3Q9NA

In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
138
Chain Sequence
ATRPIDGLTDEDIREILTRYKKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPNYEEVLGRKCYPSVLDIPDKVEVVDLFVNPAKAWRFVVYAIKKGAKVVWFQYNTYYPLAARQAGPIIVANRCMMREHERLLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A de novo protein binding pair by computational design and directed evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding, de novo protein
molecule keywords CoA binding protein
total genus 39
structure length 138
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3q9nA00
3KOUA 1MV8A 3ITKA 1ADBA 2Z5LA 2DTEA 3DZKA 2PZKA 2O23A 2ZIZA 1K0UA 1GQ2A 3CE6A 2JCVA 2CF5A 1E7RA 2NTNA 2FSSA 2X1HA 3HFGA 3H5RA 2XXBA 1N5DA 1PTJA 4FOOA 4ND4A 1Q0HA 5CFZA 1BW9A 2J6IA 3B1KA 4GBJA 4XYGA 2X23A 1K6XA 2R00A 5T8KA 5A02A 4PLTA 5I9MA 4CPDA 1T24A 3GVHA 1FDVA 3ZWOA 5B12A 2AQ8A 2VYVA 1WAMA 3PFWO 3V1YA 2RBEA 5CEEA 2P9EA 5L7YA 1OC2A 3GOHA 5IXYA 4J6FA 3FPCA 4B8WA 3DAGA 5EQDA 4Z6KA 2QQ5A 3N7UA 4M87A 1IE3A 4Z0TA 1ZH8A 4YRAA 2EERA 3GZ4A 3FWZA 2OMEA 4MJLA 4BO3A 1NX6A 4I5EA 2OXIA 4EYEA 3E6AA 4PRKA 1C1XA 1ZSVA 3V2HA 2FR0A 3WJ7A 4IZHA 1E1MA 2PD3A 2X0RA 1PL6A 3EZLA 3GVPA 4BUCA 4YT4A 4Y6SA 3AU9A 1B3RA 3L07A 1SAYA 1O9BA 3O8QA 4CMHA 6LDHA 4S1VA 4E31A 5ITVA 3KYDA 1NM5A 4R1SA 3GN1A 3LDHA 3VOSA 3DBHB 4QFDA 1IZ0A 3GUYA 4LVCA 4BV9A 5L4LA 2JCXA 3GG2A 4PLYA 3PK0A 1I2CA 1YVEI 2EGHA 4UUOA 1TB4A 1OBFO 1E3JA 2FRDA 3LVFO 4C7KA 2IYPA 4QSMA 3DBRA 2UUOA 1NTOA 1TXGA 3ZCXA 2O50A 4EEZA 2GGSA 2CFCA 3OBBA 1QYDA 3F3SA 3HJAA 3RIHA 1ZVMA 1NPTO 1R0SA 4FJ0A 5JY1A 1UZMA 1V3TA 1HSZA 2RCYA 4E5KA 4PZEA 4WNIA 3U4DA 3KEQA 2VHWA 2AQIA 3MJVA 3DFZA 4B3IA 4L4RA 4WEQA 3WNQA 1VRWA 5CHEA 3QWIA 3FBGA 3RJ9A 2V6BA 5JNLA 1KC3A 4B79A 4D45A 5A9SA 1PR9A 4Z9FA 5BSFA 1ISMA 4RF2A 4DQUA 2UAGA 1HE4A 3GVIA 5T57A 4CQLB 4AJNA 1EDOA 5BSEA 1ULSA 1LEHA 4WE3A 2GERA 2QRJA 4L4XA 3TJRA 1ZBQA 4PRLA 2AEJA 3AY6A 4D41A 2B5VA 2AE1A 3BIOA 4PLHA 1NHWA 1H6AA 3L9WA 3OSUA 5FFFA 4BO1A 5L4SA 3UUWA 4DBVO 4ZHSA 4FSHA 3K2EA 4YAEA 5DCWA 1NFFA 1O89A 3FPLA 4I9HA 4M1QA 2VOJA 2QHXA 1ZNQO 3E8XA 4I8XA 3ZWAA 2QRKA 4JLWA 4ZVVA 3ZWCA 3R6DA 2EF1A 4WASA 3VTFA 4XGNA 1U3TA 5JYEA 1Y8RA 4GX2A 1TVEA 1GEEA 5TJ9A 3EDMA 3RFXA 3KTDA 2Q49A 4Q9NA 1T4BA 1A7KA 5TT1A 1DEHA 1ENZA 3CPSA 4WCFC 1V3VA 3ON5A 4FCCA 1K89A 4JROA 3UCEA 1UDAA 4I9NA 5ER9A 3E9MA 4DA9A 1PJTA 3D3WB 4LSWA 1F0YA 3S2FA 4II2A 1I2ZA 1YQXA 3OFSA 4YRBA 1SB8A 1NAHA 4GMGA 1NQOA 2P2SA 2D2IA 1X0XA 2ZCUA 1RYEA 4ITUA 3GZNA 3JYPA 4EBFA 2YDYA 3IKTA 3ZNQA 3Q0EA 1VL6A 2J5RA 1YB4A 2YV3A 4LISA 3MZ0A 1VL0A 1AXGA 4MVJM 3ZU4A 5KTKA 3O38A 4E5YA 4HX5A 5DP1A 1L7EA 4DLAA 5IZCA 3LYLA 4PG8A 2PKQP 4FFRA 3IDSA 3U09A 1BRMA 4BNFA 1UP4A 2WD7A 3WS7A 2EKLA 3DOJA 1VM6A 1X0VA 2XPCA 3FBTA 3PDUA 4ZQFA 2G0TA 5EN4A 3RVDA 4DMLA 3RSHA 1GD1O 3K96A 5IDYA 2GD1O 4TRJA 5IDXA 2Z95A 3RD5A 3QVXA 1P1RA 3VPGA 3NT4A 1O5IA 2AQHA 3JQDA 1BG6A 1VE9A 3I6IA 2CF6A 2NACA 3H5AA 1SC6A 1AXEA 5TT0A 3AI1A 3QLJA 2Y66A 3SXPA 1IYZA 4RPKA 3WGYA 1DJQA 4NMHA 3UHAA 1YOVA 4A7PA 1ULUA 5KKAA 2O3SA 1H5QA 1Y6JA 5B4TA 4CLOB 4FDAA 1KVRA 4BMSA 5I7FA 1ADCA 2NLOA 3PJGA 3C1OA 2W2LA 3MJ4A 1XGKA 3JQFA 2BFPA 3ZU5A 5I9LA 3PP8A 3IUSA 1ZW1A 4KWHA 4MP3A 3U49A 3GRKA 1ZKMA 1P0FA 3W1VA 4YT5A 2UV8A 3PPIA 4DXHA 1M75A 1XYGA 2JD0A 1FDTA 2IODA 2E48A 3DZGA 4UULA 1HWYA 1GV1A 1EQ2A 3WBFA 4DYDA 3AFMA 1E6UA 3K5PA 4FC6A 1B16A 3W4KA 4YJHA 3ZWMA 2FY8A 2I65A 3KB6A 1HSOA 2AA3A 4R1TA 1G0NA 1C0LA 1F8GA 1UAGA 3I5MA 4GX0A 2X6TA 4NH4A 2C82A 2EG9A 2W2KB 3O03A 2ZQYA 1HYHA 1EUCA 2O2SA 3ICPA 3GN2A 4JP2A 4R41A 4GVXA 4UREA 1P0CA 1I3MA 1NPDA 4N5LA 1OFGA 5TJHA 3W8DA 3LT4A 4P4LA 3U4HA 5IJZA 1UXGA 1E3EA 3FRJA 2YV2A 4F46A 1GYPA 4E2YA 1VI2A 1OC4A 4K1LA 3F6YA 3CMCO 4J1SA 5IDQA 3O26A 3HSKA 2E6UX 4EW6A 1H6BA 3JQEA 3ZWPA 4HNGA 1EVJA 1YB5A 3VZRA 1M6HA 1E5QA 4K26A 1I30A 4GVLA 1MXHA 2EP7A 1D3AA 1JN0A 1UP7A 1Z6ZA 2VHVA 3IC5A 1EBFA 4IY1A 1ISHA 3C7DB 4O6VA 2X5OA 5F1OA 4CMGA 3IUPA 1QG6A 5DCUA 1SOVA 3AUUA 3ETEA 4NJMA 4R4JA 5B4VA 1JKJA 4PG5A 4NJMB 4L9RA 2IDZA 2H6EA 5JPIA 1Y8QA 1DIHA 2YHIA 4WJZA 1NR7A 1CEQA 2AW5A 5J23A 1BXGB 3C3XA 1X1EA 3QA9A 5LCXA 2BF7A 1ZK1A 4W9NA 1KEUA 1KY5A 3ZW8A 5KJEA 4B3HA 2Y99A 4CM7A 4U0JA 3RBVA 1H6CA 3E5RA 1HETA 4EJ6A 1V0JA 4LN1A 3DXFA 2DLDA 2FZEA 4IDGA 2HMTA 4AICA 1KERA 4NI5A 4ALLA 2OBYA 2EKQA 3KXDA 4JJIA 4W82A 5KVVA 4A26A 2OFPA 1QR6A 1P1JA 3I9MA 3RC2A 5AYVA 3TQHA 1GZ3A 1U9JA 4GGPA 3TZCA 4WKGA 3JSAA 1ZEMA 5A5EA 2ZTMA 5TSDA 3ROKA 4UAGA 3WXBA 1SEPA 2PNFA 3JQAB 4MVJE 5A05A 2J3KA 3MCVA 3MWEB 5L45A 5JE8A 1BWSA 3PZBA 2Z1NA 1B8UA 4KUHA 3C7CB 5L53A 2C59A 4B4OA 3ULKA 1V8BA 1TI7A 2Y0DA 3ASUA 2Q1WA 2EEZA 2V65A 4IZIA 4XD2A 3KO8A 5A3JA 4AJEA 5JXWA 4IINA 1BGVA 3H9QA 4TRRA 4NFHA 2DBQA 3PVZA 4TRMA 3F47A 3I4CA 2H9IA 4Q3NA 4Z3KA 1KEVA 1LU9A 1HDRA 2FSVA 2BGMA 3K92A 5IAAA 4YB8A 1PJBA 4ZQGA 5EPOA 4CUJA 1EDZA 2IZ0A 1J0XO 2EW2A 3HWRA 4GLOA 3V2GA 3G3EA 1JAYA 1I5RA 3VDRA 3D0OA 5ENVA 1NQTA 3DMYA 3LU1A 2WYWA 3D3WA 2BGKA 1Q0QA 1XA0A 1C0IA 1FK8A 4DQVA 1AHIA 1I32A 1F12A 4AG3A 1T1RA 4RZHA 5FEUA 2DBVO 4J1TA 2YYYA 4OL9A 1YWGO 4Q3AA 4Z9YA 5EIOA 1PJSA 3OETA 1TT7A 2YV1A 5CG1A 2VN8A 1PQPA 2B69A 3VTZA 3DWFA 3MJSA 4CM8A 1WDLA 4XQ9A 1JKFA 1QP8A 2Q1SA 5T8KC 4P4NA 5AOVA 4DPLA 1DLJA 1E7WA 3HHPA 4OSOA 4CJXA 3ASVA 5F5LA 1X7GA 1M67A 4MVJI 1F14A 2O4CA 5JO9A 3GMDA 3D64A 5BNTA 5ICMA 2Y05A 1EZ4A 1LDMA 4E30A 2J5KA 4GI2A 5KKCA 4KZPA 1QMGA 1BVRA 5L9AA 2IZZA 1D1TA 3GC6A 3QIVA 1ENYA 3DZFA 4NBVA 1NBOA 4XDYA 3K30A 3S8MA 2YY7A 1TA4A 5MGBA 4WEOA 1U7HA 1O95A 4MKRA 3ZGYA 5BQFA 3DOOA 3RUDA 3IMFA 3B20A 3E48A 1DRWA 1X13A 3E18A 1XQ6A 4MP8A 3OJEA 2B5WA 4PIVA 4IIVA 4A0SA 1ADFA 2QG4A 4IMRA 4TQGA 1E3WB 2CVZA 3NGXA 1DB3A 3ONFA 1P77A 5KJ1A 1O94A 4RJTA 2DPGA 4DWVA 2WWRA 2O4UX 3SX2A 4E2XA 5ITWA 2JFFA 2GR9A 3NUGA 1Z75A 3OICA 2H1SA 4FBGA 4IGFA 4C4OA 3CSDA 1DC3A 3K6JA 2D0IA 1Q7GA 3CZMA 3GQVA 1L1FA 4YJGB 3WGOA 3B1JA 4J43A 4CM5A 3KETA 2PD6A 4DC0A 4DPMA 2FHSA 4BVAA 2BRUA 3KEOA 1IHXA 3RUEA 3UFXA 2WYVA 3ZHYA 3JQ6A 4EI2A 3PLRA 1VPDA 4OQYA 5JW6A 2O3QA 1NHGA 4BNYA 4IMPA 1EE9A 3H3JA 5JC8A 1CDOA 3GFGA 5F5NA 2VNAA 3GVXA 1VC2A 3EUWA 3VPXA 4G81A 1DOHA 4A2CA 3AI3A 3OIGA 1Z82A 1GV0A 1HT0A 1PQWA 2PZMA 3DB2A 3IL2A 3DBLA 1C0KA 3QQPA 5C7LO 2FPIA 4R1UA 3ICCA 4YJHB 4P22A 2VUTA 1NAIA 4GH5A 4NPCA 1H94A 5THQA 3VVCA 1Y9EA 3QJ5A 2PK3A 3QWHA 3D4OA 1D1SA 2YW9A 1YKFA 5TGDA 3S55A 3V1TC 4CM1A 2VQ3A 2YUTA 3JD2A 1BDBA 4MDHA 2NUAA 3DFUA 2WSBA 3NAQA 1R15A 1GY8A 5A06A 4JGBA 4IGEA 5EJ2A 4CL3A 1R0LA 1I2BA 1HE2A 5C7OO 1BVUA 3SJ7A 4GX1A 1AUPA 4R1NA 3OJFA 4U6QA 3UICA 2RIRA 4KUGA 4BOYA 1EEHA 2UUPA 1AGNA 2DU8A 4EDFA 4CMAA 4DLBA 4W4TA 4YT8A 3ZWNA 3DHYA 5B1YA 3PHIA 1U5AA 1IL0A 3LC7O 1YQDA 1Z74A 2TMDA 1GZ6A 2PY6A 3DONA 3RCBA 2O7SA 2VYVD 1P9LA 1P3DA 4KWIA 3KM0A 2B35A 4CQMB 2C2XA 1WMAA 1T25A 2NV6A 4WPGA 1VJ1A 3KSUA 3WGGA 5JAQA 1U3VA 5DCYA 4CM4B 9LDTA 3CEAA 4XYBA 1HLPA 4E21A 4D44A 2D5CA 4PLWA 3STHA 7MDHA 4BNLA 1PJCA 3FNGA 5CEJA 2LDXA 2J3HA 4OH1A 2IE0A 3BMCB 2B0JA 4ZD6A 4MP6A 1P1HA 1GQYA 4ID9A 4OM8A 3QWBA 3DMTA 3NKLA 5F3RA 1R16A 3ABIA 3RI3A 4BNGA 4QO7A 1K3TA 5IZCC 2NSDA 4UEKA 3TZHA 3KSZO 1KBZA 3E9QA 1QYVA 3GPDG 3RQSA 3WLEA 4MVJP 4Q3EA 1UXHA 1YJ8A 1ZK4A 1LXCA 3LK7A 5I7EA 1DAOA 2D1YA 2R2GA 2GSDA 2VHYA 3TZ6A 1Y5RA 4FC7A 5FI5A 4LW8A 5TIIA 1R37A 2JKVA 1GR0A 5CDGA 1HDGO 2W8ZA 1BXGA 3INTA 2WM3A 3DOCA 3FR8A 4AFNA 4B3JA 1JLLA 4KTTE 5AVOA 1CJCA 1NR1A 1Q0LA 3K73O 2VYNA 1U28A 1VLLA 5IN5A 4WLNA 4BKQA 2NQTA 3ZWVA 4B7CA 3ZHZA 1FMCA 1JW9B 2ZTUA 4IBOA 2DBRA 3DL2A 3AK4A 5IXSA 1CQIA 3QY9A 1JWBB 2DM6A 2E49A 3D1LA 4LK3A 3LC2O 1X1TA 4M55A 5IF3A 3BA1A 1MFZA 1N9GA 1T2AA 1CIVA 1ZJYA 2DQ4A 4HFJA 4FS3A 1SMKA 1ZUD1 4B4UA 4BB5A 2GNAA 1V6AA 3ANNA 3QW2A 4RPGA 1GUYA 2JCYA 3K31A 3DDNA 2HRBA 2I6TA 4AJKA 1CF2O 4NIMA 3EHEA 3PDJA 4KDEA 4N18A 4HV4A 4AJ1A 5G0VA 4CLDA 4HY3A 2P5YA 4IDFA 7ADHA 3GDGA 4PLFA 1A72A 4BNNA 3PTZA 4X54A 2OOSA 2X4GA 1SPXA 3ZH2A 1GEGA 2J3JA 3PQDA 1FDUA 3WFJA 4YJFA 3JQGB 3DBVO 3F1LA 4Z9XA 5G4LA 1C1DB 1SB9A 2X9VA 2Y67A 3LT2A 2ZTLA 3C1TA 2D5AA 2GN4A 3WICA 2Y1CA 2OP0A 4O59O 1NVMB 4M86A 2HDHA 1X14A 4A5OA 3GT0A 4CQLA 1IOLA 2YFHA 4FFPA 3ZU3A 1U4OA 4G5HA 1VKOA 3GEMA 4LMRA 5T6BA 3WGHA 4YR9A 2CVOA 3VZQA 4PVDA 1S6YA 2DKNA 1LQTA 3BMQB 5G4KA 5KIAA 5KVCA 4NU5A 1H93A 1V3UA 2W90A 2DBZA 2VHXA 4ND1A 3WG9A 1JQBA 1Q1NA 2O2YA 2QYSA 1PGQA 2I3GA 2NNLD 1MG5A 1KYQA 1FXSA 4BNJA 3AI2A 2NVWA 1DLIA 3ONEA 1MP0A 4RDHA 3PJDA 1WNTA 1RJWA 3TFOA 3U62A 1IHYA 4PLZA 3MJCA 2HAEA 3RUIA 1HYGA 1B7GO 1LRLA 4AJPA 1I8TA 2BFMA 2PLAA 3HDJA 3R1IA 3VVBA 1T4DA 1Y7TA 3GEDA 1MX3A 3NV9A 3LZ6A 4CM3A 5JDCA 3ETGA 1AHHA 4DMMA 1KOLA 1H0KA 2V6FA 3EYWA 5EL0A 4RVDA 2PKQO 5IFLA 1Q2XA 2QX7A 3JQGA 5A3VA 3RUAA 1UZLA 1D4FA 1K6JA 1UXJA 3ZWXA 1NNUA 5TRTA 1NFRA 3TPCA 4NZ9A 4R51A 5DOVA 2OO5A 3NTRA 3I3OA 5CDYA 3I9LA 2AE2A 3GR6A 2HU2A 3JQFC 3VAZA 1XU9A 3K9QO 4OXKA 4W6ZA 4I1IA 5HA5A 1RM3A 5AXBA 3FI9A 1KVUA 1QYXA 3VKUA 2GN6A 3PEFA 2PGDA 1XHLA 4FQ8A 3PI7A 1E3IA 3PHGA 2EKPA 2DUWA 3ZV5A 2VRCD 4XRGA 3AUSA 5TX7A 1EMDA 4E2ZA 1BXKA 1R12A 3KRTA 5T5QA 3OA2A 4DTIA 4YACA 4KMSA 2Y68A 4ILKA 1U7TA 1ZO8A 4CR6A 4Y6PA 3E9NA 4MVJA 3D4NA 4FGSA 3GMSA 4OSPA 4CMIB 4Y8VA 5LC1A 2VWGA 1F8FA 3NT5A 4NNJA 1EFLA 3GPIA 3ZNNA 2ZYDA 3WGIA 4MVJG 3UH1A 1ISFA 1EVZA 2C7VA 4ZJUA 2ZB4A 5HTOA 1F17A 5BSHA 3JTMA 1HL3A 3QVWA 2PD4A 4J90A 2G5CA 2I99A 1A5ZA 4DLLA 4UUNA 1DAPA 4MOWA 3R3SA 4IS2A 1I24A 4ZQEA 5JS6A 1LSJA 3PLNA 4Y6RA 4B4VA 2NADA 4YAIA 4U5QA 4J4BA 3S2GA 1R66A 2ET6A 3WWZA 4BS9A 4CLHA 2AEMA 2ZJ1A 3CXRA 3WNVA 3UKOA 4C7JA 1E3WA 4ZU3A 1A7AA 3H9JA 3HQ4O 4IDDA 1KY4A 2GZ3A 1C0PA 3GRPA 5JMWA 2J5QA 3SVTA 1F06A 1RM0A 3N74A 2ZJ0A 3Q1LA 5I8WA 4E5NA 1I36A 1YXMA 3A9WA 3H9UA 3AOEA 3JQ9C 4GWGA 2HO5A 4RPHA 4BGUA 1Q7BA 1NQ5A 4E3ZA 4L0QA 1TT5A 3WYEA 1DC6A 4YQYA 4CMKA 1O8CA 2C20A 4BGVA 3VH1A 4I5GA 2JAHA 4BO8A 3DBHA 3OP4A 1E3SA 1PZHA 2VNSA 2ZQZA 4GKVA 4IJKA 1QXSA 2HMUA 3LC1O 4L75A 3VH4A 3MTGA 4IQ8A 1ADGA 3KSDO 1JVBA 1U5CA 4I5FA 3RUHA 4HFNA 5JDIA 5T67A 4IPTA 4LSMA 3ZDFA 1E5LA 3EK2A 3RKUA 2PH5A 3CKYA 4TWRA 4CM4A 1DBVO 3RBZA 4E6PA 3VPSA 4CV2A 3T7EA 1O6ZA 1QSGA 3INRA 3F5SA 2ZCVA 4BNZA 4J0FA 4CMCA 3EVNA 3PGXA 3WFIA 1OMOA 3NEPX 5C7IO 2GO1A 2HJSA 3UCXA 3JYOA 1YGYA 2D4AA 2FP4A 3PYMA 4QECA 1KETA 5FF9A 3DEYX 4WLFA 1T2DA 3BMCA 4BHTA 2J3IA 3P5SA 1CETA 4CODB 3PJFA 2OZPA 4UVDA 2VOEA 1UH5A 2IXAA 5DT9A 4CL8A 5L7WA 2EXXA 3MJEA 2P4QA 2VRBA 2I76A 1QV7A 2JFGA 2FR8A 1N1GA 2PGJA 2VT2A 3WQSB 2Y0EA 2CZCA 4Z3DA 1PZEA 1C3VA 4YJGA 3U4CA 1P33A 4RORA 4CR7A 1LTHR 3CH6A 3ANMA 3KYCA 5GZ1A 1N92A 4L4SA 2RHRA 3NJ4A 4J3FA 3OJOA 3EMKA 2FMUA 3S2IA 3D4PA 4R16A 1FF9A 2CDBA 3ENKA 4RVSA 3TNLA 3T7CA 3PRJA 4R9RA 5CPBA 4Q39A 1HRDA 2A4KA 1ISGA 5H83A 3WWYA 1DFHA 1NASA 2H5LA 3UVEA 3I83A 4O5OA 3GUCA 4I5DA 1E77A 3RFTA 2GASA 2BH9A 3T4XA 1JA9A 2X7HA 2J8ZA 4U8GA 4KTVE 1EUDA 4GWKA 2R6JA 3QVTA 1E92A 4GAEA 1O0SA 3VH2A 1XEAA 1WPQA 2JFHA 2R00C 5TF4A 3ROPA 3SLKA 5I7VA 5K9ZA 4K28A 2A35A 4RVGA 1N7HA 2BI8A 1LX6A 2ZB7A 3C1AA 4FIZA 3QWFA 4D0RA 5KJCA 5K6AA 2W4QA 4FW8A 4TZKA 2BLLA 1CRWG 2X8LA 3I9JA 4HFMA 5JC1A 5C5IA 1YDEA 2VZ9A 3IJRA 4CQMD 1DJNA 1JDJA 2G1UA 4TSKA 3LQFA 4FGWA 1U8XX 5EQFA 3RKRA 1K5HA 3QE3A 5A1TA 2NQ8A 1GUFA 4RDIA 4AJJA 4R3NA 2Y0CA 1HF3A 3ZWWA 4I9UA 3ZWBA 3TZKA 5HWSA 3X2EA 2GN9A 2JD2A 3AJRA 2VCYA 4J7UA 2IZ1A 3B1FA 2CMDA 1B15A 3WOHA 4DUPA 4GSKA 2HSDA 4IJVA 2VUSA 1LLDA 1ZEJA 1UP6A 4PLPA 3PFFA 2UYYA 2O48X 4CUKA 4O1MA 4F3YA 1PZGA 3A06A 3JQBA 4RLHA 1FDSA 1EK5A 1LDEA 1C14A 1E6WA 2I9PA 5IG2A 2W2LD 4OQZA 4NBRA 2CDCA 5CP8A 5CDUA 1PWXA 1PSDA 3QP9A 2I66A 1PEDA 1ARZA 5G0SA 4DIFA 1PL8A 4Z0PA 2GRAA 3D5QA 3L6EA 1JU9A 3M1LA 1MLDA 4YCAA 1A27A 3F4BA 5CPFA 4AJ4A 4XYEA 3SLGA 3T4EA 2Y1OA 3EAGA 4U6SA 3PZRA 3L4SO 4A10A 1KVSA 2B4QA 2FZWA 2QZ9A 3TSCA 3A28A 3G1UA 1BDMA 3GDFA 4BKOA 1BTOA 1Z73A 1ZXBA 2POQX 3O4RA 4ZRNA 4BNTA 1AE1A 1DRVA 3ONDA 1XIVA 4D3SA 3DZBA 2HRZA 4DBZA 4YAJA 5A9TA 4RPLA 1PGPA 3VH3A 1BW9B 1QLJA 1SO8A 1E7QA 1ZK2A 2H63A 5HBRA 4OMUA 1PGJA 2HK8A 3TWOA 2C54A 4ZRMA 2PV7A 4A27A 5JAIA 1A4IA 3MEQA 1HE3A 1W0CA 3ZI0A 3SBOA 3F9IA 4K6FA 4Q3CA 5ILOA 3Q2KA 1IB6A 1GPJA 4OHUA 5CG2A 1HLDA 1MFPA 4DPKA 3C8MA 3F46A 2X22A 1R6DA 4FR5A 5LDGA 3UF0A 3E03A 3P2OA 1WDMA 1YL7A 2NM0A 3E1KA 4NJOA 4EUHA 3AW9A 3M6IA 2WJPA 5TC4A 1B8PA 1NVTA 1XSEA 3ST7A 4L76A 1W73A 5B37A 4P38A 1A71A 1LNQA 1MGOA 3OF2A 3OJLA 1GPDG 2NVUA 2DUUA 4P8RA 4IM7A 2B4RO 4JBIA 1TEHA 1HKUA 2D8AA 2P9CA 3O8QB 3H4VA 4TZTA 2LDBA 3OIDA 1YOVB 4XIYA 5IN4A 4RF4A 2F1KA 2B37A 4AJOA 4BO6A 2WEKA 1HDYA 3DC2A 3RUFA 5BSGA 4BMVA 3QVSA 4NDNE 3NRCA 4AL4A 3A1NA 2EHDA 3FHLA 1G1AA 5JCXA 1KS9A 1S7CA 1WDKA 3RBXA 1X15A 4RCVA 1TLTA 2Q99A 3JYNA 3JD4A 3IAHA 5ILGA 1DSSG 1G6KA 2AXQA 1DO8A 4J91A 5JBIA 4K9DA 1MB4A 4E2WA 1PS0A 3DAFA 4KQXA 4J0EA 3OIFA 3VPHA 4KUEA 1RYDA 2X0JA 1P31A 4OO3A 3P7MA 4YJFB 3I9NA 1U3WA 3F4LA 3NT2A 5JAMA 3OEYA 3ORFA 3E82A 4IDBA 4ONEA 4YPOA 3U9LA 4BNWA 2W98A 3C24A 1WP4A 4AVYA 4PZDA 2X5JO 3QHAA 2I3AA 2Z1MA 4CQMA 5L40A 3BMOB 1NQAO 1XLTA 4MIOA 1A9YA 3K8ZA 2NU6A 4UVEA 4BIIA 4D3FA 1NP3A 4QEDA 3EZYA 3OQ1A 1PZFA 4Q3BA 1M76A 5L95A 1UAYA 4OAQA 5THKA 3RASA 4XX0A 5A04A 4H15A 1UXKA 4XYLA 3IS3A 4IDEA 4LCJA 4XKJA 1M6WA 1KEWA 3DZHA 4R69A 1U8FO 3LF2A 1PJ3A 3M2PA 1XG5A 3RROA 1NPYA 5IDWA 3PQFA 4IJWA 3AY7A 1Y5MA 3OA0A 5JDCC 3ZV6A 3WSWA 2DVMA 3V5NA 3NJ8A 1ONPA 4H7PA 1ZK3A 2FPGA 4N54A 3DAPA 1IULA 4FFMA 2PTGA 4XB1A 1YL6A 4AJIA 5L4NA 5KOIA 1N7GA 4J4TA 1K2WA 4WGGA 1WWKA 3ROQA 3U3XA 1U1IA 4IIUA 3KYCB 3H3FA 3GDOA 5EMHA 2YJZA 3WIEA 2HK7A 3HE3A 4NFSA 1MC4A 2QZZA 5A5FA 3G0OA 1VSVA 4ESOA 2OUIA 1RPNA 2Q1TA 4GKBA 4J1NA 4L8VA 4XB2A 2EGGA 3VC7A 5GY7A 4AJLA 4K6CA 3PHJA 4BO9A 1X7DA 3RWBA 5MDHA 4II3A 1JWAB 5JO0A 1ISJA 4NK4A 2NU8A 4J16A 1DFIA 3GZNB 4XYMA 1E1LA 4R01A 1ZZEA 1XCBA 4CM9A 3PIDA 3PXXA 4FB5A 3UN1A 1HDOA 3GG9A 2VUUA 2EJWA 2P9GA 4CR8A 2CVQA 2NU7A 1GUZA 5F21A 5BNIA 2A94A 2DFVA 4R3WA 2AG8A 3AUAA 4YDRA 4F6CA 1HTBA 2EP5A 5HRUA 4ZN6A 1I3KA 2SCUA 1NVGA 4H3VA 5A03A 3W4IA 1H6DA 2WD7B 2VZ8A 3ITDA 5KNLA 4QT0A 2I67A 3GA0A 4UVHA 4CLRA 1K6IA 4Y67A 1SOWA 3WX0A 1N1EA 3GF4A 4PLVA 1UDBA 5DOZA 1BMDA 2RH4A 4BQPA 1Z7EA 3I52A 2JHFA 4E12A 4ALMA 4M49A 3HDYA 1H9BA 4MINA 1DHRA 3ZV4A 5KJ6A 4ZA2A 1EUZA 2IEBA 3QVOA 3F1KA 1DC4A 1Z7BA 5DZSA 1PGNA 4CMBA 1R4NB 3WB9A 4XCVA 1JKIA 1R0KA 3FF4A 3FTNA 1R4NA 4YA6A 4EGFA 4JK3A 3KVOA 1LDGA 2ZB8A 1J5PA 4JCOA 3QV1A 1OAAA 3I9KA 2O3TA 3HNPA 4J2HA 4J2OA 3Q9UA 4JQCA 4UVIA 5F1KA 4BNVA 1JAXA 5U1PA 1CYDA 5L3ZA 1P44A 1LQUA 1I3LA 9LDBA 1MG0A 4FFOA 4FFNA 1E1NA 2V6MA 3BMQA 5G4KB 2O3JA 4GGOA 2F00A 2HKIA 3M1AA 1PJ4A 2Y1FA 2Q2WA 3H2SA 1HDXA 2IXBA 3C7AA 3GGPA 2IRWA 4O0LA 3KZVA 2Q3EA 4JP3A 4ALKA 5GZ6A 1A4UA 5CEFA 4J9VA 1DIGA 3U4IA 4Q3DA 2X9GA 1DIRA 2JL1A 3IJPA 4MKXA 4A73A 4ALNA 2OORA 4IDCA 1XU7A 1WZIA 3DBRB 4JJFA 1QYCA 2VWPA 3UGKA 2W2KA 3KV3O 1EQUA 3WGTA 1L7DA 1YE3A 3HFSA 2GLXA 2Q50A 1T2CA 1PQUA 4YQZA 5DNAA 3H6KA 5G0WA 3HB5X 3G17A 3WMXA 4HADA 3NTQA 3GNSA 3OECA 1AN9A 1B8VA 2ZKLA 4BNHA 2BFAA 5ICSA 2C0CA 3MOIA 4CMEC 5AQ1A 5JFOA 1T2FA 3H5NA 3BMNB 1LSUA 4TKMA 4BO7A 1ISIA 4RVUA 1XQ1A 4YWJA 2VZ0A 1DHTA 5BT9A 3D3EA 2BMAA 2FR1A 4JX8A 2X58A 3UOGA 4O63O 3TOZA 5DULA 4QX6A 4RGBA 1WMBA 1EE2A 4RVFA 5EERA 1YB1A 4RVHA 4J7CA 2EWMA 3JQAA 5EINA 2Q1UA 3NTOA 1I10A 4XWYA 3O9ZA 3JCZA 5JCJD 1OOEA 1PIWA 4YAKA 2PFGA 4UVGA 5TQVA 2BHLA 8LDHA 1UUFA 1I01A 2VT3A 1U4SA 2AEFA 3VPFA 4IXTA 4W7HA 4FPXA 1HE5A 3Q6IA 4I08A 5BR7A 1GL3A 2Y1DA 3HDQA 4IJUA 1P1KA 4BNIA 3W8FA 2FPPA 2ZB3A 3MOGA 5COQA 4CM9D 4CV3A 4TVBA 1KVTA 1XDWA 1NWHA 2YFQA 3S2EA 1B0AA 5ADHA 2NTVA 1HDCA 2BELA 3GHHA 1YBVA 5KVQA 1B3BA 1WLYA 4JBGA 2OGUA 3UXYA 4MVJH 3JQ8A 2QIOA 5JAZA 2QW8A 3BMNA 3G1TA 1DXYA 3NDIA 3W6ZA 5ER6A 1SCUA 2V7PA 3KYDB 3NDRA 1H2HA 2C5EA 3G49A 5GMOA 3OHSX 4CMIA 1LI4A 3JV7A 2AMFA 2PR2A 2FOIA 4R5MA 5B4UA 5JCJA 1ZMOA 4E33A 3AM3A 5I9NA 1LLCA 1ORRA 4BO5A 5LDHA 3SEFA 3BHJA 3JQAD 3MJTA 4NBUA 4IQGA 4CMJA 1E7SA 4NU6A 5AXCA 2E82A 4BKPA 3IP3A 4YTEA 3HZZA 1YL5A 3IQDB 3OM9A 2RAFA 4UEOA 4E5PA 3L4BC 3ROMA 2VTEA 1CWUA 3KUXA 4PFJA 1VJTA 4Y9DA 4NK5A 3W6UA 1W4ZA 3Q11A 1SNYA 5KCZA 2QRLA 1PS8A 3WQRA 1ZK0A 1EBUA 4ZICA 3IP1A 4G65A 2DC1A 3GNTA 1PL7A 4CM8B 3CMMA 4U7WA 1GAEO 1YO6A 2A92A 1CQJA 4BO0A 4U0KA 4NG5A 3SC4A 4BGEA 2EJVA 3GH3A 5COBA 1KVQA 1IUKA 3WGZA 2DTDA 2GUGA 3BMOA 1Y1PA 1C1XB 4XGKA 4XQEA 1PJQA 3V2UA 1XKQA 4BO4A 3I9OA 4LCEA 3WMWA 4XRRA 2DAPA 2IYOA 5JMPA 4FOSA 5I7SA 3D5TA 4XDZA 4ZQBA 3CINA 1ZSNA 1VL8A 4RPJA 4DYVA 2G76A 1WVGA 2P5UA 3BHIA 4D79A 3V8BA 3B70A 3MWDB 4XEHA 2C2YA 3WBBA 3H7AA 5U9CA 4E5MA 1SEVA 3CZRA 3HN2A 1H9AA 1GU7A 3OH8A 2VRCA 3IIEA 1ZJZA 2B4TO 1MUUA 4ALIA 1LSOA 5CAEA 3FCOA 4J7XA 4WECA 1ENOA 1WW8A 2CNBA 2Y1GA 5FWNA 3WDSA 3HB4X 3DTTA 3TL3A 5KWEA 3H65A 3L0DA 5U4QA 3IOYA 5DP2A 3EY4A 3P19A 4RZIA 5IZ4A 3ZV3A 3AU8A 2E4AA 2WE7A 1YDWA 4HP8A 4PCVA 3JD0A 1IY8A 4EEXA 1ENPA 1ZMTA 3JD1A 3L4BA 3U0BA 3TDKA 2HCTA 3PQEA 2Q2VA 2OL4A 1LC3A 1HEUA 1PS9A 4BNXA 5TNXA 3VHRA 4URFA 4BKUA 4M54A 2P68A 1KC1A 1T2EA 3W4JA 4CV1A 4OKNA 3TZQA 1J6UA 4WLVA 3ZN2A 3EGOA 5HS6A 3ENNA 4E4YA 4D46A 4DREA 3B6ZA 3LLVA 4DRYA 4XR9A 3VKVA 3AUTA 4M89A 2PH3A 3I1JA 1G0OA 4XJSA 1ONOA 3WTCA 2GZ1A 3PIIA 4WOKA 1BSVA 2C5AA 4J4HA 2Q2QA 4S3MA 3DBLB 1T26A 1EK6A 3AM5A 2O7QA 5DBFA 1VJ0A 4JXKA 3HADA 4PVCA 4MIYA 4CLOA 4PG6A 1RWBA 5L7TA 1E1KA 1SBYA 4GL4A 5HM8A 4TRNA 3ZWYA 1ML3A 1I33A 1ZFNA 3JQBC 1E6EA 4FD3A 3I6QA 4BL5A 3GHYA 3PWSA 1MA0A 3IKVA 1FDWA 3L6OO 3L77A 1DFGA 2ILTA 3M2TA 5G2OA 4KQWA 3DMTC 3BTOA 3CUKA 5DBGA 3UCFA 4BMNA 4EJ0A 2G82A 2B36A 3W8EA 3WIDA 3UW3A 3DO5A 3RJ5A 1GCOA 1U2DA 1GQQA 1XELA 2XXJA 1H2BA 2VHZA 3TN7A 1LRKA 4CLXA 3MTJA 3ZZNA 1YONA 1YBMA 4D42A 2RH8A 1LA2A 2C7GA 4YEDA 4B4WA 3TRIA 1OZAA 1I0ZA 4AJHA 3Q2IA 5I8ZA 2PGLA 1DPGA 1DRUA 3COSA 1MXFA 3OJ0A 4EUFA 5AXDA 2HMWA 2C29D 4CV0A 3Q9NA 2FN7A 2GF2A 4RV9A 3R3JA 3VDQA 3NDJA 4KDFA 3GFBA 4BB6A 3P2YA 2HMVA 2PWZA 1P1FA 2OP1A 3ANLA 3GK3A 4KP7A 1PJ2A 3LF1A 1QYWA 1YRLA 3KYBA 4YJDA 3OQ6A 4GMFA 4DVJA 4AJ2A 2OHXA 4Z0HO 4R5HA 4WK6A 3A14A 4HBGA 1XWFA 1RM4A 3KBOA 2X9NA 4NFYA 3DHEA 3FNFA 2Q4BA 4W99A 1W8DA 1WZEA 4FN4A 3U5TA 1P45A 5DN9A 3LT1A 3Q3CA 3BTVA 2CUKA 3AOGA 5DDIP 1UJMA 2VTDA 3K2BA 4E32A 3FN4A 1N2SA 2EIHA 3RUCA 4YXFA 3WTBA 2PZLA 3WYCA 3DR3A 3RU7A 4RF5A 4CLEA 4A03A 1GTMA 1EVIA 4EITA 3F5QA 2YQ5A 1E7MA 2ZK7A 3FR7A 4E0BA 4BV8A 1LLUA 2HLPA 3GNQA 3OMLA 3FTPA 4CM6A 2X5KO 2BFOA 2X0IA 2IEDA 1ID1A 4H16A 4IQ0A 4PLGA 4IXWA 5ES3A 1B14A 3WSVA 4INAA 3I23A 4WCDA 2BI7A 2GYYA 1R4MA 4QO8A 5CDSA 4GX5A 2Y93A 4PGFA 3VZPA 1UR5A 3JD3A 3H2ZA 3TOXA 4ALJA 4WUVA 3WYBA 4QTZA 3ETDA 3JQCA 4UUPA 3TF5A 1LRJA 4ND3A 2WD8A 4CLRB 2CDAA 3DHNA 4FFLA 4CUZA 4F45A 5FI3A 5DF1A 4LGVA 4XZ3A 2PA3A 4YYZA 3GAFA 2WMDA 2WTBA 3WLFA 4JN6B 4WLOA 3WQQA 1PJLA 3WGQA 5JYDA 2VYND 2QYTA 3C85A 4QQRA 3DZIA 3QRWA 1LC0A 5A4DA 1DC5A 2EV9A 2PZJA 4GPD1 5EESA 5JY6A 2Q46A 1P1IA 1NXQA 2HJRA 4TVOA 1ZIDA 2DTXA 5K0ZA 4WCFB 3JQ8B 2WYUA 1YS4A 4MO2A 1DDOA 1XR3A 4WCFA 2JD1A 4E13A 2JHGA 4L73A 1CERA 1SZJG 4NHEA 2XF8A 2DT5A 1ZSYA 2PKRA 1PGOA 1LUAA 1FJHA 3BYZA 4YVFA 3FSRA 1KIFA 1NYTA 1B26A 2UDPA 4D43A 2X86A 3JQ7B 1GZ4A 2BD0A 4NBWA 2GDZA 3RC1A 4ND2A 4OYRA 3JQ7A 3BHMA 1NFQA 3FNEA 4ZGWA 5GZ3A 1GYRA 3N58A 4D0SA 2VWQA 1V9LA 3EVTA 3UAGA 3ZNOA 1U2GA 3S1LA 2HK9A 1OI7A 4M8SA 4EZBA 4XA8A 1C1DA 1NWCA 4JJGA 1YH3A 3RAJA 2Q45A 4JBHA 4IUYA 3PHHA 4XQGA 3HN7A 2ZYGA 5C3MA 1T1SA 2P91A 4WLUA 1Y81A 4L74A 4B7XA 2UVDA 1J4AA 4IS3A 1E7YA 4HUJA 3JYLA 4CMEA 3V1UA 4LMPA 1P74A 4DIBA 1JTVA 4WNCA 1GCUA 4DIOA 3QWAA 1M2WA 3GAZA 3EC7A 1N8KA 4NBTA 4RQUA 2ZTVA 4OXYA 2AHRA 1D8AA 1D7OA 3ZU2A 5DBIA 3X2FA 3JYQA 4N5MA 4ROSA 4QXMA 2NWQA 2XAAA 3GGOA 4ND5A 1HZZA 4FJ2A 4TKLA 1DIBA 4XR4A 4YAGA 1PWZA 5G0TA 3DZJA 3GVCA 1BHSA 3H9EO 2GZ2A 4DGSA 4Y98A 2NTJA 3AWDA 2AG5A 4W9NC 2YZ7A 3PWKA 4QFCA 3SJUA 2C07A 4BNUA 3WR5A 1HDZA 2VWHA 4R68A 5C37A 2YDXA 4XGIA 4OJNA 3INGA 4HXYA 4PG4A 4PZCA 4BO2A 1MC5A 6ADHA 3ZHBA 3KHUA 3H8VA 2OBNA 5L51A 2FWMX 1LDYA 1IPEA 1QRRA 4YT2A 1HXHA 3RFVA 2D3TA 1PR3A 3EW7A 3PJEA 5T64A 1W6UA 1Y8RB 1IZ9A 1LBEA 1UZNA 3NGLA 3ADOA 4RF3A 2O3UA 3ADPA 3BTSA 3GY0A 1HZJA 2G17A 4OOEA 5A9SB 3GGGA 3RC9A 1V35A 4OOFA 1J49A 4NQZA 4MVJF 1LJ8A 4N7RA 4UUMA 5JDIC 3PYLA 3LT0A 3I4FA 4LRTB 1N9GB 4GQAA 4BKRA 3KLMX 2WDZA 3JQ9A 5COAA 1LSSA 2TMGA 2A9FA 3AM4A 3HG7A 4JNKA 5H81A 3FNHA 2BGLA 2E37A 2V6GA 4DL9A 2X0NA 2HQ1A 4HWKA 4OKIA 4B8ZA 4RO0A 5BNFA 1M66A 5TLSA 1LDNA 3PWZA 3E5MA 5H82A 1EFKA 4ZQHA 4IDAA 1B2LA 3BTUA 4W7IA 1LLQA 5ENDA 4N5NA 3AFNA 1JVSA 1UDCA 2GPTA 4MPDA 1RKXA 1QORA 4XQCA 1QKIA 4GSLA 2XOXA 4PN3A 1Q7CA 4BQRA 2JJYA 1U3UA 3GLQA 2DPHA 3CIFA 4XJTA 5HS4A 4YRDA 4P4GA 5G0UA 1Y9AA 4OIMA 3GEGA 1YBAA 3BZUA 1WXDA 1E3LA 1X7HA 3NYWA 1RM5A 2NU9A 3OQBA 1E0DA 2GCGA 1KEPA 3AOEC 3WJAA 4HNHA 4KOAA 4LVUA 4UEJA 1GDHA 1VKNA 1BXZA 4XIJA 2NVUB 4DQXA 1UXIA 3FD8A 4D3DA 3R0IA 3NX4A 3BAZA 1TT5B 3BXXA 3PYXA 4BNMA 3FWNA 4GLLA 2CSUA 3RU9A 2DFDA 3DQPA 1ONNA 4OXNA 4WLEA 2HMSA 4RL6A 2HUNA 4RQTA 4J9UE 4F6LA 4TMFA 3HUDA 4HKTA 2GN8A 1PU2A 3ZNPA 5KVSA 1GFSA 1IPFA 4FJ1A 1YJQA 1I3NA 1R4MB 5AXAA 4RLSA 5FYDA 5F1PA 2YHUA 1PX0A 1Z45A 2EW8A 2D59A 3CTMA 3PHLA 4TROA 3RC7A 3LSYA 2CD9A 4R54A 1YQGA 5K6AC 3VZSA 1A9ZA 5KJFA 3DTYA 4BGIA 3D7LA 1GYQA 1VSUA 2Y1EA 5TS3A 3L6DA 3OEWA 4JIGA 4EUEA 4BNKA 8ADHA 4PLCA 3G79A 4WOJA 4DC1A 2B83A 4HFRA 1Y8QB 2YHIB 1EVYA 1QLHA 5A9RA 2Q4EA 2ZYAA 3QSGA 5JSFA 4LRSB 4R9SA 4B7UA 4G2NA 1QV6A 4YBZA 5JLAA 4J49A 4QUKA 2WE8A 2AQKA 2JAPA 2P4HX 2NVBA 2RHCA 3KLPX 3HDHA 3L9XA 3PGJA 1LDBA 3ZW9A 3A4VA 4MKZA 2BKAA 1GADO 3ZHXA 4EJMA 1DIAA 3H9GA 2I5PO 4NR0A 1ZCJA 5CDTA 4J1QA 4OGWA 3SC6A 3LLSA 3AY3A 2O3RA 2ZATA 4MIEA 2YQ4A 4PG7A 4MVJD 4D7AA 2CY0A 1HYEA 3TFQA 3TL2A 1ZXLA
chains in the Genus database with same CATH superfamily
3KOUA 2O0JA 3FCCA 3N0TA 1MV8A 1WSBA 2DHEA 5D87A 1RMYA 1TVKA 3FYUA 3TQIA 2JANA 1EWVA 1FDRA 1Z39A 1FFGA 1S7GA 4IRXA 3MWGA 4H18A 4L8GA 3HPQA 5K0LA 3VC1A 1QGDA 3FMOB 3RREA 1E9VA 3OFND 4PS1A 5HKLA 3IVAA 4K3UA 4UM9D 3SEQA 1O5TA 2FSSA 3LY7A 4GC5A 3H5RA 2QRMA 2QRGA 4B31A 4A3SA 4W63A 3C6MA 4CE6A 1V48A 3AB3A 3JY6A 5GV7A 1IOZA 2XUZA 1QF9A 1Z4KA 2XNCA 3B1KA 4GBJA 3VR5H 3I61A 1KDRA 1DAIA 1NBIA 5T8KA 1ICIA 1YJAA 3H1EA 2P41A 3GVHA 1QF6A 4KJXA 3C4VA 1J23A 2XODA 3ZWOA 3AG6A 3GBVA 1ZU5A 2FLKA 2Q0QA 3FTQA 3PFWO 4MRAA 4KHPB 1YR2A 1P9OA 2OBFA 5L7YA 2QTCA 4FNMA 1ULBA 3FUWA 1AQNA 1XRMA 3FPCA 3HRKA 5ALIA 3HLYA 1OTHA 2VP0A 2QQ5A 4M87A 3QBTA 2YWRA 1P19A 3AL0C 4YRKA 3KZOA 2OAQ1 3BS4A 4Z5XA 4I5EA 1Z06A 3UMFA 1C1XA 2CLFB 3LQYA 5K5EA 2W6JD 2X0RA 4EX7A 5GONA 2QR3A 3GJQA 1B3RA 4UKDA 3K70D 1SAYA 1O9BA 4L6CA 2YW2A 4CMHA 1TK3A 4R2HA 4TM8A 1UPCA 4C0HA 2H5EA 1DMSA 4PZYA 1QU3A 2QQ0A 1Y89A 4MPJA 3H1BA 1VCNA 4KLRA 1NM5A 3CW9A 3G13A 4F71A 1ZIPA 4P35A 1KOFA 3BC1A 3L0SA 3GN1A 4BV9A 5BV8A 4KAXA 3JX9A 3QTLA 1ZH6A 4LVCA 2GCEA 2VTKA 1JHXA 3PUIA 4QFDA 5P8WA 3T7RA 3V4PB 1BWRA 2CXNA 3GG2A 4PLYA 1I2CA 5J9FA 3KE8A 4EFLA 1VCHA 4LOHA 3TLEA 2C4HA 3U61B 4BBZA 1SIUA 2IYPA 4GPAA 4HWTA 2QD2A 3CX4A 3DBRA 3H84A 1NTOA 4X6LA 1G98A 2PZFA 4BU0A 3BWYA 2Q5LA 4EEZA 2CFCA 3RYTC 3OBBA 5E1MA 3KQQA 1QYDA 2BL4A 4H7KA 4ZI5A 1U81A 3DBOB 3DULA 3G23A 1XKTA 1FYEA 1G1MA 4F8JA 1YR7A 5SY6A 2J85A 4FJ0A 4C3VA 5JY1A 1TQ4A 2AIRA 3CS3A 2GFHA 1L3CA 1YBFA 5EZ6B 3RO7A 3NETA 3V33A 5DNUA 3OCWA 3HJBA 5EMMA 5ESWA 3VMFA 4WNIA 4NCHA 3U4DA 4IEEA 2J7KA 4ML3A 8GPBA 2I1QA 2AQIA 3SS7X 4EUSA 4WJKB 1H4TA 3MJVA 3DFZA 1NJ5A 5IJ0B 5JPDA 4L4RA 1WV0A 3B48A 5D5QA 3D6MA 3WNQA 1CXZA 1E2EA 4HLCA 3CBGA 2J9RA 1PQ4A 2W8BA 4YIKA 2GJ8A 2ACVA 4JKIA 4KBFA 2V6BA 1KC3A 4B79A 1XQVA 4RF2A 2UAGA 1SQ6A 1X39A 4R8SA 1W75A 4CQLB 5F51A 4A6XA 3K1YA 3O3MB 2HO4A 3LOUA 3LH5A 3BGWA 4PO1A 4YFYA 4BCCA 1MEEA 4P54A 1ZM9A 5KZMB 2PQ0A 3HY6A 4D41A 3AY6A 3L6BA 4Q24A 4GZLA 1Z8HA 4PR0A 1WRBA 3HU5A 5L4SA 1TLLA 4JV5B 2HM7A 3R7NA 5HMMA 1N4AA 3ZV7A 3FFBA 1KIMA 3FPLA 4I81A 5DCWA 2VOJA 1EX7A 1TEZA 3ZTTA 4F4DA 4WZBA 2W4MA 4YUVA 4PCUA 3QELB 5HIAA 3GWZA 4UBMA 4PQEA 1X1CA 4I8DA 4JLWA 3GV0A 4ZVVA 4WASA 1H3FA 3BERA 4RS3A 1EB9A 2PKEA 3NDPA 1MAWA 4C76A 1TVEA 2PMCA 2XGMA 5FBRB 1GEEA 3S5JA 2QBYB 1GRRA 3QV2A 4FTWA 2RGUA 3G85A 3MMNA 3RFXA 3KTDA 1T29A 2QK4A 2Q49A 4Q9NA 1T4BA 5TT1A 5DBOA 3K4QA 2WPDD 1ENZA 1JJIA 2XTMA 3AILA 3CRZA 1QK3A 1XHFA 3WGKA 3HVHA 4WCFC 4OF4A 1OV4A 4FNAA 3D3KA 4TPKA 2WT4A 3DP7A 2DPLA 3HWX1 3TAHA 2YZMA 4ZEVA 2DBYA 4II2A 3H1PA 2E21A 3UK6A 1ML4A 3KU4A 2OPBA 3P9SA 1NW5A 3SOPA 5BRJA 1KO7A 1RNLA 4Q66C 1TVCA 2G3YA 2C4WA 2P2SA 2ZCUA 4XXHA 4B8YA 1JXQA 2BFCB 4MWOA 4URYR 1Y37A 4XWGA 1U9IA 5SZHB 4MWTA 1PV1A 4IMJB 4ODIA 3K70C 2C1XA 3FTCA 1KJ8A 3IKTA 1EDBA 2ZXFA 3FHJA 2HLDA 5JQGB 5EUBA 2J5RA 2CKDA 1YB4A 3KX2A 5DNEA 2YV3A 4TSFD 4YH1A 1AXGA 5KTKA 5G41A 2WI8A 2Q9UA 4HX5A 5DP1A 4E94A 5IZCA 3LYLA 3FROA 4NLLA 1MJ5A 1M9NA 3IDSA 4ZZ3A 3U09A 1UPTA 3DMPA 1M72A 2IVZA 3K4PA 3ZIAA 4WUTA 2KX7A 1TX4B 3RH0A 1XTSA 5EN4A 2G0TA 4M1TA 3RVDA 1QRTA 2REQB 1QIDA 1J1ZA 1UFRA 1Q0ZA 2FETA 3OLVA 5BN4A 2H11A 2IXEA 2HC9A 5CA1F 1GD1O 5IDYA 3IV6A 1VGVA 2HX1A 2FUEA 3LUFA 4LHYA 4TMZA 4W5WA 5IDXA 2BGGA 1O6FA 4FYKA 4TQUS 4ZAXA 3V97A 3EEOA 1K97A 1XA3A 4JLJA 4AX8A 2JCBA 3JQDA 5J47A 3DBIA 1CJSA 1BG6A 3T3MB 4N3AA 4YCSA 2R4UA 3FSEA 2WWFA 1CP3A 3KKLA 3I6IA 3G0IA 4FS8A 3QTTA 1AXEA 5B3KA 4U7JA 4V0QA 1IYZA 3KZNA 4RPKA 2FZ4A 4M0UA 4TX1A 4L5JA 2R1TB 2ZQ5A 1EFHA 5LP6F 3ZLTA 3CUYA 3KD2A 4EW2A 1ULUA 5KKAA 4ZVSA 1PJZA 2O3SA 3VHLB 1CK4A 1BWQA 1OXUA 2I6UA 5L3RA 3X1YA 4CLOB 5LKRA 2BW0A 3HKDB 4BMSA 3MUEA 2C2GA 2L69A 4EPWA 2NLOA 5BV1A 5CB8A 2H8KA 2CNLA 3LIPA 2HF8A 1OYWA 3IBGA 1F1JA 3JQFA 1J25A 2BFPA 2NP6A 2ZIUB 5CAEB 5I9LA 3PP8A 3BILA 1OZHA 4JT2A 1G8PA 3IERA 3PD7A 4MP3A 1ZKMA 4EZIA 1XAGA 2IHBA 3QENA 4LGMA 1XYGA 4LSZA 4B6QA 5KDOA 3IAEA 1NBMD 2IODA 4N7BA 3M5DA 4HLUA 4HNQA 1NJ6A 1E1YA 3STWA 1U3CA 4EY7A 1GRVA 2CFTA 4DCJA 3K5PA 4OHZA 1XHEA 4ZCIA 1U90A 2O5CA 4YJHA 2FZCA 4GPIB 2JLQA 2QNIA 3ZWMA 2FY8A 4YJKA 3SKVA 2JRCA 3CVOA 1OYVA 4IQFA 1C0LA 1PUXA 2QSJA 3CUTA 5EJIA 1ZL2A 1DKQA 3R5HA 2PX6A 3UK1A 4DUZB 4LZPA 4AF7A 4HGZA 2I7XA 1Q17A 2EC5A 1EUCA 3PSHA 1JV2B 1P72A 2YHAA 3GN2A 4KXWA 4R41A 5DHAA 2VRNA 1I3MA 4ZZ0A 5LBUA 1QAMA 5TJHA 3SHOA 3W8DA 3BDVA 3W5CA 3DE3X 2CLEB 3UB4A 4I1RA 5AP9A 1TTPB 3LT4A 4FX2A 3VYUB 3VR5D 4YYEA 3G02A 1GZHB 3LP5A 5HGXA 5FL7D 1VI2A 3WY9A 2XNJA 3O74A 1EUYA 1S4MA 2D0PB 1S2LA 4AAYA 5LMCA 1VI5A 3JQQA 5FOWA 3CMCO 5F7OA 1T8YA 3O26A 3DT6A 2VP6A 2PT5A 3AHDA 2YXPX 5BPFA 1DX6A 3FNBA 4K26A 1XAJA 2E89A 3MK31 4HQOA 1G8KA 4GVLA 1MXHA 1CZOA 4MSUA 1UP7A 1QH9A 2Q5CA 1CQXA 3A4YA 3QYPA 4J0CA 5FOSA 3T15A 1T9HA 4X95A 4MUMA 1CYEA 3DEHA 3KOZA 1YF3A 1VKZA 2A9JA 3JRNA 4KXXA 5DCUA 5EKSA 2KBEA 1TNDA 4HAYA 4C0JA 2QN9A 2R11A 4JC5A 4F3NA 5B4VA 4UU0A 1NLUA 4MX8A 4L9RA 2IDZA 4ZZIA 5JPIA 1U8EA 1YRYE 4Q7LA 4UNSA 1JH9A 1U7PA 1OTYA 4EHHA 2VK2A 1CEQA 4JJKA 4EEKA 3OJCA 1GCIA 2EG5A 5K0JA 3P2KA 1ST3A 3I92A 3COPA 3ONVA 1GUDA 1NN0A 1WD5A 1ZGZA 5CW1A 5LCXA 2PT6A 1ZOLA 2H7YA 3H86A 4PHTA 5KJEA 1JSCA 1NBMA 4M99A 4X7MA 4CTKA 4AZ0B 2C4MA 3EC2A 1HUQA 4CM7A 1W4RA 1JR3A 4FB4A 1YMUA 4QU5A 4PHGA 1C8VB 1SQ0A 1HETA 4NCXA 1V0JA 3ILHA 3MERA 1L5LA 4B3FX 2VSNA 1JMVA 2E1RA 2IIBA 3BWVA 3ADKA 4IDGA 6GPBA 5JEEA 1H9CA 2OBYA 4JJIA 2EX4A 2RB4A 4YO8A 1XROA 1GT91 3NIGB 1M1UA 3UK2A 5EJ5A 1KNQA 1UBMS 1W4LA 4L9WA 1QR6A 3RC2A 4A26A 1UOQA 2IW1A 4DT1A 1JWLA 1GZ3A 1VECA 5KYKA 3EQ6A 1SBNE 2Q3DA 3SE0A 1DUIA 3EWSA 3A4NA 3QI7A 1K88A 1RPAA 3VZCA 3CH5A 1R9JA 1V96A 2GBCA 4JH0A 3ROKA 2IYTA 4NJEB 4S0XA 4UAGA 1BJTA 3D2CA 3CCFA 1SEPA 2VUHB 2CDNA 2EQAA 3MCVA 3UAYA 2HV9A 3DDWA 3MWEB 5AD1A 4TLBA 1R1DA 2GEFA 5AKLA 3HVRA 1WU8A 3GLRA 1YB7A 1B8UA 5LNK1 3FPSA 3GA5A 3ZGVA 2V1XA 4BKMA 3E2PA 1K9VF 4B4OA 2UYQA 3ULKA 1V8BA 3WLKX 4C4PA 3MB5A 3PEEA 4JZYA 3K5WA 3HACA 1G20A 1IATA 2EEZA 3GNLA 4ZVTA 4EJ2A 5A3JA 3BL6A 3USCS 3QZUA 3WQHA 2ZI7A 4IINA 1ULAA 3H9QA 4U2CA 2DBQA 2QB5A 2SBTA 4WOPA 3ET5A 2H9IA 4Q3NA 3GRZA 3ZIAD 4Z3KA 4JSYA 1JB1A 2WMOB 3MAJA 4WQMA 2FSVA 3K92A 2BMWA 4LZOA 4YB8A 3W3AA 5EPOA 3V6LA 2DLCX 1MRNA 5FBLB 2IZ0A 1J0XO 1OVGA 2A5FA 4LY3A 2FWBA 3HR4A 3JPYA 4GLOA 2PG3A 3AESB 1QP7A 1WUKS 5JS2A 3PUYA 1MQAA 1RAFA 2JJ1A 3DMYA 3HK2A 1KPGA 4ARCA 4UCXA 1K7SN 1RWKA 2WYWA 3D3WA 4WY8A 3GEEA 1ABFA 5KYNA 3K8OE 4MV4A 4OI0A 4IWNA 5AKHA 4AT1A 2XUKA 2XTAA 3QFSA 4HGPA 1ULTA 5E38A 4MITA 5BVGB 1Q1AA 4DLWA 1F12A 4ARSA 1SXQA 5LXTA 3WHPA 1FVFA 2COKA 3LJKA 1YWGO 3MTDA 3TSWA 3UAZA 1PJSA 3KK0A 3I2HA 1TT7A 4JBXA 2IHZA 3O2JA 1AKVA 1T8WA 3TL6A 5IF9A 4LHVA 5C18A 5T8KC 2WTEA 4CJXA 1EFCA 5WRFA 5TPZD 3NH6A 4MVJI 3N9IA 2I6QA 3NWEA 3KD3A 3D64A 1GPYA 1YZLA 4KPFC 3VNAA 4KKXB 2Z8ZA 5I5GA 4RDXA 2WC1A 3I6YA 1QMGA 1S96A 3K0AA 1D1TA 1KK2A 2QM7A 3DZFA 2EIXA 1DQNA 1NBOA 2V7BA 3IAXA 3JATB 4MUKA 3V8RA 2VP2A 1K4YA 4PIMA 3GPLA 2HUPA 4NCKA 4L2IA 1W93A 4MKRA 3KALA 2CV2A 4AUEA 1X74A 1GTZA 2CJXA 3GP5A 5FEMA 5GIPE 1TQHA 2H31A 4F7DA 2XQJA 4DV5B 5LXTF 1DRWA 1RKVA 1USUA 2GLUA 3I0ZA 1TCUA 1ILEA 4Q02A 2C4UA 2B5WA 3EXHB 1CQJB 1B1AA 3LLUA 3T3IA 4A0SA 4IMRA 2BJWA 2QTMA 3N75A 4TQGA 2HN9A 3HTXA 2CVZA 3BSSA 3F8WA 2Q4DA 3KUCA 1YGPA 1R6VA 3NGXA 1HMPA 1JQJC 1P77A 4J0KA 3QSYA 3WWPA 4RJTA 3D2AA 2QU7A 2RK3A 2WWRA 5IAJA 1R0BA 4TTJA 4X8HA 4E2XA 3O4VA 1N2HA 3R3XA 4RJIA 4C9BA 4JY7A 3A0UA 4PGAA 4C4OA 2QTNA 3QNMA 3CZMA 3GQVA 1U6IA 2WAOA 4LXIA 3K0SA 2FSUA 1V7PC 5BQ5A 5KTPA 3QEBZ 1V1MB 1UWCA 2E2WA 3CGWA 4I3GA 5IASA 5A3SA 5ISMA 5BNZA 1FSFA 4DPMA 4BVAA 1KWKA 2HB6A 3N0RA 1IHXA 3O5AA 4UDNA 2WYVA 3RUEA 2WOJA 1DCMA 3UFXA 4ENVA 2BAGA 3DEIA 3M5WA 2XNDD 4L28A 1P5RA 1EEXB 3PS9A 3Q85A 3EFEA 1TCCA 4BNYA 2FOXA 2GN0A 1EE9A 5LQKA 3H3JA 6YASA 5JC8A 3H42B 3KJFA 1CDOA 1WEKA 3COWA 3GFGA 3QXXA 3G89A 2BJHA 4J0HA 4LY0A 4QHSA 4UHCA 5GVSA 4MRVA 3VPXA 4BPRA 2QLNA 2IH5A 3NBFA 3BH7A 1Z82A 4UW9A 1ESCA 2PZMA 3VKFA 4BGDA 2YIJA 3KWJA 1C0KA 3SJAA 3WGMA 4CEHA 3ICCA 2Q6VA 3WK4A 1PT8A 3MPOA 2PUCA 5KQRA 5HZMA 4P22A 2L18A 4BEJA 1N5JA 2HRDA 4K9NA 4NPCA 4ZAGA 4D9BA 3EF1A 4ZO4A 5AVKA 3F5FA 1OROA 3QJ5A 4BMCA 2M6LA 4KQHA 3KT0A 1SBTA 1YKFA 3P2JA 1P4JA 4WADA 4Y0AA 2ZITA 3UHOA 3V1TC 4E3WA 3JD2A 4MDHA 2NUAA 3EXEA 4E07A 4KR0A 3T0GA 3QXCA 2LTAA 2R1VB 1LB1B 2IHTA 3Q98A 3CRQA 2NU7B 3IA7A 4ZYZA 1A76A 5EJ2A 4F1JA 1A9XA 1R0LA 2W2MA 4LNUB 1BVUA 5F77A 3SJ7A 2PBRA 3MOSA 1J0AA 1AUPA 4H6XA 3OJFA 2FCAA 4OJYA 1XPOA 3OQHA 1G8YA 5DTJA 4KUGA 5IW8A 1L5NA 1LK5A 3AUXA 3IQIX 2FZ5A 4YP6A 3T3PB 2CYAA 4YCNA 4YT8A 4YIHA 1XFAA 2V7VA 4DARA 3OZAA 3PB3A 1M1YA 5B30A 2QE6A 3ZDDA 3UWKA 1QUEA 3I2YX 3LC7O 5IM5A 1YQDA 1W5TA 2O7SA 1P9LA 2VTVA 3LIIA 2MSDB 4KWIA 4B6JA 2VJMB 1DU4A 1R8JA 3IHKA 3PC4A 5C52B 2UZ4A 3C7KA 1SKQA 4YLYA 4MDYA 2LKDA 2ODBA 2QLJA 1AQIA 4Z4IA 4BAUA 4N12A 3CT6A 4KGZA 1JDTA 4WPGA 1VJ1A 2PRZA 4NNPA 4UZEA 5JAQA 2X9LA 4CM4B 2I7VA 2R6GA 4XYBA 1QQ6A 4E21A 5ESDA 4LWPA 1JZSA 2WU0A 3NNDA 3VISA 3AIKA 1SJ9A 4CU5A 3NHAA 4YQEA 4ARBA 4HTAA 4BZXA 4WT7A 4Q9IA 2J3HA 4OH1A 2IE0A 4PR3A 4RD1A 2O2DA 4RD0A 3FOCA 2E4UA 4D97A 3LFHA 4M1MA 4AO6A 3MPUA 4I36A 4ID9A 3RS9A 2CVPA 2QA5A 2CUZA 4I50A 5F3RA 3UV7A 3OQJA 1L1RA 1FMFA 1FFWA 1OWOA 4QO7A 1G291 2V9ZA 4BNGA 5EXXA 1RRPA 3NB0A 4Y9TA 5GM1A 5LZ4A 1TM2A 1KBZA 3RQSA 5SZJA 3WLEA 3IBYA 5KTSA 1JEQA 3CLSD 4PM4A 3IVGA 5IHPA 2R8PA 2Q4RA 4Q3EA 4RSRA 4BJ1A 1GUBA 1K4MA 1XLWA 2PIAA 5ECGC 1LXCA 2AL7A 3P52A 1EX9A 2R2GA 1P6XA 4KFTA 2GX6A 4LWQA 4B75A 2GSDA 1AKUA 3LX4A 4LJ5A 3GLGB 2X42A 2PTHA 3L1VA 1Y5RA 2QAGC 2QL9A 2TMKA 3NALA 3ZK8A 5FI5A 4BB0A 4RADA 4C0QC 1R37A 1GR0A 2CCKA 1FP6A 3QKSB 1YI0A 4AFNA 1BXGA 3DQQA 3QUCA 1JLLA 5AVOA 3KVNA 1Q0LA 5AUQA 3LQ1A 3T7AA 3RJMA 4MGKR 2NQTA 1RAEA 2PWPA 1KJQA 3CC8A 5EOVA 1A98A 2N46A 2XMPA 4B7CA 3GUHA 1TLFA 3ESAA 3ZHZA 4COKA 1RJDA 2G1KA 1NBEA 1ZOSA 3C4QA 2AYYA 3IIMA 3FVRA 4L8LA 4PSDA 4EVQA 2J0EA 3OPYA 5EZ5A 4BBAA 1CQIA 2YRWA 1JWBB 2DM6A 5CLLA 3U7FB 3D1LA 1CUYA 4ZP1A 5HM6A 4U2BA 1IXRC 4LV5B 5IF3A 4CEJA 1P60A 1P5ZB 3BA1A 1MFZA 1T2AA 2HXGA 5H4HA 3T06B 1CIVA 5CM9C 4ZJYA 3LX6A 3ZDCA 4IDPA 1BXRB 2FF5A 3RJTA 2I91A 5H8WA 1ZUD1 3T9FA 4BB5A 1JFRA 1IXSB 1G7RA 3I73A 4TWZA 4X6XA 2RHBA 3QW2A 4RPGA 1GUYA 2HMAA 4ZVNA 3HO8A 4OATA 3WRXC 2I6GA 4LG1A 3TGWA 1LZLA 1JJBA 4J16C 1CUBA 2BMFA 1OJ7A 2I6TA 2WDPA 4PYLA 4Y30A 3I6MA 1CF2O 4NIMA 4YAOA 3ADBA 1AVTA 1JTEA 3EHEA 4KDEA 4N0PA 4L0CA 2JGMA 4N18A 4JJZA 3VYSB 2HA7A 4AJ1A 4HY3A 1B6TA 3VO1A 1H5NA 3NDBB 1UXOA 3L8EA 3M6VA 4IDFA 1A72A 1XTZA 1FJXA 4BNNA 4R8RA 3PTZA 4BTEA 2BTOA 2WAYA 4XSGA 4FHFA 3WZMA 1NW9B 2EFYA 2C2BA 3MCTA 5DX0A 2P77A 4BRUA 3SZOA 2J3JA 4FUTA 3PQ4A 4O2LA 3JVIA 1OREA 3BFVA 2IVFA 5ES4B 2QKYA 4CKWB 3V8EA 3QLUC 4MAAA 1C1DB 1G2QA 3IAS1 2X0FA 4JB0A 2OD9A 2P78A 2Y67A 3JZFA 3LT2A 1U02A 4C87A 3JRXA 3O94A 1GO2A 5KBYA 1I7DA 1RMTA 1ZIXA 2DY1A 3LBHA 2OP0A 2ZRAA 1UPBA 4NBNA 3RRMA 3UNXA 1M0EA 1NVMB 4FYVA 4PBSA 2C03A 4ZU1X 2XDAA 1OB5A 2QNBA 4IJ5A 4CQLA 5DU2A 1KA9H 3RK4A 2YFHA 3LUBA 3EXIB 3ZU3A 1U4OA 1XC7A 1VKOA 2WF6A 3SSOA 2X5XA 4DUGA 1BFKA 4EOGA 1TEXA 5HZKA 3E7FA 3IDQA 1LQTA 2A0KA 1QCYA 4P3OA 1JHYA 5EGSA 2DBZA 3HXOA 4LJ6A 4QDXA 5FAXA 4G9EA 3G0BA 5EQJB 5JHHB 1JQBA 2R6HA 2A7QA 1PGQA 4QEKA 4DDWA 4H08A 1MG5A 1KYQA 3SXUA 3AI2A 3NTXA 1PDOA 3L8HA 4NESA 1Z0IA 5FUXA 2O8BA 4DHWA 3PJDA 3KCQA 1CJVC 3ANXA 4HDQB 4G07A 4IWYA 4MAMA 1RJWA 4GM4A 1V8ZA 3IUEA 3O8CA 4PLZA 1T5IA 4A23A 3MJCA 3QG5A 1FTQA 4QJ5A 3KKEA 4Y2TA 3WL5A 5IVHA 2C84A 1X94A 2PYDA 4GR5A 4OLFA 4RIHA 4GZ5A 3VVBA 5DNWA 3NVKI 3BH6A 2D1FA 3KYIB 4JLDA 4F85A 1R0XA 3LZ6A 2OR3A 3NV9A 3LPCA 3QOWA 4DCGA 3P96A 4W9MC 3NHYA 1AHHA 4DMMA 4US0R 3V42A 1Q77A 1H0KA 1QJ4A 4YJ2B 4U3JB 3ZS8A 4C0KA 2RHLA 3RUAA 5CR9A 1HT1E 3LECA 2WIGA 2YXDA 1OFUX 2O2HA 1NNUA 5TRTA 3WLIA 1NFRA 4K8OA 2G1PA 3TPCA 4X8LA 4NZ9A 4R51A 5A4IS 4CGYA 3PQ7A 4P5PA 1V8OA 4MV5A 1FPMA 5KNDH 2O59A 3GR6A 3BMXA 4Q4AA 3VAZA 3HU3A 3IQWA 3FFAA 3DPUA 3O6VA 4JYCA 4OXKA 4W6ZA 4BATA 4Y2QA 1FUKA 4I1IA 5ALGA 3SYLA 2UKDA 3ZOZA 5HA5A 2RB5A 2WJGA 5JQGA 2RGBA 1I5OA 2A4MA 1PFKA 2A5GA 3PPYA 2XVXA 4TXLA 1PLLA 4W1SA 1KVUA 5DCLA 3TRJA 3MGGA 1RBMA 3VKUA 5IUNC 3ETCA 2PGDA 4RHEA 4C0AC 5I4KA 4RGYA 2A9QA 1RR6A 3PIRA 5A7FA 1KTVA 2DUWA 4NBLA 1VOTA 4XRGA 4E2ZA 4B32A 3HFRA 1CIJA 1VL1A 2O05A 4KMSA 4ND6A 2Y68A 1L9KA 1AC5A 4PNPA 3WIOA 4UBOA 1ZO8A 4Y6PA 3D4NA 3UTCA 4UUAA 4Z1MD 3TRKA 4RA6B 3OFVA 2B7BA 3PKJA 1C3XA 1CR2A 1YMVA 5AHOA 5LC1A 3USES 2EYQA 2JFOA 3WKDA 4X64B 2Q28A 1JDUA 3QKRB 4K9OA 5JBNA 2OV1A 4MVJG 3UH1A 2IEGA 3BL8A 1EVZA 1E96A 4HB4A 3UMJA 2VP3A 1TZMA 1R50A 1TMKA 1UC5B 2WMNB 1F17A 2FW8A 4M9ZA 2O7VA 3ZVRA 1REQA 2DR0A 1DAFA 2PD4A 3I28A 4J90A 4YAFA 2PZEA 1CUFA 3Q0TA 3MVEA 4FBMA 3E27A 1ZP6A 3TRFA 4KSCA 1VHWA 1S2OA 2ATCA 2F1HA 1VG0B 1B43A 1E9AA 1I24A 4KN5A 2JPDA 1RE0A 1LSJA 2BEUB 1KU0A 2ZSKA 1KOJA 1X92A 2XJ9A 4J4BA 1U80A 3ZDZB 2QPLA 3VU0A 6REQA 2PCLA 3I76A 3AONB 2TSYB 2Z3VA 4QYTA 4W9RA 3SBDA 1YQTA 3UKOA 4IH9A 3I01M 1ABBA 1A7AA 2IOFK 5JO0A 4TTIA 4WFQA 1P0IA 5JMWA 4EO7A 3SVTA 3L79A 3P32A 1R6AA 1XJCA 3N74A 4O5AA 3Q1LA 2B7CA 3EVAA 3CXUA 3JQ9C 4PSKA 3AOEA 1SXHA 5H5JA 1ZVQA 4RPHA 1SU4A 4BGUA 4PHCA 1TAHA 4RELA 4L0QA 3JW8A 1ZGJA 3FBWA 4YJ2F 1RJ9B 3CTPA 3AEKA 3IAM6 4CCYA 3ER8A 3CLTD 1DQPA 3B5JA 4OHFA 4UE6A 1OT5A 2PX0A 3QKIA 5BWOA 1UFVA 3A9SA 3N5CA 4M6WB 1WCWA 3OZGA 3TZBA 3LHKA 4ZV4A 1PZHA 1IY0A 2ZQZA 3C74A 4AXXA 9MHTA 2HMUA 2JGNA 2VYCA 4L75A 4KRFA 2IUFA 1L8LA 5ALUA 2VJOA 5EEHA 2HEGA 2IYZA 2WJYA 3GJ7A 2C8LA 4LC9A 3S7ZA 2QU8A 5K0BA 5D3QA 2BRUC 3RT9A 5JDIA 2G9UA 1E5LA 1OI3A 5CX1A 4E1AA 1YJCA 2V96A 2W70A 1DX9A 3RKUA 4PZAA 4DLZA 4E6PA 4ZDJA 1U0SY 2ID7A 5B7QA 3F5SA 1H8EA 4CETA 4BNZA 4KWTA 1VE3A 3IH5A 3OJWA 1FTNA 3MQ4A 3RGWS 4J0FA 2AUMA 3J7TA 1W36B 2ZT7A 4X71A 121PA 2ZWPA 2IWHA 1EP1B 4UBNA 2A0WA 3LT5A 3MTEA 4CTMA 2GO1A 1NMXA 3FMIA 4TVKA 3UCXA 2AFHE 2IYXA 4C3UA 3PE3A 5LB4A 5KX5B 5D51S 5FF9A 1U1DA 4MA0A 1T2DA 2P6RA 3AHJA 4KK3A 4QM6A 2E4ZA 4UMDA 2GCOB 4HBZA 4MI9A 4F56A 2P79A 2VOEA 4HQNA 3VI4B 4DR1B 1WB9A 2JFQA 1RXEA 3LA6A 3RSFA 4ZIRA 3DD5A 3N6VA 5L7WA 2X8JB 4LNUA 1KAEA 4PQGA 5TQJA 2PUFA 3HJTA 2I76A 3O4JA 2VDVE 3CNOA 2PX4A 1C9EA 1G42A 1ZJ5A 1ZWLA 2GLTA 4PHHA 1N1GA 5J40A 4DSUA 4FBLA 3U7GA 3W3ZB 4EW1A 4M76B 2Y0EA 2AYZA 1QIHA 4FDTA 4H7DA 1IUPA 4HWSA 1BJRE 1P33A 4LE0A 1YV9A 2J6CA 3QLTA 1QOPB 4KE8A 1TYAE 4ZEOA 3EEQA 5AJWA 4CDRA 4DEXA 3ANMA 5IK2D 3AJAA 3V6MA 2R96A 4DQ0A 1FVHA 1Q11A 2ACEA 3D4PA 4I50F 1FYWA 4P82A 4WOBA 4IP0A 4FYPA 2CDBA 3R76A 4YCDA 1NIPA 3N7TA 4PSCA 5T3UA 2AR9A 3EE6A 4DMKA 2QJTA 4RIEA 5KTMA 4NAHA 3AJ8A 3BL5A 3DE5X 3PRJA 4X3PA 5J43A 3ET4A 3ELYA 4LJ9A 2A4KA 1ZUWA 4YUYA 1KK3A 2HPHA 1P80A 2X15A 4EPXA 1PZXA 1E2LA 2LVBA 2ZE7A 1HG1A 3KHSA 5KCMA 3TLYA 2H5LA 1N6HA 4ZVRA 3UWPA 2QMHA 4RKYA 2YJ3A 4YAUA 4I5DA 5LOVB 3F9RA 1SUEA 2B1IA 4JT9A 3T4XA 5BSUA 4PAWA 2NTEA 5FR1A 1QIFA 2C8KA 4U8GA 4JLOA 2JH3A 4GWKA 4M37A 1A8IA 4GAEA 1E92A 1W5AA 2EZTA 2J4DA 2WUEA 3IELA 3VH2A 4TZ6A 3WK7A 4RVNA 2O8CA 4N3BA 3ETHA 4KMRA 3O73A 3ROPA 5K05A 4MV1A 3EIEA 3IUYA 2Q2OA 2A35A 4ZYLA 2W42A 2B94A 3W1EA 4ER0A 3I8XA 1QIJA 1LX6A 4FIZA 4AY4A 2CL0X 1J06A 4QBFA 1PV2A 1R74A 4KIJA 2C04A 4DEYA 2D3WA 3TTSA 2W4QA 3EF3A 1UK7A 2GVZC 2NYUA 4FW8A 5BQXA 3I9JA 4HFMA 2IOQA 1QH0A 2C5SA 3GJRA 4QBKA 2I78A 4BQNA 4F92B 5JC1A 3FYUC 5AW3A 1CY7A 1Z2PX 5CT4A 2VKTA 1QHFA 2ZSUA 1DOZA 4H1UA 5EQFA 1W25A 5A1TA 3KB1A 1T9CA 2NQ8A 4LOJA 1W1UA 1M6VB 2BEVB 2FH5B 2DETA 2B34A 2Y0CA 3LPLA 2FX2A 4OHRA 3TZKA 3VNBA 5JJIA 4EABA 2IYWA 2IZ1A 5FYQA 2AFVA 4CKBA 2KMLA 4A15A 2PAFA 2XGOA 3B1FA 4GZ3A 7REQA 1B15A 2YOFA 3CB4A 4DUPA 4ZI7B 4IJVA 3ZG6A 3CWCA 2R1ZA 2IYRA 3PF9A 3FA2A 1SC4A 4HX9A 1ZEJA 3NQ41 3ZJ5A 3ZQJA 4JB3A 4ZMBA 3NATA 4E15A 1PK8A 1PZGA 3OEED 3ZOKA 4ZZ2A 4W5TA 2CEKA 4L9AA 4YMVA 3SZLA 2FRVA 3R5XA 1W0JA 2JDID 4N5IX 1HLGA 4YR7A 5HJ5A 2G8NA 4F97A 7YASA 1JX6A 1TKCA 4HI0E 4H1HA 1VJRA 3N2GB 4Z0PA 1O8BA 2C5FA 3TPZA 4EY3A 4CEJB 2GRAA 5EZYF 3EQZA 3M1LA 4R8KA 1KYXA 4F9FA 4KX3A 4O2AA 4MLDA 3F4BA 1RWWA 1GARA 4XWWA 3CN9A 2WF8A 4H7IA 4JSRA 1KDTA 3HCDA 1N3YA 3T4EA 4BWGA 1LY1A 4PNZA 2BKXA 1W30A 2GXQA 3OF5A 4U6SA 3GFQA 4A10A 2V9CA 4CL0A 5HKBA 1BD4A 4FWBA 2I55A 4KAAA 4MQ4A 3P8ZA 3O4RA 4O4IA 1KMHB 3T3NA 2HA6A 3ONDA 1XIVA 4GXTA 3KFVA 2P35A 3DZBA 4GOXA 2HRZA 1XZCA 1JHPA 1M2VB 5I9SA 2GI4A 5A9TA 4TUYB 4UU8A 2IPAB 4RPLA 4CHGA 3HL4A 1ZU4A 3NORA 4RIIA 2JB9A 2H63A 1SO8A 1IUOA 3VH3A 1W76A 1DDIA 1PGJA 3THYB 3T5BA 4I1OA 4ZRMA 3OY7A 4LHXA 5J2UA 5J5VA 1VJCA 1ZI8A 1IEQA 2YRFA 5ALQA 4UXHA 3FJYA 2F17A 3I05A 4YRRA 5K3AA 3K09C 3HNRA 4K6FA 4Q3CA 3WRWA 1B23P 4OQNA 2UZ1A 1IB6A 3ADCA 3BH0A 2WLTA 3CF0A 4WZBB 3W7BA 821PA 3PX7A 3ZCUA 4TS3A 1MFPA 1OLXB 1XXLA 2O2XA 3F46A 1HYQA 3KJQA 5FPHA 5JTUA 4D57A 1JAIA 3E03A 3P2OA 1YL7A 2OSBA 3AFIA 3KOYA 4G1EB 4GC9A 4Q00A 4YP9A 5TS2A 2TYSB 4NJOA 4EPVA 5K8LA 4AJLA 1TIKA 3ST7A 5G3ZA 3FH0A 4XWTA 3H2KA 4X3CA 5B37A 4BVJA 3C6BA 4P38A 1QFMA 1A71A 1TU0A 3OF2A 4D9MA 2XWBF 3SR0A 4YMUA 1Z0JA 1QPGA 3A1FA 1JQ3A 4P8RA 2LNDA 3GARA 5BYJA 4C1NA 3RW9A 2G0AA 2LDBA 1UBFA 4NS1A 4DKXA 1YOVB 4XIYA 1RT9A 2XYRA 3Q3JB 4M9UA 4NC9A 3TDMA 1A8HA 3KQNA 5K8IA 3E1GA 3WGVA 4N49A 2WEKA 2R7AA 4A92A 3KZMA 5BSGA 4BMVA 2OG2A 2G40A 4JLVA 5FR2A 1ATIA 2EWVA 2A0FA 3NRCA 1LW6E 3DKVA 3NUQA 2XUPA 1NZDA 3CLRD 2EHDA 1UC8A 1G1AA 2B78A 3RVKA 4EYQA 4DB2A 1WDKA 3MCUA 4RCVA 2H57A 3C0KA 3KXPA 1NXOA 4RH1A 1KYWA 2YOGA 3JYNA 3BGSA 4LQDA 4NMLA 3UPUA 3KQWA 1RIIA 1WUYA 2FW7A 1QV9A 2F48A 1XTIA 1VGQA 2GK6A 1MB4A 1S02A 2A6PA 2Q3MA 3FETA 3QLUA 3QJYA 4E2WA 1T5BA 2QV7A 4J0EA 3VPHA 4KUEA 1RYDA 5AR1A 3ZDEA 2VXYA 2X0JA 4J29A 1L0BA 4HH4A 3UHFA 1SOAA 4QBIA 5AW9A 3W2TA 1KJIA 1L7VC 1OH6A 3FWHA 3WL4A 1QVVA 1A96A 3EEFA 1U3WA 1XXHB 2JHPA 4UTZA 1Y4UA 3OEYA 3ORFA 4WA8A 1ZC4A 3N2KB 4MRRA 3RHTA 3U9LA 3E8MA 2BFFB 1PFWA 2W98A 4FFWA 4PC3A 3D54D 4PZDA 4U8HA 3I9FA 3VPDA 3QHAA 2I3AA 4QGGA 1ZD8A 2FDXA 1X7ZB 3DGEC 5ALRA 5KQMA 2IBTA 4LCBA 1NR5A 4BX3A 2VPQA 2AJCA 1J2EA 4ZK2A 1XTPA 3H2GA 4DMCA 2YFKA 2LCIA 1A9YA 3O3OB 2ZRGA 2NU6A 4MIOA 4R7GA 4BLRA 1SOUA 1IIRA 4BIIA 5B3JC 1NP3A 4FSXA 3H2JA 2OESA 2I1VB 3UB3A 2PZAA 3G5LA 1NMSA 3G82C 4KLCA 3EZYA 2JGDB 1M76A 1MIOA 5L95A 3L06A 4NMWA 3K05A 4P84A 5C8YA 1R9GA 3C3KA 2PSJA 4E1BA 2ECPA 1UXKA 1C7QA 3JARA 4H15A 4DLTA 3T52A 1RYMA 3I2KA 3IS3A 4IDEA 4LCJA 5F76A 1LI7A 4XKJA 3UJBA 3N3AC 4ZDKA 4S04A 4AF6A 2BTQB 1NOIA 3CZ5A 4R69A 4PBRA 2A0YA 2G67A 3LF2A 3O7WA 3GLHA 3MA0A 4WMLA 1GPH1 5IDWA 1NPYA 2QL6A 3SC3A 3E3OA 1Y5MA 2XAUA 2VK4A 2XB8A 4JLAA 1OWPA 4S1NA 3B78A 1U3DA 4AO8A 1XTVA 1U8AA 4HH0A 5KOHB 3QA3E 1I5EA 4OUKX 3NJ8A 1J2UA 1ONPA 4O0MA 1Y6RA 2FPGA 4H7PA 4V3BA 4X1IA 3PCTA 3TLGB 1M6EX 3DAPA 3A6ZA 3BXZA 1KSGA 5JQGF 2PTGA 4G0UA 2QE7A 1TAUA 5B58T 2XXAB 2XBUA 5CBPB 3M3DA 3DOFA 4CFZA 3W8RA 4MW2A 5NULA 1LPSA 2RDMA 3VSDA 1WA5A 1JLKA 3ABSB 1YS2X 3HWSA 3WIEA 3E61A 3TLKA 2PUGA 3TVTA 2HK7A 4NFSA 4YUXA 1VRVA 3ZLBA 2QZZA 4K9QA 1JHZA 3E7XA 1VSVA 3EZ2A 1H22A 2QN6A 1K06A 3HDTA 4L8VA 5ARDA 3KLBA 3HU1A 2P4SA 1W35A 2B25A 1JDSA 3NANA 4MS1A 1U1EA 3LMKA 4FR0A 4LJ4A 4P93A 3QUBA 4XYMA 1E1LA 4H7FA 3BXEA 1ZZEA 1XCBA 4WBNA 2ZBUA 2XKKA 1ONBA 3GG9A 1HDIA 1A1VA 5CXXA 1RHUA 5FHQA 4EMTA 4LFCB 1GUZA 3N8DA 3WYGA 2A94A 3NI2A 4EHAA 4YV0A 1OU4A 5DSXA 1UKVY 2XZDA 4RD4A 3VU1A 2HHJA 2HV8A 4YMGA 2Q1XA 3OT4A 2PRSA 5HKAA 3GLIB 3CVYA 4H3VA 4JT4A 5A03A 2GHIA 2C1EA 2WD7B 3CNBA 1CJKC 3BKXA 1YZUA 2WKSA 2PXAA 1BN7A 2Q7XA 3TUIC 5BSKA 4CLRA 4O02B 3S99A 5KSOA 1K6IA 1YAJA 5IABA 5FUBA 1ISRA 4MKGA 5HKKA 1F20A 3WX0A 1F5NA 1N1EA 2QTVB 1SHKA 2GQ0A 3A4LA