3Q9NA

In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
138
Chain Sequence
ATRPIDGLTDEDIREILTRYKKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPNYEEVLGRKCYPSVLDIPDKVEVVDLFVNPAKAWRFVVYAIKKGAKVVWFQYNTYYPLAARQAGPIIVANRCMMREHERLLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CoA binding protein
publication title A de novo protein binding pair by computational design and directed evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding, de novo protein
total genus 39
structure length 138
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3q9nA00
4K1LA 1CETA 3BMOB 1TT5A 3DBVO 4IS3A 2DLDA 2CZCA 3GUYA 4MINA 5TC4A 4CMGA 1DC4A 3OF2A 5THKA 5ENDA 1D4FA 2PZKA 3U5TA 3X2FA 1LDYA 1QKIA 4DBZA 5JY1A 3PTZA 2GD1O 4AJ2A 4CQMA 1NHGA 5JO0A 3F5QA 5ENVA 1EK6A 3PJEA 5G4LA 5BNIA 3HFSA 4TKMA 4YXFA 5JYEA 1LSJA 1B15A 2VOEA 1OBFO 1AHIA 1H6BA 4DQXA 1I10A 4BOYA 2NTJA 4I08A 3TN7A 2B4TO 5JDCC 1PGPA 5TX7A 4FN4A 2OUIA 4AFNA 4RDHA 1GYQA 1I2CA 3AOEA 3WBFA 1HLDA 1PJLA 1DIHA 3PQFA 5JY6A 3O8QA 1VSVA 1BXGB 1WNTA 2J3IA 1P1FA 3ZHXA 4ND3A 2FR0A 4OOFA 1ADBA 1UP4A 4OQYA 2FPIA 4EYEA 3ST7A 3ZCXA 4Z6KA 4OGWA 2ZIZA 1ZEJA 2AMFA 4MVJG 4ZVVA 5KVQA 3NUGA 2Y1FA 4B3IA 4D46A 1MP0A 3JQ7A 1UUFA 1I24A 1ZSYA 2C7VA 4LK3A 4QFCA 1I3NA 1K3TA 1ISHA 2A9FA 3A14A 1GCOA 4HNHA 1OZAA 1VJTA 4EBFA 3V1YA 4I5GA 4CPDA 2CVZA 4GBJA 2E49A 1M76A 1U2DA 4BNJA 5KKCA 4R9SA 1GV1A 3FPLA 4PG5A 3WS7A 3PYXA 3L4BA 5JYDA 1MC5A 1AN9A 3DEYX 2LDBA 5JPIA 2O7QA 2OBYA 1NBOA 5CG2A 3RAJA 3WG9A 2NU6A 3JQCA 1ZEMA 1VL0A 2DQ4A 3G3EA 1R4MB 2QZZA 4IMRA 4MVJI 5T6BA 3D1LA 2D8AA 2QYTA 3SJUA 4BO1A 2D5CA 1PJ4A 2FSVA 3VPFA 4Q3DA 3ROKA 4B79A 1PGJA 2YQ5A 1H5QA 1Y8QA 1B16A 4DBVO 4EZBA 4O6VA 5EN4A 2CF5A 1U4SA 3ZWMA 1X7DA 1YBMA 4FQ8A 1Z74A 1NFRA 4ZRNA 1Y1PA 2ZTMA 4ZRMA 1YB4A 4N18A 2BKAA 3JQ9A 4DPLA 4NFSA 2NTNA 4PFJA 4N5NA 3ZGYA 3BTVA 5KVSA 1BW9A 4CM6A 4F6LA 2BLLA 4KP7A 4I5EA 3VZQA 1KVUA 3Q1LA 2VT2A 3LU1A 4RVUA 4E12A 2QHXA 4BO5A 2NQ8A 4NK5A 4KMSA 1HDCA 1DPGA 1XSEA 4JP2A 5MGBA 3KYDA 4CODB 3S55A 3HDYA 5COAA 1ML3A 3RUAA 1IPEA 1ENOA 5L7TA 1P33A 2Q2WA 5G4KA 5THQA 4PLHA 1HE4A 3TFQA 2VCYA 1LNQA 1MFPA 3RFXA 5FYDA 1WLYA 1WZEA 4RZHA 3GVPA 3DBHA 4GWGA 1E6EA 1PGQA 2AXQA 1E3WB 3TRIA 3PWSA 5ILGA 4CM4A 2HU2A 1ENZA 4M86A 1X0XA 4MIEA 4XD2A 4PZEA 2WDZA 2O3TA 4IQ8A 4JJFA 3GNTA 1JN0A 3FPCA 1LTHR 1AGNA 3NTRA 3VH4A 1KOLA 3GVCA 1W6UA 1YH3A 3H5NA 4U0KA 4CQLA 4BVAA 2JD2A 4R5MA 3RUCA 2VYNA 3ZWAA 4ZGWA 2NVUB 3PK0A 4WNCA 4TZTA 5FI3A 5CDYA 1ZSVA 3BXXA 4YT4A 2Q3EA 3ZWOA 2I3GA 4BO4A 1NR7A 1HTBA 1EFKA 3IQDB 4TMFA 2V6FA 1WPQA 5EQDA 4QT0A 3GZNA 4EUEA 1HF3A 3CTMA 5JMPA 4IMPA 4ALNA 1EQ2A 4BV9A 1EVYA 3MTGA 3DZKA 3JQFC 3WWYA 1OFGA 1G6KA 2Y0CA 2YUTA 4J1NA 4UUPA 4HP8A 4AJIA 2GN4A 1GPDG 4BNNA 2NTVA 3ZNQA 3LYLA 4PVDA 4J4TA 4RZIA 1PZEA 1ZO8A 4FR5A 4UEOA 1B2LA 4WCDA 1SAYA 2EXXA 2VUUA 2VN8A 1ARZA 3JQAB 4XDYA 2GERA 3RC1A 3KXDA 3WYBA 4UREA 1NAHA 4Y98A 1OC4A 4CMEC 1HYGA 4DLAA 3RROA 3OA0A 3UICA 3X2EA 4CM9D 4CLEA 1E7QA 1I3MA 2BFAA 1R0SA 3HDQA 5F5NA 3AM3A 3PQDA 5JNLA 2DBZA 4FW8A 4ITUA 4CMBA 1PJTA 4PLCA 3SC6A 1LBEA 4E5YA 4BO6A 2ZB4A 2FY8A 4FJ0A 3QWHA 4ID9A 3GK3A 1W4ZA 4RV9A 4E0BA 1UP6A 4CM1A 4JLWA 1DHTA 2BRUA 2FN7A 4D43A 1HE3A 2EGHA 4NBWA 4J2HA 4YJHA 4G2NA 1LDGA 1C1DA 1U3TA 1VJ1A 1R0KA 5BSHA 3E9QA 5IF3A 2Y0EA 4GVXA 3GHYA 4P4GA 4XR4A 5L3ZA 3WWZA 1UXGA 1L1FA 4RF4A 2WD7B 3E8XA 5TNXA 1DFHA 4B3JA 6ADHA 5EL0A 4AVYA 4FIZA 3JCZA 4B3HA 1ULSA 2GASA 3RKUA 4E21A 4CV3A 3HQ4O 4KQWA 2EJVA 3TOXA 1ZK2A 4ND5A 1GD1O 3RQSA 1UDCA 3W6ZA 3TWOA 1VLLA 3KLMX 3TJRA 5DN9A 1XLTA 4RVFA 3U4DA 4BNVA 1TB4A 5BR7A 2HMSA 3M2TA 4Z3DA 3A4VA 3I9MA 5KIAA 1I8TA 2Y99A 4FFOA 3UGKA 2DTXA 1T4BA 1XQ1A 3BTUA 4CLOB 5B12A 4RLSA 4WPGA 1GV0A 2NVWA 4IGEA 4CMKA 1N92A 1PZGA 1TT5B 2GO1A 4GQAA 4PRLA 4XQ9A 3NTOA 2VTEA 3N58A 3ASVA 4YPOA 4NI5A 4E5PA 1GZ3A 2G82A 1PZFA 1IZ9A 1DBVO 1VL8A 3CIFA 5DNAA 3GFGA 1LLDA 4FGSA 4CQMB 3HB5X 2HKIA 4QUKA 4DIBA 2FR8A 1CEQA 4XZ3A 4D42A 3O26A 4UVGA 1FDUA 4H7PA 4XIJA 1BXZA 4MIYA 4QECA 2HMUA 2X9NA 5JCXA 1NQAO 2B37A 4ZU3A 4AJPA 5C7OO 5IG2A 1YL7A 1B0AA 3IJRA 4MVJH 4NH4A 5JE8A 2UAGA 2AG5A 3H4VA 1GY8A 3F5SA 1CIVA 4FSHA 2DVMA 1P31A 4RGBA 3O8QB 3QHAA 3GHHA 1SB9A 3PGJA 4YCAA 4CUJA 1C1XA 3ETGA 4XGIA 3OH8A 5CHEA 2PH5A 1X7GA 4GKBA 2GRAA 4MPDA 1ISJA 3B1KA 1JVBA 4CV2A 1QYWA 4WLEA 3DONA 5C3MA 5CDGA 4UUNA 1UJMA 4YQYA 4BNXA 5DCUA 2OP0A 3GQVA 3ITDA 4H15A 5L7WA 3JQ7B 4DA9A 4AG3A 3GF4A 5ICSA 3BZUA 3PIIA 4J1TA 2E82A 1GZ6A 2PKRA 3IIEA 4GX0A 3JD0A 1OC2A 1H6CA 2C07A 3H3FA 1CDOA 1GUFA 1ONPA 4FJ2A 4BKQA 3BTSA 3ZWYA 9LDBA 3RCBA 4O1MA 3WGQA 1YDEA 3FTNA 3U9LA 5I7FA 1VKOA 3UKOA 2CD9A 1EBFA 3BMCA 3QWIA 4L73A 4NZ9A 4R41A 2V6GA 1O95A 3WQQA 4CM8A 4CM5A 2CDBA 1PEDA 2Y93A 3D0OA 3C1AA 1A4IA 1VM6A 3H7AA 3LC2O 1B14A 1O89A 4O63O 2ZATA 1RJWA 4DC0A 5A04A 1T2FA 5U9CA 1Y8QB 2O3RA 1TLTA 4RQUA 1IHXA 3SX2A 4W7IA 4I5FA 3DFZA 2JCXA 1BVUA 1K6JA 5L51A 3H6KA 4W99A 2GZ1A 4PN3A 1NQOA 2D4AA 3LVFO 1K89A 3DTTA 3R1IA 1T4DA 3SEFA 5COBA 3OSUA 1B26A 4FFRA 3UUWA 5DT9A 2B36A 1JAXA 4QO8A 1BW9B 5CG1A 4DC1A 4F46A 5HS6A 4FDAA 4EEXA 2Q50A 3L4SO 1E7YA 4M89A 4YAJA 3WQSB 2EWMA 1P0FA 3TFOA 1VJ0A 2OL4A 1NNUA 3KYDB 3MOGA 1LUAA 1UXKA 2A94A 4J0FA 3PDJA 5G4KB 1SCUA 3WNVA 3KEOA 4RPKA 3C1TA 4IIVA 3DR3A 3DBHB 3NV9A 3OIFA 3ZZNA 5T67A 4BB5A 3TNLA 2B0JA 1T2EA 3T4XA 4CM4B 4Z0HO 5H82A 1E7RA 1HT0A 3H9GA 4J2OA 1O6ZA 5HA5A 5I7EA 3H8VA 4S1VA 1HDRA 4IBOA 3ZV4A 1XHLA 4BNHA 3LDHA 4CV1A 3PJDA 1E3IA 2DU8A 1E1LA 1OOEA 2EGGA 2HO5A 3UOGA 1H2BA 3VVCA 4W9NA 4E3ZA 4ZN6A 5L9AA 5EESA 4CQLB 4NIMA 3VKVA 4XQCA 1X0VA 5JC8A 2X5JO 3WMXA 4ND2A 5IN5A 3RU7A 5HWSA 3INTA 4OXNA 1R12A 1I3KA 4LCJA 1GL3A 1PQWA 4OM8A 2PLAA 3F6YA 2PTGA 2DKNA 3B70A 4J49A 3GZNB 3NT5A 1H2HA 3CPSA 3V1UA 4BO2A 3AI2A 4K28A 4Q3AA 4CM9A 3GVHA 5BSFA 3GAFA 4Q3NA 1V3TA 5K0ZA 2E48A 1CWUA 2X0RA 3D4PA 3WNQA 2YV1A 3FTPA 3P2YA 4YACA 5L4LA 3AU9A 4IDEA 4RL6A 3EC7A 3JD4A 1LSSA 1T26A 2ZCUA 3PEFA 4BNZA 3ZU3A 4R3WA 1NR1A 1EDOA 4WLUA 3S2GA 1WDKA 2NADA 1EZ4A 1DRVA 2W2LD 3RC9A 3S2IA 2Q49A 4D41A 1JQBA 1BTOA 1DFIA 1MGOA 4PLPA 3W4JA 1Z73A 2V7PA 1DEHA 1AUPA 1KY4A 4DGSA 2IYOA 4GL4A 4P22A 4LGVA 5AVOA 5C37A 3A1NA 1QR6A 2Y1DA 2YFQA 3Q9NA 4NBVA 5KNLA 2PNFA 4NBTA 1PZHA 3NJ8A 2SCUA 3ZV3A 1E1KA 3KRTA 1C1DB 4BO3A 2I6TA 2DM6A 3KYCA 5C7IO 4II2A 1X14A 3FNEA 3RJ5A 3VH2A 1EUZA 2FRDA 1C0IA 3QE3A 4PIVA 1XYGA 2ET6A 3GVXA 3RBZA 3RD5A 4CMHA 4O5OA 5DCYA 3ADOA 1NQ5A 2O4UX 4RPLA 2J5QA 1NM5A 4R5HA 3AI3A 4LRSB 4GGPA 3DZBA 4IXWA 4TRMA 5G2OA 3C7CB 1XU9A 4RVSA 1M6HA 7MDHA 3DO5A 4W7HA 1CERA 4OL9A 1HETA 4JCOA 1U3WA 2IEDA 4GX2A 2DTEA 1JVSA 4TRRA 4KZPA 2O7SA 4L76A 1LSUA 3OECA 4IY1A 2Y68A 3EK2A 2DAPA 4WLNA 4YA6A 3OJFA 2H63A 1E5QA 3FR7A 4BKRA 3H9UA 1YBVA 4J7UA 2JCYA 2F00A 3AOEC 4KTVE 3ZNNA 2G0TA 2VHVA 4R4JA 1D1SA 3HJAA 4OHUA 1KERA 4RF3A 3U4HA 2WD8A 4GMGA 1U4OA 2FMUA 3G49A 1ONNA 3H3JA 2VRBA 5ES3A 4DIFA 4MO2A 2W90A 4UUMA 4MVJD 3ZHZA 3HSKA 2B69A 3I52A 5TQVA 1IB6A 2I66A 3ANNA 3E1KA 3ZU2A 2AG8A 3DB2A 4O59O 1U5AA 1EE2A 1EVZA 3F46A 1Y9EA 4A10A 3SVTA 3PJGA 3F1KA 1Q0QA 4Q39A 1UXIA 2ZK7A 5ILOA 3F9IA 2R6JA 5KVCA 2P9EA 1HZJA 5FI5A 1BHSA 1ZJZA 3E6AA 5B4UA 2AEJA 4RVHA 1W0CA 2QIOA 4XYEA 4E2ZA 3HHPA 3DMYA 4YTEA 2NM0A 3L4BC 3D4NA 5KJEA 4OSPA 5IDQA 4OO3A 1DLIA 5JO9A 1CF2O 1WDMA 1C1XB 3HG7A 3C7DB 3O03A 4F6CA 4R1NA 3PRJA 1YWGO 3GDGA 1BSVA 4J1QA 1S6YA 5AOVA 5FF9A 3QWAA 3PP8A 1EVJA 2XOXA 2ZQYA 4A2CA 3BAZA 2OORA 2BFPA 2OBNA 3TDKA 1B8UA 3JSAA 4OJNA 1CJCA 4JROA 3HB4X 2NU7A 2CY0A 1RWBA 3HNPA 3RSHA 1MG0A 4Z0TA 4BKOA 2XAAA 3QV1A 3OFSA 1UAGA 4RDIA 1F14A 3JQ9C 4M87A 4TRJA 2ZYGA 2ZYDA 4BS9A 1SOVA 5L40A 1CRWG 3EHEA 4KOAA 2C2YA 3CZRA 5ICMA 4HBGA 2V65A 3E82A 3IKVA 2C29D 1DB3A 1LEHA 3MJTA 4E5NA 3PHLA 1HSZA 2CUKA 3I4CA 4PG4A 2AQHA 3BMCB 1X1EA 1LQTA 1RM0A 4HWKA 3D3EA 2C5AA 3LT0A 5F3RA 4CM8B 2FPPA 4PLWA 1DC3A 1ZIDA 1IL0A 1GQQA 1YB5A 4F45A 1P1JA 4MP8A 5KJFA 2P68A 2EEZA 3GRPA 2AW5A 4R01A 4LMPA 1QORA 4ZHSA 3JYPA 3WGZA 5A5EA 2VQ3A 2Z95A 4J4BA 3TZ6A 5A02A 4CUKA 1UZMA 4ALIA 3I1JA 1PJ3A 3K5PA 1J5PA 3NGXA 2OGUA 4J43A 1MV8A 3IP1A 4OOEA 3AY3A 1Z6ZA 1HDOA 2Y1CA 4OXKA 1BWSA 4L0QA 1EDZA 4BNFA 4HFMA 5JAIA 3DQPA 4MKXA 3WTCA 4RF2A 4E2XA 4DL9A 9LDTA 1M2WA 4I5DA 2FP4A 3RUFA 3GLQA 4K6FA 4D0RA 1ADCA 3LLVA 4HX5A 3I4FA 2GN6A 2UUPA 5TGDA 4NBUA 1E7SA 2X22A 2YV3A 1E92A 1PSDA 2VNSA 4KTTE 3HN7A 4NJMA 4U6SA 3WMWA 2YQ4A 2P4HX 4HY3A 3UW3A 1YDWA 1PJQA 4NFYA 2P9GA 4PGFA 1YJ8A 1E3EA 1E3LA 3WGOA 3VTFA 4XB1A 4YRBA 1GZ4A 5J23A 4UVIA 5EJ2A 2OMEA 1T1SA 4IZHA 4Y67A 5CEJA 3IJPA 3H2SA 2D3TA 3AM4A 4WE3A 3S1LA 1W73A 5A9RA 1PJSA 4R68A 1WMAA 2POQX 2WYVA 1U2GA 3FD8A 4R1TA 5KJ1A 5L4SA 2P5UA 4FFMA 4AJLA 1MUUA 3I3OA 3RFVA 3LT1A 2P5YA 3RBXA 4J3FA 3ANMA 2IZZA 1V8BA 3Q2IA 1RM5A 2GF2A 2BD0A 3STHA 1A27A 1DAOA 2RHCA 3GN2A 4XQGA 4BO0A 1K6XA 4ND1A 4D79A 2X5KO 4MDHA 3PGXA 4W4TA 5AXBA 4YDRA 4TKLA 2GNAA 2HMWA 2W2LA 4AJJA 4NMHA 4YT2A 1ZW1A 1LQUA 3K2EA 3MEQA 5G0WA 4L8VA 3H9EO 3L6DA 3Q0EA 3RUEA 2X0IA 3B1FA 4BMSA 1WXDA 4BQRA 1CQJA 4CL3A 1LRKA 2FOIA 3IKTA 4L4RA 3T4EA 3GC6A 3WBBA 1UR5A 2J3JA 3DBLA 4JP3A 1O5IA 1ORRA 1GR0A 3MJVA 3PFWO 3ONEA 1XWFA 4CM7A 1D3AA 3WYCA 1A5ZA 1ONOA 2DPGA 3IMFA 3ULKA 3VVBA 2XXJA 1OAAA 3MCVA 1H9BA 3IUSA 4YBZA 4CR8A 1AE1A 1U9JA 5HBRA 4CLDA 1MG5A 4Z9FA 2HCTA 3TZKA 3QVXA 4HFRA 3LC7O 3QLJA 2PGJA 4DMMA 3KOUA 4E5KA 5A3VA 3WLFA 4NJOA 4EJ6A 3ZH2A 3KYCB 3ROQA 1V0JA 3ZV5A 2NVBA 2ZKLA 2BGKA 3KEQA 1DRWA 1N9GA 4BKUA 4W82A 4DQUA 4BNWA 4HV4A 1HE5A 4BO9A 4DUPA 1Y6JA 1ZBQA 4WECA 1B3RA 2EIHA 3SXPA 3TQHA 4B4WA 2O3QA 5JAQA 3F47A 4A27A 2BHLA 4CR6A 1NX6A 2X8LA 1ZXLA 4MVJM 1HDXA 1LRJA 1Q1NA 2CVOA 3LQFA 3Q11A 4I1IA 2DT5A 4LMRA 4MVJA 2Q1TA 4JIGA 1FDTA 3FHLA 1F06A 3CH6A 4P4LA 1DXYA 1ISFA 1QYVA 5I7SA 3E03A 4N54A 1VKNA 3GMSA 5JAZA 4IDAA 4PG8A 2P4QA 2PWZA 3GG9A 3TL3A 2OXIA 4XB2A 3VHRA 2GUGA 3PI7A 5A1TA 1Z82A 3AUUA 3RUIA 3K92A 1TXGA 2XPCA 3Q9UA 5H83A 4TROA 4NFHA 4DQVA 4Q3EA 1LA2A 1NPDA 2AE1A 4OMUA 1A71A 3RUHA 2FPGA 1HZZA 3UF0A 2H6EA 4ZJUA 1E1NA 1R37A 3W4KA 1QYXA 1J0XO 1Q2XA 2GZ3A 3EGOA 3TZCA 3RKRA 3F3SA 4XGKA 2PKQO 2RH8A 3M6IA 3I9KA 4R3NA 5LDGA 5TLSA 2NQTA 3M2PA 3UAGA 5A3JA 1MFZA 3PJFA 4IM7A 3I83A 2HRBA 1LDMA 1LLUA 1ZK1A 1DHRA 3E48A 1YL6A 4II3A 3F1LA 4Y6RA 5AYVA 2PR2A 4B7UA 5JCJD 3WIDA 4UEJA 2YY7A 5T57A 1F12A 3V2HA 3R3JA 4WUVA 4I8XA 1PL7A 1PWZA 3DAPA 2J6IA 3AY7A 3FNFA 2JAHA 4IQGA 2JFHA 4TZKA 3VDRA 1HKUA 1LRLA 3ASUA 1R0LA 2Q1SA 2ZYAA 3NDJA 5IN4A 2YDYA 1LC0A 4AJHA 3B6ZA 1VL6A 3OJEA 4XEHA 2VZ9A 4EITA 1IHYA 4YJGA 5I8ZA 3TL2A 3AY6A 5G0UA 3I6IA 3KBOA 1F0YA 2Q1UA 1H6DA 2AQ8A 2QRJA 4K6CA 3CEAA 2JKVA 3L9WA 1E7MA 4HFJA 3D7LA 3TSCA 1EEHA 3RJ9A 1TA4A 4L9RA 2P2SA 1NYTA 1W8DA 4E32A 2IYPA 3ADPA 2A92A 4GSLA 2BMAA 1M66A 4YEDA 3V1TC 3KSZO 4E5MA 1XCBA 4R9RA 4LSWA 3DHNA 3QA9A 4WOJA 3DMTA 3U09A 3TZHA 3OBBA 3JYNA 4IDBA 2Y1GA 3WICA 4GX5A 5A5FA 4IJVA 3C24A 3AK4A 4DRYA 5C7LO 2DPHA 4WKGA 4GPD1 2NU9A 5KWEA 1UXJA 1NVTA 3JTMA 2HUNA 4WCFC 3JD2A 4P38A 3GNQA 1GADO 1KEUA 1C3VA 5K6AA 1RPNA 4WK6A 2BF7A 1YQDA 3PHJA 2WM3A 2EP7A 1BVRA 1ZK3A 2GPTA 3FR8A 3S2FA 3DXFA 1TVEA 4BGVA 4XCVA 4HADA 1YQXA 2CDCA 4ZQFA 1CYDA 2JD1A 2B5WA 4Z9YA 1L7EA 3VH3A 3VPXA 2GLXA 3IAHA 3UFXA 3GGPA 1SMKA 3HWRA 4GMFA 4IJWA 3AWDA 4W9NC 3DZJA 4BGIA 1QP8A 1B8PA 3NYWA 4FS3A 3UCEA 5L95A 3OJ0A 5DZSA 3D64A 4UVEA 4D3DA 4DXHA 2X6TA 4IGFA 3BIOA 3WX0A 5TJHA 5DOZA 1Z45A 2CMDA 2VHWA 3BYZA 3H9JA 1X7HA 5I9LA 3WB9A 4NK4A 3BMQA 1HE2A 1PGOA 5EQFA 3V8BA 1GFSA 2QRLA 3ZWXA 4NJMB 5DP2A 5IJZA 4ZQGA 4XDZA 5A4DA 3VC7A 2JHGA 1SNYA 5CFZA 4FCCA 1VC2A 2NSDA 3VAZA 3ZV6A 1UH5A 3HE3A 2PH3A 4E13A 4FC7A 4JBGA 5F1PA 2IXBA 2RHRA 4GKVA 5DBIA 1PQPA 4FFPA 4FGWA 3T7CA 4LN1A 3RUDA 1XIVA 1QRRA 1UZLA 4HUJA 3C8MA 5AXCA 2IDZA 5JDIC 4GSKA 1DDOA 5C5IA 3BA1A 1KC3A 1JKFA 4GLOA 5CDSA 1H93A 1IULA 3ZDFA 3COSA 3GN1A 4FFNA 1JDJA 4ALJA 1IOLA 4RCVA 1KVSA 2GN8A 3OHSX 1WDLA 1QLHA 4IPTA 3FRJA 4Q3BA 1SOWA 1TI7A 1ENYA 3K6JA 3H65A 2PY6A 2OZPA 3Q2KA 2ZJ0A 4OH1A 5HS4A 1U7HA 3ON5A 1E3JA 1IYZA 2PK3A 4XYLA 1EBUA 1U28A 4DLLA 3MJSA 1I01A 4CUZA 4YAEA 4ALKA 1DFGA 4GVLA 3DBLB 2BFMA 4B7CA 2ZB8A 3PHHA 1PTJA 4CJXA 4X54A 3AFMA 3R6DA 4JXKA 3LZ6A 1U1IA 5JMWA 3ZWVA 1MX3A 1EUCA 4QSMA 1ZH8A 3G1UA 2X0JA 3Q6IA 1DIBA 2E37A 1O8CA 4WCFA 5B37A 3WXBA 2B83A 4RQTA 3QSGA 3WDSA 3OEYA 2C20A 2BGLA 5CEEA 3AFNA 1I36A 4BB6A 1OMOA 5HM8A 1MB4A 2ZB7A 3FI9A 4CMAA 3HZZA 4E33A 4EJ0A 4UVDA 1E77A 4WLOA 3BHJA 5I9MA 4YAKA 1X15A 3DZGA 5EERA 1EQUA 4IDFA 5F1KA 4AJ1A 3WR5A 1N9GB 3OIDA 2JCVA 1HDZA 4M49A 1H94A 1XGKA 4YT5A 5L45A 4JJGA 2CSUA 1HSOA 2YJZA 1P0CA 2WJPA 3GNSA 2VRCD 1T2CA 4BO8A 2I3AA 3OA2A 4WOKA 3VZRA 4GX1A 4RLHA 1QLJA 5DDIP 3UN1A 4M8SA 4BGEA 4DIOA 3ONDA 3T7EA 3E9MA 1BRMA 3QVWA 4ILKA 3PPIA 5L4NA 4I9UA 4B4UA 3BHMA 3ZU4A 1NHWA 1PL6A 5F21A 5T64A 4PLYA 1EMDA 4HNGA 5A9TA 4E30A 2QW8A 2JJYA 3PZRA 4U6QA 2VYVD 4H3VA 4OSOA 4J0EA 2JD0A 3QJ5A 4CR7A 1GAEO 1HLPA 2UVDA 4A0SA 2X4GA 2Y1EA 4XYBA 2VUSA 5CPFA 1YKFA 3QWFA 2DBRA 3LSYA 3HDJA 1ZVMA 1KEWA 2VOJA 2NUAA 4FPXA 4K26A 1FDVA 2BI7A 3GGOA 4M55A 5TT0A 1FJHA 2DTDA 2X58A 1DSSG 2EV9A 1TT7A 2A4KA 3I9NA 3LF2A 1VPDA 4O0LA 4L74A 2CVQA 4W6ZA 5JCJA 4FB5A 3W4IA 4J4HA 1GTMA 1IUKA 1T2AA 1GPJA 2G5CA 3GFBA 3K96A 1E1MA 1ZXBA 5JDIA 1M75A 3KLPX 2FR1A 1K5HA 3ZWBA 4C7JA 1G0OA 2NLOA 2C7GA 1ZK4A 3C7AA 1HL3A 3GAZA 3JQDA 2XXBA 4YAGA 4K9DA 5G0TA 1YE3A 3R0IA 4PLZA 4WASA 4IDGA 3DBRA 5IXSA 2H9IA 2D5AA 3V5NA 3LT4A 2WYWA 1I32A 1WW8A 1YONA 1S7CA 1P1RA 4UAGA 3D3WB 1MXFA 1YVEI 2FZWA 3JYLA 4ZA2A 2H5LA 5TS3A 4YJGB 4AJOA 4A7PA 2VWQA 3WQRA 5A05A 3VPHA 1PGNA 1ZMOA 2AHRA 1NPTO 3OQ1A 1XELA 2Q4BA 3FBGA 1PJBA 3IC5A 3H5AA 4NBRA 3U62A 2HJRA 1HYEA 1Q7BA 4H16A 2EF1A 4XKJA 4LVCA 1YO6A 3ETDA 1Y9AA 3H5RA 1DRUA 2Q4EA 3RU9A 5BSGA 1MXHA 4NU5A 3DAGA 5LDHA 4BMVA 4D3SA 3U4CA 1GYPA 1F8FA 4EEZA 2CDAA 4TVOA 3EZYA 3EVNA 1EE9A 1C14A 5H81A 5T5QA 5DOVA 1RM3A 3EYWA 1IPFA 1ADGA 1DIRA 3ICPA 1UZNA 2YHIA 3HDHA 5JXWA 4GWKA 4D45A 3Q3CA 3W8FA 3NGLA 2Y66A 1RM4A 3QWBA 5B4TA 4L4SA 2J8ZA 3U3XA 3U49A 3WGGA 3OEWA 3AI1A 3UXYA 3ZI0A 4DTIA 4PLGA 1JWAB 3CXRA 4KUHA 4EDFA 1WWKA 5BQFA 4CMJA 2D2IA 2YZ7A 4U0JA 1EK5A 3AUTA 2QZ9A 1M6WA 5HTOA 1E6UA 2E6UX 2PKQP 1PJ2A 3OQBA 1C0PA 1DO8A 4IUYA 4NNJA 1N8KA 2X5OA 2Z1NA 4BGUA 1E5LA 4BNLA 3NKLA 2EP5A 4QO7A 1XDWA 3E5MA 1KEVA 2HDHA 4BQPA 4ZQHA 1T24A 4XX0A 3R3SA 5EIOA 2PD6A 5FWNA 3BMQB 5KJCA 4MIOA 4PLVA 1XEAA 3MZ0A 4BMNA 2PGDA 1QYCA 2DFDA 3QW2A 3OIGA 3ETEA 4MKZA 4XJSA 2PZMA 2WEKA 3I6QA 2HJSA 3PYMA 2YYYA 4ALMA 2VWHA 5CP8A 4Z9XA 4MKRA 4TSKA 1QSGA 3F4LA 3EVTA 1T1RA 1WP4A 3OJOA 5CAEA 4UEKA 2QYSA 2RBEA 3GGGA 3LC1O 4N7RA 1TEHA 4CMIA 1BDBA 5GMOA 1ZUD1 4AJEA 3I9LA 4RPJA 3D4OA 3JQ8A 1XR3A 4INAA 1PR3A 4XGNA 2VWGA 2G17A 3WSWA 3NDRA 1PX0A 3LLSA 4DYVA 2I76A 2I65A 4DPMA 2AA3A 3FWZA 4RO0A 1R16A 2JL1A 5EINA 1Z7BA 3NT4A 2BFOA 1U3UA 4IXTA 2AQIA 2Y0DA 4TQGA 2HSDA 1HYHA 4J6FA 5IZCC 4ONEA 3G1TA 1I0ZA 2YW9A 4WGGA 4LW8A 4A26A 5K9ZA 5BSEA 3RC7A 1YJQA 1V35A 3CZMA 3QVSA 1Y81A 4AJNA 2G1UA 3QIVA 3KHUA 4PZCA 1RKXA 3BMNA 3SLKA 4OKNA 4OYRA 3VPGA 5KVVA 2ZQZA 3G17A 5KKAA 1BG6A 4RVGA 3U4IA 5BT9A 1QV7A 3B1JA 4L75A 2PA3A 4P8RA 1O94A 4FFLA 4WCFB 2CFCA 5T8KA 4JN6B 2GSDA 4B8ZA 2I5PO 4A5OA 1NWCA 4LCEA 5I9NA 4KWIA 2IEBA 2VRCA 4BIIA 1OI7A 4KDEA 4Z3KA 1T25A 5A9SA 2HLPA 4I9HA 4L4XA 5CEFA 5JSFA 2B4RO 3EMKA 1DJQA 3JQGA 4BKPA 1A7AA 4CLRA 3ENNA 1F8GA 5ER9A 3A9WA 3RI3A 2OFPA 1JU9A 3ZHYA 1PS0A 1NFQA 2X9GA 4MP3A 2NU8A 5ITWA 2VYVA 1Q0LA 1LX6A 2IE0A 2W2KA 5IAAA 4JNKA 1NVGA 1DAPA 2QG4A 4CM3A 3DFUA 4GH5A 4Z0PA 1R6DA 3KUXA 5G0SA 3VOSA 3B20A 2D0IA 2IRWA 1SBYA 1ZSNA 2AEMA 3DOOA 5ADHA 1LI4A 4Q9NA 3ZWPA 3OMLA 4CV0A 2VTDA 1LXCA 3VPSA 3VDQA 3GR6A 4JJIA 3A28A 5IDXA 2VT3A 1P77A 2W98A 1QMGA 4EUHA 1JTVA 1NAIA 1NP3A 3PYLA 4FC6A 2J3HA 5BNFA 4B7XA 5DBFA 3WFJA 1SPXA 2D1YA 1GCUA 4YVFA 3UVEA 4NPCA 2EKPA 2Y1OA 3JYQA 4N5LA 3RBVA 1NXQA 2O3SA 3MWDB 1GEEA 4J91A 3E9NA 3ROMA 5JAMA 3NDIA 1L7DA 3CSDA 4DPKA 1BMDA 4HKTA 4Y6SA 2PZLA 1Z75A 1HDGO 3AUAA 1PWXA 2FHSA 1SZJG 1MC4A 3ONFA 4YYZA 4WJZA 1P3DA 4GAEA 1GQ2A 2GDZA 3DBRB 3EAGA 2X9VA 3DDNA 3MJ4A 4E6PA 3DMTC 5IZCA 1UXHA 3G0OA 3AOGA 8LDHA 4ND4A 5CDTA 1GU7A 1LJ8A 3I5MA 1Z7EA 3WGIA 1MLDA 2HRZA 2DC1A 2AE2A 2C0CA 3WJAA 1GYRA 4BNUA 1JKIA 3L6OO 4PZDA 1SC6A 3ITKA 2GR9A 4Y9DA 3O4RA 3FNGA 4QFDA 1ENPA 5ER6A 1NPYA 4J9UE 1U3VA 4CMCA 3DL2A 3CINA 1RYDA 4IDDA 4DYDA 4CLHA 5K6AC 5DP1A 3JD1A 4F3YA 1BGVA 1UDBA 1ZFNA 3GA0A 5JDCA 2J3KA 1LLCA 5DCWA 2PFGA 4PCVA 1D1TA 1R4NA 4UULA 1JA9A 1YL5A 4RORA 2EW2A 4Y8VA 2EHDA 2E4AA 3EW7A 3NT2A 2GYYA 3DAFA 3RFTA 4P4NA 1PQUA 3MTJA 1N1GA 4PG7A 3PZBA 2NWQA 1N1EA 2UUOA 3DWFA 5JLAA 1GDHA 3GY0A 2W4QA 3H2ZA 5L7YA 3WYEA 1J6UA 5CDUA 1KBZA 2VNAA 1LU9A 2QX7A 2EG9A 3FSRA 4C4OA 4YJFA 2ZTUA 3HADA 3K31A 3O9ZA 1E7WA 1NASA 3GOHA 4FOOA 4I9NA 5IFLA 5U4QA 2X0NA 2YHIB 1KVTA 1XQ6A 3IS3A 4FBGA 2EJWA 3TF5A 1FK8A 1H9AA 3OM9A 3MOIA 4LVUA 1JLLA 2WTBA 4XRGA 2P91A 2BI8A 4GI2A 4R69A 1ISMA 4MJLA 3EDMA 4YB8A 1VSUA 1SEPA 1MA0A 3KETA 3KYBA 1JAYA 1WVGA 1GEGA 3AW9A 3KSUA 3ZW8A 1Q7CA 1I33A 1I3LA 2Y05A 2X1HA 1VI2A 1LDEA 3D3WA 5IDWA 2C5EA 3N74A 2GCGA 1P1IA 1ADFA 3NX4A 4TVBA 1KETA 2YHUA 3CMCO 3FF4A 4J16A 3S2EA 3MJCA 5JS6A 4J1SA 4DVJA 4R1SA 4GLLA 3GT0A 4NQZA 2HK7A 3QVOA 4XQEA 1ZNQO 3L9XA 2Q45A 3EUWA 3ZW9A 3AM5A 5KJ6A 3CUKA 3QY9A 3M1LA 3ROPA 4XA8A 8ADHA 5JBIA 1QV6A 4IJUA 3C1OA 4NG5A 5CPBA 3I9OA 3GEMA 4Y6PA 3ZWNA 4QTZA 2LDXA 2O2SA 5G0VA 4DWVA 1YGYA 2VWPA 3L6EA 1O0SA 3VZPA 3INRA 5LCXA 3INGA 3JQBC 4AL4A 4CMIB 4MVJP 1P45A 4KUGA 3CKYA 3IOYA 4FJ1A 3PDUA 1EFLA 3JQ8B 3AJRA 3GVIA 4J90A 3PWKA 1J4AA 3ABIA 4G81A 3JQ6A 3GPIA 1KS9A 2Q2VA 1YB1A 3PFFA 4DREA 1IY8A 4UVHA 1ZKMA 2CNBA 3DHEA 3JQEA 4PLTA 1AXEA 1X13A 3V2UA 3V2GA 3PLNA 5GZ3A 4M54A 4BNIA 2BH9A 3U0BA 3G79A 4YWJA 4XJTA 1PJCA 1HEUA 4WEQA 4YRDA 3L0DA 1PL8A 1X1TA 2HK8A 4ROSA 3FWNA 4EUFA 5GZ6A 3W8DA 3DOJA 4LSMA 2O23A 3SC4A 2QRKA 1NVMB 1GUYA 5KOIA 2B5VA 3GH3A 4CLXA 3BMNB 4WLFA 4NR0A 4KUEA 2RAFA 3OP4A 1PIWA 4BV8A 3JQAD 5B4VA 3C85A 4EI2A 4YT8A 2JFGA 4JX8A 4RF5A 1N7GA 5HRUA 5TRTA 1KIFA 5TF4A 4E31A 3KZVA 2A35A 1E6WA 3K2BA 3NJ4A 4FD3A 4J7CA 4ZQEA 5JFOA 4NU6A 3JQFA 4BNKA 2NV6A 4OAQA 3JD3A 4M1QA 2FZEA 1IZ0A 5IZ4A 5B1YA 2HMVA 3QQPA 3QVTA 1T2DA 3P19A 3RASA 5A9SB 1YS4A 1DOHA 4BO7A 3CE6A 1Y8RA 3BHIA 3OICA 4UUOA 1M67A 3GDOA 3K9QO 1LLQA 3VTZA 3ZHBA 4KQXA 1UAYA 2NACA 3JQGB 4BNMA 4CLRB 3FN4A 3UCFA 4KDFA 4CMEA 3P2OA 2OO5A 4XR9A 3SBOA 4FOSA 4B4OA 1F17A 2J5RA 5JC1A 2PD4A 2W2KB 1XA0A 3EY4A 3ZNOA 2W8ZA 1BXKA 1AXGA 4IIUA 2FSSA 1DC5A 1FDWA 1HXHA 3PVZA 1H0KA 3LK7A 3KTDA 1U8FO 2X86A 3WOHA 3O38A 3A06A 3D5QA 5IXYA 5IDYA 1HRDA 3MWEB 3SJ7A 4D0SA 2CF6A 2EERA 1ISIA 3PLRA 2BGMA 2AEFA 1YOVA 1U5CA 1JKJA 4IZIA 2PGLA 5LC1A 4PG6A 4D7AA 1A9ZA 1HWYA 2DBQA 3BMOA 5DF1A 4XYMA 3GEDA 1D7OA 4ALLA 2UDPA 4RPGA 5FFFA 4A73A 2RH4A 2O2YA 1G1AA 2GN9A 2DUUA 3FNHA 2C82A 5MDHA 4OIMA 3JQBA 3VH1A 2EW8A 3F4BA 3C3XA 4ZQBA 4ZICA 5A03A 4TWRA 2Y67A 1KVQA 1SB8A 1U8XX 2EKLA 2O4CA 2YV2A 3DZFA 4G65A 5FEUA 5AXDA 4QXMA 3GRKA 5COQA 3IUPA 4LISA 1PS9A 3NEPX 3OJLA 2C54A 3PHGA 5AQ1A 4AJ4A 3GDFA 4ZD6A 3DZIA 1Y5MA 3RVDA 4E2WA 2JFFA 3ZWCA 2HMTA 2DBVO 2WMDA 5DULA 3NRCA 4NDNE 3GEGA 4CQMD 4AJKA 5JW6A 1A9YA 1O9BA 4RPHA 5I8WA 4D3FA 4BNYA 2WE7A 2R00C 4XWYA 1BXGA 5ITVA 1E0DA 1ZMTA 2DUWA 4YRAA 1Q0HA 2TMGA 3W6UA 3D5TA 3VKUA 2XF8A 3S8MA 3HFGA 2H1SA 3SLGA 1FXSA 3TPCA 3CMMA 1I2ZA 1YQGA 5GY7A 3RWBA 4YAIA 4DLBA 2PD3A 4S3MA 1QG6A 2ZTVA 3LF1A 4QX6A 4DMLA 4YR9A 3PXXA 1H6AA 5EMHA 2V6MA 1ZZEA 3FCOA 3E18A 1Y7TA 3ORFA 1ZJYA 1CQIA 1VRWA 5TJ9A 1YXMA 1DC6A 1N7HA 2JAPA 3P7MA 4A03A 5TIIA 2UV8A 1I2BA 1R4NB 4HFNA 4BL5A 2RIRA 1P74A 3EZLA 2PZJA 3W8EA 1ZCJA 4OKIA 3K8ZA 3DOCA 5A06A 2OP1A 1R4MA 2D59A 1NTOA 1P1HA 2UYYA 4JBHA 4QEDA 1WMBA 4YJFB 2G76A 1EUDA 1Y5RA 1WZIA 2WYUA 3PHIA 3GPDG 1VE9A 3PIDA 1UP7A 3UH1A 1AHHA 4U8GA 3IL2A 1EVIA 3VZSA 3L07A 1XU7A 3PQEA 4Q3CA 4YQZA 2IZ0A 3QP9A 2GGSA 3NAQA 3WSVA 2O3JA 1D8AA 3E5RA 1C0LA 1KY5A 2Q99A 4R54A 5DBGA 3WTBA 4OXYA 1NFFA 4C7KA 5AXAA 3GZ4A 1FDSA 2HQ1A 5L53A 4RVDA 1I5RA 4WNIA 1V3VA 2X23A 5TT1A 3ANLA 4IJKA 4JBIA 3ZNPA 2RCYA 4YJDA 3JYOA 3UHAA 1NWHA 2AQKA 4TRNA 1KEPA 2IODA 1UDAA 1LDBA 3H9QA 1RYEA 3KVOA 2O48X 2GZ2A 1JWBB 4WEOA 3GMDA 3ZU5A 1E3WA 2Z5LA 3KB6A 3RIHA 2OOSA 1PU2A 4G5HA 4YJHB 5U1PA 1IE3A 1DLJA 5F1OA 5KCZA 3KM0A 2V6BA 2Q2QA 3K73O 4MVJE 1K6IA 2VHYA 3ENKA 2DFVA 1P44A 3QRWA 4LRTB 1HDYA 2ZTLA 4KWHA 5KTKA 1J49A 2C2XA 3OQ6A 3DHYA 5GZ1A 5BNTA 2Q1WA 2HK9A 1FMCA 2ILTA 1YRLA 4OQZA 3M1AA 2JHFA 4IS2A 2J5KA 2R00A 3LT2A 4ESOA 4PRKA 5EPOA 2NVUA 4BNGA 3ZN2A 1U7TA 1QXSA 1JW9B 7ADHA 1DIAA 4JQCA 3AU8A 2VZ8A 3KSDO 1ZK0A 2FWMX 4B8WA 4RJTA 1I30A 3MJEA 2B35A 2ZCVA 1GQYA 1A72A 2YFHA 4IDCA 1PS8A 2VZ0A 3KO8A 4R16A 3OETA 4EGFA 1V9LA 3HUDA 2Q46A 3FBTA 3JV7A 2B4QA 5T8KC 2VYND 1GUZA 4J9VA 1E3SA 4NHEA 1N2SA 4B4VA 4EJMA 1R66A 3TZQA 2I9PA 3I23A 3WLEA 3JQAA 1DIGA 1QYDA 3GG2A 6LDHA 4URFA 1BDMA 4AICA 1C0KA 2C59A 2IZ1A 4BHTA 1LC3A 1ID1A 2I99A 3DC2A 4E2YA 3I9JA 1NQTA 4GGOA 3GUCA 1KYQA 2QQ5A 4BUCA 2BELA 1B7GO 2TMDA 4HXYA 4XYGA 4CL8A 4R51A 3UCXA 1WAMA 3TOZA 3WGTA 2OHXA 4JK3A 3IP3A 4EW6A 1K0UA 2HAEA 3ICCA 3K30A 1G0NA 3W1VA 1P1KA 2R2GA 4PVCA 5F5LA 3DTYA 4D44A 1PR9A 2O50A 2WSBA 3IDSA 2VUTA 2YDXA 4JGBA 4U5QA 1LSOA 4QQRA 3ZWWA 1P9LA 4BNTA 1R15A 3N7UA 4IINA 1B3BA 3WGHA 3WIEA 1Y8RB 4MVJF 2WD7A 4XIYA 3NTQA 3AUSA 1KC1A 2X7HA 3WGYA 4XRRA 1DJNA 2VHXA 1V3UA 1KVRA 2I67A 1V6AA 4J7XA 4PLFA 1B8VA 1K2WA 2Z1MA 2IXAA 2ZB3A 3P5SA 5I7VA 2WWRA 1ULUA 2NNLD 3WFIA 3HN2A 1SO8A 1A7KA 2F1KA 1N5DA 1YBAA 4N5MA 1ISGA 2EKQA 4U7WA 2WE8A 2P9CA 3WJ7A 2VHZA 4MP6A 3L77A 1A4UA 2ZJ1A 5TSDA 2O3UA 3BTOA 1SEVA 4IQ0A 1XKQA 4WLVA 3PWZA 3DZHA 3KV3O 1XG5A 4MOWA 2PV7A 4E4YA 4CLOA 1FF9A 4R1UA 1Q7GA 1LDNA 3RC2A 1YOVB
chains in the Genus database with same CATH superfamily
4CNQA 2CXHA 1QHFA 1KGSA 1U2ZA 3BMOB 3AW8A 2VBFA 2WP0A 1OLUB 2XT0A 3KKZA 4IS3A 1A04A 1L4EA 2XJ9A 4KAFA 3SKVA 3VR5A 2GCIA 4CMGA 2GSWA 3OF2A 4UU7A 4NF2A 5ENDA 2FZVA 1RXWA 1KI3A 3ESXA 2HGZA 5FTNA 3MGBA 1QKIA 2Q0XA 4HEJA 3ECAA 3D02A 1QK3A 4WN3A 2ZRCA 3F7OA 2GD1O 3AKEA 1OTHA 4ZVKA 1C4WA 2M6LA 1QHSA 5ENVA 1MHPA 3EH1A 3OX3A 1PW7A 2C95A 3FLBA 3II6X 3PJEA 1OILA 5G4LA 5GV7A 5JYEA 2VOEA 5KSWB 1OBFO 1ORDA 1NF8A 3QKSB 1AHIA 4BQQA 4PAMA 4TSFA 2HWYA 5AT1A 2PDAA 2WR8A 2FGJA 3H2GA 4C76A 4F60A 3LQ1A 2X77A 4B82A 2YY5A 4RSGA 3U3DA 3G2QA 2BZ1A 3VC1A 4RHFA 1SUBA 3HXLA 3LHDA 3PGKA 1I13A 4RDHA 3CNEA 1NY6A 1I2CA 4JL6A 1I9GA 2GYVA 3CEPB 3D2CA 3RAGA 3ZCPA 5JY6A 5EKTA 2BISA 2IOQA 2DWPA 3LCVB 3CLRC 4K0KB 1BXGB 1WNTA 5F4BA 1OKKA 2GQ0A 1FFXB 4IGAA 5JXIA 4B34A 3GO4A 1ADBA 2FPIA 2X5NA 1R0XA 4EA9A 1G8AA 1FXWA 3GP5A 4FFBA 2A7QA 1KDZA 1HT2E 1HPLA 4MVJG 5KVQA 5JBQA 2GEVA 1GTRA 3BFJA 4G1MB 1FC0A 1WUJS 3NUGA 4M0EA 4E14A 2BCGY 4RD1A 2NMVA 1SOUA 2LUOA 1DG1G 3D7RA 1BOOA 5DISB 4KOEC 4R1SA 2OM2A 2RG7A 1I3NA 4FVTA 4RTQA 4KVZA 3A14A 3THYB 1II0A 4H7IA 1GCOA 1DAHA 4D9IA 3UAXA 1C7ZA 1XVAA 2BW0A 4I5GA 4KVGA 1JQLB 1YI8A 4OSEA 3K9FC 1FU4A 1VG0B 2E49A 4MUEA 1BX0A 2FVYA 4PG5A 3CJTA 1PZXA 1S5PA 3KC2A 3OPVA 1FY2A 2JATA 5BORA 1L7QA 4C1BA 2XUAA 5KNDH 1ZWKA 2JLRA 3FDZA 3OHPA 3VR2A 1VL0A 2DQ4A 4YMTA 2OEPA 2D2XA 2D1TA 3D1LA 1SVSA 4YC7A 1D1QA 1QTRA 3MUEA 2QJWA 1JEEA 1PGJA 2IDJA 2JW5A 1Y8QA 2I4IA 2YQ5A 4IHKA 4DBVO 2O1SA 2OCDA 1BKDR 3RRFA 3QKRB 4EZBA 1XK6A 2OPBA 4O6VA 4YMWA 3WBJA 4MWTA 3ZWMA 3TJZA 1M1NA 1YBMA 5DPMA 4EELA 5BXYA 1RC1A 4C03A 3IEPA 5LZ7A 1UJCA 4LTMA 2ZTMA 3AEZA 4N18A 4ZRMA 2VDKB 2BKAA 3EOZA 4P5DA 4DPLA 3KSBC 2ZSJA 1N5IA 1CVRA 5DTJA 4N5NA 3CZ5A 3ZGYA 4FOTA 3BTVA 4F86A 1BW9A 3A1FA 3TEJA 1YIDA 2AN5A 2BLLA 5LYYA 4I5EA 4OLBA 1KVUA 1BH6A 4NOJA 4POOA 2L82A 2QN3A 3LU1A 5A7GA 2M98A 4QDUA 1RXVA 3OQOA 3LQ4A 2VAPA 1VKZA 3T52A 4QBKA 5CK5A 2GZAA 5DHFA 5MGBA 3CF6R 3GLHB 3NEJA 4B3CA 1CHNA 3VDXA 3D6VA 2O2HA 2HLDD 4B8YA 1LS1A 5KYUB 5IT4A 4RXTA 5G4KA 3U7IA 4EW2A 2C8KA 4IF6A 4ZYWA 4LV6A 1WZEA 1M1YA 3MOSA 4GWGA 2QVZX 1FP1D 1JDTA 2EJTA 4MRVA 1C8VB 4DCOA 1ULBA 1DQNA 3PWSA 3NFRA 1QFMA 1P4SA 2NUTB 4OAPA 1DAMA 3TLMA 4CM4A 3V3TA 5IEBA 3SCZA 3FCUB 1X0XA 3FPAA 4MIEA 5HTKA 1S89A 4DNPA 1YZVA 3D6MA 2E0IA 2OCAA 2GXAA 1OI3A 4RVNA 3AONB 3TMKA 1D03A 5FUXA 1Z2AA 1AGNA 3C5WP 3VH4A 4NAVA 2BMWA 1BEZA 1RRFA 1RYHA 1XTUA 4OI2A 2I62A 4QEKA 2Q29A 2XQIA 3LW8A 5KMGB 4YH1A 2MIIA 4ARZA 4BVEA 2A3NA 1UFVA 1CD5A 3O8RA 2VYNA 2CJWA 3O3CA 4QXQA 3ZWAA 1W2WB 2FZKA 1CJKC 3TRDA 2G5GX 3Q0TA 3AR4A 4BCCA 2REQB 4ZOLA 4TZTA 3LA6A 4IQ4A 5CDYA 2C4NA 5K0SA 2HJ9A 2FR8C 4EQ6B 2I8CA 4JMPA 3KWMA 2Z04A 4PGAA 3I2YX 2PS1A 1XZJA 3UXHA 4BVHA 3IQDB 1XCOA 1MTOA 4PU0A 1G4HA 5JZ9A 1AS0A 4GXNA 2YWRA 1GAQA 3MYRA 1FU7A 1EVYA 4MUGA 3WWYA 3CRMA 3AF3A 3H1PA 1TJ4A 2ARKA 5JECA 1J1ZA 1UPTA 2Q9UA 2QN8A 4HP8A 3OOJA 4J1NA 4UUPA 3T1OA 4AJIA 4BNNA 1KXZA 3N70A 3KZOA 2A9QA 2CNKA 4JJ4A 2XQKA 1Y1RA 2FPUA 3RHFA 4XIIA 3BL8A 2EXXA 4ZZ0A 2FE4A 1U2PA 3B1WA 4PZYA 3L49A 4XDYA 1ARZA 2MOKA 2GERA 4FGLA 1ZI8A 3THWB 4IFTA 3GLHE 2XWBF 4V0QA 1OC4A 1QCDA 3PQ3A 3H99A 4CMEC 4CM9D 5T4FA 4JJAA 1WXXA 1X7XB 1KO4A 2BFAA 5F5NA 1CUHA 3AM3A 3PQDA 5FA8A 4MTCA 2HD4A 3M8KA 1NMQA 3N2ZB 1S4MA 4MUMA 4LZLA 4PLCA 2EZ8A 3T12A 3ZXSA 2ZB4A 3SFZA 5EXEA 2C94A 4JCCA 3TXXA 4D3YA 4DCNA 4RQAA 1Q77A 4DA6A 4E08A 1T1GA 2BRUA 3T3IA 3RHZA 4D43A 1KI2A 3L7AA 4Z8YA 1TUBA 1FYDA 4NBWA 3H1EA 1CJUC 5JD4A 2R6AA 2AMJA 4PN7A 6CHYA 5LP6B 2REOA 3CHYA 1R0KA 1G64A 2H29A 2HOQA 3DNMA 2Y0EA 3IR7A 4XWGA 2HJVA 4HDKA 1G8MA 3GHYA 5L3ZA 3VR4A 1F20A 1M74A 4OJMX 1L1FA 3QUQA 1E5TA 4PICA 4RF4A 1JIIA 4YCCA 1P72A 2A86A 2CWWA 4LQDA 5EL0A 3E2PA 1PKEA 3BERA 1PJAA 2XUPA 4RK1A 3UH0A 1NI5A 4CCYB 5KTMA 3HO8A 2O8CB 4RE6A 4XWOA 1ULSA 3OZAA 4I19A 1IBLB 3AL3A 4K9KA 3ECSA 2EJVA 1NUUA 1QKJA 5CTAA 4QNMA 2D1SA 4J0KA 5IAEA 1J42A 2ZIXA 5BSMA 2NP6A 2YVQA 5J2UB 3TK1A 1K7EB 3PUVA 4B44A 1NBHA 4EFLA 3KLMX 1UOOA 2FKNA 2PKWA 5DN9A 2VJMA 5IBCA 4E15A 1R6TA 1TB4A 3BJZA 1R9GA 2JFNA 2M6SA 3OE1A 1BA2A 4UARA 4UM7A 3RYFB 3U5ZB 1Z68A 4TM8A 5EJ5A 2JJMA 3O21A 2HMSA 3M2TA 3I9MA 4GR5A 1O7JA 2H4JA 3R6WA 4BFSA 3QU2A 4BCDA 1M7HA 5B12A 3PKJA 3U16A 1CUXA 3W5AA 1JG2A 4YJ3B 3CW8X 1PZGA 2RAVA 2GO1A 2HWXA 2O5VA 4M7PA 1KDTA 1NLZA 1QUFA 2BGRA 5FO0A 4X44A 3TD9A 1NG1A 3AMVA 3N58A 1QIEA 1A8PA 4QUGA 3UGQA 5KO2A 1PF7E 1XXHA 2VDMB 3SP1A 4E5PA 1XEWY 4PS1A 1GZ3A 2PRZA 4PTYA 1IZ9A 1VL8A 2J85A 1AHNA 3QLVC 4LNUA 4QD3A 1UKBA 2B34A 3BX1A 2OTCA 4Q1VA 3IDQA 1LVGA 3D3NA 3GBVA 4LQCA 3GJZA 4QUKA 2YJTD 1MJGM 2QX6A 3T1HB 2D2EA 2DY1A 4LOIA 1K88A 3ABRB 3BQ9A 4RGVA 4QUAA 3V3KA 3C97A 2ACWA 3M3PA 3RPEA 4EJSA 8ATCA 2HTFA 3F6SA 3PA8A 3OT4A 4Q6BA 5KBYA 1NQAO 1Z0UA 1B0AA 4BRSA 2G83A 2PX3A 4QPJC 3R3XA 1H1TA 3H97A 3BL5A 3F5SA 4LXUA 3C3KA 3AC0A 2F3UA 1RJGA 1X80B 3F78A 3O8QB 4AUKA 5LFAA 4TTIA 4AYXA 4TV8A 4IRUB 4YCAA 2ID7A 3F5DA 3SICE 2EYQA 3ETGA 4GOLD 4A15A 2PMWB 2EGUA 3V55A 4NFLA 4O2AB 3Q87B 1LB1B 4P1ZA 4S1PA 4DOMA 3UB3A 1X7GA 4GKBA 5JAOA 2ZI6A 4MPDA 2DHDA 1ISJA 5ALEA 3ZJUA 2ZRMA 5DLYA 1GARA 5IT0A 3BGOS 1AK2A 3SQDA 2HYDA 2IT1A 3EXHC 1SH7A 4FWIB 4OK6A 1CY6A 1Y4UA 3HLTA 5H8WA 4KQJA 4BNXA 2CZQA 5DCUA 4DXDA 3JAWB 3GQVA 4Q3KA 3HYLA 3ZVMA 1AN0A 1ZCZA 3CUYA 5JZOA 3TLKA 1QE3A 5LLTA 5H3LA 5ICSA 3BZUA 3PIIA 4CFZA 4QTTB 4U6NA 4DJDC 3B8HA 5KWVA 4GX0A 1O5TA 1QDUA 4BRZA 2ALJA 1ZH0A 3H3FA 1WDWB 3ZUGA 1UBOS 1Q15A 3W3ZB 3UK1A 4EI7A 1UBSB 4DM7A 3PHBE 3PPVA 1PO7A 4YRTA 5EP2A 1EXDA 3CV3A 2P2YA 2GD2A 3WFZA 1EBFA 4NZ9A 1XB2A 2CNNA 4UTOA 2NU6B 3PR2B 3WQQA 1SXIA 4CM8A 1YHYA 4EBBA 2C9DA 5JVDB 1EFTA 1V1RA 4F1JA 1BOFA 2GWHA 2E21A 1I51A 2AWNA 2JVKA 2XQVA 1A4IA 3UJNA 1VM6A 3H7AA 4FGKA 4G0NA 5BYKA 3TM5A 4PYNA 4D9BA 4DC0A 3L0BA 4JLKA 3H1TA 3NVDA 4RQUA 1HO3A 3K0EA 3L7KA 4N5DA 4UCXA 2QT1A 4X95A 3DFZA 1ODTC 1E2PA 4W99A 2VQEB 1NXXA 2GZ1A 5AKGA 1NOJA 3ER6A 4IIBA 3DTTA 3VJMA 2WWYA 1T4DA 2HLDA 3ZCUA 4D99A 2H85A 5C4MA 5DT9A 2B36A 5A3QA 4LOKA 2PUDA 5DGXA 3OZSA 2QAGB 2RHBA 1Z83A 3LP5A 4FDAA 4EVRA 1JDUA 3BSSA 3SD7A 3CH7A 4YAJA 2OXRA 3KLOA 1GAJA 2JFWA 3K1JA 4O4IB 3STUA 3TFOA 2V3WA 4G9GA 1NNUA 3EGCA 2W22A 3MMZA 1JKMA 4X1IA 1H1DA 5EJ7A 4M99A 4QHTA 2A94A 5DXFA 1RQXA 1PL0A 1ESZA 3PDJA 1SCUA 2ZITA 5ESDA 4C05A 2V9CA 1Z4PX 4RPKA 4ZU1X 3GJ3A 1QIIA 2DQZA 1TM5E 3KJNA 3QXJA 5FWDA 3W5UA 1MHTA 2BFFA 3DBHB 2NVOA 3PL5A 1OX5A 2B0JA 2VK8A 1OXMA 5FWXB 1T2EA 2C4VA 4X62B 5T6MA 1ZU4A 4N65A 3C98A 2JRCA 3IR6A 1Z0IA 3ENZA 5E7MA 4M0CA 4PHHA 4H6XA 5HA5A 5FLYA 1YC5A 4I36A 5CB0A 2WAXA 3Q9LA 4DN6A 4BNHA 1SCBA 5CFRA 3LDHA 2PSJA 1LPAB 1YZGA 1MB3A 3DV2A 3PJDA 1E1LA 1FSZA 1H4TA 1OOEA 3UOGA 3AR2A 4IX9A 4L4ZA 2VPWA 4E3ZA 1LZLA 2A1UB 2WIKA 3SDZA 2X5JO 3ICEA 1LNSA 2P2CA 2XUOA 3CZAA 3M1IA 1BS2A 2P4EA 2AOWA 1VE7A 3DW3X 3V1NA 4W5OA 3DPUA 3MRXA 4IFBA 2WNSA 3U4GA 1C7RA 1R12A 1I3KA 4QHYA 4OM8A 4TKVB 3S44A 2Y1LA 4JBNA 2Q28A 5D01A 2WM8A 3AKZA 2ORIA 1I7SB 1NKVA 1CDEA 3GZNB 1WB4A 3O8BA 2OD7A 3GQBA 1H2HA 3IALA 1KWGA 1HNXB 5BMVF 1R6VA 3AI2A 2G1AA 4K28A 2ZSDA 4MW5A 4N3AA 4CM9A 3NH6A 3BAFA 4KPUA 2O05A 4Q3NA 2P3OA 5CMLA 4EHBA 1ODIA 1V3TA 1VCNA 1ES9A 4HB4A 3WNQA 2SKEA 2YV1A 1JUDA 2PMCA 1R8QA 3P2YA 5DE3A 1HI9A 1FPQA 4G5XA 1VPEA 3BGWA 4IDEA 5A4IS 2WQZA 1L8LA 4RABA 3EC7A 4RL6A 3UKDA 5AKZA 2KBFA 3NXSA 1HORA 3INNA 4AZ3A 5IS2A 1FUEA 4R3WA 1NR1A 2OORC 3EIXA 4QBHA 2HSZA 2NADA 5AVWA 2HSEA 5B30A 3ILXA 4Y2HA 3RC9A 3S2IA 3TRHA 3UGTA 2PV0A 2PT7A 1PFQA 2AX3A 4DGSA 1SUPA 3PRKE 2IYOA 4P22A 3AWIA 5L3SA 3A1NA 5J43A 2Y1DA 4I3GA 2O8EA 4YMSA 2NAFA 2C5HA 5JCPA 5KNLA 5JSHA 2OCLA 1U65A 4LHEA 4NBTA 1JJAA 4MH0R 2SCUA 1Y37A 4GNKA 2B1JA 4OYLA 2BYTA 3KRTA 5ESRA 3C5HA 3AR6A 1C1DB 5ULLA 2DM6A 3U1TA 5C7IO 4II2A 1X14A 3FNEA 4PNPA 1L9XA 5E6UA 1WU7A 4DMFA 3VH2A 2FRDA 4R8MA 1C0IA 1Z7YA 5BQPA 2R44A 3KTOA 4LGMA 3AYXB 3RAEC 2ETVA 3Q3EA 3RD5A 3MB8A 5DCYA 2KLHA 2VHTA 2FQQA 2O4UX 3GMIA 2J5QA 2EYUA 3VVLA 3ZY5A 4DM4A 3GV0A 1N77A 1KJJA 2FPRA 1L7PA 3CSSA 1KRXA 2Z8ZA 2H1LA 1AURA 4S1TA 3DWGA 1G6Q1 1CS0B 3GYBA 2RKWA 4XWTA 1KMNA 2GFQA 4OU5A 4W7HA 2QI9F 1CERA 3HABA 4OL9A 4OQLA 3TINA 4HUTA 1PX2A 5IJWA 4RM2A 1SUAA 3QE2A 1TQ2A 4OBXA 5CVVA 3WO1A 1U3WA 4F91B 2IEDA 4MUYA 5FL3A 2GA9A 5KPDA 1DOZA 1QGED 2BF4A 2W6QA 4KZPA 4L76A 5BYBA 3RRXA 1C3EA 1Z9BA 4BQOA 1CW2B 5KTNA 3JTEA 4Z1MD 1J09A 3VI3B 4CIAA 2ZWIA 4GWLA 1VYUA 5D5PA 3T3GA 3H9UA 1AK1A 4LHZA 3WL6A 5HQ3A 5B2FA 2ZS7A 4BMXA 4K9SA 1UBRS 4UEQA 5IKEA 3A6LA 4XUGB 2GD0A 3R76A 2G0TA 1JPUA 2VHVA 2GZMA 3MMPA 3OURA 1CS4C 4MRMA 1DX6A 1L4GA 2P5SA 2VRBA 3ADKA 4LHWA 1GRQA 1Q0ZA 2OD2A 3HU2A 1DCMA 1WMEA 7AT1A 1D6MA 5CX1A 1S7GA 4KMRA 4LF8B 1IB6A 4QPNA 3E1KA 3GGCA 2IGBA 3ZU2A 3OJCA 1YHNA 2IEAA 5JS1A 4JYAB 4ZANA 4KZKA 4MWEA 2DUMA 1VYHA 3V8NA 4A10A 5E6SA 4LYDA 4GMDA 4H18A 3KZNA 2O2GA 4ZOBA 3H7IA 5FBKA 3LUHA 2XUFA 3SFTA 5ILOA 4RM3A 3F9IA 3Q88A 1RWVA 3MLAA 4KR6A 4QAQA 2P9EA 3KLBA 1NX9A 3H87A 1BHSA 1IM5A 3G5TA 4U2FA 5B4UA 1G21A 4RVHA 5HE9A 2BBOA 1RMYA 3ZR4B 2QMQA 2WUDA 3KE8A 5KCMA 3JVDA 3CPEA 5DRYA 3OZEA 2NM0A 2XRYA 5JW6A 4I2NA 1EINA 3FGOA 4UMDA 2O8BA 2HIHA 5AKYA 2Q4RA 1E1DA 5K8CA 4WXRA 4N6NA 2PGXA 1C1XB 4UC0A 5K2MA 2BGGA 1CP3A 1XQXA 4ETIA 3PRJA 1BSVA 3OZTA 1XOIA 1S6YA 5H3CA 5DT2A 4KPFC 3WO0A 2JANA 1EGHA 3PP8A 1WBJB 2BUCA 2QIPA 4Q9JA 1LW6E 5ENZA 1Z0FA 3HCFA 2BFPA 1MT0A 2IFTA 1JEOA 3UMMA 2WWWA 2NU7A 5A3RA 5AVXA 5JQGB 3KOXA 3O1IC 2CCKA 2JGRA 2CY0A 5H5JA 2XE6A 4FMPA 3WZ2A 2L17A 2VSQA 2XAAA 1SGWA 3AKCA 2ZRJA 3AVPA 3PFIA 3QV1A 3SHQA 2QXTA 1HNZB 5IHXA 2CHFA 1CUYA 3WVNA 3X1MA 1QUEA 1K92A 2PFSA 4PYRA 1V9CA 2J33A 4YRNA 3SZMA 4EPVA 1EKXA 2ZYGA 3ZE7A 1SOVA 3DV0B 1O6CA 5TS2A 3EMDA 3U3RA 3QEAZ 1IEQA 3G0HA 2GS9A 1BVHA 3ZY4A 3QHQA 5BWMA 1CBUA 3PX7A 1L5MA 2ISQA 1NJ1A 1DB3A 1TYDE 3IPYA 4E5NA 2XMSA 2E4YA 2SECE 4R8LA 5IAKA 3I4CA 5FA5A 3ZX4A 4LFAB 1GUAA 1ZUWA 3EF1A 1LQTA 1VI5A 3IVGA 1VHQA 3OPYI 4KH1A 4XPZA 3DQQA 2PVSA 2H16A 5IABA 5J59A 3PRHA 4D96A 5DVZA 5JWOA 5FNVB 3FNQA 2HA6A 1WZNA 4TWZA 4MJ3A 3S6JA 1P2VA 3RW9A 4MP8A 5AM2A 4XI9A 1ESMA 4MYDA 4EY7A 2GK4A 1ZUNB 2EEZA 2AW5A 2P68A 2J45A 2BUBA 2R1TA 2YVKA 3AV3A 1W1UA 1PT5A 4LMPA 4U2BA 5CURA 1XVTA 1ND5A 3T6KA 5CBPB 3H0EA 2Z95A 3KKLA 2HWKA 1C41A 4P7BA 3X1XA 1VB3A 4R1LA 3LPAA 1YUBA 2AJCA 3H8WA 1RXUA 2OGUA 1KP9A 4JFAA 5D87A 3T15A 3LE8A 3AY3A 1ZY2A 1Z6ZA 1DCKA 2Y1CA 1BWSA 1AKMA 4BBPA 5CFOA 1MJHA 3ZKWA 3CISA 1EDZA 2XUQA 5B3KA 1GPWB 3M70A 3EGIA 4JEUA 1O57A 4MKXA 1S3IA 4GLFA 1RR6A 1DINA 3F49S 4HVAA 4LRWA 4JLSA 5A71A 4DL9A 1F48A 3CT4A 1NXOA 1R3UA 1YS1X 4I5DA 3RUFA 4ATNA 4D0RA 3HDVA 3W77A 5CB4B 1ADCA 4Z4EA 2WC1A 3BD9A 3L0SA 3BRWD 5TGDA 4O0MA 4NBUA 1E7SA 3U4QB 1P0IA 2JLWA 1KSHA 4OXRA 1K4YA 5U4XA 3MWKA 4UQLA 4ENQA 4J03A 1SQ5A 5F64A 1KZHA 2XOEA 1HK7A 2ZBUA 2GHTA 4U6SA 2P9JA 2P4HX 2AH5A 3J7AC 3DOFA 1MB0A 5MN6A 4Q4CA 2P9GA 4DEVA 4PGFA 2EAUA 1YJ8A 1GFWA 1E3EA 2O7VA 3E3AA 1N0VC 2MMCA 4S35A 1Z22A 3WGOA 4AT1A 5GQSA 4ER5A 4YRBA 3BILA 3E7FA 4UVIA 5EJ2A 4F2WA 5AM3A 3O0TA 1DS6A 3CH4B 4PPGA 5F1YA 4DW8A 2A0WA 2AZTA 4KFUA 3ZHQA 5EHQA 1W46A 4WE3A 1KK0A 3F9CA 3S1LA 3LQKA 2NV0A 4R68A 3K2QA 3SXJA 1P2BA 1LPOA 3LXUX 2NZVG 2FLVA 2RDMA 4JIMA 2W2MA 4C7BA 1AK9A 1F4PA 1GILA 1K3FA 1XD2A 4R1TA 5EWMA 4FFMA 4JI4B 1G9XA 2OCPA 5FTWA 1HE1C 4G0WA 4N03A 1NZFA 2P5YA 1YVRA 2A4MA 4J3FA 1MKYA 4HYQA 1ZD1A 2B3TA 2IZZA 2PANA 2EJCA 3HR7A 3V6MA 2GF2A 2BD0A 2YHBA 2QPTA 1P4JA 4AYTA 1G19A 2BRUC 3I5UA 1E3QA 3DL7A 1W0JD 4RULA 3HI4A 3PGMA 3K0SA 5BWCA 5DASA 2X5KO 4MDHA 4YRLA 3OMWA 5AXBA 4XWAA 3T3PB 1A97A 1T8SA 1GRCA 1F38A 1ZRSA 4TKLA 3H1FA 5TQ2B 4WDRA 4QDKA 1MMFB 3LP6A 3KOMA 4AJJA 1L9KA 2G88A 4NMHA 1ZW1A 1ZI9A 1E79D 2CWDA 1I1NA 3K6KA 3UWMA 1LQUA 4YT2A 5MGNA 2FPMA 2WQ6A 3LFTA 5G0WA 4L8VA 1V96A 3L6DA 3Q0EA 3RUEA 3B1FA 4PSVA 4BQRA 4GD3Q 3K1YA 3DV9A 1LRKA 4LYYA 2WFAA 4OHZA 5FTMA 4YCJA 1T6YA 2BFWA 4EFKA 5A2GA 4DSZA 1RBQA 4JJ7A 3FGZA 2C5LA 4QVIA 5EMLA 4FT4A 3DBLA 4JP3A 4I55A 3MJVA 1XWFA 4LDPA 3HMQA 2H2WA 4GE0A 1ONOA 2GCOA 3DHVA 3I28A 4JP8A 1OAAA 3D2AA 3B7GA 5CYGA 2P6PA 4GOMD 3ED5A 3KB1A 4PC7A 1KFCB 1YOBA 3IUSA 4YBZA 4KHZA 4ZCQA 5B2ZA 1EHIA 5DRTA 4MW7A 4CR8A 5CA0F 2IXTA 4LE1A 2GYWA 2Z5FA 1WG8A 4Z9FA 4EKIA 2HCTA 3TZKA 1S9DA 4HFRA 3TKYA 1MR3F 3L8GA 4RV4A 4E5KA 3KU4A 5F9HA 3IQZA 4BIMA 3WLFA 4D9JA 4Y9TA 5D3KA 2JH3A 3KYCB 1DQYA 3LC0A 3ZH2A 3CLVA 3PVCA 1Q17A 3KUKA 3WNZA 1Q0SA 1GVHA 3A1UA 4Y6QA 2PO5A 4ARVA 3VHQA 1BDJA 2NVBA 5JR3A 3EYAA 5AJXA 4BKUA 4V2IA 3ZCQA 1M6YA 3NNNA 1LBQA 1DXOA 1HE5A 1J39A 3AVTA 4Z1MA 5AHXA 2EX4A 3L92A 2C9CA 3BDVA 4WECA 1RHJA 4MHSA 4KX5A 5LL6P 4Z8XA 3LUBA 4YP7A 2VJKA 3TQHA 1W48A 3STTA 1Z0DA 3O4HA 2C8VA 2IHNA 4CR6A 1B1CA 1NX6A 2VH5R 3KT8A 3C8DA 4GZLA 2C77A 1LRJA 4CETA 1MIHA 4NULA 4Z7OB 3L7OA 3LQFA 2NO4A 3JWJA 1YKGA 4I1IA 5E8JA 4C87A 3DL0A 3OCVA 2I2FA 2WKRA 2R2AA 1YNOA 3KQTA 3OCYA 2A59A 4JIGA 4DHEA 5F4ZA 3AM1A 1M8JA 2HGSA 2R6DA 4KK3A 2P67A 5HZKA 4MW1A 2W7TA 3JATB 1QYIA 1O5OA 5I7SA 4N54A 3U44A 3G88A 1OGIA 3GJ8A 2R1UA 2AGVA 2CUZA 2ODBA 4ZEWA 4XB2A 1IPHA 3TSAA 3UO8B 1T8WA 3IB6A 3VHRA 5A1TA 1F5SA 3AUUA 5AKJA 4OI0A 4PRZA 4A9AA 1KRWA 1TXGA 2WJZB 2YTZA 5EWJA 3N9IA 3N76A 4HG2A 4NFHA 3NALA 1GG5A 1NPDA 1IEWA 1LLFA 1SIBE 3H8JA 3MMSA 5ALRA 1UAAA 2YWJA 3EX7C 2UUAB 2V1UA 3EGOA 1J0XO 4YLEA 2GHIA 2VDPB 2RH8A 3M6IA 4M9CA 3I9KA 4R3NA 2BGTA 2TSYB 3KQWA 3E84A 1RDFA 1L8XA 2CDRA 2ZE7A 4IM7A 5BO5A 3BGIA 4LNHA 3I6BA 2HRBA 2XMZA 5FTKA 1NIPA 1UBHS 2O2JA 1I6LA 4HPXB 4C4XA 1T9AA 3RRBA 4ZJPA 3E48A 4Q01A 1FMLA 4TMTA 1YL6A 3K5HA 3F1LA 1ONSA 1BZYA 2F6RA 4N7MA 3CPHA 2J31A 4PCUA 5GV8A 3TTSA 1XNQB 1M72A 4GO1A 1N4DA 2OESA 3RYHB 2ZQ5A 3IX7A 4FYXA 1IZZA 5AUPB 4UEJA 4JH0A 1TU0A 1E0AA 3R3JA 4BLPA 1I4EB 1PWZA 3DAPA 4F96A 2R7MA 1QZUA 2OZKA 2J6IA 2QUHA 4XWKA 3L8HA 3O93A 3FNFA 2NGRA 4D57A 4K2AA 3FLMA 1L0BA 3VDRA 1LRLA 1BYIA 3DFFA 3T1YB 2ZYRA 1L5FA 3V7NA 1KO5A 2CJFA 2P11A 4KQ9A 3SOPA 2RBKA 3W5IA 2PLNA 1XDDA 1RWXA 1MVNA 3B6ZA 1ZGAA 4EITA 2VZ9A 1QG4A 4N3NA 1IHYA 4JYPA 2I8LA 5G0UA 3T5MA 1QH1B 4D8UA 3O2NA 1FRQA 5KOHB 2XMDA 1H6DA 3WDLA 4XTCS 4HFJA 3B9RA 4Z2AA 3QEOA 1IWBB 1KYXA 3I42A 3MUNA 4X20B 1WCIA 2B6HA 2JLSA 3FAZA 5ECDA 4HDSA 4L9RA 5GWXA 2WKQA 3DWEX 4LJ6A 2QL5A 3RJ9A 2PM8A 4PEVA 1PFWA 1IC6A 2Q1YA 4E32A 4S1NA 2AG6A 4YLYA 1Z07A 3OO1A 3ADPA 2A92A 2I6XA 3C45A 3O9VA 5HMLA 2BMAA 5BRNA 3SU8A 3HK2A 4MV0A 1ECCA 4F9EA 2C9ZA 4HWTA 3LXMA 4LSWA 1CFJA 5CNMA 3DHNA 4F8JA 3IV6A 1PVVA 1ZYUA 4WOJA 4FE4A 4D02A 4OGLA 3TZHA 4HT3B 5C32A 4IDBA 1MC1A 2Y1GA 3OE7A 2IHBA 4O4JB 1JSRA 4QGFA 3E3LA 3CN9A 4O25A 3C24A 3AK4A 5KQMA 2DPHA 2J4FA 3FOZA 1KYZA 1M0SA 2ZPUA 1BQ4A 3FWKA 2FPPB 3WWEA 1FSPA 4FFVA 4CIXA 3GUVA 3ELBA 1R50A 4WBNF 3GBSA 1WUTA 1MPXA 2NU9A 2O7RA 2VS1A 4MKGA 4NSNA 4R2JA 2GPAA 3S2EA 3TLAA 5HGXA 3CSUA 1EP1B 1VL2A 1KDPA 4WCFC 3B9PA 1O87A 1SA0B 2Q62A 4EVIA 1KZ9A 5DM0A 1GADO 1KEUA 1VLMA 1P81A 1C3VA 4H0CA 2WFLA 2XHZA 1PR2A 3EQ2A 5K6AA 1TM1E 5DHTA 5LQRA 2ZRDA 3C2QA 2EP7A 4HK4A 4C7XA 4YJKA 1RHRA 4ZMRA 4BV2A 4HADA 2C7QA 2HXSA 3AERA 4MAAA 3BRWA 5KYTA 1CYDA 2OFXA 2BKVA 1MNQA 4JEHA 4PO3X 4RK7A 5M3BA 2A0XA 4E94A 5IRCD 4WNAB 3SWWA 4DG8A 5A5VA 1VYVA 3AJAA 4MRPA 4IJWA 2G3YA 5LA6A 3VHXB 2VP6A 3BRSA 4TMXA 3DZJA 1Q12A 3V4ZA 5JOQA 1VSTA 5L95A 2FP4B 3KPUA 4MQUA 3OJ0A 2BCEA 3W9BA 4TQ9A 4BVLA 3SZ3A 4UHHA 3VZDA 1B42A 3EVEA 4B3FX 4HS9A 3QVKA 1RZ3A 4WN9A 2IZOA 3H9JA 4QOHA 1X7HA 1DE0A 3RNOA 5B6PA 2H8GA 4O4LB 5DNWA 3RADC 2WU1A 4GYYA 3RYIA 1T36B 4AWAA 4TUYF 1JHUA 2QRLA 3WV5A 3ZWXA 4NJMB 5DP2A 3EOBI 4YWHA 5F23A 4XDZA 5A4DA 3VC7A 1JG1A 4F84A 5IJZA 1DWOA 4WV3A 1RPJA 2JHGA 1THGA 2BGJA 3QBTA 5BQXA 2QT9A 2MYTA 2YICA 4PGHA 3EEFA 4LZZA 1EE1A 3UANA 2QMEA 2PH3A 3ZV6A 4E1VA 2G9QA 3CB2A 4C0XA 4D74A 4EMTA 5IMSA 3ABOB 2IBTA 2RHRA 3WMGA 3PFCA 4PAOA 2Z09A 4KLNA 1YB7A 1Y7PA 3WKEA 1FSGA 4II7A 5HJ7A 3R7FA 2JC3A 1YC2A 1PQPA 4NU8X 3SSNA 2O8VA 1VGVA 2ZI7A 1NBIA 2HHLA 4FFPA 2HIAA 4D8VA 4L0DA 1GA6A 1XIVA 3UPTA 4S1OA 1NW4A 1E9FA 4G1CA 1BKYA 1AXRA 1NSYA 1Z13A 3LDAA 3P9CA 4L22A 1G3RA 3C8MA 3L18A 5EXPA 2PMFA 3FB4A 5J9FA 3HKDB 2G06A 4E5DA 4WESA 2OV1A 4B87A 4GSKA 1E79A 4N3BA 3BA1A 3JVUA 4YFVA 1GZ7A 3MB5A 1JKFA 1TIBA 2GWRA 1H93A 2R25B 1IULA 3KEMA 4G0YA 3REGA 3COSA 1W36D 3I2IA 4DY6A 3K5IA 1V11A 1XQWA 3PRYA 3U40A 3BULA 4ALJA 3AF2A 1A1VA 2DFLA 4XW2A 1NNSA 1L4FA 3FG9A 3LYUA 4PYIA 4A4DA 1XQ9A 2VK4A 1O08A 3KQVA 1ENYA 2DP4E 1Q1QA 1U04A 3K0KA 4HRXA 1W9HA 2B1RA 2FRDC 2OZPA 1KIAA 3Q2KA 3EAQA 5FBZA 4OH1A 5DGIA 3G8CA 2DH5A 1ZRMA 1KQOA 1S3FA 1IYZA 1ACMA 1LK0A 5LP6F 1NW8A 2X19A 5AJWA 1U28A 1VDMA 2CBGA 4DLLA 3PX2A 4PO9A 1W7AA 1Z15A 1VBNA 1A9XB 1QGUB 4YAEA 4EA6A 3EVCA 4GVLA 2JLVA 4P2GA 4V24A 3PHHA 1PTJA 2QX9A 1EFUA 4X54A 3AFMA 3LH5A 5EZQA 4KJXA 4LY3A 4Q1BA 4TL9A 2XKAA 1SVIA 1ZH8A 3A9SA 3F2IA 3AQIA 3Q6IA 4MUFA 3AFGA 5AK5A 1QZZA 4YMLA 2DUNA 3PENA 4KPGA 3WXBA 2W6ID 1QTIA 3BIJA 3EG9A 3MHPA 3H1AA 3I04M 4EPRA 3WDSA 1GQSA 1BX3A 2P0YA 2X3UA 4CFYA 3JAKA 5G41A 3OTHA 5BVGB 5CEEA 5BSVA 1KZ1A 1O96B 2QGNA 1X42A 4M3NA 4Q9AA 4UW9A 2XWQA 3VGPA 4E33A 2EZ4A 2EBWA 3CE9A 1X15A 3DZGA 2J9FA 4PBRA 5EERA 5G53C 5K0GA 4AJ1A 4G4GA 2OGWA 2I4NA 1FUIA 2JCVA 1HDZA 3DQZA 1XGKA 3PDWA 4M49A 4P7FA 3A7EA 4KH0A 5EYPB 4E5SA 1EFAA 2Q6OA 5HGJA 221PA 1UBMS 4IJQA 2ADMA 3VNVA 2NSHA 4RLFA 2VRCD 1MOZA 4JR2A 1DUSA 2Z30A 3N2KA 3OA2A 4WOKA 1W94A 5DDIP 1QLJA 5DW0A 3SYNA 4BGEA 5A4FS 5JNTA 1Y6FA 4OQXA 3RS8A 4WFQA 4K9LA 4F5DA 1QRUA 4PFQA 4G0VA 1RLTA 3L8EA 4JJ6A 3T7EA 1EAYA 3P9QA 3QVWA 1UWVA 5L4NA 4C7OB 1HEYA 1BHQ1 1TZCA 3BHMA 5T64A 3ZU4A 1ZMRA 3CRRA 4FE3A 5AESA 5FBLB 3VX3A 4EVQA 5C1BA 1VSBA 3TGPA 1NKTA 4B3RB 2VYVD 4D8YA 4H3VA 3C3CA 4L28A 4DMKA 3WGVA 3QJ5A 2PYIA 4UUBA 2DWQA 3DMRA 3M81A 3OG9A 5AICA 2UVDA 4A0SA 4W5QA 2F43B 3AF0A 1YKFA 3KJHA 4UCWA 5WRFA 3U3ZA 4CRWB 3GLIB 1ZVMA 2VOJA 2G1JA 4FPXA 4AB1A 2BI7A 4NVRA 2EU8A 3GGOA 3FTCA 1NJGA 2N75A 3CYFA 4DANA 1KJ9A 1AHPA 3KNZA 2EV9A 1MENA 1L4LA 2EFGA 3B60A 3I9NA 4L74A 3R3UA 3C6BA 1YHZA 4G8JA 4RFSA 4W6ZA 4WACA 2ZUSA 1X7ZB 5FT9A 3NLLA 3AHIA 3W4IA 3H5IA 3JASA 4KKXB 3I9FA 4RJ2A 4NENB 2Q8PA 2C88A 2BY4A 3K96A 2RB4A 1CUJA 5LZ5A 1M75A 3ZGNA 1L1QA 2BIFA 3KL4A 1V5IA 2FR1A 4O2AF 1KO7A 2ABWA 1J5XA 3KOYA 4YUWA 2QPOA 3BH7A 4RA9B 1ZK4A 3C7AA 3PUYA 4IHJA 4UNIA 5JSZB 3TAUA 1MRSA 5ALTA 3O92A 4UU0A 2ERCA 2PSDA 1W88B 4OATA 4I1RA 3GRAA 4IDGA 4Q1EA 3AYZB 4G0UA 4BQIA 4URVR 3FNIA 5JEEA 3W34A 1MV5A 2QRVA 4NMLA 2OFFA 5K8JB 3OWOA 3KKPA 3V5NA 4M0UA 2QTLA 2YL2A 4J76A 1I32A 3RHSA 4KQIA 3PI6A 2GILA 2OZLB 2WBLC 5EIFA 2DJ5A 5B53A 5EJEA 1FP4A 3STXA 3T5BA 4RTSA 4KK4A 4OYHA 3AXTA 5JROA 3LYAA 5A6SA 2FFJA 1Z28A 4EGCB 1MXFA 1WW3A 3IKLA 2BEVA 2FZWA 4IF4A 4ZDIA 2BSAA 4ZA2A 3UJ6A 5G1OA 4A8JB 1RYMA 4YJGB 3W9YA 1KEKA 1JEQB 1TRHA 4AJOA 3PEYA 3PA6A 2WJ3A 5A05A 2MINB 4AQDA 2IPLA 1JBQA 1P73A 1JLSA 1Z7GA 3OTIA 4HVCA 4UTVA 4V1CB 1ORHA 4K9QA 4TKUA 4U8HA 3EDRA 3RTCA 1NQXA 1XVLA 2CMGA 4ZT7A 2H57A 4JQZA 5LYJB 2KWIA 3DZCA 3H5AA 4NBRA 5H02A 4F2PA 1Q7BA 3PT9A 2EF1A 3JWEA 5CYOA 3CEHA 1OA0A 4GXQA 4LVCA 2FMIA 4PIMA 5G1PA 1PLKA 5EJ4A 3HP1A 1Y9AA 2CK3D 1JFVA 3H5RA 1MZVA 4HX9A 2DBYA 4QUEA 5EFOA 5KX5B 1RC8A 3GEPA 4NU5A 1GXSA 3LQ2A 4KC0A 5KC9A 3KYJB 1OAKA 1PLLA 3PNQA 4RU1A 5J40A 3DVLA 2I34A 4V0RA 4BX8A 3PXCX 2BFNA 1A88A 3SGLA 3B38A 3W79A 1O9GA 1Y3BE 2PGAA 2FSGA 5ECYA 1QIHA 2QM8A 3V4LA 3LX4A 5KYXB 4PANA 2OG1A 1R88A 4OUKX 1RJ9B 1E0KA 1AKRA 4PGMA 4X41A 1EE9A 2RGYA 1UADA 1PP4A 4ZCTA 4Y2TA 1EP3B 3SS9X 2X2PA 4ZIRA 4C21A 5ADUS 3MYYA 1RM3A 2HU5A 1ADGA 4RQBA 1UZNA 2CV1A 5JXWA 4GWKA 4CQJA 2G0AA 4F11A 2J4DA 1Q7TA 4KE7A 4RYLA 1Z6AA 3PQ5A 5MN5A 2QF7A 3WGLA 1U9ZA 1YJAA 2J8ZA 2ZAOA 4RGYA 4QVGA 2O0LA