 3GYEA 1X6NA 3S5OA 1P5BA 2ZICA 1V3MA 4GQQA 1YDOA 2PU1A 1QT1A 3WO8A 3ZSSA 2NUYA 4KFPA 2D1ZA 3SQSA 3LU2A 1PL9A 2AQWA 4MMWA 5D2WA 4Q7BA 1LG1A 4KBXA 1WOAA 3MSRA 4WY0F 2BY1A 1XF0A 2VC6A 5FF7A 1S1RA 4NRSA 1L6SA 3R13A 1XLBA 4B2DD 4DYEA 3CTTA 2WQDA 1IEIA 4J3XA 3O16A 1V7YA 3W7IA 3SUSA 2ZRXA 4I9MA 4ZENA 1IHIA 2PZNA 3ARRA 4IUGA 1F6KA 1EZ2A 2ZXBA 3T81A 3VI2A 1KLYA 1NAL1 4LJ3A 4QIUA 2O4MA 3AYTA 5FI8A 1XPGA 3R58A 3WQEA 2BS9A 3UA3A 1EPVA 4H7CA 3VIFA 2Z1KA 1XCFA 2J8FA 3CAKA 1MQPA 2WSPA 3W87A 4J5NA 3CPUA 1VYPX 2C6QA 1POKA 4TX6A 1MSSA 1C8YA 3GDKA 4QQ3A 4BK9A 4YHGA 1UZDA 4HGXA 4MYXA 3M0HA 4NAFB 5CGTA 1ONEA 4YN5A 1ZQ5A 1QFEA 2VELA 1TWDA 3GDBA 4JGDA 4ZB0A 3V5OA 4IG2B 4JR5A 5HNRA 2V63A 3TXZA 2X1SA 1NWSA 2R1KA 4IIBA 4L4MA 3CLMA 3LLFA 1QI0A 2BHZA 1OT2A 2D0HA 4AISA 5AYXA 5BROA 1K9FA 5FJIA 5T8GA 4V33A 1JUKA 3VDHA 2YXOA 1Q6GA 3PWAA 3REQB 1GQNA 3MWAA 4CU7A 1KTBA 2C1HA 3VKKA 3ES7A 1UCWA 3NSMA 4MNKA 3BARA 3VILA 2X8RA 2XN0A 4PL1A 4GWEA 3STPA 4MPQA 3D46A 3LK6A 4AIEA 2FGBA 2WHKA 1X96A 3RLUA 1G0CA 5CAKA 1UZ1A 4JN6A 4Q4OA 1JNEA 1Q8JA 3UBPC 1GK8A 1C8QA 3W81A 3DOPA 3WLOA 2C18A 2J25A 3FS2A 1U30A 4LOCA 5FCZA 3BQ6A 1A5OC 7TAAA 3DG7A 1E55A 5XIMA 5F7UA 3I10A 4BCEA 4P7OA 1XI3A 3V3WA 5K9CA 6CGTA 2DGAA 3S42A 2ZRWA 1R46A 4L65A 1DWIM 3FEMA 1FQ0A 3XISA 3CJPA 1LUCA 1JZ5A 2AKZA 1UASA 4IGNA 4XIAA 1GW9A 3W2MA 4C7FA 3WF1A 3GNRA 1K02A 1J12A 3B8SA 2VVNA 3C2FA 3IWPA 3F4WA 4XUGA 3S3GA 5BOOA 3GKAA 2CZFA 4GYKA 1BWKA 1UD8A 3MP4A 3N6QA 1J4EA 4GYFA 3M0LA 3TN3A 1W9UA 2PZ0A 2YW4A 1P7TA 2V81A 1OIMA 2VD8A 4S3EA 3RF9A 1FP8A 2ZTKA 3GHUA 4GI9A 1YYAA 2GJLA 3TQKA 3FAWA 5H6HA 3ZQ9A 4AYGA 1A5BA 2O4QA 1RUSA 2ZZ4A 3T7VA 1LBMA 3BW4A 3E2RA 4FNSA 1I0BA 3GXDA 3H7RA 1QRQA 3ID7A 2WVVB 3PG8A 4MB4A 2VZUA 2IPFA 2PA6A 2WSQA 4WKFA 2REQA 1R3QA 2Q3OA 3S1XA 3VD7A 1TPVA 3R7MA 3M46A 3NL2A 4GJJA 4TQTA 1WXYA 3W1PA 3I3BA 4UTHA 3VPLA 3FHQA 1AJZA 4RE0A 3WNNA 4YTSA 4MJ2A 3UG3A 1LF1A 4CD8A 1TWWA 2X1IA 3BO9A 1J10A 3TAOA 4KT2A 3W2LA 3PC0A 3RLHA 4BF7A 1ZP3A 2ZKMX 1TRDA 4JIPA 4L56A 5CPLA 1AZ1A 4G1NA 5HINA 1NSJA 1ZNNA 4L5ZA 3IGXA 5REQA 3F4DA 1NWTA 5ECUA 2FKPA 3HG5A 4GIAA 3UXDA 4P7LA 1V4YA 2FLIA 1GVEA 1L0PA 2F2KA 2GOKA 3CV6A 3TYZA 3WEMA 4JFUA 1YNQA 3EXRA 3ARWA 4UFIA 3G6LA 5HDRA 2EGZA 3NL3A 5K7JA 4JD4A 4JTKA 2KAUC 1EX1A 4ROQA 2PODA 1Q7MA 4MG4A 4OV9A 1MFVA 2YR1A 1AQMA 2CLEA 4JTHA 2OGYA 4LAKA 5I07A 2HK1A 1TJRA 4GYPA 3LHVA 1V0NA 4I5UA 1FWDC 4MB5A 1AJ2A 5HUPA 3VUPA 1XGEA 2PTDA 4OVXA 4BY3A 3KUMA 3FA4A 3TV8A 2Z2BA 2P0IA 3L68A 1BEUA 1ZSXA 3N3MA 4Q6JA 3CQHA 1TG7A 6PTDA 1UWRA 3QMTA 4Q4KA 5CZKA 1WDSA 5FJOA 1A80A 1XYMA 1KLZA 4Z1DA 3QHNA 2HVMA 1ALDA 1HQTA 2GL5A 2CKRA 1R3WA 4J9JA 4QQUA 4E38A 5KINA 3ONCA 4RZ4A 3BLIA 4G1KA 1KFEA 2OZTA 3AU2A 3EDKA 1TELA 3WQWA 3EYPA 4ZA0A 3GG1A 4FR1A 1F3XA 3PZ9A 4XV0A 3MUZ1 1VRXA 1GOXA 4MJ4A 1ITQA 2PWGA 2PF0A 3QKEA 4JY9A 5EU9A 2XH7A 4FLSA 3DC8A 5HWNA 4LCRA 2OT0A 2Q71A 3HG2A 4QDPA 4UTLA 3NQBA 3DGBA 3SR7A 4ES4A 4PMNA 1SJDA 2TAAA 5BU6A 4TO8A 3KOFA 3LV5A 1XC6A 2V2CA 1LZOA 3AJXA 3NUKA 4UFJA 3WL1A 4ZGYA 1AQHA 1Q6LA 2BG5A 2ZADA 2WAGA 3KFTA 4FNTA 1H62A 1Y8BA 3DYMA 3GR7A 4I7VA 3OIHA 4EANA 1QNOA 5CZTA 3L0KA 4DVOA 4M3PA 2WC4A 3QMSA 4XWUA 1RV8A 3IIVA 3R6IA 3L0NA 4FXSA 2WKGA 4QE4A 4NP7A 3G1AA 2YCEA 2GQ3A 1H1ZA 3SCTA 2IKJA 4JZ5A 1DHKA 5I3KA 1BRLB 3KVLA 4L64A 5D03A 3QPZA 1D7KA 1BFNA 1KFWA 1J6PA 2YL6A 3CL8A 7REQA 5LKYA 1J0HA 1HP4A 3HURA 4CCEA 5FL1A 3S2NA 3KLLA 3R11A 3O07A 1MXGA 1V8EA 3RR4A 3MZ2A 4TXEA 1SJBA 1LJYA 4C6MA 2WLYA 4Y96A 4HD5A 1DE5A 5I0DA 1GYLA 3PTMA 1W9PA 3KEHA 3V1PA 1UUOA 2QDGA 4ZQRA 5EYWA 4O17A 1LRTA 2QCFA 3BOXA 4PB5A 2NZLA 2F6XA 4OOUA 3THUA 1PAMA 4JY8A 1DJIA 4AF0B 1GPWA 1E70M 2E67A 1Z44A 4NHVA 1RY0A 4DJEA 3CHCA 2QVHA 2OPJA 1XIDA 1XIJA 3ZVHA 4IIFA 2VEGA 4PRWA 2CW6A 2VD9A 1JFHA 3EDEA 1RCXB 3S4TA 1K3UA 2QGYA 1LWIA 1WZKA 4GUJA 5CC5A 4ML4A 4AD2A 1N7KA 4DO5A 5FESA 3CC1A 2J13A 4QG8A 4M19A 1M9HA 4NYYA 3MMDA 1SR9A 1ME7A 1BF2A 3NPXA 4HTYA 2HS6A 4ZTXA 1B1YA 3V0UA 2V9DA 4MIMA 4GOAA 2P88A 4WDTA 2WYSA 4QNWA 4E5TA 3GUWA 3B4YA 3CHFA 4XISA 1LQ0A 3DX5A 4B16A 1OGGA 3QFEA 2DFAA 4AD1A 2A1YA 3VX1A 3TN5A 4UTTA 1ZTVA 3CMFA 5AC4A 3NDZA 1Z41A 3W7RA 3ZSTA 6XIAA 4EPDC 4M1RA 1M01A 2V5LA 3DEQA 4NXKA 3QY6A 1B4EA 1V0KA 4IPPA 2OTDA 4O8AA 3H8AA 4LEFA 4NVTA 2OEJA 4TU1A 4UQBA 2HPMA 3BL3A 2PDHA 1FWAC 4F40A 4Q4MA 1FWRA 3P8IA 4OGZA 3KBVA 1XYCA 1IV8A 2P3EA 1E0XA 3M0IA 5F2MA 3DFTA 1PB0A 2PPGA 3K4WA 4IIEA 1FFRA 4AD4A 2ZVRA 3KBNA 1RD6A 1LL4A 3WCZA 4LW7A 4U3AA 2YKKA 1CB7B 3NXFA 3KP1A 4NI3A 3XIMA 3LA4A 2NVDA 1W8GA 2A85A 2Z7KA 4B9ZA 3OQEA 1Q45A 1BVZA 2FYMA 3VIOA 3S8HA 4JTTA 4L7ZA 3NQDA 3LY0A 2BB0A 3A13A 2DEPA 5GJMA 3WQCA 4B3ZA 1LCOA 1VC4A 5DX7A 4UR8A 3NG3A 1EDQA 1EIBA 2E3ZA 1PJ9A 4C6OA 2B4GA 2OMAA 4R5EA 1EBGA 3UNTA 1ZPTA 4ORMA 3DBNA 3TROA 5I5RA 2ON3A 4LX4A 4GVIA 4TX9A 3QC0A 5A6BA 5JH2A 1W54A 4PUNA 4XAYA 2R9RA 1PTGA 4JIEA 1XYZA 3PS7A 3DHPA 3SRHA 3TUUA 2ZVIA 4RNHA 3URQA 1ISZA 3BQ5A 3RRXA 3DI0A 4PTWA 2Z25A 5IDZA 4KIEA 4XAPA 1UC5A 3A4AA 4CCZA 4Q4RA 2D22A 2ONEA 4IPJA 3F03K 3F7JA 5I79A 5JH1A 2CC0A 3H2CA 3NQCA 1MQQA 2VYOA 3WG6A 1W9BM 3VX0A 3DIPA 4ATLA 1X1ZA 3MUIA 4B91A 2Z29A 3COTA 4FOKA 1SW3A 1TPB1 1P0EA 2BXVA 1JZ4A 3F2DA 1XLEA 4H6EA 4J2PA 4MTVA 1YDNA 2WZTA 3N11A 5I3FA 3ATZA 4XG1A 1NDVA 1EFZA 4A2RA 3H2FA 2YXXA 4N7QA 1YBQB 2F2HA 3QSRA 2PWHA 3HGOA 1V3IA 3GB6A 1ECEA 3AOFA 4ZXOA 3A9BA 1H5VA 2WJFA 3W1RA 4AY1A 1WNOA 1RXOB 4KRZA 1OCNA 3TSMA 3TQVA 3FXYA 1S2WA 3M0JA 4S3BA 4TMCA 1G6CA 2X16A 2NUWA 4ZQNA 4L6OA 2IPWA 2YCIX 1RY8A 4TV5A 1K8XA 3P0WA 4U3CA 1KKRA 4B4FA 2D73A 1R47A 2YA1A 1IWPA 4HOXA 2HV5A 2ZXQA 1YX1A 3ANUA 4J3VA 5M3WA 3AS2A 3W24A 2VFHA 4K1WA 3TCSA 4PUKA 1J0ZA 1CWYA 4S2BA 4MWAD 1E6NA 3LCIA 1OGSA 3L4WA 4H9UA 1WQ5A 4B2DA 3WNOA 1H09A 4LYRA 4DWSB 5B7YA 3IV3A 2CHOA 1XUZA 3SUUA 2YJQA 4H9XA 1JPKA 2YL9A 5AYIA 2FPTA 3W1XA 1V03A 1XPYA 4LBRA 3EEGA 2PDWA 2DH2A 1IEVA 2VEKA 3FDGA 3GVQA 2OZ3A 1ZU8A 4QSFA 1X6UA 2PI6A 1EOMA 4P8UA 1ECQA 3GKFA 2GK1A 4FF7A 2FQIA 3TW6A 4KRTA 3MSDA 4NI8A 3DZ1A 1BVNP 3LCHA 1Z7AA 2QJIA 3L2IA 4IGSA 2QJJA 2WVTA 3AMDA 4HKPA 5B80A 3ZR5A 1UWTA 5CGQA 3UXKA 2EF9A 3GHRA 2QT3A 3NFUA 1F73A 5JQ9A 4FXJA 1HKVA 2RKXA 2Z1XA 3I4EA 2PF8A 1OK6A 3AHVA 3VYLA 4YNGA 4ZMGA 1YPFA 1E6PA 2PE4A 1W3IA 2OOFA 3HJEA 5FJJA 2I9UA 2PRHA 1KFBA 4B5XA 3W6YA 1IT7A 3W83A 1MNZA 4MKVA 1BWVA 2E9BA 4UTFA 3NPVA 4G7EA 3VGDA 1ZCCA 3UVIA 4REQA 3AMGA 5AKQA 3MS8A 3RX4A 2PFHA 1KFKA 2HNHA 1QPRA 3VUSA 4GBUA 5E6ZA 3OTRA 2GGGA 4XKYA 3P84A 4QJ1A 4JNYA 5KZ6A 3AHTA 4AVOA 4KWOA 3LB0A 1QNVA 2G4JA 3VA8A 4LS1A 2Y62A 4MJZA 5CPMA 2E1WA 2RDXA 3UCDA 5EMJA 2ZRUA 4GI6A 1B2YA 3W71A 5HXMA 1EDGA 5IDIA 2WKJA 3AUOA 4QJ4B 1WB0A 3B06A 1UH3A 1W32A 8A3HA 1GHSA 2OEKA 1THFD 3SUWA 4FZIA 4JTEA 4JL1A 1OX4B 2FVMA 3UWYA 1JZ3A 4GZ7A 1R9ZA 4FHAA 3RIKA 4IP7A 4HK5A 5D8WA 3APGA 3N2BA 3OEXA 4D6FA 2ZX8A 2VI0A 3GH5A 1QI4A 1BHGA 1FHDA 3MHGA 1TPFA 4UCFA 3FVMA 1OC7A 1E72M 1WA3A 1AK5A 3WK1A 1S2UA 4ASTA 1B57A 1VH7A 3W74A 2ATMA 3DFOA 2BASA 2WWCA 4RK8A 1REQA 3DFPA 4L9ZA 3AMKA 3SCOA 3BV4A 2OKTA 2QF8A 3CYVA 3N4AA 2P8BA 2NVCA 3QN3A 3NO1A 5A2CA 4EF8A 2RJHA 2WZIA 4YWIA 1M68A 3AO0A 3IAQA 1IZJA 1TPWA 3FJLA 1JIBA 2YA0A 1ELSA 5AVHA 1KA9F 3ZO9A 3W7MA 4XX6A 1F8MA 2Z1VA 5E9AA 4HK7A 1XFBA 2ESCA 1FWSA 3VE9A 5D33A 1B3OA 2CYGA 4XVDA 5M2FX 3B0UX 4D72A 4C6CA 2O9OA 1DJZA 3L65A 3LX9A 4PSPA 1H63A 5I23A 3BH4A 3FHAA 3VGFA 3UETA 3SCPA 3T4WA 3VNDA 2CHRA 3ISIX 4LRTA 1G5AA 4L61A 1GCYA 3ITGA 4C91A 4BF5A 3U2ZA 1XX1A 3TW7A 4D6IA 5A95A 1MMFA 4HIBA 1J5SA 4HYRA 4NKCA 2YB4A 3SCWA 2HCVA 4ZEPA 3UPBA 3VDCA 2NSXA 1AW2A 2G3MA 2ZUSA 1PDZA 4P8XA 4H8VA 1PKLA 3U2OA 2QLYA 1Q8AA 1PCKA 3RHGA 4UR7A 4WXZA 1XLAA 1JPHA 1H1YA 4UTMA 1HVXA 3TOPA 4F8XA 1V51A 3N2XA 1W9DM 4Q7NA 4MF4A 2YA2A 3UWEA 5JIPA 2GSJA 4A8LA 3DYOA 4E3VA 2QGHA 4AEEA 3SCUA 1I1WA 2IXUA 1Y65A 5EA9A 4IQEA 3GW3A 4U5IA 1N8FA 5BOEA 1RZMA 4V1XA 4WSKA 2WMFA 5LGZA 1NY1A 1C92A 2O9RA 4P7NA 2NX3A 5JBDA 3W7EA 3BAIA 4V2XA 4US5A 3WBEA 4JQ4A 4HNUA 5LGXA 3ZR6A 1XLJA 4GXMA 1JYXA 1A0CA 3K13A 3VIPA 3POCA 3AIRA 2R82A 4QM1A 1HXJA 1E1CA 5I3GA 4R9OA 4GNJA 1E0VA 1WOBA 2Y61A 3IJQA 3Q58A 4NIRA 3IS4A 1RH9A 3LQGA 1XISA 3A4XA 4NNAA 1XS2A 2QJHA 4YL2A 3GDTA 3EDFA 1E51A 2DQXA 3VIJA 3EKLA 3AZSA 3GAYA 3OP2A 2AQVA 4AIOA 2D69A 3CPGA 1SO4A 3C61A 4AEOA 2BY3A 3WY1A 1UR1A 3A12A 2QUTA 4HNNA 1AQ0A 3LTSA 4FO4A 3W1NA 3VNKA 2PDPA 2GWNA 2VWSA 3GAKA 5I2UA 3BG9A 1BSLA 4AVFA 3CT7A 2J7EA 3GTFA 3M5VA 4XZHA 5IBXC 2HMCA 2R1PA 2VZSA 3S5YA 2J9YA 4B4HA 1IQ8A 1UOKA 2G97A 3P93A 5D9PA 4HMEA 2VX7A 3PZIA 4BS0A 2HRWA 1DHPA 3MZNA 2CLKA 2EXOA 2OG9A 5GPRA 4RV3A 3VFLA 4RR4A 3PAOA 3WX7A 5I3JA 2WM0A 3NVDA 3KBMA 4AIUA 1W1IE 1PYMA 2FIQA 1UPMB 2Z1BA 3DKLA 3W22A 3LHZA 3FAXA 3GIQA 2CERA 3INPA 3BMWA 5HA7A 2PP1A 1JDEA 2RAGA 5AHEA 3G0SA 3JU2A 3N4EA 4QDMA 3U3HA 1EX5A 1ONWA 4G9PA 4O11A 1EB3A 4HCHA 1HTIA 4E2OA 5EKYA 2ACQA 2QPSA 2BGSA 1FHUA 3M0KA 1PTDA 3MVIA 1F3TA 2DW7A 2ACRA 1RBLA 3OYZA 3VNZA 1G4PA 4M6QA 5BXRA 2WC7A 4XVEA 3OHIA 4HTBA 4DF1A 3RM9A 4B90A 2P10A 3NDOA 2Q8XA 4H6KA 2Z0IA 3PZMA 3STGA 1MVYA 2ZWZA 4M29A 3WIJA 2Z2UA 4JKLA 5BXTA 1BYBA 3B8IA 3ZLHA 1RJPA 4JTUA 2WWDA 3GR4A 1LORA 3W01A 2FDSA 2RDTA 1X7IA 1X8CA 1GKPA 4BEQA 3UGRA 5M1TA 1PPIA 1GQJA 2OB3A 4H8UA 1S46A 4LYPA 1GONA 1IT0A 4WSJA 4NNBA 5CCZA 2ALDA 2X05A 3V75A 2IS7A 1F7BA 4YU1A 4L6HA 1Q4NX 1WO2A 3IV8A 2E6DA 1QTWA 4IMGA 4F0HA 1XCWA 1KM6A 2VKZG 3ZS4A 4A21A 4WD0A 1FTXA 5CEWA 1JZ6A 4CCCA 1VBGA 1QHPA 2JK2A 2I14A 2OX4A 3MSYA 3WEOA 3FEQA 2BHUA 4HNTA 1F6YA 3Q67A 2PTWA 1O6IA 5M17A 1L6GA 3UP8A 3R10A 4E4FA 1BD0A 2W66A 4FLOA 4P7QA 5CC3A 3EXTA 4JOMA 2Z1WA 5I3HA 4ML9A 2A7RA 3NQ7A 3IVUA 1P0BA 3KLKA 3WBYA 4AXNA 3BXWA 1QXLA 4FR6A 4WUIA 4MDPA 1AMYA 1P0KA 1NP0A 4L1WA 1I1XA 3JRKA 2VZTA 3GFXA 2A79A 4GQRA 2PURA 2WANA 4UFKA 4DXXA 1CXKA 3T9PA 1WBJA 3E5PA 4CNUA 3W2UA 1GOKA 4RXFA 5IHSA 3RPTA 2CESA 3P2VA 1V6TA 1S1PA 4IFKA 2Y6ZA 1UKTA 5AFDA 4HMNA 2BODX 1FXQA 3RXZA 4M81A 1DXEA 1H51A 2VUNA 8CGTA 1W31A 3CIVA 1Q65A 3U0HA 3W1UA 1QHZA 1US3A 3N9KA 4DWSC 1XDJA 1AD4A 1VLWA 4RPQA 1RALA 4KCVA 3VDBA 2YYUA 1C9DA 1GZJA 2DP3A 1RQEA 3SN1A 2GJRA 2A3HA 4DJFC 1M03A 1VHNA 4ECLA 3O2LA 5LIKX 3LERA 1EGVA 3OGSA 4KFOA 5KTLA 5EL1A 3WDPP 2IPGA 5DMYA 3VABA 3U57A 3SUVA 2VTFA 1EYWA 2D2GA 3GNXA 3KCJA 3IJ7A 2JKEA 2D0FA 1F07A 2QIWA 5ABFB 1UD2A 3WLIA 1E6ZA 2ZYFA 4GQ0A 3KRBA 3F4CA 1S39A 1R86A 3PPGA 3RN6A 3CUHA 1IEQA 1C7SA 1TE1A 4U2ZA 3ITLA 3GH4A 3LCWA 4EIVA 2QVNA 4RKAA 4ZFMA 5HQLA 1Q63A 1OEPA 4NZJA 1TV2A 1OHLA 3IAPA 2NWSA 4DPPA 1ONXA 5LSMA 1RAKA 1MYRA 3M0ZA 4XSLA 1VD6A 1BF6A 3OLIA 3TN6A 4Y7EA 2XIMA 5A6SA 4W85A 1GVFA 4DI8A 3DAQA 3N4FA 3NZPA 4A05A 4KQNA 1O5KA 2VL4A 3K46A 4ROPA 4QTGA 1R8LA 3MTWA 4FSAA 4WK9A 3VD3A 5A6LA 1R38A 3RU6A 2WMKA 2EPNA 3AYVA 2B81A 5HJLA 2J74A 1TPC1 3IANA 3CEUA 2DIJA 3QOMA 1TJ0A 4RDYA 4UTWA 4HJFA 3LBMA 2FZDA 2WV8A 3W76A 5E93A 3LCFA 1UR4A 1KM4A 2GWGA 2OSYA 3EX4A 4E4UA 1DJQA 2PDUA 3R2GA 1KRAC 4URIA 3IUHA 2B7QA 3BLOA 2X0HA 3ZMRA 3KZPA 2PGWA 2DZAA 3WFLA 4LAOA 2G4FA 4BKNA 1TWSA 3GWQA 5CQ1A 1B4KA 5CBIA 4OOZA 2ZUVA 3WYZA 4H9YA 4X2RA 3QTPA 4MGGA 1JUEA 2GUUA 4LUIA 4S3GA 2PDNA 4IUOA 2XSBA 2OWXA 2PRMA 3NURA 4AZGA 1TVLA 3WLKX 5MKGB 3SCNA 5J5RA 2JGQA 1XRTA 3VU2A 3H6OA 5LNUA 4CQDA 5D02A 1XGDA 2BP1A 5HK4A 1M53A 2Y88A 3CAQA 1QASA 4DZ5A 5IFTA 3EWCA 2UWFA 4HMDA 4MWAA 3FX4A 3TSBA 4RDZA 2E5BA 5HMSA 3TNBA 1V7AA 4BEUA 4ZQMA 1B5TA 3Q45A 1UYQA 5F1UA 1IXPA 1E1EA 1JD9A 3TA6A 4JFVA 3AALA 1MZHA 4S3CA 2UV8G 3OOQA 4EAMA 1IXOA 5GJPA 4UFMA 4Z2IA 3N1AA 1Q3NA 3QRHA 5U4NA 1RHCA 2DSZA 4UQCA 3VE7A 1XQKA 4Z2JA 4IT1A 4GC3A 2FFIA 1UWSA 2OO0A 3N9SA 4G7FA 1SR0A 5D2TA 1KCZA 2HEJA 4A8NA 3ABSA 3PG9A 3MDWA 3T0TA 1E56A 2PC4A 3R12A 2Z4GA 1MRQA 2VDHA 6REQA 1XD0A 3LN3A 1CCWB 2O92A 4Q8OA 4PMYA 2VFDA 1CLVA 4BA0A 2CBUA 3TR2A 1M3UA 3ZR4A 4ZR8A 3WJYA 4MFDA 4ZE5A 1KM2A 1G01A 4F0MA 1O5QA 5K3VA 1H0IA 2ZUNA 1PS9A 4XAFA 3AXXA 2J27A 1P43A 4CNSA 4Z2LA 4Q8QA 3BCFA 5GJNA 1GQIA 3SQMA 3G8EA 1PV8A 4J3UA 1J0KA 4LEQA 4NAEA 1PZ2A 3HMJG 3SFWA 5K2ZA 4Y2WA 1VFFA 3EPOA 2J66A 5CSRA 1SO3A 2FJUB 4OECA 2PWFA 1XYFA 1UWAA 2A5HA 2B7PA 3W7OA 3S6TA 2HK0A 4HMCA 2V2HA 4O15A 4PMUA 3E2QA 1L2QA 3P67A 2J7DA 2YBTA 1KNWA 3HJZA 1NDWA 2VRQA 2PTYA 1ZBWA 2XH4A 3MC5A 1RPKA 3GO2A 5A3HA 2OZ0A 3EA1A 3SADA 5DRCA 3DXIA 1SZFA 1VFHA 5AY7A 3HV8A 4HNVA 4IGHA 2YYTA 2Z27A 2UBPC 2HNEA 2DQWA 1A5MC 3FGCB 2D3LA 1ZAIA 3HQNA 2HTMA 1OYBA 3C2YA 2EKCA 3GW0A 3B04A 2ODOA 3RFAA 1HO1A 1SZNA 2ZA1A 2CETA 1HGWA 4ZSTA 3B8TA 2H9AB 3E3HA 3TLQA 3BW2A 4PMZA 1L6YA 3GG8A 3ABZA 1IZCA 4PBEA 2Y5EA 4OV4A 5TD4A 2J6XA 1EXPA 2CZ5A 3R0KA 2QJMA 4IL2A 3ARZA 3JVAA 3A24A 1E5NA 1TMLA 4IOTA 2FZNA 1FCBA 4KS0A 4NJIA 5FIPA 4AG0A 3NM3A 3ONBA 3E12A 4K7YA 4W7WA 5FEWA 5K4XA 1R6WA 1DQUA 4NUWA 2D2OA 3W2JA 4A8IA 4UOJA 8TIMA 4OQVA 3S83A 2I17A 1J18A 2A21A 1TRIA 2JF6A 4GJ1A 2QQ6A 4HHMA 3TZFA 3UG4A 3LLXA 3OGRA 4NXSA 2PGFA 1IXNA 1R0MA 4NQ1A 4M7TA 3S1VA 4EK7A 4AD0A 1E9IA 1A5KC 3U5YA 1RBOB 4PE8A 3WD2A 2VM8A 5D9NA 4CD6A 3C8NA 4LNCA 4NAFA 4AZCB 1VPXA 1OCBA 2HDJA 3H2MA 1V3LA 3XINA 5KITA 4LGXA 4WOZA 1W1B1 1J6OA 3IK4A 3VZXA 4N6EA 4S3DA 3E96A 4N0RA 3W7CA 3BLLA 4XQ6A 1GORA 1CGWA 2WNNA 3MSGA 5LNVA 1RJQA 2HVOA 4MY1A 3W73A 1GJPA 2BLEA 3SFKA 3LNMA 4UNIA 1VCVA 4BQ2A 1BKSA 3CZ8A 3CGTA 5D04C 3Q4DA 4KEMA 1PKYA 1QNSA 1W3TA 5FJRA 4HNOA 3IK2A 3AXHA 3F4VA 2J7GA 1KW1A 2FJKA 2GGJA 1KBBA 4RLIA 1Z32X 3N04A 3WQVA 4WHBA 4XB3A 4QS5A 4TX8A 3EWUA 3ARSA 3CMJA 1I8JA 4EVZA 5BWFA 1UR8A 4LAZA 4AMCA 3BJTA 4IX2A 1W1A1 3HMCA 2FB2A 1P6CA 2J24A 2XFFA 3IEBA 3U4AA 3URAA 4BR1A 4EX4A 4BFAA 4GHRA 1XBVA 3BK0A 5I3DA 1ISWA 1UB3A 2JIEA 3ABXA 1EP3A 2AAAA 2X7VA 3LMZA 2FZ9A 2XSXA 4Z1BA 4HSNA 2XGZA 1TKKA 1PEZA 4HA1A 4QROA 2PBOA 3P82A 4QP0A 3FJNA 3NA8A 1CX9A 1QWKA 3HPAA 4B5NA 4GH1A 1ITUA 3BV7A 3BVJA 4MNLA 5LIXX 3B9DA 4JEQA 4G6CA 1CB2A 5DCEA 1FDJA 2CLFA 2QMKA 3ITCA 1TTQA 3I7RA 5A8OA 4GVGA 2ZX5A 3ALGA 6TIMA 3TYAA 1WBHA 3S1UA 3L0GA 1TTIA 4DLMA 3NR0A 3BSGA 2Q01A 1ZJIA 1O12A 5C9RA 3TK7A 3G3MA 2YZRA 2WOQA 4HSOA 4W88A 2YFNA 4E3TA 3BOLA 1DOSA 3R8HA 4K1GA 3B8VA 2OR2A 2VOMA 5GNZA 2VT0A 1TTPA 1OJXA 3S5NA 2PP0A 1DXFA 3LDVA 3WQ6A 4NJKA 2NV1A 4PRRA 4O0KA 1LWJA 1OF6A 1M1BA 2CIPA 5A6MA 4WKAA 4ADUA 2VXNA 3L5LA 2ZX6A 3GXNA 4EE9A 4O54A 1DIEA 4PODA 3R1ZA 4CQBA 3RO6A 2JF7A 1TA3A 3ERPA 4O4WA 1EKOA 1BGAA 4DQWA 4O4VA 1K8ZA 3BUVA 3TYBA 3VD5A 3VM7A 4B92A 3N34A 4LF2A 2WHJA 5HJYA 2EPKX 1LUCB 3AJ7A 3CQKA 1W5PA 2W0UA 2CNCA 3JZEA 4I90A 1N2VA 4N2YA 4W87A 2ISWA 2Y4SA 4DYKA 1NOWA 4R27A 5LNRA 3O0FA 4CKQA 2GGHA 2SFPA 2XH0A 1P0DA 1KQYA 3T2PA 5CLWA 2AMGA 2WC3A 3NJ3A 3LM7A 3SDOA 1P7TB 5DY2A 4PUEA 3A5VA 5M5DA 4PUWA 4PMJA 4KETA 1VBJA 3TVAA 3BANA 3R79A 3CB8A 3W1LA 1DORA 3LHUA 5C2GA 3OG3A 1F2JA 1DIOA 1CGTA 1UBPC 1GEHA 3B9EA 4L4LA 1AH3A 2REQB 4H01A 3EWZA 3SGGA 2ZZ6A 2J8GA 2G3JA 3VZYA 1L9WA 1SMAA 4S3FA 4KFNA 1I2RA 3AYSA 3H26A 3CLWA 1EP1A 1I2NA 1PX8A 2IQ0A 4GABA 3GH7A 3G8RA 4QAWA 3LOTA 4P8VA 1LWHA 1DWAM 3M6YA 4F0RA 3QQ1A 3QF0A 5DCBA 4O12A 3HFYA 4TTUA 4L6DA 2CWNA 2DUXA 3EMCA 3GC2A 2ZXAA 2NWRA 3PNZA 6XIMA 3EBVA 3N18A 5E5CA 1I2QA 1VBRA 5AYYA 1FCQA 3GTHA 4C6PA 4X60A 2JEQA 3UPWA 1I60A 4DBEA 3ZZ1A 1VJSA 1VYRA 3ARUA 3Q94A 2E7FA 4LY8A 2FVLA 1JQXA 3PZOA 3PPHA 2GQ8A 3GUGA 3LM3A 4DLFA 1OF8A 1KKOA 5M03A 2C19A 3R43A 3ZFHA 2W62A 2XZ7A 3HN3A 3W7QA 4K39A 3H2NA 2ZUUA 3QY7A 4L80A 3EB4A 4XUYA 3GZAA 4DUOA 4E8GA 3LENA 5H8MA 4RZBA 3NYDA 2E4TA 1EUNA 2AL1A 2VENA 3S0CA 4ZO6A 1W1ZA 2G50A 3AIWA 2XIJA 2BBFA 1CT5A 1EC8A 1O68A 3YPIA 3DCPA 3QHOA 4PTVA 4I6KA 1G67A 2X40A 1V6UA 3O06A 2JIWA 1J0YA 1RK5A 4ZODA 4LNYA 2A7PA 1JDAA 4UNLA 1KV8A 4J3ZA 2E9LA 1OC5A 1A4LA 4CVWA 2ZUWA 2FPVA 2DZVA 1JZ7A 1JCXA 1DQWA 1IR1A 2VCCA 4WGXA 3TLLA 4DO6A 2V5CA 4LF1A 3WH6A 2PDJA 4GX9A 3A3HA 4R7OA 4J4KA 1XLGA 4PUDA 2NX9A 4QDWA 3B0VC 3GU1A 2QUNA 4QG6A 4XTDA 1ADSA 3IARA 2CXEA 1W1VA 3B0XA 4LQ1A 2CEQA 2XG9A 5ABEA 1J79A 2V2DA 3BAXA 5BXPA 1TV3A 4AF0A 3SQLA 1WP6A 2XPKA 1E6SM 1W5NA 3TAKA 1TTJA 4GXWA 3BTNA 1C9WA 3U2EA 4DX3A 4RZ5A 4PCFA 1AG1O 2WHMA 5C8BB 4Z2GA 3FSUA 3BWWA 4UTUA 5AHNA 2WSKA 1S2VA 2FMNA 4JYEA 2B0MA 3CAWA 3UJEA 3M0YA 3DGRA 3WJXA 4S23A 3THCA 4W89A 4UFHA 4F48A 3BPWA 2VJXA 3ARPA 1H11A 3EWBX 3AAMA 1Q6RA 2YOCA 3N12A 3VOFA 3KRSA 1TREA 3FCPA 3IJ9A 1CGYA 3UJFA 4IMFA 1BTMA 5IBXA 3L2LA 4XD3A 3KWSA 1QBAA 2O7QA 4BJHA 4DJED 1OM0A 4O1EA 2XFWA 4I6VA 3HGSA 4QX4A 1GG0A 4QFUA 1PWMA 4QITA 5HOSA 7REQB 2O7SA 5FF2A 3LPGA 5HMDA 4I9TA 1W2PA 1US2A 3M7SA 2VFGA 4Y8FA 3PZQA 1SVDA 1NOUA 5AYBA 4TIMA 4QG9A 2OYLA 1O95A 4GGHA 4IGMA 2BV9A 3N2MA 3F2BA 4CN4A 2INEA 1N8WA 4JN7A 3GVGA 1KV5A 4GY0A 1PUDA 5PTDA 3IVTA 1W56A 4W7UA 4QGCA 1RP8A 3E0FA 1V79A 4DF2A 4Q3MA 4IZGA 3WDJA 3M6DA 3WMLA 3A5FA 4MZ1A 3SBFA 3UEQA 3OLGA 3S9ZA 2RFGA 4YJ5A 1FVPA 2WZEA 1H3GA 1GTEA 1PZ0A 4DUWA 1P4CA 3TR9A 1KRCC 4LCSA 2ANUA 3M4HA 3RJYA 4WEVX 2PEVA 1S2AA 3IIXA 2FHCA 3IRDA 5E1QA 4B5UA 2AGKA 4FIRA 3HV9A 4Z0JA 1MXSA 4GIYA 3IPWA 1O4UA 5F4SA 1XIHA 3DN5A 3BGAA 1GQKA 3TWAA 3VCNA 3WLTA 4GBDA 3M7WA 3CQIA 2V82A 2NV9A 1SFTA 1BGGA 4FX7A 3TJXA 4S39A 1DJHA 3L4VA 2XVKA 3NCOA 2Y7DA 2VGIA 1DIDA 3E0IA 3SN4A 3WJZA 2CCRA 3SIMA 2A2IA 4MUPA 2QAFA 1ZJHA 5E6YA 3PFRA 4D8LA 3PSVA 4PMQA 4ZCWA 3HPSA 1OGBA 1W5QA 3FFSA 4LH8A 2DU2A 1H0GA 4ZQCA 1ODUA 3TQPA 4AX7A 1UG6A 1EUAA 3LI0A 1Z8AA 1ZP4A 3AS3A 3EAUA 2PDMA 1W3HA 3P5YA 5F4WA 3PF3A 2Y70A 5E09A 2J9XA 1BG4A 1VLIA 3AHXA 3E02A 4FLRA 3MI3A 4RJEA 3DFYA 4G2DA 4XIMA 1DJWA 4IIGA 4RNFA 1J0IA 3E6EA 2XWEA 3MPGA 4X9SA 1CECA 3KOYA 3OHMB 3ANVA 3L7RA 1N8IA 3UY7A 4ERGA 4JIHA 1ONRA 4KCTA 1QMLA 3CZLA 5FOOA 1TO3A 3G1VA 1TV5A 1P6BA 4WVXA 4DB7A 3W38A 1S3HA 1VKFA 3FN9A 3NL5A 4DEFA 1R3RA 2ZBTA 1ADOA 1KCXA 5H8UA 3PUEA 1NARA 4XZMX 2PD5A 1E1FA 3GIYA 1TQJA 3W25A 1HJWA 2GUYA 2P5NA 3B05A 4AEFA 2CLMA 3VVGA 1TX0A 3ZM8A 1QPQA 1UQZA 5D8ZA 2ZZ2A 2NQ9A 3MI6A 4UXDA 3FJ6A 3VKDA 2DSKA 3GVVA 4B5TA 4P8WA 4C65A 2P50A 5H8PA 2QPUA 1KBIA 4X9YA 4WRHA 4ZOBA 3PTDA 3WDIA 3WMBA 3RRAA 4MM1A 1Q6QA 1TZ7A 2DV0A 5HNUA 3W4RA 4PB4A 1XLMA 1XGZA 5I3IA 4O10A 3IACA 1WDRA 5AC6A 4R3UA 3R89A 5EB8A 1PIFA 4D1JA 4C6KA 4GQBA 4I7WA 5I02A 4O13A 2Y7EA 1Q6DA 5HR7A 5BWAA 4UNKA 1UHVA 3GTIA 3PJXA 3B8WA 2NQ5A 4OE7A 2QW5A 1Q2SA 3LPFA 1Q6OA 1U5JA 4M6VA 3E2SA 3EMZA 2YCJA 2E9MA 2QUVA 2HJPA 3RILA 1SW0A 4DJFA 3M47A 5HQMA 3B97A 3OBEA 3NQMA 2EKGA 3WSUA 1V08A 2GQ9A 4C1NB 2VUYA 3I7SA 2QXWA 4UCGA 2X09A 1O94A 3MO4A 1AVAA 1PZ1A 2AMXA 3EOEA 3W07A 1E5JA 4AHQA 3CB3A 3HG3A 1GYNA 4FNQA 2Y5JA 3BC9A 1XIEA 2IQDA 4L4PA 1OCQA 3QGAC 3AHYA 2UY2A 2F6UA 2YL8A 1HIZA 1R2SA 2MANA 2WXDM 4A29A 5AHLA 2CLLA 2W61A 1WZMA 2A3EA 3CM4A 2A7NA 3V18A 3II1A 3RMJA 4LU0A 2BOEX 3S5ZA 1GVQA 3Q2DA 3VZZA 3FYPA 2CBVA 2W4XA 1KM3A 3W7GA 5A1AA 3KTCA 2ZA2A 2WJEA 4JTCA 4W8BA 2WNQA 1TPUA 1S5WA 2GOUA 1K7EA 1G4SA 2XM1A 2V8ZA 1JRCA 3OJGA 4DM1A 1C93A 3BLFA 3O9NA 3WLJA 3QSTA 2QYGA 4EXBA 4FXRA 3NZQA 3MKKA 4FPSA 1XH0A 2VCAA 3H2AA 1MW2A 1QU4A 4RL3A 4ACZA 4DNMA 2C7FA 1IZKA 3N15A 5ABHA 2EQDA 2IXVA 2FGLA 2J4GA 4G8TA 1KBJA 4IQLA 1U5HA 4QLJA 1MO0A 1MDRA 4WDXA 4D9PA 1FWIC 1OABA 5C2CA 1C90A 3RO8A 2DJLA 4ZXLA 1MZRA 4MOZA 9RUBA 3CEPA 3JUGA 1Q2RA 1OX4A 4DELA 1DKWA 4XBSA 5BZAA 3NQAA 3ME3A 5GNYA 3DC0A 2HZGA 3MA8A 1Z42A 1T40A 4ENLA 2DZTA 2QR6A 5FAGA 3GVWA 5HR6A 3WEZA 2GVJA 2XINA 1DTNA 1KM0A 2F7FA 3AMCA 1FWFC 3MY9A 3N2TA 4HU3A 4QSHA 4ONVA 3AROA 4Z08A 1JEZA 4MB1A 4ZL1A 7PTDA 1PZ3A 2NT0A 2WHLA 5ENLA 2Y5SA 3QHMA 1XIMA 1ZZMA 3S1GA 5D30A 2H8XA 3PUDA 5HUOA 3L12A 2G3FA 5IRPA 4ADTA 4IWWA 1F76A 2PDBA 3WDRA 1JYNA 1YTEA 2R94A 4AWSA 2Z00A 4HQVA 5EGRA 3CV2A 1B3WA 3O63A 4C1KA 1CLKA 4G7EB 5A69A 1AD1A 4PEEA 5A6JA 4U31A 1CDGA 3ZJ8A 3E49A 4OT7A 1TV7A 2V68A 7ENLA 1FH8A 4HZ8A 3TC6A 1SW7A 4X2PA 3M44A 2OKOA 3GU2A 3EXSA 4L9XA 3S47A 4QLLA 2R6OA 4CN6A 2H90A 1TIMA 4NX5A 3EOLA 3MI2A 3WFAA 3RG6A 5CKSA 2D2HA 3OU8A 2PTXA 4MZ8A 5EY5A 4DUVA 3SRFA 1ZBVA 2QV5A 2E6YA 4BZYA 2C79A 3EMQA 5IM51 3JR2A 4YXGA 2GJNA 5D37A 5AECA 2J9ZA 4AY8A 3G3DA 3BLKA 5B7ZA 2ZOXA 3CV7A 3A21A 4DJDD 4AWEA 2OELA 3WELA 3KHJA 3PB0A 1U83A 4WIWA 3T8LA 1H7RA 4N42A 1HUVA 2GSHA 5HQEA 4N02A 1TMHA 2WBGA 3SCRA 1QR7A 4MWAE 1TZZA 4YCOA 1ML1A 3DU0A 4DHGA 2WSYA 4LAUA 4E8CA 9XIMA 1KM5A 2Y7FA 1CPUA 5AZ0A 1W8SA 1Z9AA 3R0UA 2XISA 1VJIA 3UR2A 2ICSA 4ADSA 2W67A 3T40A 3BMXA 2WQPA 2J7CA 4JDYA 5FF4A 4BI7A 1EO7A 4ZOCA 1DWFM 5HMEA 2Y89A 1LT8A 4GG9A 3E0WA 1EBHA 1ODZA 4YS1A 5JU6A 1FDZA 4QNEA 5T26A 2ABBA 4CEXC 2EJ1A 1I75A 3RITA 4BI5A 2WCSA 2OX1A 4XBJA 3GFZA 5HWMA 3LRLA 2DDXA 3T09A 3QV6A 1LDCA 3KCLA 3TQ0A 1EJUC 4Q7IA 4C6JA 1E4NA 2JE8A 4IFRA 4CUCA 3A3WA 1HL8A 1AJ0A 5CC7A 5GVJA 3UXLA 2XVLA 1A0DA 3P80A 3CUJA 2YDRA 3N14A 3LRKA 4JTGA 3TYCA 3E1F1 1DJXA 2B7OA 3AU6A 4NSBA 1JDCA 2YBUA 3DFHA 3KZSA 3OQ8A 2FZBA 1OFAA 1A5CA 4US5D 3UWZA 3GIPA 3TYUA 4S3JA 4DAIA 3PN8A 4TTGA 1NJJA 4JX6A 4W9TA 4IJCA 2IKIA 4E4PA 3NO3A 3WD1A 5C9WA 2Y63A 3FYOA 2BGQA 1W1YA 2WPGA 3U7VA 3QLDA 4YHEA 3RR1A 4GACA 3H22A 3C0LA 4OKDA 2C16A 4UIOA 3EOSA 5G1TA 2R14A 4GIEA 2GLKA 2EG7A 5MF5A 3N25A 2XSAA 5D2XA 1BAGA 1W6TA 3E2VA 3AIUA 4ZZ9A 2YX0A 3LXCA 3WH7A 5JXQA 4HN8A 3EOUA 2CXGA 4IL0A 1V0MA 2G8ZA 3CH9A 1C8VA 4K36A 1HP5A 4FX6M 1RSCA 1T0OA 1HJUA 2AL2A 1GZGA 1OFPA 5BW6A 4DRSA 3MP3A 3UESA 1J8VA 1A0EA 3MJMA 4AFYA 4FAMA 1EQPA 2PMQA 1XIGA 4AAJA 3PJWA 4RNIA 1QATA 3ZJ6A 2VR4A 3C3NA 3QC3A 4N6FA 4UTIA 3WDQA 4FLQA 3SRKA 3G1DA 3MUXA 3VNYA 4KEUA 2RH9A 5C9UA 2EG8A 3L4YA 2PC8A 2OQHA 3WQ8A 1SZEA 4A2SA 5TBOA 2I9EA 1OG0A 2X1UA 5A8GA 1R3TA 1US0A 4BI6A 1XBYA 1FDYA 4PTXA 4PCSA 1PKMA 3R0DA 2Q8ZA 2V5BA 4XK2A 3O3RA 3CMGA 1W1PA 1K4GA 4Q22A 4IP5A 4Q8WA 3H24A 4UTTC 3FJ4A 3WD3A 3O6AA 3WQ4A 1B3ZA 4NX0A 3KE0A 1R7OA 2GDVA 3NQEA 4FB7A 2BTMA 1VFSA 2QULA 2OGJA 4H83A 1D7FA 2QEZA 3TJ4A 4V1YA 3VOGA 4H6RA 4XD6A 3KDNA 3MMUA 4LY4A 5JUVA 2NQJA 3AISA 3NOEA 3T0BA 2DY3A 3CNYA 1RVKA 3IJIA 4X22A 1G7VA 3HTWA 4OHQA 3MO7A 5KMYA 2VC9A 3R4IA 1FUYA 1J93A 4JIIX 5LA1A 4HPHA 4MDOA 1ENUA 2V3FA 3QZEA 2XM2A 1SZGA 1GQLA 3WBAA 3S1WA 2XHYA 4H19A 2I57A 3EWDA 2A3AA 1K6AA 1XLHA 3RM8A 3KOWA 3UJ2A 2TODA 4F9DA 2PD9A 4PR4A 1X39A 1V6XA 1NDYA 2PCEA 1YPIA 2J79A 3E9AA 3LZ3A 4MFEA 3G1FA 4JIQA 1DTUA 2G96A 1OIFA 4RDWA 1YXYA 4HSHA 4TVDA 3H2EA 4GI8A 1XIIA 1XL9A 3K4DA 5C71A 1YMYA 3W29A 1CGXA 2OYMA 2W3ZA 4AW7A 3AC0A 4ERIA 4X3ZA 1JG9A 4QS6A 1U1JA 1ZL1A 1XLFA 5I78A 1UW9A 5DANA 4M80A 1LG2A 3TXVA 3N29A 4YVXA 2EJAA 1GOQA 2R24A 5AZ1A 2O9PA 3CWNA 1OB0A 1M7XA 4N4PA 4PCNA 1OX6A 3PBWA 3T4CA 3GHTA 3A4JA 3GNNA 1IYXA 1H60A 1UR3M 1YE6A 4EPKA 2V6AA 4RCXA 3F2CA 1WAUA 3LSCA 5ABFA 4ZB2A 3QFWA 3VGHA 3O15A 2FGZA 1T6MA 4GUHA 3WN6A 3WF2A 3DECA 3BAWA 3B0PA 3QKZA 5XIAA 3SN0A 3ATYA 3NPUA 2WKLA 4A8RA 3A4WA 5A8PA 3LXBA 3P62A 4LVDA 4JTQA 2PGEA 4ORIA 1M7JA 4BWLC 2XWDA 4NNCA 3RX3A 4JX5A 1XG3A 5GQBA 2KZHA 1RVGA 2NVAA 1NF0A 1SFSA 3KWXA 5LA2A 2OWCA 2CBJA 9CGTA 4XD5A 3V0SA 1O5RA 4IFKB 3SCVA 1S3TC 2YCKX 2WM1A 2YSWA 3WQFA 1TSIA 2GFTA 2IQTA 2ZE0A 1WDQA 2WMJA 5A8NA 1MEHA 2C71A 3VCRA 1TWIA 2ASHA 3T1GA 3VIKA 3G1YA 3P8JA 1P0NA 2VR2A 1PKNA 1KWGA 4LV9A 1XXXA 3B4UA 3GK0A 3TWBA 2XTKA 1M7OA 4K38A 1WDPA 2PLJA 3LCXA 4ZO9A 1LLWA 4U33A 2BFGA 2R1MA 2ZDRA 2Z1SA 2EPMX 1A5LC 4C1LA 4K6AA 3W70A 4GX8A 1V6VA 2QDEA 3VFCA 2QHAA 2E0PA 4XSMA 2V5DA 5A6KA 4HU4A 3M5ZA 2QCLA 1IGWA 2Z6JA 3QOKA 1VBUA 3GXTA 4LXFA 2F9RA 3PHAA 3QQWA 4DY1A 4NZ4A 1R9YA 3PTQA 4GA8A 2CZVA 3BAYA 5LA0A 4HA4A 4HOZA 3PR2A 5AC8A 1YEYA 2NLIA 4KCWA 4PRTA 1GVOA 1AW5A 3VDAA 2OLAA 1SMDA 3CL6A 4JHZA 4ACYA 3NZGA 1TUFA 3KHDA 4GVFA 3O6DA 4ATWA 4HOWA 1KBLA 1CYGA 3GSMA 4AMAA 4EPBC 5SWUA 5H91A 5U7SA 1S2TA 2BNJA 4RUBA 3R25A 5FL0A 3ZJ7A 4ZB5A 1FH7A 4CNTA 2A3CA 3VIGA 4GYJA 4CU6A 1QWGA 5E0FA 2BHYA 3NPWA 3TA9A 3RNDA 3D3AA 1YLVA 2IPJA 2FH8A 3T78A 5TIMA 3TZNA 1XWYA 4XZBA 2G95A 3ITYA 3PBVA 6ENLA 2VEIA 3K30A 1QPNA 2X1RA 3V4BA 1T96A 3BMVA 4HNCA 1OWQA 5A8QA 4DBDA 4WY0A 4KKXA 2Z2AA 5FKYA 1JCLA 2FVKA 4BQ3A 1DE6A 3KP0A 4OZOA 3AWOA 1KCLA 1OK4A 1CEOA 1E0WA 2P1FA 4JEJA 3GQYA 2ZC8A 5BOFA 1B30A 4J3WA 1X1OA 1VYSX 3PM6A 3HA1A 1YHTA 3N73A 5CPOA 3ES8A 3GVRA 1QNRA 1TYGA 4EACA 3K8LA 3SIZA 1E0UA 5CZSA 1U22A 1ZBKA 4Q8VA 1FWNA 1NDZA 2Y0FA 4UBPC 1QJWA 3M0XA 3T07A 4IPNB 3HQOA 3TYDA 1GVIA 1IR2A 1H49A 4O52A 4CD5A 4Z1AA 3M1ZA 1TUXA 2VGBA 1OFEA 2VCBA 5DT5A 4H1ZA 1R87A 2GVYA 1EA9C 5XINA 6ALDA 2JEPA 4KEZA 4DBUA 2Z24A 4MWAB 4Y90A 1OD0A 1ICSA 3D0CA 4Z1CA 4LVFA 4LUSA 3ZT6A 1TCMA 3GRIA 2B7NA 5IXEA 1WKYA 2V5JA 4QR6A 3N3TA 3A6OA 3QGVA 2OYKA 1BWLA 4KPLA 3TU9A 3W1TA 1EWEA 4BQ4A 3VD9A 2ISSA 3O8AA 2BDQA 1MUMA 1OYAA 4LBSA 4B5WA 5L6UA 3WKZA 3ABOA 1RCOB 4PMOA 2Q8LA 1FA2A 4JQAA 2OCZA 4PULA 5AYZA 4O0QA 3I3DA 4F0SA 3FV9A 4ICMA 2AGTA 1E15A 3G0UA 3RPDA 3FGCA 5G4WA 2E40A 1TJ1A 3KBJA 3M5YA 4FIQA 4MNJA 2PCQA 1E6RA 2G41A 3DKJA 4HNLA 4GINA 3NQGA 3SY5A 1XJBA 2TRSA 3DG6A 4B3KA 3UJSA 3OZPA 2EAWA 2CFFA 5D09A 2XVPA 1TB3A 6REQB 1XLCA 1UA3A 3UF9A 3CAVA 4O1AA 1W3NA 2PDXA 1V6YA 3LCGA 4C5ZA 2F38A 4CQ9A 4IM4A 5EMUA 3P60A 1UJQA 4JN8A 1NP2A 3HPZA 4XAZA 3PUOA 3IIOA 3NQ8A 2PB1A 1UH2A 3TSDA 2VFEA 1X8FA 1LTDA 3I65A 3OW1A 1QHOA 3USBA 4TMBA 3V7PA 3WD0A 3A23A 5TAOA 1NFPA 4NZCA 4O28A 1Y5VA 4GE8A 1FCVA 3U2CA 4GXPA 1J5TA 3TFCA 2WK2A 1WUFA 4PYSA 4OBSA 1KXTA 1CIUA 3USZA 3GU9A 3VGEA 4TVUA 5FACA 1K7FA 1QDSA 1XBXA 2DORA 4MPKA 4WJEA 3KRUA 4POCA 4R33A 1BTCA 3BW3A 3KL0A 3CWOX 4X61A 1KCKA 1GVRA 1DBTA 2ZRVA 4PN2A 1FWTA 4GCAA 4IFOA 5JIWA 3W2KA 1C7TA 5DY3A 1XW8A 2C1GA 3OG2A 1XD1A 2A3BA 2OQYA 2XIQA 1J0JA 2PBGA 2PWEA 1H50A 1E73M 2P53A 1XYBA 3CHVA 2POZA 1ISYA 4Y9OA 1EA0A 2FTWA 3HOJA 2NV2A 2W6RA 4CNNA 1NU5A 5AN7A 4DJDA 4JDBA 3C2VA 1EGZA 1GOWA 5LXEA 1ZJAA 5ABGA 1Q66A 3NZRA 3W84A 3CPRA 1ZAHA 5DLCA 1K77A 3WLRA 1NWUA 3TE9A 1NWRA 4YVVA 4NJHA 1CGVA 5TQLA 3MMWA 3RLGA 4GQGA 4WLCA 3L21A 4FOJA 3QW4B 5DELA 2VWTA 1IWAA 2G0WA 3CT2A 3GTNA 3ZOAA 1QI2A 1D3GA 3KM8A 2NSOA 1NEYA 4R7WA 3RCNA 2D20A 5L9FA 3P74A 4KMQA 2XYLA 1WYIA 4EPEC 1K9EA 1TQXA 3P14A 5CJNA 4DF0A 4AHPA 1EF2A 5FEXA 2HBXA 3RM4A 1KXQA 2L5HA 2GQAA 3OGVA 1NM9A 3O6YX 1J96A 3IVSA 3TTOA 1LL6A 2GVGA 5E0CA 4HA0A 3SM0A 1L8NA 4YLWA 1UC4A 3VNMA 5EMYA 1UIPA 3N19B 1QOQA 3FIGA 3QYQA 5LHEA 4UR9A 1GJWA 4HJWA 3NSXA 3NXLA 4LBUA 2ZZ1A 5CJMA 1EH9A 3KCOA 4P7RA 3AZRA 2J62A 3GD6A 1P1XA 3FXGA 3OYXA 1VBHA 4PCTA 1H2JA 2YCLB 2A6NA 3W7JA 1ZUAX 2PLCA 2NQLA 1CXLA 4PFHA 3QJAA 4IJRA 5FJPA 4LUJA 1MI3A 3H54A 4F9JA 1LOLA 3C4UA 1NFBA 4WJXA 5D05A 2OT1A 2OOGA 1RPXA 3QPEA 3BSHA 1OFDA 3C0JA 2VEMA 2ZX9A 4GZEA 3UZ5A 4QCEA 4K8GA 1W17A 1CXIA 5CPSA 1SO5A 4EOUA 4XZWA 2ZUMA 3WH9A 3SB0A 3UT0A 1GEQA 2MNRA 1KGUA 4LUTB 1VEMA 4YPJA 1PHQA 4GNVA 4GH3A 2YW3A 3B40A 3WF4A 5KSWA 5KETA 5FF0A 3P0XA 3KXQA 1WXZA 4IH3A 4LAMA 4K68A 5F2IA 1HGYA 5FD0A 3W7KA 2OWWA 4B5VA 2Q6ZA 1JPIA 3A9IA 3WBWA 1ZLPA 2EHHA 3MKVA 4Z1YA 4C6IA 2NQHA 1YRRA 2X2YA 1SSGA 3UU0A 4QCFA 5DMMA 4O1CA 1XFCA 1F4HA 5DN1A 2GUBA 2MUCA 4IMCA 3MHUA 1LLOA 4R53A 3LNPA 5BXSA 1H61A 3W7PA 3KOZA 1IT8A 1C8XA 4IP4A 1A50A 1AODA 4NT0A 1XRVA 2PSNA 1JF6A 1MEIA 1E9ZB 5D2YA 3W6MA 4JFSA 1MW0A 4PA8A 3H70A 2BY0A 1B9BA 3M41A 1UROA 2HISA 4GFIA 3EX3A 3EPMA 4CEUC 3LI1A 1HVQA 3UJRA 2BVYA 1AMKA 3NGFA 3MV01 1V3KA