3Q94A

The crystal structure of fructose 1,6-bisphosphate aldolase from bacillus anthracis str. 'ames ancestor'
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
285
structure length
285
Chain Sequence
MPLVSMKEMLNKALEGKYAVGQFNMNNLEWTQAILAAAEEEKSPVILGVSEGAARHMTGFKTVVAMVKALIEEMNITVPVAIHLDHGSSFEKCKEAIDAGFTSVMIDASHHPFEENVETTKKVVEYAHARNVSVEAELGTVGGQEDDVIAEGVIYADPAECKHLVEATGIDCLAPALGSVHGPYKGEPNLGFAEMEQVRDFTGVPLVLHGGTGIPTADIEKAISLGTSKINVNTENQIEFTKAVREVLNKDQEVYDPRKFIGPGRDAIKATVIGKIREFGSNGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of fructose 1,6-bisphosphate aldolase from Bacillus anthracis str. 'Ames Ancestor'.
rcsb
source organism Bacillus anthracis
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase, class II
total genus 100
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3q94A00
3C61A 3BPWA 3E96A 2EHHA 2F84A 4NJHA 1VCVA 2B7OA 4ICNA 3C52A 4H3DA 4PODA 3TE9A 3W1RA 3P8JA 1BWKA 3NL5A 3W7QA 3LM7A 2ZBTA 3EWZA 1NVMA 4DF1A 1FXPA 1H61A 3M44A 5K4XA 1OHLA 5IBXC 3HBLA 2Z6JA 1E51A 3N9SA 2GPTA 4LV4A 3FJ6A 2KZHA 3W2KA 2XFWA 2B7QA 3O06A 2J9XA 1GVOA 4E2BA 4UXDA 3IGUA 4GWEA 5LNSA 2F7FA 1KM2A 1YYAA 1D9EA 1IXQA 3S9YA 1ME8A 5FEWA 2OX1A 3S42A 3VCRA 1ALDA 3IV3A 4FNTA 2CZFA 3W7KA 1ME7A 4P61A 3S1XA 1OFAA 1PS9A 1ZALA 3FEMA 4JTSA 1VJIA 4LRSA 2RKXA 1ML1A 2I9EA 4NU7A 4RV8A 2E6YA 3WJZA 3UPWA 1GTEA 1KBIA 2NUYA 4WOQA 3UXAA 3CM4A 4JN6A 1TTJA 3S5ZA 5D32A 2ISWA 4QNEA 3LGEA 5FF3A 2YX0A 4LOCA 4IQLA 4M5PA 2JKEA 3FYPA 4OHQA 2ISVA 5AOUA 2WKJA 2Y85A 4JEQA 5EBUA 4MYAA 2GOUA 3UXDA 1N7KA 1L6YA 1OJXA 1H63A 3UWUA 4O12A 4ALDA 3WK3A 3DKLA 4UC5A 3HPSA 5TQLA 1GPWA 1F6KA 3QFEA 5DCDA 3RLUA 3C56A 3LOTA 1X6UA 3W1AA 4FNPA 4EVZA 4MPQA 5DBUA 3W1TA 1JCNA 2ZZ2A 3L0NA 4NJJA 4J9JA 3DBPA 1SZGA 3QMRA 4S2CA 3EX4A 4XZ9A 1GOXA 3DGRA 4UMCA 3VE7A 3D0CA 1SUXA 3FS2A 2ZRUA 3AJXA 3KFTA 5HUOA 1XDMA 4UFHA 2A21A 1JRCA 1ZNNA 3I6RA 3GDLA 2V2HA 3QJAA 1LBFA 1V5XA 2CLLA 3HGOA 2Y70A 3W7GA 4EF9A 2OCZA 3O05A 2CW6A 3CTLA 3TKFA 3G1SA 1B4EA 3GDTA 3T4CA 3LCLA 4LU0A 3GKFA 1I8JA 4O52A 3IIXA 2YDAA 2Q3OA 1H51A 4GC4A 3O8AA 1MZHA 2A2IA 3FLUA 1GVSA 3RFAA 4N6FA 5G1TA 1GQNA 1ICSA 1UB3A 5D04C 2TSYA 3NQ2A 2PC4A 4O19A 1XM3A 3C3NA 3DAQA 3S5YA 5H2ZA 2DJXA 4X3ZA 3WJYA 4CCCA 1ZHAA 3AO0A 3P60A 3W7OA 2VFDA 1X1OA 2QEZA 4L4MA 1XBYA 3LCHA 1KLYA 3W2JA 5F4XA 3P81A 3NQMA 3TX9A 3C2VA 4A29A 2Y63A 4ADSA 1RD5A 2H3BA 2DJLA 3VFLA 1PHQA 2Y6ZA 3PC0A 1IXOA 3RF9A 1XBVA 2CZEA 4U4MA 5HUPA 4FX7A 2YFOA 2ZCGA 4UR7A 3LLDA 5K3VA 1VS1A 4H4IA 5D2YA 3SIZA 5LHFA 4AHQA 2GUUA 1HO4A 1WA3A 1R2SA 1N8FA 3DFTA 3WK1A 3DI1A 2RH9A 3PB0A 4NQ1A 3QMTA 1G4SA 4NNCA 3STFA 1G69A 2E6FA 2GVLA 4WX2A 4XTDA 1K8XA 5HINA 3NZ1A 3DXIA 1WOAA 2HTMA 1Z48A 2E09A 3IGXA 1B9BA 2BTMA 2NV2A 3A23A 3W85A 3KVMA 5CZJA 5LNRA 3ELFA 1TMHA 1I2NA 2VC6A 2C19A 3O6YX 3PBUA 5J5DA 3Q94A 4PCFA 1LBLA 3MI6A 3JRKA 4M6QA 3NL2A 2A4AA 5AHEA 2JKAA 5FEZA 1FWTA 3IRDA 3EWYA 3SW6A 1AL8A 3HB9A 4NUWA 4FXRA 4X9SA 2I14A 1JR1A 4ZQMA 3BGGA 4N9EA 1OFRA 1RZMA 3HGRA 1O95A 3LXCA 1G4PA 1U5JA 3UWQA 1KLZA 3A5FA 3RMJA 3NQDA 1ZJIA 3M9YA 4CCDA 3W07A 4KFPA 3BO9A 5FF2A 1EA0A 1FY6A 4I7WA 4IPIA 3SFKA 4RXGA 2B0MA 1NF0A 1R30A 4MJZA 3PBVA 1GZGA 2PRMA 1VH7A 5KTLA 3QMSA 1JULA 4GE8A 2ZZ1A 1U83A 1HUVA 1EEPA 1QDSA 4JIQA 3C8FA 3R2GA 2P10A 3R12A 1GJPA 2V0TA 4AVFA 4JS3A 5IBXA 1LDCA 5HWJA 1XDLA 3PM6A 3PWAA 4OQVA 1L9WA 1DQXA 4TR9A 4DBDA 3WJSA 1OFPA 4MZ8A 4M6PA 3HG2A 3GXNA 2YW3A 2RHGA 4QJ1A 3LHUA 4FIQA 4Y6GA 2ZTJA 3W88A 1A5CA 4POCA 1TQXA 3EX2A 5LNWA 3PG9A 3QEZA 2OMAA 3FFSA 5F2MA 3S5NA 5DCBA 1VCGA 3RU6A 1SO3A 2NXGA 1KM3A 1QPOA 3W1NA 4O4WA 4IMCA 3S8HA 1R2TA 3DU0A 3G22A 5D2TA 1EWEA 3T7VA 2H8XA 5D02A 4LS1A 1SZEA 4JDBA 5U7SA 4R7JA 5CG7A 3ZWTA 4JR5A 4QQ3A 5LGXA 3DH7A 1Q6QA 3DENA 4MY9A 1EUAA 1TPEA 5D37A 4RXFA 1SR9A 3LCIA 3LRLA 1TPH1 2X1SA 3TXVA 4R53A 1UASA 4O13A 3OG3A 4GUFA 4LW7A 1Z42A 5DCEA 4A22A 1JUKA 3BLFA 4R34A 2NXIA 1TB3A 5F1UA 3UY8A 4CLMA 1W3IA 1EUNA 3UZ5A 2RDTA 2ABAA 3LCWA 3BLIA 1JCMP 3W1UA 4M6VA 4MVAA 2E77A 4UTHA 3NYZA 3UWZA 4ZQNA 2QCLA 2O7SA 3M5XA 2VFGA 1ONRA 3WK2A 1DQWA 3PVFA 3NGJA 3OVQA 3NM1A 2BLEA 1OK6A 2QCDB 3G1FA 2ABBA 2H3DA 1S5WA 5AC6A 2X16A 4HKPA 3G1VA 3NDOA 2G96A 1D3GA 5I3HA 4DO4A 5KMYA 4O1DA 3GVGA 5IM51 3S5OA 3N34A 4MY8A 5CKSA 5E1QA 1OF6A 3NZRA 3NVTA 3DI0A 1G6CA 3NL6A 1OFOA 2BZNA 6ALDA 1YPIA 2CU0A 3NQGA 1T0OA 4MOZA 3CLMA 3LLFA 3T55A 1SU5A 4Z08A 5AYXA 5G2IA 4LS2A 4UTTA 4JY9A 1P0KA 2A85A 2YXGA 3FA5A 1MEIA 2EPHA 4N2YA 1WYIA 1KV8A 2VENA 1L6SA 1O5XA 3W76A 4WD0A 4O11A 2FB2A 4LS0A 2C6QA 2ZYFA 3PULA 2G97A 2QCNA 3B0UX 1SO6A 2A7PA 4C1KA 2QKFA 1F2JA 2YCEA 4MLJA 2IQTA 1YADA 1KM1A 4UNLA 3CU2A 3CIXA 3TQKA 4DELA 3OA3A 3P62A 1VYPX 5F2GA 1VQTA 2Y7EA 3NA8A 3ZS4A 3E12A 1K03A 3CHVA 4AXKA 2QJHA 3P5ZA 4UNKA 4PL2A 3R5EA 3L0GA 3QH2A 1JQXA 1WQ5A 3G1AA 1OFBA 2WSQA 3SSJA 3TJXA 3W73A 4LT9A 4QM1A 3KOFA 3TIMA 2R14A 2EKCA 4YCOA 4BWLC 1KTNA 3I68A 3K30A 4FXSA 4DEFA 3I7SA 1LTDA 3L66A 3M5VA 2OT1A 2XN0A 1PL9A 1XUUA 2VFEA 2LLEA 1LYXA 2ZRZA 4XUGA 3DFQA 4Z0JA 2W0UA 4O0KA 3NQEA 4K6AA 1Y0EA 5D2WA 1H50A 1FWRA 3QQ0A 5AHMA 1TV8A 4O57A 5G4WA 4UIOA 2EGZA 4A2SA 1YDNA 2J88A 4NVTA 1VHCA 4OWGA 3MP5A 1VPXA 4ZL1A 2E6AA 1YXCA 1H7OA 1W3TA 2ATMA 2ZZ6A 1I2QA 3BV4A 4JTKA 3GR8A 3E49A 3STGA 5I3GA 5AFDA 3CEUA 1LBMA 5E0KA 5LGZA 3G24A 3W7LA 2ZRXA 1UJPA 2C0AA 3TC7A 3B0PA 3UPBA 3B8DA 2C16A 4RR4A 3TMQA 3BVJA 1FWWA 3L9CA 3LBMA 4FO4A 1JJKA 5BOOA 2OT0A 4HNUA 4RCXA 5LNVA 3GNDA 2H90A 4BI6A 2Z6IA 4UMAA 1T99A 4GRSA 4WY0A 3HG3A 3GK0A 3A5VA 3EWWA 1EP1A 5LNUA 2FIQA 1JUBA 1H7PA 2VFFA 5K9XA 1X7FA 3P8IA 3IIVA 3L0KA 5DXYA 1F5ZA 3LHTA 1EIXA 1H7WA 3PG8A 4IMEA 4GFSA 5CZTA 4LRTA 3LTYA 3VE9A 1JRBA 3NQ8A 1W3NA 1Q6RA 4LC8A 3NO5A 3THQA 5CPOA 5D09A 2QDGA 3PS7A 2A5HA 1DBTA 1OYCA 1P1XA 4ADTA 1LLZA 4FX8A 1W31A 3N2MA 4GJ1A 3OBKA 1TV5A 2DZSA 3DKJA 4ZMGA 3LRMA 5TIMA 5D05A 1H62A 2QCGA 3LV6A 3VI2A 1K3UA 2A6NA 3CPRA 3STCA 4AAJA 1K02A 4AWTA 4FF7A 1FDJA 3E9AA 2G5WA 2V2DA 3W2LA 3CB8A 2ZA1A 3MI2A 1WBJA 3PF3A 4O10A 3G1YA 4O0ZA 4LVAA 1V7YA 3N3MA 3NQFA 3TJLA 1GG1A 1JCLA 5EPDA 1OFEA 4JDYA 3L21A 5BW6A 3GYEA 3FKKA 3L2IA 3HQ1A 4Q4KA 2R94A 4YXGA 3OHIA 3ABOA 3MMTA 4DO5A 4LVBA 4NZFA 2JK2A 3E02A 2AGKA 4HNNA 1EP2A 3OIXA 4JYFA 2Y88A 4IMGA 4ORMA 2QCEA 2ZDRA 1X1ZA 3HPXA 4MZ1A 4ZVJA 4ZZ9A 1W56A 5AHLA 3R8RA 3JS3A 4WOZA 3UD6A 2PE4A 2ZZ7A 3BARA 5FF4A 4N9CA 2R91A 3NQCA 5HWNA 4KFNA 4MFEA 3V75A 3KVJA 3QYQA 1QO5A 3W7MA 4UTWC 2CLMA 3I65A 3IIPA 1NF7A 3EX3A 4Q32A 1JCXA 4HT3A 1LZOA 3HGJA 3THAA 1KFLA 1PIIA 4M19A 2NLIA 3S1UA 3M5YA 3G1HA 2DZUA 3CC1A 3TW6A 5U4NA 4X2RA 3BW3A 4TIMA 1OX5A 2Z2UA 3KX6A 5I3FA 4JD4A 5LKYA 2GJLA 1WV2A 4R33A 5CPMA 1TREA 4I7UA 1VZWA 1K8ZA 3TROA 1R2RA 3TMLA 3IVTA 4JY8A 4JTFA 3G0SA 3NPWA 4MFDA 2YGYA 3IGSA 4LNYA 4CQ9A 1FWNA 1XL9A 1Z44A 3W83A 4MZYA 5GVJA 4HN4A 4HNVA 3SGZA 1KFJA 5HNRA 1QOPA 5SWUA 1RV8A 5EA9A 2ZRVA 4NX5A 1NSJA 1EP3A 3W71A 1EPXA 2RDWA 2QR6A 1LRNA 2Q3RA 5I3IA 1H7XA 3NXFA 1VLWA 2VKZG 2ZQ0A 1A5SA 1QNVA 2VEPA 3DFNA 4JYEA 1FQ0A 1KFKA 1TTQA 3N19B 3TSBA 3L68A 3W70A 4UR8A 3W87A 2CWNA 4EIVA 2JGYA 1OYAA 5ABTA 4UFMA 4K7VA 3NQAA 4BWLA 1LRTA 3W2NA 3NOEA 5EKYA 2VOMA 1EWDA 3M0ZA 5CSSA 3YPIA 4GNJA 3LCGA 1Q45A 1QAPA 4TX9A 3U2OA 1AW2A 4WZHA 3B4UA 3LI0A 3W2UA 1ZFJA 1YXDA 5G2WA 4LWWA 4TMBA 3UNDA 2GJNA 5DBTA 1W5OA 3W2MA 3W22A 1GT8A 1UCWA 2JGQA 4HIBA 4JTGA 5J5RA 4XKYA 1A53A 2FPTA 3INPA 4BK9A 1AL7A 4QITA 2VEMA 3FKRA 1S5VA 2VFIA 4RZ4A 3F1QA 5HR7A 3O07A 5HULA 4LV9A 3GAKA 1SQ7A 4UCGA 4HSNA 2YPIA 3V1PA 2ZA3A 3W72A 3B0VC 4DBEA 4PA8A 5LHEA 2NUXA 3C0JA 1SZNA 1KTCA 3TQ0A 3W7PA 3W7RA 4HPJA 5D33A 3WJWA 2HMCA 3UZJA 3MYOA 3LBCA 3LRKA 4RZ5A 1KW1A 2TYSA 1VC4A 4N9DA 4FNQA 3W86A 3PUEA 2CLEA 2FQIA 3E0IA 3ABRA 3WFAA 4PEKA 1OFDA 1GG0A 3QC3A 3SY5A 3L67A 1PV8A 2WNNA 3QSTA 2DP3A 1O94A 3HF3A 3PAJA 4Z1DA 3W1XA 2Q8ZA 2YW4A 2P0OA 1J2WA 1F7BA 3NNTA 3IIZA 3W9ZA 1ZY9A 3TNOA 3EXSA 5CSRA 1TPDA 3WJXA 3FIGA 3G1DA 3B06A 2B7PA 3W7NA 1ZAJA 1LP6A 4LY8A 4WJEA 2A7NA 1NAL1 3L5AA 1G4TA 4OBTA 8TIMA 1TJPA 3A21A 3MP4A 4FEZA 2CLIA 3QPYA 3MUXA 4O18A 3S6DA 5KZMA 1A50A 1QOQA 5F4SA 1BKSA 2C14A 5LSMA 4ORIA 1SFLA 4IXHA 1HG3A 3NM3A 4UTKA 3EKLA 4UFJA 3B04A 3NEVA 4IX0A 4GBUA 4OV4A 3BGJA 3LI1A 1SW7A 5H91A 1XUZA 4BR1A 1P0NA 1FWSA 1K7XA 1A5BA 3G0UA 1TV7A 4NXSA 1MEHA 1Q6LA 2V30A 1O60A 3SECA 3DHDA 1L2UA 3LHYA 1DJQA 4YMZA 5D2VA 5L6UA 2NZLA 1KFEA 1LLWA 2DZVA 1W0MA 5D30A 4DF0A 1IXPA 2AAMA 5L9FA 1ZENA 3PUOA 1LORA 4RK8A 4B5NA 1CI1A 4AWSA 4NNBA 5FF7A 1F76A 1SPQA 1DORA 3UWYA 3P61A 4ZQPA 5KZDA 3VNDA 3QW3A 2AQWA 2VEIA 3MHUA 3LERA 4NJGA 2NX9A 2WO5A 4MJMA 4PL1A 5F2IA 4FNRA 4WXZA 3MP3A 1F73A 3GDRA 4XQ6A 2NX3A 3USBA 5A5WA 1I45A 1W54A 3DFPA 3W1QA 4CNPA 1A5AA 3N14A 4YCPA 4TU1A 2QUTA 1IIHA 2GQ9A 3P82A 3EXRA 2GVJA 6TIMA 1EB3A 2PRLA 3O6CA 4FHAA 4JNMA 4PTNA 1NFBA 2VELA 2BSLA 4ZQOA 4Y9AA 1H60A 1H7RA 4UMBA 2WSRA 2CLHA 3ANYA 3P80A 3FJLA 1VRDA 3TH6A 2FTPA 3DFOA 4UFIA 1ADOA 1UUOA 1SSDA 2WNQA 4XBSA 3P84A 1MSSA 4I9AA 1W8SA 5G1YA 1P4CA 3ZWSA 1PVNA 4ZQRA 3TSDA 1RR2A 1MXSA 4ONVA 3P67A 2CZDA 4K36A 1WXJA 3HG5A 4JXCA 4DPQA 3NR0A 4UFLA 4HPXA 3SR7A 2I1OA 3RK8A 2ZA2A 5CGQA 1DHPA 5AN7A 4O1CA 3BG9A 3P5YA 2DORA 3TDFA 3TSMA 3UWVA 5FESA 2ATSA 4E2DA 1T96A 5T26A 2FPVA 2TRSA 4IJBA 5AYYA 4DQWA 2YZRA 3CQ0A 3W1PA 1QCWA 2G95A 4O16A 1DJNA 2CLKA 3EXTA 1O5KA 3KRUA 2E68A 5FEPA 4K7YA 5AC8A 2WNZA 1TCDA 1TO3A 1TRIA 3O16A 5BMXA 1I4NA 1QO2A 3NPVA 1SSGA 4K37A 4XWUA 3GNNA 1F05A 4K39A 3W75A 4DO6A 3KRZA 4OU1A 1LROA 1AG1O 1OK4A 1L6WA 4KWWA 3TXZA 2ZRYA 3HG4A 2B7NA 4FB7A 3S1VA 1IIGA 3MI3A 2C3ZA 1MEWA 4JX6A 4N6EA 4OV9A 5EYWA 4G1KA 4LVFA 3H53A 2H6RA 1HO1A 2D73A 3NQ6A 1VHNA 1GTHA 1G7VA 4JTUA 2W6RA 2DZWA 3N2XA 4A21A 1FUYA 4A2RA 4FX6M 4CNNA 4JTIA 4JYDA 3RLVA 1TPVA 1B57A 2H8ZA 1YTDA 3IVSA 2CLOA 2J27A 4MLRA 5LZLA 1H5YA 4E0CA 1D3HA 4NJKA 3OEXA 3U6WA 3Q37A 2J24A 2C1HA 1I2RA 4HNTA 2ZZ3A 3G8RA 4D2JA 3EWUA 3R89A 5F2LA 5TBOA 3W7EA 3C2OA 3A24A 1NEYA 4FNSA 1LRQA 2DZTA 2X2GA 4UTJA 4PH6A 3LX9A 4Y8FA 2O7QA 3NPUA 1XBZA 1KBJA 1SO5A 1YDVA 1ZAIA 3PY2A 4QISA 5EY5A 1P5BA 2E6DA 2JBMA 3DFSA 2JKPA 4OT7A 3GZ3A 4IMDA 4MUZA 4IWWA 1ICPA 1W5MA 1EX5A 3L65A 3HGSA 2Y7GA 3STEA 4LVGA 1WDWA 2BXVA 5K4ZA 1X8FA 4XTIA 4S2BA 4NT0A 1LCOA 3M16A 5HWMA 4M7TA 2QJGA 1BTMA 1OABA 4CQAA 4MKNA 1H1ZA 1GVFA 1ZCOA 4WXYA 4NX0A 4NNAA 3TC6A 3CEPA 3QSRA 5C55A 1QWGA 1W1ZA 3W1LA 5HJLA 2E5BA 1W5NA 2DZPA 5HQEA 1GVQA 5D38A 4Q33A 3MBFA 3W1MA 2ZZ4A 3SJ3A 4C1LA 3CIWA 2TPSA 4N4QA 1AK5A 5DXXA 3W7HA 3TFCA 4M7SA 3U8GA 3R13A 1T8XA 1XCFA 3BK0A 3L5MA 2XN2A 3A22A 2Z0IA 1VCFA 3UY7A 4AWUA 4AB4A 3TW7A 2Z1BA 2P1FA 4UTWA 3P7YA 1FX6A 4RZ6A 1JUEA 1H7NA 4KFOA 4BFAA 5AB3A 2BX7A 2E1DA 4QIUA 1TQJA 3Q58A 4WY0F 3PUDA 4BI5A 1OVDA 1W5QA 3T78A 1FDYA 4DPPA 3BG3A 3N73A 3MBDA 3W7DA 1KFCA 3Q2DA 4IOTA 1B3OA 3LXBA 4JTLA 1SZFA 3GXTA 1H1YA 4MYXA 4WUIA 3PBYA 2QF7A 3ATZA 1AMKA 5KITA 2PRHA 1DL3A 1GYNA 3I7QA 4UTTC 3UWWA 3LHVA 2W79A 2NXHA 4HHPA 3O1NA 3KRSA 1S5TA 1TPWA 1LOSA 1G67A 4TMCA 4UTMA 1TYGA 1DVJA 1PCKA 4UFKA 1Z41A 3GX9A 4LUJA 3MO7A 3O6DA 4IGHA 3P74A 1WBHA 2OJPA 5DLCA 4PFMA 1FCBA 1B4KA 1TPC1 5E93A 1TPUA 4O28A 1C29A 1HTIA 5DN1A 1R47A 3EX1A 2YR1A 3MWAA 3GXPA 3SI9A 4YL2A 2ZRWA 1I2PA 4W9TA 2NUWA 4IUOA 1F74A 3CWNA 4PC8A 2ISSA 5C2XA 4AEOA 2OZ0A 1UBSA 1YTEA 3B05A 5KZEA 3LV5A 1OYBA 4X22A 3G3DA 4CCEA 1KV5A 3KVLA 1KM6A 1TSIA 2C13A 4HSOA 4JTHA 3M47A 2NX1A 5CPLA 1FCVA 3GAYA 3HIJA 5KSWA 2QJIA 4O1BA 3BW2A 3TQVA 5K9CA 2CZ5A 5FEXA 4JGDA 3W84A 1RQHA 1DKWA 2X30A 5K9DA 1CW2A 4LTSA 4Z1CA 5D2XA 3G18A 4N4PA 3LCFA 4XKYB 4DXVA 1LOQA 3PSWA 2NWSA 1CX9A 3QZEA 1IGSA 5EMUA 1WX0A 4L4LA 1SW3A 3IVUA 3NQVA 2QCCA 3GR7A 5C5YA 2UV8G 1OX4B 4K8HA 1TTIA 4FNUA 3WK0A 1XFBA 3MHGA 3F4WA 3SZ8A 1VGAA 1SFJA 2QDHA 5AHFA 1KTBA 3LHZA 1KM5A 2RFGA 2X1UA 1YLVA 4RKAA 2HS8A 5CPNA 4NZJA 5KINA 3W23A 3NL3A 4AF0A 4LUIA 1KM4A 3BW4A 4NJIA 2FLIA 3L5LA 1N55A 5F1VA 3TA6A 1AW1A 3QQ1A 1S3HA 5K7JA 2YYUA 4O54A 5AC7A 1M6JA 3M41A 1KA9F 2EAWA 2A6LA 3OVPA 4GUHA 1QR7A 5DY2A 3QM3A 2WOQA 4TO8A 4OE7A 1TIMA 2QCFA 3EWBX 5C6MA 3HOJA 1UUMA 1YTKA 2FFCA 1XC4A 1ICQA 3C2EA 5G5IA 4UUIA 1GVRA 1RPXA 4UTLA 3SGUA 1F6PA 3DHFA 1OX6A 1JCYA 4Y90A 4Z1BA 3GDKA 5F4WA 1K7FA 1PCWA 2C18A 3C4UA 3ABSA 4K38A 3HJZA 3CWOX 4O8RA 4A3UA 1GWJA 2ZFAA 2FJKA 2FDSA 3QPZA 1JCJA 3EEGA 3G0XA 5HMSA 3H55A 1SO4A 3HPZA 5DY3A 1QPQA 1BEUA 2X1RA 4MY1A 3NAVA 3LCXA 4RJEA 3LXAA 1XXXA 5G2HA 4GUGA 4N9BA 3W3OA 3W7JA 1OX4A 1KM0A 1PHWA 5FI8A 4CQ8A 3G3MA 3F03K 2J9ZA 3IEBA 2RDUA 1M7OA 4RX0A 4P2VA 2ZTKA 5DELA 1TPFA 3S0CA 2WPBA 2V2CA 3FOKA 4Y96A 5D03A 4IPJA 3UQNA 1FDZA 2V5BA 1KFBA 4O1AA 5K2ZA 4GUIA 3QRHA 2V9DA 3LTSA 3JR2A 4FIRA 1G7UA 2QUVA 1XI3A 4JIPA 3NPXA 3W74A 1RVGA 1IXNA 3G8EA 2YYTA 3MYPA 4AHPA 1FCQA 4O14A 1FXQA 4LC6A 1BWLA 4QSHA 3OVRA 1THFD 3GB6A 4Z0SA 3LDVA 5HR6A 4CNOA 2V5LA 1Q3NA 2GVGA 4JX5A 1JVNA 4RLIA 2EF9A 1WOBA 3LTPA 4UTUA 1QPNA 2YSWA 3S1WA 4IX2A 3M5ZA 3T44A 4QAIA 3ABQA 2HSAA 3TR2A 3EWXA 5AYZA 3LHWA 1FCUA 3W7CA 3MHFA 3MW7A 3TK7A 1WAUA 5G4EA 3TU9A 1JQVA 3KHJA 4O15A 4E38A 3TUUA 1QFEA 1LM1A 2Y7DA 2R8WA 4O50A 3F4NA 1FBAA 2J6XA 1VLIA 3O63A 1IF2A 2QCHA 3I7RA 3C2RA 2Y62A 1OF8A 4EF8A 5BNKA 2X1TA 2E5CA 3BLEA 5CZ0A 4O53A 1MO0A 5CZSA 5EL1A 2NWRA 3EB2A 1ME9A 4JTJA 1I2OA 1TRDA 4BF9A 3O15A 3PB2A 2VEKA 1RQEA 1C9DA 2CLFA 1VYSX 2C15A 1Q6OA 2FPYA 2V81A 3HMJG 1PE1A 1SW0A 3RNDA 3G1XA 2WV8A 1G4EA 4DF2A 3W6YA 2A1YA 2Y61A 3DZ1A 1J5TA 5I3JA 5C54A 1K8YA 4AHOA 3W7IA 2QCMA 3GIYA 2E5DA 1C8VA 3M1ZA 3M6YA 4XBKA 4AH7A 2ALDA 3ZR4A 1VYRA 3NG3A 3TAKA 1DOSA 2NV1A 3EX6A 1DV7A 1YPFA 2Q8LA 1LOLA 4JX4A 4KWVA 4O4VA 1QPRA 3EKZA 4Z1AA 2DZXA 2GQAA 4JTEA 3UYCA 4WQ6A 4IXXA 5BRBA 2PCQA 1W37A 2Y7FA 3CT7A 4YLWA 5AHIA 3T40A 4ADUA 2TMDA 1ZAHA 1O4UA 1M5WA 1W5PA 4IMFA 4JTTA 1OFQA 2PURA 3ATYA 4EWND 3KAOA 5I3KA 5FF0A 4GXMA 2FB3A 4AF0B 3C2FA 4EOUA 2WQPA 2ZZ5A 4H6KA 3TFXA 4AMAA 3LB0A 2WJZA 3FYOA 3H54A 2QCDA 1TTPA 5BMWA 1GEQA 3A9IA 2Y89A 4O17A 2BWGA 3M7WA 4JICA 2YFNA 4WY0B 3GKAA 3ZFHA 3TV8A 4ML9A 2VXNA 4QNWA 3PR2A 2QUUA 3PSVA 1YXYA 2VFHA 1RQBA 3QW4B 2J9YA 1R46A 4NXKA 3MJYA 2WSYA 4MIMA 3B03A 1VR6A 1J4EA 1M7PA 3N9RA 5MHBA 1TPB1 1OG0A 4K8EA 3QF0A 4U28A 1AW5A 4GUJA 2B4GA 2GQ8A 3M43A 1TJRA 4N02A 3KVKA 2HS6A 1HFBA 4S1FA 2CFFA 2V8ZA 5A8GA 1XBXA 3KXQA 3NQ7A 1YDOA 4UTIA 3C6CA 2V82A 4YWIA 7TIMA 3GDMA 4KKXA 2A0NA 4ZQCA 3TAOA 2XN1A 3PBWA 3BG5A 4LVDA 1XKYA 1GYLA 2A7RA 5AHNA 3VKJA 3GLCA 1K7EA 4I7VA 3IIOA 1HL2A 3HO8A 4OGZA 4BI7A 2QAFA 1QMLA 3TCEA 2QAPA 2DU2A
chains in the Genus database with same CATH superfamily
4I90A 2J8FA 3TONA 4GOAA 3BUVA 1RAKA 4ICNA 2B7OA 5I78A 2HVOA 5M2FX 1IYXA 1ADSA 1VBGA 3BLLA 4ACZA 1NVMA 4DF1A 3FGCB 1H61A 3U5YA 4PCPA 1AZ2A 3ZYZA 2XFWA 3O06A 3AROA 3ZIZA 2Y5JA 2J9XA 2GDVA 4E2BA 1XYFA 3PPHA 4GWEA 3DFYA 1S38A 3CT2A 3OQ8A 3FNDA 1YDYA 1IXQA 1ALDA 2GJRA 5FKYA 2G3FA 4NAFA 3W7KA 3S1XA 1OFAA 2YDRA 3FEMA 4JTSA 1L6FA 4MAVA 2E4TA 1U33A 1GTEA 2OKOA 1KBIA 1US0A 3AUJA 3S5ZA 4XD4A 2GSHA 1FH8A 5M1TA 1X98A 2YX0A 4BHYA 1FWBC 4IQLA 3FYPA 4OHQA 3PJWA 5AOUA 2Y85A 5EBUA 4MYAA 4EWJA 3GHRA 3V0UA 2ZDSA 1UWQA 4IP5A 4WCJA 4GYKA 3G6LA 4JN7A 2EG8A 4Z2JA 3GNRA 1VFFA 3LOTA 4YN5A 3VIGA 5DBUA 4I5RA 1A3XA 3EX4A 3R8HA 3DGRA 3F4CA 3VE7A 4HA0A 3B97A 1Z3NA 1KGUA 1VFMA 3VKBA 3JZUA 5H8MA 2GGEA 3GDLA 3GG7A 1RBLA 3M46A 4Q7BA 2IUZA 4LAZA 3UJ2A 3O05A 3AHYA 3NVDA 3G1SA 1B4EA 2J62A 1P7TB 4HHMA 3QTPA 5HMDA 3IIXA 2Q3OA 4MAZA 5DRCA 3TYZA 3KDNA 2XH7A 4Z2KA 1BGGA 1GVSA 3RFAA 1BQCA 4N6FA 5G1TA 1GOIA 1UB3A 1J0IA 1W2VA 4O19A 1W1TA 2E7FA 3MVTA 2VQTA 4RDVA 2OB3A 2DJXA 4CCCA 3WJYA 3AO0A 5CJNA 3VMNA 5GNYA 3PBMA 3LCHA 5F4XA 2R1MA 3WD3A 2Y63A 4ADSA 1RD5A 1V6XA 1T40A 1WZMA 1HKIA 4TTUA 5C7VA 1CYGA 3PC0A 2Z1WA 3AYVA 3RF9A 1XBVA 1K9EA 3UT0A 4MNLA 4U4MA 2AAAA 1RJRA 1DIOA 1SM9A 1W1YA 5HUPA 1JPHA 4AHQA 3O7UA 4KCUA 4UTFA 2P3EA 4IGSA 1G69A 2E6FA 4XTDA 1K8XA 4A05A 3A4JA 1E56A 1Z48A 2NV2A 3IGXA 4CQCA 4IG2A 2VEGA 3QR0A 5AKQA 4LF2A 2UZ9A 3S46A 1X7IA 1Q63A 3IARA 5LIUX 1WXZA 3ELFA 3K1GA 1HVQA 3WMSA 4XAZA 1TMHA 4LFYA 3PP7A 4F40A 1I2NA 3FA3A 3UJFA 5I02A 4HTYA 1M41A 4PCFA 3JRKA 5BROA 2CHRA 3MT1A 1TJ2A 9RUBA 3PWIA 3HB9A 2PODA 2QF8A 3KBJA 2G50A 4X9SA 2VTFA 1JR1A 4P7LA 2WVVB 2XZ9A 4MWAE 1RZMA 3N11A 1O95A 1D7KA 1KLZA 4C7GA 1C8YA 3MDWA 1WDDA 1FY6A 4I7WA 3SCNA 5DANA 4NZCA 2VL4A 4RE3A 2B0MA 1R30A 3GU9A 3KTXA 3PBVA 1GZGA 4KETA 5KTLA 3WLPA 1JULA 1H5VA 2CKRA 3URQA 1HUVA 1EEPA 2AMGA 4YIWA 2ANUA 4L6DA 3RCMA 2P10A 1GJPA 2V0TA 4AVFA 2DSUA 2POTA 5D9MA 5IBXA 3PM6A 5DX7A 4DBDA 4QQUA 4M6PA 1XIJA 4OFCA 1OGGA 3LHUA 4FIQA 4Y6GA 2ZTJA 3H2CA 2QUMA 3OZOA 1E40A 3QEZA 3RU6A 2UY2A 2NXGA 4U3AA 4L7ZA 4Q8VA 2WZHA 4IMCA 4DJEC 1A5UA 1GUVA 5D2TA 3DGBA 3T7VA 2H8XA 4DZIA 4LS1A 4JDBA 4A6GA 1RLDA 4GY7A 2W61A 1ZGDA 2WB5A 2CBJA 5CG7A 3E0VA 3ZWTA 2FHFA 3DH7A 3ZQ9A 2P0IA 1EUAA 1O1HA 1E73M 1ZRQA 5JIWA 4J2MA 4RXFA 5I6SA 3LRLA 4F48A 3TNBA 3TXVA 3WEMA 2DQWA 1UASA 4CNSA 3L7RA 2PMQA 1Z42A 2ZVIA 2EPNA 2Y4SA 3BQ6A 3FAXA 2PWHA 1ZJHA 3QHOA 2WHKA 3N1AA 1EUNA 1OCBA 3WDHA 4HYVA 4F79A 1EL3A 4DB7A 3ZLHA 1N8IA 4H8VA 3M5XA 3AZTA 3WK2A 3GWQA 1O66A 4EPEC 3VD4A 4KGLA 1ISZA 1OK6A 1K8CA 2X7VA 4NI3A 5DMMA 3GFXA 4XK2A 3LUTA 2XIBA 4WKFA 1YNPA 1JXKA 4TV6A 1D3GA 4DO4A 1JZ4A 1YW1A 5IM51 3CUFA 2ZX8A 3DC8A 4JIRA 2Z1XA 3NZRA 4AY1A 2XVLA 3VKAA 1G6CA 3NL6A 3T8QA 4BKNA 1BVWA 3B8UA 1R7OA 2NT1A 2CU0A 4L9YA 3NQBA 4MOZA 1DJIA 3M4HA 3LLFA 4C6MA 5AYXA 2E0PA 5G2IA 3EDKA 2V68A 2Y8UA 2QDEA 3L4XA 2VOTA 4H1ZA 3WD0A 2PBOA 5I77A 2V5DA 4XAYA 6CGTA 4GYPC 2G4FA 1PKMA 2O56A 1J0JA 1L6SA 3DYMA 4LS0A 3VUSA 4MWAB 3KRBA 1U1HA 1A49A 3EDEA 4C1KA 1J6PA 3IACA 4PUWA 3TLQA 4D9PA 1KM1A 2ZVRA 3CU2A 3CIXA 1Q4WA 4DELA 4C7FA 3VZXA 3OA3A 1VYPX 5F2GA 1ONEA 3N25A 1KB3A 2Y7EA 3NA8A 3ZS4A 3TOPA 4MMWA 4GO8A 4MM1A 3VD3A 1E9IA 3UW6A 1VFSA 1S39A 4PL2A 3R5EA 3L0GA 3H7UA 1OFBA 2WSQA 5C2CA 4BF7A 2OOFA 3KOFA 2BS9A 1D3CA 3TIMA 4GVHA 3WQPA 2GK1A 2Z29A 2CEQA 3I68A 3I7SA 4DM1A 2YBTA 1BTCA 5HOSA 3QGKC 3I3EA 1BSLA 2OT1A 1JYXA 1S2WA 1PL9A 1V3HA 2HBXA 5B7ZA 3C3UA 5MF5A 1LYXA 5GJPA 4XUGA 3WH8A 3NQEA 2PPGA 4K6AA 5D2WA 1Y0EA 4Q4PA 3H12A 1FHVA 1RCXB 3BAJA 3VZZA 3KZPA 3VXGA 4O57A 3OBAA 2Y8KA 3D6NA 1YDNA 4QLKA 1VHCA 4CQDA 2QMKA 2YLLA 1YXCA 1H7OA 1W3TA 3EDJA 1TWIA 4TQTA 4F0SA 1XLIA 3GR8A 4HJFA 2EPLX 5I3GA 1V0KA 3AZSA 5BYWA 2ZRXA 3UP8A 3OHMB 3B8DA 2C16A 4S3EA 3TMQA 3BVJA 4FO4A 5E70A 5LNVA 1T99A 4IIEA 3W25A 3NFUA 4WY0A 3F2DA 4CEUC 3A5VA 3EWWA 4GCXA 1W8GA 1OM0A 2YA0A 3AQUA 1V93A 3SUTA 5DXYA 1RD6A 4ZB0A 3ZLFA 1EIXA 2BMBA 3PG8A 4IMEA 4LRTA 4INFA 4ZOAA 5HQLA 1TMLA 4DWDA 3RM8A 2A5HA 1OYCA 2E3ZA 4CN1A 1EDTA 1FWHC 4ADTA 4GJ1A 2XWDA 3AHTA 2UY3A 2RGLA 5TIMA 5HK4A 3ZR5A 1ADDA 3LV6A 4L6OA 3KP1A 4AWTA 4FF7A 1XH0A 3ZJ6A 3E9AA 1UH3A 2WWDA 3MI2A 2ZA1A 1S3TC 3OPSA 4LVAA 3N3MA 3AIQA 3NQFA 1GG1A 1HJVA 3L21A 1UWIA 3P3BA 1XS2A 2O0TA 2VVSA 4CCZA 4AD5A 2WVTA 1HL9A 1JDDA 2JK2A 4HNNA 2AGKA 1EP2A 2PGFA 2OLSA 2Y88A 4L1WA 4MZ1A 4QLLA 1W56A 5AHLA 1Z69A 4AIUA 2DW7A 3VNIA 2BV9A 2R91A 4MFEA 4KFNA 4GACA 5CPSA 1XIDA 2WVSA 3KVJA 3QYQA 3W7MA 1XLBA 2CLMA 4JPGA 3I65A 3GG1A 1GOMA 3A3XA 5C0QA 1PWLA 1EGVA 3L4VA 1TR1A 4HN8A 4DIAA 3CC1A 3TW6A 3H8AA 3BWWA 3BW3A 3ONCA 1OX5A 4JD4A 3GM8A 2G3NA 1TREA 5CXPA 1VZWA 1C8QA 1K8ZA 3K4AA 1R2RA 3TMLA 1YX1A 2VWTA 4JTFA 3G0SA 5JUVA 4QE1A 1XLEA 1I0DA 1XL9A 4HN4A 4HNVA 2HRWA 3SCWA 3VFCA 3GU2A 5SWUA 5EA9A 4HCHA 1OQFA 2ZRVA 3W71A 3ANUA 2YCLA 3CPGA 1Q6EA 4LEQA 2GFTA 3ARUA 1YMYA 4DN1A 2ZQ0A 4PSRA 1FQ0A 4WIWA 3R4IA 4NRRA 1QTWA 1J18A 4F4RA 3W87A 2CWNA 3TA9A 3K13A 1VFHA 1OYAA 4K7VA 5CSYA 4H2HA 3GTFA 4XD3A 4J3XA 3A4XA 3EB3A 5EKYA 3HFYA 4KIRA 1JZ2A 3LCGA 3QGAC 1Q45A 4TX9A 1AW2A 3TYDA 3H4GA 3W2UA 5D9NA 1TX2A 1XIHA 1M53A 4WSHA 3ZJ8A 3DUGA 4U5KA 1W5OA 2G3MA 3W2MA 4DYKA 3V1HA 4AYGA 4L80A 4JAWA 4D1IA 3TN4A 1EC9A 1PKYA 4XKYA 5J5RA 1A53A 3INPA 2C91A 3FKRA 1S5VA 2VFIA 4MB3A 5HULA 3GAKA 4HSNA 4EXAA 3CWHA 3V1PA 1UG6A 2OEJA 4PFHA 2PDWA 1ODUA 3NXLA 3VGDA 3QN3A 1WCGA 3UZJA 3CL7A 1D8WA 2TYSA 3REQB 3THDA 1LUCA 4AZCB 1POKA 1F9CA 2EPMX 2YL8A 3WDPP 2NV9A 3WFAA 4PEKA 1OFDA 1A5MC 4WHBA 4GKLA 2IQDA 2BOGX 2DP3A 1B30A 2J7GA 4HTBA 3W1XA 2Q8ZA 1J2WA 1VRXA 6XIMA 2PDXA 3NNTA 1AH3A 2ZC1A 3IIZA 4N7QA 3W9ZA 2VR2A 2VMFA 3EXSA 1ZTVA 1JI2A 3B06A 3DCPA 4PMXA 4FR6A 8TIMA 5ABFA 2CLIA 3QPYA 2XFRA 1QOQA 3IK2A 4PMJA 1V6WA 1WNOA 1XLHA 5FJIA 1BF6A 2ZE3A 1EIBA 5IOBA 4K3ZA 3B04A 5FJJA 5BCAA 9XIAA 1UW9A 3U3HA 1NFPA 5J04A 1XYMA 4DYEA 1S2UA 2XTKA 4BR1A 2CBVA 2INFA 4H8UA 3MY9A 3G0UA 1TV7A 4NXSA 2V30A 1NOWA 2VC9A 6ENLA 2MNRA 2XIJA 3WMLA 4Z2HA 4YMZA 1S2CA 4LH8A 1JDCA 2FZ9A 4EPBC 4Q4QA 1LT8A 1W1PA 3D5HA 4ZB2A 5L9FA 3PUOA 5BXRA 3W82A 5FF7A 4LEFA 1L0PA 1F76A 4M6UA 1R8LA 4ZQPA 1TIWA 2J7FA 4YYCA 5CCZA 2D2HA 4MJMA 3M0KA 1SFSA 3KW3A 4WXZA 3GYCA 1F73A 1O5RA 1ECEA 3DFPA 4CNPA 1BSIA 1TVLA 4EE9A 2GQ9A 3P82A 3EXRA 2X8RA 1OY0A 3O6CA 4V1YA 2VELA 3GHSA 1H60A 1H7RA 1XRTA 3FJLA 1SJBA 3F5KA 3WQDA 3T81A 2FKPA 3TH6A 3DFOA 1ADOA 2WNQA 5I79A 7ODCA 4BQ5A 1W8SA 4GGBA 5EFFA 3IGHX 3TSDA 4ZOCA 3HG5A 3V5OA 4DPQA 3NR0A 2QHAA 4HPXA 1JPIA 5AN7A 3P5YA 4GINA 2AL1A 3MA8A 3TDFA 3TSMA 2J7BA 3K2GA 2GOKA 4H04A 4E2DA 1T96A 4DWSB 5I24A 5T26A 5A8NA 4FXFA 2CLKA 4RW3A 1O5KA 1UH2A 5FEPA 1XH1A 2PD5A 4JOMA 4K7YA 4UOJA 4H9UA 4I9TA 4ZOBA 3KZSA 2QVHA 1TUXA 1AODA 3DERA 1QI2A 4K39A 1LROA 1AG1O 1OK4A 3TXZA 4D6CA 4PMRA 2ZRYA 3OO2A 3HG4A 4AXNA 4FB7A 1DXIA 4HMNA 1J01A 4R88A 1MEWA 4JX6A 4OV9A 5EYWA 4LVFA 2WZMA 3VOGA 2CERA 3ALFA 3Q4DA 4AX7A 1C92A 1GTHA 4MKVA 3N2XA 4W5ZA 4A2RA 3KS5A 4JYDA 1C3FA 3RLVA 2YZ5A 4HOXA 1B57A 1UPMB 3IVSA 1A3WA 6REQB 3Q65A 4H9XA 3S2MA 1DYSA 1QU4A 1XHGA 2BHUA 2CNCA 3Q37A 5FAJA 4C65A 4WJXA 1O5QA 2ZXBA 2VURA 4EK7A 2WMGA 2DZTA 4ZFMA 2XGIA 1CGYA 3EMZA 1UD6A 1NQ6A 2QNEA 3O0FA 3NPUA 1XBZA 2JIEA 2ON3A 3PY2A 4QISA 4ATDA 2JBMA 3FHQA 4W4QA 4OT7A 4MUZA 3MUIA 3ZXWA 1I1WA 1EX5A 4B9YA 4LVGA 1VBUA 2BXVA 3CV1A 3VYLA 3TTEA 2X0HA 1PIGA 4S2BA 3M16A 4YJ5A 2YL6A 1QHPA 1YNQA 4M7TA 4Q8MA 4GZJA 4MKNA 1P6WA 4WXYA 2GUBA 3QSRA 1XRFA 1UC5A 4JTCA 4GVGA 3GC5A 1MW2A 1EC7A 3W1MA 2ZX7A 2YCLB 3NJ3A 3SJ3A 4C1LA 4N4QA 3W7HA 3ZLGA 3R13A 2XSXA 3BK0A 2NQ9A 1DIKA 5A6BA 3T09A 3E2SA 3WNMA 2YB1A 3TW7A 2E40A 3KLLA 4IHCA 1R3RA 5E9XA 3P7YA 4UNIA 2J74A 4KFOA 4R7WA 5AB3A 4GY1A 4FP1A 2DVXA 4QIUA 3CAQA 4IZGA 3WENA 3IUHA 2TODA 1NOFA 1U2YA 3T78A 3BG3A 3N73A 4KRTA 1FWJC 3EA2A 4J35A 1NP0A 4IOTA 1B3OA 4JTLA 1SZFA 2J13A 4E8DA 4JQ2A 1AMKA 4RPQA 3G6MA 1DL3A 4AD2A 4WJ8A 4DNHA 4J2PA 5JQ9A 1S5TA 4TMCA 3CUZA 1RA0A 1TYGA 8A3HA 3I3BA 4UFKA 3MO7A 4IGHA 1WBHA 2OJPA 3HZ3A 4M1RA 4RL3A 2PLMA 3O2LA 3MKVA 1TPC1 2VR5A 1J0ZA 2PDKA 3E3HA 2P53A 3CTTA 1BG9A 5DN1A 2WC3A 1Q7QA 4HYWA 1JGMA 3EX1A 2YR1A 1Q6FA 5I07A 2ZRWA 2PP0A 2WXDM 4FLRA 1P48A 1T8QA 5C2XA 1SJDA 1B3VA 1VENA 1BYBA 1E4MM 5LIKX 1OYBA 4H19A 1XWYA 4IL0A 2ZUNA 2CC0A 2WM0A 1E55A 1UZ1A 2CHOA 4U3CA 1E1EA 3GAYA 5KSWA 2QJIA 1XD1A 3MQTA 1LWHA 2OYMA 5K9CA 1J2BA 1OZMA 3CV2A 2X30A 4GQRA 1CW2A 4QBXA 4ICCX 3QV9A 1LOQA 5AC5A 3QZEA 4QSFA 1TMQA 3CLWA 4L4LA 2V5CA 3IVUA 1I60A 1GKRA 3LN3A 4E2OA 5TF0A 3SZ8A 2VDHA 3VGHA 4PUUA 1OC6A 1SFJA 1KM5A 2GDUA 3U2ZA 1XISA 2RFGA 2X1UA 2HS8A 1HIZA 1HZYA 4NHVA 4QFUA 5A8PA 4AF0A 1IQ8A 1DWJM 4LUIA 4I5XA 2O92A 1N55A 1E3XA 3M0VA 2CBUA 2YYUA 5AC7A 1YPXA 1K4GA 5GQBA 2EAWA 2A6LA 3OVPA 4DJFA 5DY2A 3CZEA 2I7GA 2VZUA 4OE7A 3TEVA 2PC8A 4IPLA 3IJDA 3OW1A 1YTKA 3N2CA 5G5IA 3HPFA 3SCOA 1RPXA 2NQZA 3VIMA 1LQ0A 1NDWA 5FL0A 4Y90A 3OYXA 1PUDA 4JQ1A 4FF5A 3D47A 1WUEA 1PCWA 3PJUA 4L6HA 4GNKB 5I03A 4K38A 1E3ZA 4O8RA 2VR4A 1HP5A 3BURA 4A3UA 4C6EA 4E8CA 4A8LA 4QX4A 4M81A 2FDSA 4D6FA 1V8EA 3HPZA 1AQ0A 3L4TA 4B90A 2X1RA 4PB5A 3UG5A 2DH2A 3LCXA 1OINA 4DXKA 1YKWA 3CHEA 4N9BA 4GI4A 1V7AA 4W8BA 1OX4A 1KM0A 3IEBA 4W86A 4H2CA 3TOYA 5A1AA 1XYAA 3HN3A 3L12A 1JDFA 1WB0A 3AIWA 4IPJA 4P8WA 5A8MA 2ZC8A 3VIJA 3AIRA 4HMEA 1FDZA 1KFBA 2YCKX 5T91A 2R24A 3R6IA 2PLKA 3S47A 1BHGA 3LU2A 3I6TA 4IJRA 2YYTA 4HOWA 4DHGA 4QSHA 1THFD 3UJSA 3OGVA 2IKGA 1XIBA 3FXYA 3IUDA 3LBOA 4RLIA 1EDQA 2I9UA 3VC5A 1U5HA 3RHGA 5CAKA 2YSWA 4WSJA 2I5IA 3SRKA 3T0TA 4ZODA 4QAIA 1PXGA 3ABQA 2HSAA 1UR8A 5EFDA 3TR2A 5AYZA 3SQSA 3LHWA 3CB3A 1PYFA 4LX4A 3TK7A 1AD4A 1WAUA 2PDHA 1JQVA 3TUUA 1QFEA 1LM1A 2IPFA 2Y7DA 2R8WA 3OP2A 2Y2WA 3RITA 3HV8A 3VDBA 1ECQA 1FBAA 2VQUA 2QCHA 4CD7A 2Y62A 1XGEA 4EF8A 5BNKA 2G41A 2VYOA 4HA4A 1MO0A 3TYCA 3OZYA 2NWRA 3EB2A 2VRJA 5BOFA 4G9PA 1I1XA 2EG7A 3PB2A 2VEKA 1ONWA 2VZTA 2V81A 3HMJG 3GRIA 1PJ9A 2GK1B 3RNDA 4YVPA 5HPOA 1XSJA 4ZFCA 1UA7A 1FH7A 1GQKA 2W5FA 4PUJA 3W6YA 1E0XA 3VIHA 4AEEA 3DZ1A 5I3JA 2XIIA 4AHOA 1T6MA 3GIYA 1C8VA 4FS9A 3RG6A 4BQ3A 2GVEA 4XBKA 3H26A 3ITLA 4ES4A 3PZUA 4XG1A 1DV7A 2XM1A 1EQPA 3EKZA 1KCXA 3GC2A 2DZXA 3RAOA 1CLKA 3CUXA 2HXTA 4X9YA 3UYCA 2R9RA 1PZ1A 4DUWA 2EG6A 2REQA 3K5XA 3CT7A 4QDMA 4CD5A 2KAUC 4ADUA 1O4UA 3LENA 1FA2A 5FF0A 3PFMA 3OTRA 2FB3A 3C2FA 3ISIX 1HX0A 2YL9A 2WZTA 2ZZ5A 5DO8A 4JCMA 1XG4A 2WJZA 3FYOA 3A9IA 2Y89A 3CIVA 3VPLA 1WZAA 2WPGA 4J40A 1JZ8A 3BJSA 4J3ZA 2YFNA 3VIFA 1Z6KA 5IHRA 1UWUA 4V15A 3RUBL 4ML9A 3PR2A 3E5BA 3L2MA 1YXYA 2VFHA 1QK2A 4TUFA 4LAUA 4UCFA 3OLIA 3B8TA 3H2FA 3BZGA 1XH2A 4U28A 1GYMA 4GUJA 2GQ8A 4JFSA 4N02A 2X05A 2HS6A 2QULA 2V8ZA 5A8GA 1PYMA 4QXIA 3ANVA 4ILSA 2XISA 3NQ7A 3LGGA 5JU6A 1JZ6A 4YWIA 1YQ2A 4C1NB 3GDMA 3VVGA 2VX6A 1PTDA 3BG5A 3GIQA 1XKYA 4IGNA 5AHNA 2A7RA 2W92A 3W6LA 4GGHA 1OT1A 3IIOA 3C0LA 1XX1A 2PP3A 3HO8A 1FTXA 3GUWA 1QMLA 3ITCA 3TCEA 3O6AA 4YU1A 1WDPA 3TE9A 3W1RA 1XIIA 3T0DA 3P8JA 1FFQA 4HJWA 4ACZB 2WANA 1FXPA 2IXUA 4BQ4A 3QHMA 5IBXC 3N9SA 4AC7C 4LV4A 2RAGA 3W2KA 2AMXA 4NZ5A 2V67A 2XGBA 1LL4A 3FSTA 3AOFA 4UXDA 3IGUA 3LD5A 2VP8A 1B3WA 1AJ2A 2OX1A 3E0LA 4H9ZA 3REQA 3S1GA 3VCRA 3IV3A 4HCLA 1PKLA 2CZFA 1W9XA 1F3EA 1PS9A 4XUYA 4NF7A 3D3FA 2RKXA 2I9EA 4NU7A 5LXXA 3WJZA 4HNLA 2NUYA 1TTJA 4J5NA 4S3DA 3R79A 5FF3A 3ZMRA 3EB4A 4LOCA 3JZEA 2BB0A 4WK9A 1BYCA 2WKJA 5I5RA 4LYKA 3WSUA 4H8HA 5TNVA 5LIYX 4ALDA 4GCAA 2MANA 1U5VA 3EBVA 3WK3A 3WLHA 4UC5A 1JAKA 3UETA 3HPSA 3K4DA 4EAMA 1F6KA 1J6OA 3RLUA 1KCKA 1TE6A 2GYIA 3C56A 4JKKA 1X6UA 2BVWA 2QJMA 1PZ2A 1J10A 3W1TA 2ZZ2A 1MRAA 4J9JA 4XZ9A 4UMCA 3O9NA 4C6JA 3FS2A 4MPKA 3KFTA 3BC9A 5HUOA 1XDMA 1Q7ZA 1ZNNA 3I6RA 1P1MA 1JNEA 4Y9PA 4K1GA 3BANA 1V5XA 2VC7A 2Y70A 4HU0A 2AQOA 3Q67A 5GJNA 3UNTA 2OCZA 3BJFA 2CW6A 1CXLA 1A47A 4FA3A 3GKFA 2G8ZA 2OO0A 3UXIA 2FHBA 1EO5A 2F38A 3O8AA 4DZAA 1MZHA 2A2IA 4RE4A 3VIPA 3HJEA 5D4YA 5D04C 3VILA 2PC4A 3IRSA 4AMCA 3KEHA 3DAQA 1E1CB 4ZE4A 2XWEA 3P60A 5A94A 2HVMA 3ORWA 4L4MA 7PTDA 1JEZA 3GS6A 5BU9A 4LCRA 5XINA 2AL2B 3W2JA 1UR2A 1XIMA 4PMUA 3WBXA 5AC4A 1VEMA 4GI8A 1L8NA 4Q8NA 1J8VA 3MS8A 4RDWA 3VFLA 4Q8TA 1PHQA 4CVUA 4HZ7A 1UD3A 2WCAA 1GKPA 2FZNA 2D1ZA 3U4AA 3MUCA 1EKOA 1XW8A 2YFOA 3E2RA 1RK6A 4UR7A 3CMFA 5LHFA 4H4IA 4PRTA 3DFTA 2EPOA 4OTKA 2RH9A 4NQ1A 3QMTA 3STFA 2BGQA 1IZJA 3ITYA 3W0KA 3DXIA 2Q01A 3COTA 1WOAA 1UR1A 2E09A 1HJSA 3A9BA 2BTMA 1OCNA 3DYOA 3KVMA 2QUNA 1XGDA 1OADA 2A3AA 5HNUA 3Q94A 4GIRA 3MI6A 4M6QA 3NL2A 2DVUA 2JKAA 4N0RA 5FEZA 2BVDA 4XZMX 1HKJA 3NO1A 3SW6A 3AMCA 1XV8A 3DDMA 4C60A 4K2SA 4NUWA 4FXRA 4PTMA 2BP1A 3AU2A 3AYSA 1YBQA 1K6WA 1G4PA 3UWQA 3NQDA 2X41A 4CCDA 2WC4A 4KFPA 1M03A 3SN1A 4JKMA 4R27A 2CXEA 3AMKA 3DHPA 2AQVA 3H7VA 4F0HA 4JIQA 1M7JA 3R12A 2XVGA 5HMEA 3PWAA 3PZVA 5JBFA 5FJUA 2BY3A 4TR9A 1EJRC 3HG2A 2YW3A 3MSDA 3W88A 4POCA 2VRKA 3ZVIA 1VFOA 4C6BA 1FWCC 3B0YA 3EX2A 3PG9A 1ZS2A 4UOQA 3SN4A 2PGEA 5F2MA 1VCGA 3EWCA 1HKMA 1RA5A 4LGXA 4YWSA 3JUGA 4A4AA 3RO6A 1EWEA 3BSMA 5D02A 1SZEA 1H49A 5U7SA 3PWGA 5LGXA 1Q6QA 4MY9A 4Y9MA 1TPEA 4ZA0A 3XINA 3LCIA 2O4QA 2X1SA 3Q45A 3TYUA 4S3BA 4JNYA 4LW7A 3NGFA 4GUFA 3BLFA 4R34A 2NXIA 2QGYA 1TB3A 3OU8A 1XLFA 5I06A 1W3IA 3S6TA 3UZZA 3QKZA 2W67A 1JCMP 1A0DA 1I0BA 2E77A 2I5QA 3NYZA 3UWZA 3AAMA 2O7SA 3KL3A 2VFGA 1ONRA 5JH1A 1P6CA 3IANA 1LQAA 3NDYA 4NY2A 3N13A 2WC7A 2QCDB 4XVDA 5AECA 2BXYA 5E6YA 2X16A 2HVNA 2TAAA 5FSEC 4QG6A 5KMYA 2VEFA 2DUZA 3S5OA 5JBEA 5E1QA 4MY8A 4DBUA 3DI0A 3RGTA 3TTYA 3WZ0E 4L9XA 4FR1A 2ZOXA 3NURA 2BZNA 1T0OA 1RJPA 3OGRA 3K8LA 1FHDA 2QPSA 2CKSA 4GK8A 5LIWX 1TVPA 4UTTA 4D6EA 4JY9A 3UA4A 2QV4A 1P0KA 4MF4A 3TVAA 4F3HA 1UMLA 3C0QA 1MEIA 2EPHA 1WYIA 2EBNA 2VENA 1O5XA 3W76A 1VFUA 4MWAD 1JZ3A 4O11A 2C6QA 1QPKA 3B0UX 1FHLA 1SO6A 2QKFA 1F2JA 3OQEA 2BGNE 3LGDA 2DSVA 4MLJA 3EDFA 4UNLA 3E38A 1PX3A 3ABXA 1E4IA 5I09A 2A3HA 3KOZA 2BXZA 3CHVA 2QJHA 4KT2A 2PWUA 2FH8A 1WDQA 3K1DA 4UNKA 5BRQA 1WQ5A 3SSJA 3G5EA 3W73A 3W00A 3U0HA 4NI8A 4J27A 1Y65A 3SEPA 4YCOA 4M8UA 1KTNA 3K30A 4R9OA 1LTDA 1GOOA 3UG8A 3WD1A 4B3KA 1JDAA 1XUUA 2VFEA 1KXTA 2W0UA 4O0KA 3SGGA 3WF2A 1TV8A 2P5NA 5CJMA 3WLJA 2PF0A 3WLNA 2IMRA 2A3BA 4UIOA 4A2SA 2OG9A 3BTNA 2J88A 3UA3A 4NZ3A 5A3HA 2E6AA 3VNKA 1NWUA 2ASHA 1I2QA 1A4MA 3BV4A 3WO8A 4JTKA 5EU9A 5AFDA 1LBMA 1XYBA 3G24A 2D22A 2PLCA 1HL8A 2C0AA 3N6JA 4ZO8A 5B7YA 4FK9A 1JJKA 2WNWA 5I00A 2V69A 4MG4A 4HNUA 5CEWA 3W26A 1G1YA 3V3WA 2Z6IA 4GG9A 4HK6A 1EP1A 5LNUA 2FIQA 1JUBA 4HB7A 1H7PA 1V4YA 4XSLA 5K9XA 3P8IA 1E71M 3APYA 1Q2RA 1ZB5A 3WUEA 3NQ8A 5C8BB 1SJCA 3LSCA 1Q6RA 3ES8A 4LC8A 2JF6A 4I5UA 2QDGA 1DBTA 1C91A 1ENUA 6REQA 1W1IE 4FX8A 3DKJA 2QV5A 4EPDC 3LRMA 4GKTA 3AC0A 2ESCA 1K3UA 1V6UA 2A6NA 3CPRA 3STCA 4AAJA 1IZCA 1FDJA 3QC0A 2WMHA 4W5UA 2ZADA 3W2LA 2Z7KA 2WMKA 3PF3A 5D8ZA 1RBAA 5ABHA 3HQ1A 1TFVA 3EOSA 3S9IA 4U5IA 1K9FA 2ZICA 3MMTA 4DO5A 4LVBA 5A6JA 2HEJA 1S5NA 3MWCA 1XLCA 3EAUA 1DQUA 2G0WA 4OIFA 1HJQA 4IMGA 3ABZA 2DPEA 4PUNA 1EO7A 5AVHA 1J9YA 1ZPTA 3SCPA 3GVVA 2PE4A 3BARA 1VBHA 2VCAA 3JU2A 3NQCA 3KM8A 4N9CA 5HWNA 3V75A 3VGFA 1YEYA 4IGMA 3UCQA 1SR0A 3EX3A 1LZOA 1PIIA 4GMEA 2NLIA 2D20A 3M5YA 1S5MA 1NH6A 1B54A 4X2RA 3MSRA 4ZSUA 1LF1A 1TA3A 2GJLA 5LA0A 4R33A 3TROA 2PB1A 2V3EA 3NPWA 3N17A 1V03A 3ENLA 4LNYA 3GXFA 2Z1KA 4WGXA 3EPMA 4GH1A 3SGZA 1KFJA 5HNRA 4JZ5A 4JFTA 1NSJA 1R9YA 1X1NA 3QLDA 3UF9A 2GL5A 1EPXA 4KWOA 2GSJA 4QP0A 1EJWC 1CNVA 3URBA 5I3IA 1P0BA 1QNVA 4BJHA 4MNKA 1UQYA 3QY8A 3SDOA 1QI4A 1EH9A 1KFKA 1QBAA 4P7QA 2GGHA 3L68A 4W89A 1R87A 3ZZ1A 1VAHA 2JGYA 3N3TA 4UFMA 3VX1A 3NQAA 2OLHA 1E0TA 4BWLA 1LRTA 3W2NA 3EA3A 3RO8A 2VCBA 1EWDA 3M0ZA 4S3KA 2WK2A 3IS4A 1A5KC 1V3LA 4WZHA 3LI0A 1ZFJA 1YXDA 1ONXA 2GJNA 3AICA 3TW9A 1GJWA 3T05A 4CQBA 4HZMA 1UCWA 3MV01 2JGQA 2DZAA 4JTGA 2J79A 4E3VA 1ZJBA 1WDRA 2FPTA 4BK9A 3FVDA 4F2BA 3C5QA 4H83A 2DT1A 2Z27A 3WQOA 4QITA 4RZ4A 2Z24A 5A6TC 2QXWA 2XJ7A 2YJQA 5H1WA 2YPIA 1HW6A 5AYIA 3S2JA 4XD6A 4DBEA 4PA8A 3FAWA 1SZNA 3ZJ7A 4YVVA 2EJ1A 3TQ0A 3W7PA 3W7RA 4H01A 4G2DA 5D33A 1IT8A 3WJWA 3CZJA 4RZ5A 5JH2A 2REQB 4JFVA 2O9TA 2ACQA 1B3XA 4L65A 4N9DA 5C70A 3PUEA 2FQIA 1OD8A 3QOKA 3I10A 2BHYA 3WQ5A 3QC3A 3SY5A 5FSDC 2WMIA 4MUPA 1MMFA 1WPCA 1MWOA 2W3ZA 3EGJA 1F7BA 3N6QA 4BA0A 1ZY9A 3TNOA 3WL0A 4CNUA 5CSRA 3WJXA 4HA3A 3T6CA 3G1DA 2B7PA 2R6OA 3A13A 4O0QA 4FOUA 5HAOA 4DO7A 4LY8A 3ARTA 4S38A 4OBTA 3WFZA 1K9TA 3M0JA 3A21A 3MP4A 4FEZA 3DG7A 3MUXA 2F6KA 3VA8A 1A50A 4ERAA 1J0HA 4LCQA 3UFYA 1HG3A 3NM3A 2AL2A 4UTKA 3EKLA 4UFJA 3IJIA 4IX0A 4GBUA 1A4LA 3GSMA 3UR5A 3LI1A 2OR2A 5IRPA 2OEMA 3W38A 1P0NA 3BAXA 4AY8A 1K7XA 2VZSA 1A5BA 1MEHA 5D8WA 3M0MA 2ZKMX 2IKIA 2WHJA 3FEQA 3V7PA 1OC7A 1W9BM 1CGVA 2NZLA 2DZVA 4PN2A 5D30A 5A2AA 3NEHA 4DZ5A 5FJOA 1ZENA 4RK8A 1GOKA 1CI1A 4AWSA 1SPQA 1DORA 1EF3A 4YTRA 3B8SA 3VNDA 4B9ZA 3IWPA 1QNPA 2C79A 2OVLA 1LWIA 1QATA 1ITQA 4DLFA 3NWRA 1GOWA 2C0HA 4F66A 2WBKA 2WW5A 4Q4SA 4MKSA 1Q6DA 2NX3A 5A5WA 1I45A 1W54A 3PZTA 4E5TA 3DC0A 1A5AA 4V27A 4YCPA 5CJ5A 1EHAA 1EQCA 1TV2A 3KCOA 2GVJA 2VGIA 1MFUA 1EB3A 2VM8A 3VDGA 2PRLA 4REQA 4IICA 4A35A 4JFUA 3AIBA 4Y9AA 4R5EA 2VX7A 4GH3A 4UMBA 3ANYA 4LYPA 3KBWA 3P80A 3U9IA 4DXXA 2OWXA 4IIFA 4UFIA 4AX6A 1UD2A 5BZAA 3P84A 1F8IA 4AZ7A 1NDZA 2D3LA 4I9AA 2FVLA 1P4CA 3ZWSA 1O7AA 4ZQRA 3U7BA 3AUOA 4ONVA 1E6NA 1HKKA 3D46A 2JEPA 1IWPA 1UR3M 2EEXA 2PWEA 3DG6A 1FWGC 2I1OA 3RK8A 4H00A 1SZRA 1DWAM 2Y5SA 2ZA2A 2DORA 2QQ6A 4QROA 5FESA 3WLSA 3EOOA 2J7DA 4CVWA 2PWDA 2FPVA 2TRSA 5AYYA 4B3LA 3HPAA 2G95A 1P43A 1DJNA 1PB0A 2C8NA 2Y24A 3N29A 3T4WA 2E68A 1C93A 2WNZA 1T5AA 2QMJA 3VKDA 2D69A 3GVWA 3O16A 4CU8A 5BMXA 3NPVA 1SSGA 4K37A 4XWUA 3GNNA 3ITVA 4XIAA 2F6XA 2FTWA 3A12A 4V33A 1V0LA 3VD9A 1L2QA 3ARPA 4PBEA 2B7NA 4GX9A 1LL6A 1DJGA 4PTVA 1OD0A 3J7HA 1IIGA 1E5JA 3MI3A 1BLIA 1Q8AA 3IAPA 4G1KA 1DTUA 2D73A 3NQ6A 4XVEA 5GPRA 1ZBKA 3LPPA 2W6RA 4CD4A 3BICA 1H0IA 4C90A 4JTIA 4A8NA 1WKYA 3MMUA 2YDSA 2H8ZA 1DTNA 1CECA 4Q6XA 1KCLA 5LZLA 3E2QA 4E0CA 3CPUA 4NJKA 4A8IA 2FZBA 3W24A 1Q4NX 2ZZ3A 3EWUA 2YKKA 3R89A 4JHMA 3T0CA 3C2OA 3A24A 1MVYA 2X2GA 5HANA 1KC7A 4PH6A 4Y8FA 1CENA 2O7QA 1YDVA 5EY5A 4LUTA 1V0NA 2E6DA 3DFSA 4UQEA 1TWWA 3CZGA 2JKPA 3GTIA 4TX8A 2HBVA 3QTGA 2B31A 3L65A 3FA4A 3STEA 4QDPA 4NT0A 1LCOA 2O4MA 4IP7A 1BXCA 1CGTA 4RV3A 4NX0A 4NNAA 1GW1A 1JDEA 1W1ZA 4WDXA 3W1LA 1W5NA 1GVQA 1Q65A 4QDWA 3WL1A 4B15A 3POCA 4G8TA 1E43A 2TPSA 3MCNA 4M7SA 3SQMA 2F2KA 1XCFA 3UG3A 3NZQA 3ONBA 3THUA 3UY7A 4AWUA 4AB4A 3E5PA 4U2YA 3M0IA 2AGTA 1H09A 4PBGA 2Z1SA 3HQPA 1DXFA 4RZ6A 4GLEA 1JUEA 1H7NA 2WQDA 3PK7A 2J7EA 3KLKA 3W37A 3BLKA 4DUXA 3KTCA 1CPUA 3WH6A 4WY0F 5FCZA 1OVDA 3LY0A 2V3FA 1FDYA 2FTYA 4DPPA 4Y8EA 3MBDA 3ITGA 1KFCA 3Q2DA 3TLLA 1BF2A 4H9VA 3ZR6A 3PBYA 4LAKA 3WUFA 1W17A 3PZMA 2VDIA 2PRHA 1EJUC 2QDDA 3QYSA 3I7QA 2BFGA 4CN4A 4GXWA 4RUBA 4MB1A 1UROA 2QT3A 1XRSA 2VNCA 3T1GA 1DVJA 1PEZA 3H2NA 4LUJA 3FXGA 5BOEA 1UIPA 1BXBA 2J8GA 5JVLA 1R85A 4PFMA 1FCBA 2EQDA 1F6YA 3SUUA 1TPUA 1UD5A 3F5JA 5A6SA 3M07A 1OZQA 2PGWA 1C29A 4C7DA 1FP8A 1FWIC 3OVGA 4F9JA 1E6SM 3MWAA 4YL2A 5XIAA 1S2TA 2PDLA 1F74A 1OEPA 1IGWA 3VO0A 4AEOA 2OZ0A 3B05A 3UPMA 1W2PA 5KZEA 3G3DA 4CCEA 4DJEA 1KM6A 2C13A 1MFVA 1KRBC 1ODZA 1FCVA 4XZBA 3HIJA 3T2OA 4O1BA 3BW2A 5HJXA 3RN6A 3TQVA 1V3IA 2CZ5A 3VGBA 1RQHA 2CPUA 4JQAA 5D2XA 3G18A 4PE8A 1B2YA 2PU0A 7XIMA 4X2PA 4XKYB 4DXVA 4PEEA 1CX9A 3ECQA 5EMUA 1WX0A 2DIJA 3NQVA 3GR7A 2XVNA 4K8HA 1TTIA 4FNUA 1XFBA 4DX3A 3TTSA 3WLMA 2X7WA 5AHFA 2ZUVA 2QPXA 4FAMA 2HPIA 5A6AA 4EX4A 4GI6A 2W62A 4RKAA 4PZVA 4NZJA 3W23A 4D6GA 3E0WA 5C9XA 4MTVA 3M64A 2FLIA 3H4XA 4RE0A 4J3VA 1AW1A 4O54A 1QNRA 1M6JA 3SY8A 4QEHA 1J93A 4GUHA 3POHA 1XRVA 3FVMA 3N6HA 2QCFA 1WKEA 1DJZA 3JW7A 1XC4A 1ICQA 4UUIA 3U5UA 3QBUA 1F6PA 5I0DA 1JCYA 3S2CA 4QG8A 4Z1BA 2YIHA 3SQLA 2GGIA 2XUCA 4IT1A 5ENLA 2C18A 3ABSA 2PDNA 3HJZA 3HFTA 3CWOX 2E28A 4Q8WA 2PDBA 3SFWA 2VZOA 3S83A 2FJKA 1UWAA 1JCJA 2VD8A 3H55A 5DY3A 2CETA 1QPQA 3BE7A 3CUHA 2XM2A 5G2HA 1TZ9A 3THCA 4AZBA 5FI8A 4DAIA 3G3MA 5EMMA 2BVYA 1MXDA 2IW0A 2YXOA 2ZTKA 2XVKA 3G2GA 5HJYA 2V2CA 4Y96A 3PJTA 3V5CA 3SUWA 4QTGA 3KHDA 3KL5A 2YLAA 2PF8A 1PKNA 3WQ8A 4ERIA 2V9DA 3JR2A 1XYCA 3UWEA 3VKCA 1P0EA 2PS2A 1BWVA 3NPXA 3CS2A 3UCDA 3MYPA 1FCQA 1IWBA 2HV5A 4M3PA 3AJ7A 4WGHA 4Z0SA 2OFJA 5EMYA 3BOFA 2V5LA 4DAFA 1J11A 4Q4RA 1QW7A 4UQDA 1JVNA 4FLSA 2WSPA 1WOBA 1UQZA 4XV0A 3SRFA 3RX3A 1FCUA 3GH4A 3W7CA 5C9RA 1V6VA 5LA2A 3GZAA 2PEVA 2W27A 1GEHA 1F4HA 3TN6A 3PUGA 4S3GA 4QE5A 5BXTA 3TU9A 1NJJA 1IEIA 3KHJA 2Z2BA 4M82A 4O50A 5DMYA 1E9LA 5REQB 4EP8C 1TJ1A 3C2RA 3PZQA 1BG4A 3RU8X 3BLEA 4UZSA 5CZ0A 1CGWA 4P8XA 5LXEA 5EL1A 3CQHA 2V38A 3HV9A 4JNZA 2HCVA 3H2AA 4BF9A 2CLFA 1VYSX 3VUPA 1CB7B 1XYLA 1G0CA 4C6LA 3SCTA 3T0BA 1MQQA 4NP7A 2WV8A 4DF2A 5BU6A 1W9VA 4QCEA 4LY4A 1P7TA 1X38A 1J96A 4H41A 3T0AA 4ATLA 3LSBA 2E5DA 4AFYA 3M1ZA 3M6YA 3N2TA 5DEZA 2DVTA 3WYZA 3ZR4A 4PTWA 2J7CA 5T8GA 4OBRA 2W4XA 4KWVA 1PBGA 1VIWA 3W53A 3H22A 3GH5A 3FYYA 4CUCA 4XBJA 3USZA 5E9AA 3SUVA 2GQAA 1EOKA 4Z1YA 3MZNA 5BRBA 1W37A 1P6BA 4W87A 2TMDA 1ZAHA 1W5PA 4QEEA 1NFGA 2OGYA 3UXKA 3KAOA 4NL1A 5I3KA 1VPQA 4EOUA 2WQPA 1SMAA 4B2DD 4H6KA 3W4RA 5CGMA 4AISA 2QCDA 1TTPA 2J7HA 4I3GA 2BWGA 3VX0A 1AJZA 3TV8A 2VD9A 4BS0A 1US2A 4GIAA 1EZWA 7A3HA 1RQBA 5T9BG 4NAFB 1C9WA 1H1NA 2J9YA 1R46A 2HWGA 1VJSA 4MIMA 3AHXA 1HVXA 4TV5A 3N9RA 3RDKA 1GVYA 2IKJA 4K8EA 1M01A 1VEPA 1EGMA 2GVYA 3GVRA 2Z2AA 4G6CA 2B4GA 3TJIA 2FZ8A 4GZIA 3M43A 1BQGA 3HQOA 2FJUB 1HFBA 4S1FA 2CFFA 3VC6A 3RJYA 2PDQA 1XBXA 4YVXA 1XIEA 4LQ1A 1QW9A 1B5TA 1XKJA 3F2BA 4KKXA 2A0NA 3TAOA 3MZ2A 4HU4A 3KBVA 3GLCA 1K7EA 4GQBA 4YHGA 4I7VA 5IXEA 3SCVA 5HATA 1W3JA 4BI7A 2PTXA 2PTDA 4H6QA 2QAPA 4S2CA 2PDPA 4TXEA 4EACA 3BPWA 7REQB 2WVUA 2EHHA 2F84A 3WDIA 1VCVA 4PB3A 1E1CA 2ZXQA 4J3SA 4H3DA 7ENLA 4PODA 2OYLA 1UKQA 4ZENA 2OKTA 3DYPA 3LM7A 2ZBTA 1B0IA 3EWZA 2X40A 3M44A 3AI0A 1OHLA 2Z6JA 1E51A 1S1RA 2GPTA 3MTWA 3WY1A 4Q8PA 1V79A 1REQA 2F9RA 3QZAA 1GVOA 4AU0A 2OYKA 5LNSA 2WKLA 3ZT7A 1KM2A 1D9EA 1EDGA 3E74A 1E0UA 3S9YA 1ME8A 1ZBVA 5FEWA 3IAQA 3R11A 1QNSA 3EZ4A 1ME7A 1HKWA 4P61A 3VNZA 3APGA 1GJUA 2IPGA 1MDRA 5CBBA 2PLJA 4AG0A 3DOPA 4HQVA 1VJIA 1DHKA 3G77A 1ML1A 4RV8A 4M24A 3UPWA 5A6LA 4WOQA 2D0GA 3CGTA 3GO2A 4JN6A 3UXAA 5D32A 2ISWA 4QNEA 3LGEA 1ITUA 4M5PA 3OZPA 4JEQA 3GW0A 1N7KA 1XLLA 1L6YA 1DIEA 5M3WA 1OJXA 5FIPA 1KGXA 4HU3A 2DDXA 1H63A 4O12A 3RX4A 4IIHA 3DKLA 1YBQB 1HGYA 3WG6A 3W1AA 4EVZA 1JCNA 3QZ6A 4NJJA 3DBPA 1BXNA 1GOXA 1R6WA 3D0CA 1AFSA 1SUXA 2AKZA 3TJ4A 3AJXA 1CLXA 1TELA 5HBFA 2GLKA 2VCCA 1UKOA 2A21A 1C8XA 1JRCA 5JMUA 2V2HA 3QJAA 4X0VA 2CLLA 3HGOA 1TZ7A 4KEZA 2DSZA 3W7GA 4EF9A 3TKFA 3GDTA 4LUTB 1JFXA 4LU0A 3URAA 2X0YA 1I8JA 4O52A 3B9NA 3W02A 1DE6A 1H51A 3NSMA 4GC4A 2BOEX 4ZE5A 3FLUA 3U4FA 1GQNA 1ICSA 4V2XA 2YA2A 1X6NA 3N12A 3S5YA 1IT0A 1ZHAA 5E09A 1X1OA 3CMJA 2QEZA 1XBYA 4ENLA 1KXQA 3LLXA 4OVXA 1B3ZA 3LPGA 3VGGA 3KTSA 3NQMA 2V3DA 4B91A 3C2VA 4A29A 2ZWYA 2PTYA 4AD3A 2NLYA 4J3TA 2Q8XA 4AZHA 2CZEA 1V02A 4D6IA 4OOUA 4O1FA 5H8PA 5IFTA 1R0MA 4WR3A 4P8VA 3AS2A 1PX4A 2VUNA 3H21A 1E6XM 8RUCA 1VS1A 3SIZA 3WNNA 2CCRA 4IIGA 1WA3A 2V3GA 3WK1A 3PB0A 4NNCA 4CGTA 1E70M 1JFHA 1W6TA 2HTMA 2G3JA 4ICMA 1ISXA 1QNQA 5IDZA 3W85A 4NIRA 5CZJA 3LS9A 2WYSA 3CO8A 1D8CA 1GQIA 4PTDA 1GOQA 2G4JA 1UR9A 4JIEA 3FDGA 1G9HA 3GQYA 3FHAA 2VC6A 1BVNP 2C19A 1LBLA 1K9DA 2RJGA 3GNOA 1Y5VA 2A4AA 4Y9NA 4R85A 1FWTA 3IRDA 5A6MA 3WH9A 5B80A 1IEQA 4KEUA 5GJMA 1OFRA 5G1MA 1ITCA 3VNYA 3LXCA 3N2BA 1U5JA 4K8GA 3V35A 3NCOA 1QHZA 1ZJIA 3M9YA 1Q6CA 5FF2A 1EA0A 1XLAA 3SADA 2DFAA 2PDMA 2PRMA 4XZLX 5EMJA 1QDSA 4RDYA 3C8FA 1WKFA 1OSEA 3R2GA 2E8ZA 2WJFA 4JS3A 3UG4A 5HWJA 5HDRA 4OQVA 4GY0A 1DQXA 1F3XA 3WJSA 1ZU8A 2RHGA 2VUYA 4QJ1A 3TZNA 4DY1A 1PWMA 1A5CA 3GXIA 3BCJA 4L56A 5FAGA 2OMAA 3FFSA 3O0KA 2WZIA 1HJWA 4ECLA 5M17A 1TX0A 3N15A 5EMKA 1QPOA 3W1NA 1B31A 4O4WA 2OQYA 3S8HA 3R0UA 4M0XA 1L8PA 4LB3A 1JYVA 4UR9A 1XIGA 3GNPA 4Q8QA 3RLHA 3BH4A 3OZMA 4R7JA 4WEVX 1GHRA 1UKTA 1EC8A 2JIWA 1EFZA 1NDVA 1YHTA 3ES7A 1TPH1 2WLZA 1HXJA 5T9CE 4PMOA 5DCEA 3SSZA 1VEOA 4TVCA 1XR2A 3ME3A 3VOCA 1MDLA 4LUSB 1AMYA 1KBLA 2ABAA 2UWFA 3BLIA 3LCWA 1IR1A 4MVAA 4UTHA 1ZJAA 4ZQNA 4LAMA 1DQWA 3PVFA 2HXUA 3NGJA 4MNJA 2FH6A 3SAZA 3OVQA 4NRSA 2DUXA 1V08A 3FY1A 3CXOA 2ABBA 3CAVA 4GO9A 3IJLA 2WJEA 4A3HA 1GCYA 2OELA 5EGRA 3B8WA 2A3EA 3U57A 3N34A 4DUVA 2DEPA 2D2JA 1A5NC 2FZMA 1UWTA 3RM9A 4IUGA 5A8QA 1YPIA 4OKDA 4LALA 3NQGA 3CLMA 4KGJA 5C9ZA 5JBDA 3N4EA 4Z08A 3BCDA 5CLTA 4C6QA 2OU4A 4LS2A 3UEQA 2I5GA 3PZ9A 5CBIA 4UWMA 1JYWA 4BEQA 4N2YA 2IKHA 1KV8A 2DUAA 3H2OA 4WD0A 4F2TA 2FB2A 1B9ZA 4H6EA 3CMGA 2G97A 2P88A 3NYDA 2ZX5A 1IEVA 3LG3A 2YCEA 2NSXA 3GG8A 4FLQA 1L6GA 2RJHA 3L4YA 2BY1A 4X60A 1C7TA 1EXBA 3DHUA 1AH0A 4PMQA 1E9YB 3P5ZA 1W91A 3ITXA 4DYJA 3VD7A 3QH2A 4FALA 3UXLA 3G1AA 3EWDA 2YL5A 3CHDA 3VK5A 3WNOA 4QM1A 2C71A 4PUDA 2EKCA 4BWLC 4FXSA 4DEFA 2J47A 3FDKA 1EBGA 3L66A 1R38A 3M5VA 1XSIA 1Z32X 2WHMA 1RY0A 4P7NA 2LLEA 2CITA 3SBFA 2POZA 3DFQA 4Z0JA 4NYUA 4D6DA 5DRIA 2PDUA 5REQA 3LMZA 2EGZA 1TWSA 2ZX9A 4NVTA 1NTHA 3PZNA 1VPXA 1CT5A 4ZL1A 1K77A 1PPIA 2GUYA 3STGA 4M51A 4QLJA 5E0KA 4L5ZA 3CQJA 4A3YA 1UBPC 1JPDX 1FWWA 1MI3A 1MXGA 5BXSA 2WLYA 4B2DA 3OOQA 4RCXA 1C7SA 4BI6A 2XG9A 4UMAA 3WNPA 1E0WA 1W1VA 5I7GA 4I9JA 2VFFA 1AQFA 4PSPA 2DGAA 3T2QA 3DX5A 1MW3A 1H7WA 1QXLA 1R3SA 1B1YA 4AVOA 1W3NA 1E5NA 5CAHA 3OBEA 2YBVA 3ARVA 1X6LA 5CBJA 4IJCA 4QGCA 4XZNX 1MYRA 1LLZA 2QZRA 1POJA 4WDWA 3N2MA 2O55A 4E4UA 1TV5A 5CQ1A 2DZSA 4ZMGA 4GFIA 1W32A 2QCGA 4JHOA 4OJYA 3CB8A 1E4NA 2Y8VA 1KGWA 4H6RA 4ML4A 4O0ZA 4HK7A 4HPGA 1JCLA 5EPDA 1IR2A 3RR4A 4JDYA 5BW6A 3GYEA 1KWGA 6XIAA 2EXOA 4Q4KA 4IM4A 5IDIA 1F3TA 4AD1A 3GDBA 3ABOA 4H8NA 4CD8A 2L5HA 4NZFA 3E02A 3WFLA 4ZO7A 2XSAA 9CGTA 4JYFA 1RXOB 1KD0A 3BLDA 3H70A 1EYWA 4ZZ9A 1UP0A 3STPA 4WOZA 3UD6A 2XVPA 2ZZ7A 2ZIDA 3KE0A 1A0EA 4UTWC 2D2GA 2IPWA 3IIPA 3N9KA 1NF7A 4Q32A 4HT3A 3HGJA 3THAA 1KFLA 1X8CA 1WO2A 4M19A 3B9EA 3TYBA 3S1UA 3CUIA 2DZUA 4HVXA 5U4NA 2Z2UA 3VM5A 4JY8A 3HU7A 2FGLA 1FVPA 2YGYA 1TV4A 2NQHA 4HZ8A 1I75A 3WBEA 1Z44A 3W83A 5GVJA 2GWNA 2I57A 4XAPA 3BMWA 4WVXA 1QOPA 1RPKA 5E0CA 2E9MA 1RV8A 4B5SA 3E1F1 1UYQA 3BOLA 4NX5A 4PRWA 2XFFA 3FN9A 2RDWA 1VJZA 1VD6A 1Z9AA 4NG3A 3CJPA 1M3UA 1H7XA 4Z42C 3ZT5A 4GQQA 1A5SA 4KRUA 3BAYA 4N42A 3DFNA 4JYEA 4E4FA 4YPJA 1TTQA 3N19B 3TSBA 1MUMA 3W70A 1M04A 3KP0A 3ITOA 4GA8A 4EIVA 3NSXA 5ABTA 2WM1A 2ZXAA 4JN8A 3PPCA 4PGLA 3NOEA 3QXBA 1OCQA 1PDYA 2FDMA 1Z7AA 3U2OA 1JGIA 1S46A 4D1JA 1XLGA 4YTQA 1RSCA 4J3WA 1KKRA 4IPNB 5G2WA 3RPMA 3UNDA 1AQHA 1UD4A 2PDFA 4W84A 2OWWA 3WNLA 2XHYA 3W22A 4JL1A 1GT8A 1FFRA 2JALA 4HIBA 1MUCA 3SB0A 1W9PA 4OUIA 4H9YA 2OQHA 1ISVA 5HR7A 1GGOA 4LV9A 4UOZA 1SQ7A 2ZUSA 2ZA3A 3W72A 3B0VC 5LHEA 2HK0A 3CZLA 2E9LA 5EB8A 4PTXA 3MYOA 1OGSA 1JPMA 1A80A 5FD0A 4FNQA 3VNLA 4KPLA 1ZQ5A 3E0IA 4ZO6A 1OB0A 4M1BA 1GG0A 1BYDA 1PV8A 2GDQA 4OOZA 1CCWB 3QSTA 1O94A 1PX8A 1Q7MA 1R9XA 2P0OA 3PZIA 4DVOA 4QE4A 1BPLB 2OO6A 1R3QA 3VINA 1QOXA 4FZIA 3FIGA 1TV3A 1OCJA 4PMVA 3T2PA 3QHNA 4LB4A 4WJEA 4DWSC 1NAL1 3L5AA 1MZRA