3Q9NC

In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
157
structure length
157
Chain Sequence
FGQDLGKKLLEAAAAGQDDEVRILMANGADVNATDDNGLTPLHLAAANGQLEIVEVLLKNGADVNASDSAGITPLHLAAYDGHLEIVEVLLKHGADVNAYDRAGWTPLHLAALSGQLEIVEVLLKHGADVNAQDALGLTAFDISINQGQEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A de novo protein binding pair by computational design and directed evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding, de novo protein
molecule keywords CoA binding protein
total genus 53
structure length 157
sequence length 157
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3q9nC00
4RLYA 2RFMA 5CBNA 1WDYA 3AAAC 1MYOA 2BKKB 5HS0A 3TWQA 1DC2A 3TWWA 3Q9UC 3ZUVB 2JABA 4NIKA 5AARA 3NOGD 4U96D 2ETCA 3LJNA 3TWUA 2HE0A 2PNNA 3TWXA 1K3ZD 4HNAD 3HG0D 4O60A 4YDWA 4DX5D 3W9FA 1YYHA 3EU9A 4HI9A 5KNHD 4JB8P 2ZGGA 2Y1LE 5JMND 3B95A 3W9GA 5CERB 2XZDG 5BXUA 4HRNA 3V2OA 5AAOA 2B0OE 2KBXA 5HRYA 3V30A 5EIBE 2KXPC 3EHQA 3TWRA 2AJAA 4K5CA 3HRAA 4TUMA 4G8KA 3TWSA 4J7WA 3T8KA 5ENRD 1YCSB 4CYMD 4HI8A 4DRXE 5KNGA 5CEDB 3D9HA 4O1PA 4OAVB 5ENSD 4K5BA 1BLXB 2V4HC 1IHBA 1IKND 1SVXA 5EILA 3ZKJA 4DX2A 4C48B 4BSZB 2XZTG 5AN8A 1MX2A 4U8YD 5AQAA 1N11A 4U95D 5EIDA 2Y0BG 4F6RD 5JA4D 4DX6D 4U8VD 4LNUD 1IXVA 1YMPA 2F8YA 3DEPA 5AQ9A 4ZHBA 1AWCB 1N0QA 2FO1E 3ZU7B 2F8XK 4OAUC 3SO8A 5KBAA 3JUEA 4GMRA 3T9KA 4DUIA 3NBNB 5FIOA 4HLLA 4LG6A 5HKPA 1OY3D 3DEOA 4BERA 5ENPD 4A63B 2QC9A 4HB5A 2ETBA 1D9SA 3AJIA 4QQIA 4Z68A 4HRMB 2MYOA 5EYPF 1N0RA 3Q9NC 4O1OA 3JXJA 4ZFHA 2ETAA 4GPMA 5AQBA 4J8YA 3UTMA 2P2CP 5KWDA 3B7BA 3UI2A 4ATZD 1AP7A 4HQDA 5CEAA 5ITZF 1BI7B 4LSZE 4BETA 4BEPA 2XEHA 5ENOD 2BKGA 4YDYA 1A5EA 1NFIE 2NYJA 2QYJA 2XENA 1K1AA 4DX1A 3J5PA 3KEAA 1MJ0A 1SW6A 1OT8A 1UOHA 5EN5D 5AQ7A 3V79K 1WG0A 4CZ2D 3NOCD 3IXEA 3UXGA 1MX6A 2VGEA 4N5QA 4B93B 2A5EA 2XEEA 4UUCA 1BI8B 4HRLA 5EYLA 3V2XA 2DZNA 4DX7D 5BXOA 1DCQA 3TWVA 3EHRA 3TWTA 1MX4A 4BESA 2ZGDA 3J5QB 2DWZA 1S70B 2DZOA 2J8SD 4K5AB 5D66A 3JXIA 2DVWA 3C5RA 3V31A 1K1BA 1TR4A 5ENQD 5FINA 2V5QC 4G8LA 2F37A 1BU9A 3F6QA 4F1PA 4HBDA 5ENTD 1G3NB 2L6BA 2RFAA 5CECB 3ZNGA 5CBOA 4QFVA 1QYMA 1BD8A
chains in the Genus database with same CATH superfamily
3FUDA 4FC8A 3DSSA 2CFZA 4NQ0A 5D0QD 1D8DA 4YDWA 3HG0D 4N5CA 4HI9A 3FTUA 5HRYA 2WM9A 2AJAA 3RKVA 2KZTA 3FH7A 3T8KA 4JHRA 4CGVA 2JEKA 3UKUG 3B7UX 4U8YD 4U95D 2UWJG 1QQEA 3DEPA 2XRZA 2CHXA 2V0PA 3QJZA 4GPKA 2MOWA 5HKPA 1EDUA 3FUMA 1HF8A 1TJFA 4GU5A 4B94A 3TL5A 2ETBA 3UMVA 1O1TA 5LCWC 4O1OA 2ZISA 3BUAA 5BUZA 4UWHA 5ITZF 4EBAG 1BI7B 3SBTB 1E7VA 1UN9A 3FWVA 5BV1A 1N54A 3FTZA 2FBNA 4GZ3A 5LP0A 2X3MA 5FTPA 4KVOA 1S63A 5AQ7A 3MEKA 4RSYA 3ZPJA 4G26A 3UM2A 1H6KA 1SZAA 1XGWA 5EKQD 3S2AA 5T4YA 3EIQC 5D66A 3JQ0A 4BFRA 2OEWA 2LNIA 2WQ7A 3JCKC 5FQ8A 1EF1C 3NZUA 4C0EA 1SZ9A 3ESLA 4NURA 2F0YA 4AY6A 3SZ7A 4F7AA 3NZSA 2BKKB 4NIKA 2WXQA 3PH0C 1JWGA 2QZAA 5AIJA 3RO3A 1HG2A 1E96B 5EIBE 5M72A 1Q2ZA 4I1OB 4KZCA 2J4BA 2EQXA 1SA4A 1YCSB 1INZA 2L0IA 5JJ7A 1UG3A 3ZKJA 5C2YA 3MJWA 3HXFA 3QWPA 3KSLA 4GTPA 3FU6A 3E33A 3ASDA 5FQ4A 5LOZA 3RRNB 3L6AA 1VDYA 3DSXA 4I2ZA 4Z68A 1OXJA 2MYOA 1H0AA 1E8YA 4EZLA 2LAHA 4ANWA 4BEPA 4CRWA 3UPVA 5ENOD 4DLOA 3SGHA 1NZNA 2CFUA 1DCEA 3O48A 5BPPA 3PE4A 3S7BA 1UJJA 2P9NG 4U0ZA 3FH5A 5HI7A 2IY0C 4X8QA 3TWVA 4I6JA 3E34A 2WXRA 4DI3A 3E30A 5CMYA 4G8LA 3LCAA 4YDEA 3P1UA 3UX4A 2V5FA 5T8IA 3BU8A 4LEUA 4ANVA 3ONKA 4QFVA 3R7RA 2R17C 1UN8A 3LY8A 2OCCE 2WXOA 1E7UA 3MX3A 1YYHA 4JB8P 3DWLG 5JMND 3B95A 3DPDA 2ZXWE 5BXUA 3I4RB 3TXNA 2KXPC 3Q7AA 4GA0A 3UM1A 3HRAA 3ML8A 4UQZA 4Q94A 1RZ4A 3MA5A 1IQUA 4O1PA 1SVXA 3PNLB 3UM0A 4GTRA 4LNUD 3CSFA 2XPYA 3SO8A 3RO2A 4I1AA 1ELKA 4F1SA 1ELWA 5FT9A 3ZIMA 4G24A 4FJZA 1EYHA 2XPZA 3Q9NC 2P9PG 1MHQA 2BUGA 3ASNE 3G2TA 3G2WA 3IHVA 4HOSA 3C98A 2XENA 3PZDA 1SW6A 3V79K 5CCLA 1FCHA 2RKKA 4B8CB 2R59A 4L23A 5BNWA 4GB9A 3NF1A 4PUCA 3QAQA 4UWGA 1BPOA 2VTBA 4EHMA 2XGSA 4LNBA 4WWOA 1KZPA 2IEJA 2AW6A 4HOUA 5D0OD 4MBGA 1G3NB 5CECB 1LTXA 5FZRA 2OV8A 3IKOB 3WG7E 1MYOA 1QNFA 1TYQG 3T8MA 3TWUA 3QWVA 4XI9A 1V54E 3E32A 4AY5A 2H6FA 2Y1LE 2ZGGA 3FU3A 5B3SE 2LSUA 1JWFA 2PM6A 4UI9J 2YQ8A 2KBXA 4I17A 3ASFA 2HYZA 4EPZA 4E6HA 3LY9A 3D9JA 3TWSA 4PS7A 1OWPA 3PZ1A 4H7XA 4C48B 2AXZA 3I3NA 4TRQA 4JA7A 3ULEG 1IXVA 2F8YA 3L82A 4CDRA 3FUJA 3DEOA 2J4DA 3FP3A 2VGXA 3CHPA 3AJIA 3HVEB 4UWLA 4GPMA 5KJLA 1N9AA 1HXIA 4EECA 3VLFA 3ASGA 4BETA 4EBAA 3PZ4A 3CVYA 5E76A 4GZ6A 4RQIA 4N3BA 2OOEA 1UW4B 3U3WA 3PDNA 4GTSA 1V55E 4GYOA 2I1KA 3NOCD 2WMNA 4HXIA 4WWPA 2J49A 5JJTA 3RJVA 4G25A 4LCTA 4GZCA 1MX4A 3J5QB 4O6FA 2DZOA 2CHWA 1NI1A 2XPIA 2V5QC 4JZYA 4F53A 1O5MA 3ZFWA 2X6FA 4GTTA 3ZYLA 1JUQA 2L6BA 1K8KG 5CBNA 2J07A 2PL2A 1JCRA 5KNHD 1HU3A 3CGHA 5AAOA 3LVRE 1WY6A 1H2VC 3U9WA 3L16A 3QOUA 2FO7A 4CDNA 3TGOA 4K03A 3B7TA 3HXBA 3L08A 5G05C 1W3BA 1N4PA 4OAVB 4I9EA 4GA1A 1OWMA 3QK0A 4BSZB 3SBSA 5AN8A 2EIME 2WXMA 3LXUX 3UIOC 2Y0BG 2QYUA 4F6RD 3JQ1A 4PH4B 1HH8A 5FIOA 5G04J 2UY1B 2X6IA 3E37A 3MYVA 3DPYA 2ILRA 2WXIA 1JCQA 3BG1B 2R05A 3URZA 3DSWA 3MV2B 3BEEA 3CVWA 4WNDA 4TXRA 3ASOE 3VTXA 2R03A 4UUCA 3UT7A 1HX8A 4B8AA 3TWTA 1PAQA 2J08A 4IULA 4BESA 2MHKA 2XGMA 3L54A 3ML9A 5E75A 2FEZA 4UI9C 1JCSA 2PQRA 4HORA 3UINC 1TN6A 2Y3AA 2L0TB 3UT4A 3EHMA 2RFMA 1U3CA 2XRYA 4U04A 5AYWD 4HNAD 3CIAA 2XS1A 2V8SE 3AG3E 2DIWA 3QDNA 1NA0A 4HRNA 2Y4UA 2XS8A 3B13A 2ONDA 1NA3A 3C3RA 4HVBA 4CYMD 4XE0A 3CQGB 4OVVA 3CHQA 2VSOE 3Q73A 5BT1A 3TJPA 3R7QA 3IBEA 1KZOA 4CGWA 3GZSA 3UT8A 3DRAA 4N3CA 1U2VG 2VGXB 1DVPA 5BV0A 3MCXA 4KMOA 3TXMA 4QQIA 4UWKA 1N4RA 3TG4A 2YNQA 3CEQA 1A17A 3UTMA 2AVPA 2R2LA 4C0MA 2CG2A 3SQVA 1TN7A 4JL0A 3UUXA 1K1AA 5KCMA 5EN5D 1LD7A 3CK7A 4JEUA 5BW8C 2IFUA 3X2QE 4DX7D 5HQ8A 1IYGA 4A3TA 3PREA 2ZGDA 3C5RA 3Q5MA 3S7DA 3FUHA 2VSNA 3Q79A 3R9MA 2LXLA 2BF0X 3D9NA 5CBOA 3MKQB 2RG8A 3PRZA 4ACKA 4N3AA 1HZ4A 3SNXA 2Q7FA 2XCCA 3CQCB 3CVXA 3V30A 2C2LA 3FEXA 3AS5A 3EU5A 1QBQA 2H6HA 3APDA 4K5BA 3UQ3A 4DX2A 4GMLA 2WXHA 3ZHEA 3VTYA 4L7TA 3LY7A 3PNTB 4GAAA 3ABME 3ULYA 4OVUA 3G2UA 3MZLB 1OY3D 2GRRB 3Q15A 4WWNA 2IO3C 2FULA 3FUFA 2QC9A 3MGBA 4HS2A 2B6CA 2P2CP 4BX8A 4U0SA 4AOFA 1FPPA 4FULA 4FLBA 4XIFA 3FHEA 4TV3A 1OT8A 4FP7A 3PE3A 4LRZA 1BI8B 5BXOA 2WXKA 4RG9A 3CHOA 3G2SA 1S64A 2ZU6B 4GCNA 2DWZA 3ULQA 2DVWA 4EZJA 3P2BA 3ISMC 4AV7A 2KATA 3EJNA 4P29A 4PS8A 2AWIA 1KT1A 3PEUB 2NC9A 2A4ZA 3TWWA 5AARA 5FQ7A 4XEIG 1H6OA 3L13A 4KZ0A 4AVXA 1TNUA 3Q49B 3WXXA 1WM5A 4YDOA 4JHKA 4I43A 3CVNA 3OXGA 3JUIA 4J7WA 3CVPA 4HFGA 3T5VA 1SA5A 2LSVA 4DRXE 2V4HC 5EILA 3FTXA 2QY7A 2XZTG 4IYPA 4I2WA 2EIJE 4J8FA 4U8VD 1AWCB 4OAUC 1N52A 2P9UG 3ZU7B 4YVQC 1Z5SC 2GRNB 1OCZE 4BERA 1Z3YA 3NAWA 4CT4A 3U64A 3OAWA 1E8XA 4XX5A 5KJMA 2ETAA 4WNEA 4PS3A 5ARFA 4R7LA 4BTBA 5CEAA 4U7EB 3IV0A 4E85A 3CVUA 2BKGA 4A1GA 5EX3A 3D9KA 4L1BA 2GROB 3EDTB 3RIBA 2HR2A 4CZ2D 4HOTA 3CVVA 2MRIA 3HVEA 3AG4E 3LPZA 5G2NA 2Y4TA 3TG5A 2J9QA 4ILIA 4CEMA 5ENTD 4AEZC 4GYWA 2I2OA 1H6PA 4AXHA 4RVBA 3FTVA 2WVIA 5HS0A 4GZDA 3Q78A 3QKYA 4NRHB 3EU9A 2R02A 3VLDA 3HDXA 3D9PA 4JD2G 4EZKA 1HE8A 1E8ZA 3FU5A 3D9OA 1JPLA 3KS2A 2J09A 2ZIRA 1OWNA 5AQ9A 1X81A 3AU4A 4A1SA 3ZW3A 4KVMA 5A6CA 2IO2C 3Q7FA 4UQYA 3FUEA 4LERA 2M63A 2E2EA 1H2TC 4FLHA 4TXQA 5FZSA 4DK5A 2KC7A 3CKCA 4ZFHA 4NACA 4W9RA 3HHMA 4ATZD 3OXLA 3ZVVA 3DSVA 1L5JA 5C1DA 3CHSA 4U8HA 3IHYA 2QYJA 4KT6B 4GA2A 4G11A 3LKUA 3CHMA 1Y8MA 2LXMA 3DBSA 2LAIA 3V2XA 3EHRA 3PS6A 5D2MC 1ELRA 2OEVA 3JXIA 3QNKA 2C0LA 5FINA 1TN8A 2JLBA 1HS6A 4FJYA 3ZNGA 4A3VA 4IN3B 1HG5A 2HO1A 3TWQA 4OYSA 4WNGA 3ZUVB 3NOGD 3C72A 4GTOA 4YNDA 4XKCA 4UQXA 5CERB 4MLPA 2B0OE 4WUYA 1RW2A 4ILGA 4AJWA 4U63A 3FEYA 5AQAA 4J8EA 2VGYA 1OUVA 1FVFA 1Z3XA 3CHRA 5B1BE 2IU1A 2LUHA 2P9LG 2IOSA 3T5XA 3UM3A 3ZXSA 2XGOA 3O4ZA 5DIZA 5A7DB 4EQFA 3S7FA 3ZYKA 5KWDA 3UI2A 3MV3B 1IHGA 2C0MA 2I6HA 2P58C 2KCLA 1N4SA 3FTWA 4L9PA 3CVLA 4C9BB 2VTBB 1TEZA 4G1TA 4BWRA 2DZNA 3KD7A 4AIFA 3K9IA 3LVQE 4I9CA 3FTYA 4F1PA 3FUNA 4HBDA 4CDMA 3PZ3A 2YINA 2DCPA 4U96D 2ETCA 2XHEA 2VSYA 3EHQA 3AU5A 1GW6A 1OCRE 1E90A 1OWLA 2IQCA 3ZRHA 4HI8A 5ENSD 1BLXB 3APCA 3AS8A 5JJ6A 3RAUA 3GW4A 1N11A 2Y69E 4M3OA 4DX6D 1O1RA 1N0QA 4UWFA 4Y6CA 5CHEE 3UIPC 4J0UA 4Q69A 4LG6A 3DXMG 3GZ2A 2P9KG 5ENPD 4A63B 4HRMB 3ZHEB 4APFA 5AQBA 4J8YA 4CCAA 1O1SA 4GMJA 1KLXA 3CK9A 4M7CA 1S0PA 4MS6A 1NFIE 2BTDA 5CMWA 1TNYA 2IJGX 5G55A 1MJ0A 2FI7A 3IXEA 3ZEFA 3RSEG 5LCWJ 3EIJA 4JHJA 2A5UA 2WB2A 2J8SD 3MKQA 3D9MA 2GRPB 5G05J 4KXKB 2VJ8A 2NXPA 5FZQA 4DJAA 1ZBPA 4LNGA 1OCCE 2RD0A 3AAAC 4JEHA 4V3IA 2I9CA 3Q9UC 2XEVA 2KZTB 4GZ5A 4G23A 3W9FA 5CRVA 3VLEA 2L6JA 3FU0A 1KT0A 3HXCA 2X6JA 5KJNA 2X38A 4DPRA 3LJ3A 5JHAA 2IOLA 2YHCA 1IKND 4JXTA 3FUIA 5JA4D 3B7SA 2AXUA 2DBAA 1YMPA 4I1MA 2FO1E 4ANXA 3SI5A 3SFXA 4HLLA 3EUVA 2KM4A 4N2QA 5EDSA 5EYPF 4L2LA 1N94A 4B89A 3RU0A 4HQDA 3HIZA 3HXDA 3FFLA 4ABNA 2L9BA 3CK8A 1PC2A 4DX1A 1UOHA 2I1JA 4JVSA 2VGEA 4J8DA 2P9IG 2HM8A 3QWWA 2WQHA 1DCQA 3NB2A 3GZ1A 1TNBA 5T3RA 2R5SA 1S70B 3C3OA 4K5AB 4WNFA 3CV0A 2IONA 3CR3A 4TUUA 1Z6TA 1TNZA 3RRMB 4BY6A 2GRLA 1FVHA 2P9SG 2RFAA 1LF8A 4XI0A 1NL4A 2JABA 3QB2A 5B1AE 3ASHA 3TWXA 1K3ZD 4O60A 1KPSB 3CVQA 5AJLA 5FWQA 4YVOA 2XZDG 3PUKA 3HXEA 3TWRA 4G8KA 1H19A 2XQ0A 5ENRD 3LEWA 3ZYMA 1IHBA 2PM7A 3ABKE 1TNOA 4JC8A 3I4GA 3PUJA 4XZ4A 3DXKG 5KBAA 4I6EA 1X5BA 3SD5A 5IY5E 1N0RA 3DSTA 3JXJA 3PEVB 3CSTA 4GTQA 2X6KA 2WPVA 4LSZE 2AXVA 2XEHA 2FF4A 4L2YA 3E4BA 1SQMA 5ANRA 1XNFA 3KEAA 4WAFA 4K0RA 3UXGA 1MX6A 3FULA 4N5QA 3FTSA 2A5EA 2XEEA 3D9LA 4ATGA 1TJCA 4GYYA 5A23A 3ZYQA 5KJKA 4D10C 3V31A 5ENQD 1QZ2A 2WXPA 3F6QA 2E0IA 1OCOE 4MKTA 2LO6A 4AM9A 2F8XK 4ACLA 4RLYA 2NSZA 1WDYA 2VSXE 1DC2A 4U0UA 3PZ2A 5LX8A 3UKRG 3LJNA 5ARGA 2HE0A 2PNNA 2CG3A 4JW1A 4DLQA 4GTVA 4B0ZA 4K5CA 4XKBA 3JYSA 2BEDA 4BT8A 1NP7A 5ANLA 5KNGA 3D9IA 1MX2A 1PY1A 4APOA 3GYZA 3S7JA 3LDZA 4ZHBA 2GRQB 3PVLA 4HLEA 2X6HA 4KBQA 3QARA 1E8WA 3JUEA 4GMRA 3NBNB 1MQSA 3SF4A 4LUNU 4ME2A 4I6GA 4BX9A 3BG0B 2WQ6A 3B7RL 5CRUA 2WMOA 3ONLA 2CHZA 4YDYA 3ZGQA 3KSQA 3AG1E 2NYJA 1HFAA 3FH8A 4RG6A 4G2VA 3ENEA 3I5PA 5EYLA 4BT9A 3L17A 1IQRA 4GCOA 3N71A 3APFA 3Q4AB 3ESKA 1TR4A 3MKRA 2F37A 4BTAA 3BQOA 4HOQA 2WXLA 1N4QA 4URKA 1LD8A 1EPUA 4DX5D 3ABLE 3KEZA 1OWOA 4FU3A 4N39A 3QC1A 4IRUA 3V2OA 1WAO1 1B89A 2PQNA 2GGFA 3G2VA 4TUMA 1Y6IA 4A55A 3D9HA 3KAEA 5EX0A 1N95A 5EIDA 2KCVA 2XCBA 1DNPA 4DUIA 3HYMB 2OVBA 2WXJA 3CLJA 3FY4A 5JHBA 1P5QA 2IF4A 3D3MA 3TAXA 3Q47B 4GTMA 1YA0A 4BSXA 1MZCA 3LS8A 3L22A 4JA9A 4FA6A 2PZIA 1A5EA 1ZB1A 4JPSA 3J5PA 4MRUA 1WG0A 4B93B 4HRLA 4F3VA 3U66A 2YHEA 1HO8A 2V4LA 3DSUA 3NQPA 2VYIA 3R9AB 2WXFA 4UI9K 1K1BA 2UY1A 5AJDA 5FQ6A 2DYSE 3IEGA 4H7YA 1UJKA 1BU9A 5FJYA 3AG2E 3SHFA 3AS4A 2WXNA 2GRMA 4J8SA 5G04C 3SFYA 5DBKA 3W9GA 1U3DA 4J6IA 5AENA 5CCMA 1FT2A 5CEDB 3LYAA 3RK6A 3C3QA 3FDHA 5LFAA 5H7PA 4ILHB 3RRUA 3OTNA 3T9KA 2H6GA 3EHNA 3OXFA 3FUKA 2DYRE 4HB5A 2KCKA 4AP2A 1D9SA 4Q96A 4KYOB 2EILE 3SFZA 4CT0A 4FHJA 5ENNA 4DI4A 3B7BA 4TXPA 1D8EA 1AP7A 1H2UA 2QFCA 3CKBA 3SY2A 2VQ2A 3Q75A 2OVFA 2GW1A 3ZXPA 4FHKA 4ANUA 5J90A 4Y6WA 4PDXA 4FADA 3L9TA 3U4TA 2WXGA 2EINE 3ZN3A 1FT1A 2EIKE 2H6IA 4U07A 1ZU2A 1QYMA 1BD8A 4N2SA 5J08A
chains in the Genus database with same CATH topology
4RLYA 2RFMA 5CBNA 1WDYA 3AAAC 1MYOA 2BKKB 5HS0A 3TWQA 1DC2A 3TWWA 3Q9UC 3ZUVB 2JABA 4NIKA 5AARA 3NOGD 4U96D 2ETCA 3LJNA 3TWUA 2HE0A 2PNNA 3TWXA 1K3ZD 4HNAD 3HG0D 4O60A 4YDWA 4DX5D 3W9FA 1YYHA 3EU9A 4HI9A 5KNHD 4JB8P 2ZGGA 2Y1LE 5JMND 3B95A 3W9GA 5CERB 2XZDG 5BXUA 4HRNA 3V2OA 5AAOA 2B0OE 2KBXA 5HRYA 3V30A 5EIBE 2KXPC 3EHQA 3TWRA 2AJAA 4K5CA 3HRAA 4TUMA 4G8KA 3TWSA 4J7WA 3T8KA 5ENRD 1YCSB 4CYMD 4HI8A 4DRXE 5KNGA 5CEDB 3D9HA 4O1PA 4OAVB 5ENSD 4K5BA 1BLXB 2V4HC 1IHBA 1IKND 1SVXA 5EILA 3ZKJA 4DX2A 4C48B 4BSZB 2XZTG 5AN8A 1MX2A 4U8YD 5AQAA 1N11A 4U95D 5EIDA 2Y0BG 4F6RD 5JA4D 4DX6D 4U8VD 4LNUD 1IXVA 1YMPA 2F8YA 3DEPA 5AQ9A 4ZHBA 1AWCB 1N0QA 2FO1E 3ZU7B 2F8XK 4OAUC 3SO8A 5KBAA 3JUEA 4GMRA 3T9KA 4DUIA 3NBNB 5FIOA 4HLLA 4LG6A 5HKPA 1OY3D 3DEOA 4BERA 5ENPD 4A63B 2QC9A 4HB5A 2ETBA 1D9SA 3AJIA 4QQIA 4Z68A 4HRMB 2MYOA 5EYPF 1N0RA 3Q9NC 4O1OA 3JXJA 4ZFHA 2ETAA 4GPMA 5AQBA 4J8YA 3UTMA 2P2CP 5KWDA 3B7BA 3UI2A 4ATZD 1AP7A 4HQDA 5CEAA 5ITZF 1BI7B 4LSZE 4BETA 4BEPA 2XEHA 5ENOD 2BKGA 4YDYA 1A5EA 1NFIE 2NYJA 2QYJA 2XENA 1K1AA 4DX1A 3J5PA 3KEAA 1MJ0A 1SW6A 1OT8A 1UOHA 5EN5D 5AQ7A 3V79K 1WG0A 4CZ2D 3NOCD 3IXEA 3UXGA 1MX6A 2VGEA 4N5QA 4B93B 2A5EA 2XEEA 4UUCA 1BI8B 4HRLA 5EYLA 3V2XA 2DZNA 4DX7D 5BXOA 1DCQA 3TWVA 3EHRA 3TWTA 1MX4A 4BESA 2ZGDA 3J5QB 2DWZA 1S70B 2DZOA 2J8SD 4K5AB 5D66A 3JXIA 2DVWA 3C5RA 3V31A 1K1BA 1TR4A 5ENQD 5FINA 2V5QC 4G8LA 2F37A 1BU9A 3F6QA 4F1PA 4HBDA 5ENTD 1G3NB 2L6BA 2RFAA 5CECB 3ZNGA 5CBOA 4QFVA 1QYMA 1BD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RLY A;  2RFM A;  5CBN A;  1WDY A;  3AAA C;  1MYO A;  2BKK B;  5HS0 A;  3TWQ A;  1DC2 A;  3TWW A;  3Q9U C;  3ZUV B;  2JAB A;  4NIK A;  5AAR A;  3NOG D;  4U96 D;  2ETC A;  3LJN A;  3TWU A;  2HE0 A;  2PNN A;  3TWX A;  1K3Z D;  4HNA D;  3HG0 D;  4O60 A;  4YDW A;  4DX5 D;  3W9F A;  1YYH A;  3EU9 A;  4HI9 A;  5KNH D;  4JB8 P;  2ZGG A;  2Y1L E;  5JMN D;  3B95 A;  3W9G A;  5CER B;  2XZD G;  5BXU A;  4HRN A;  3V2O A;  5AAO A;  2B0O E;  2KBX A;  5HRY A;  3V30 A;  5EIB E;  2KXP C;  3EHQ A;  3TWR A;  2AJA A;  4K5C A;  3HRA A;  4TUM A;  4G8K A;  3TWS A;  4J7W A;  3T8K A;  5ENR D;  1YCS B;  4CYM D;  4HI8 A;  4DRX E;  5KNG A;  5CED B;  3D9H A;  4O1P A;  4OAV B;  5ENS D;  4K5B A;  1BLX B;  2V4H C;  1IHB A;  1IKN D;  1SVX A;  5EIL A;  3ZKJ A;  4DX2 A;  4C48 B;  4BSZ B;  2XZT G;  5AN8 A;  1MX2 A;  4U8Y D;  5AQA A;  1N11 A;  4U95 D;  5EID A;  2Y0B G;  4F6R D;  5JA4 D;  4DX6 D;  4U8V D;  4LNU D;  1IXV A;  1YMP A;  2F8Y A;  3DEP A;  5AQ9 A;  4ZHB A;  1AWC B;  1N0Q A;  2FO1 E;  3ZU7 B;  2F8X K;  4OAU C;  3SO8 A;  5KBA A;  3JUE A;  4GMR A;  3T9K A;  4DUI A;  3NBN B;  5FIO A;  4HLL A;  4LG6 A;  5HKP A;  1OY3 D;  3DEO A;  4BER A;  5ENP D;  4A63 B;  2QC9 A;  4HB5 A;  2ETB A;  1D9S A;  3AJI A;  4QQI A;  4Z68 A;  4HRM B;  2MYO A;  5EYP F;  1N0R A;  3Q9N C;  4O1O A;  3JXJ A;  4ZFH A;  2ETA A;  4GPM A;  5AQB A;  4J8Y A;  3UTM A;  2P2C P;  5KWD A;  3B7B A;  3UI2 A;  4ATZ D;  1AP7 A;  4HQD A;  5CEA A;  5ITZ F;  1BI7 B;  4LSZ E;  4BET A;  4BEP A;  2XEH A;  5ENO D;  2BKG A;  4YDY A;  1A5E A;  1NFI E;  2NYJ A;  2QYJ A;  2XEN A;  1K1A A;  4DX1 A;  3J5P A;  3KEA A;  1MJ0 A;  1SW6 A;  1OT8 A;  1UOH A;  5EN5 D;  5AQ7 A;  3V79 K;  1WG0 A;  4CZ2 D;  3NOC D;  3IXE A;  3UXG A;  1MX6 A;  2VGE A;  4N5Q A;  4B93 B;  2A5E A;  2XEE A;  4UUC A;  1BI8 B;  4HRL A;  5EYL A;  3V2X A;  2DZN A;  4DX7 D;  5BXO A;  1DCQ A;  3TWV A;  3EHR A;  3TWT A;  1MX4 A;  4BES A;  2ZGD A;  3J5Q B;  2DWZ A;  1S70 B;  2DZO A;  2J8S D;  4K5A B;  5D66 A;  3JXI A;  2DVW A;  3C5R A;  3V31 A;  1K1B A;  1TR4 A;  5ENQ D;  5FIN A;  2V5Q C;  4G8L A;  2F37 A;  1BU9 A;  3F6Q A;  4F1P A;  4HBD A;  5ENT D;  1G3N B;  2L6B A;  2RFA A;  5CEC B;  3ZNG A;  5CBO A;  4QFV A;  1QYM A;  1BD8 A; 
#chains in the Genus database with same CATH topology
 3FUD A;  4FC8 A;  3DSS A;  2CFZ A;  4NQ0 A;  5D0Q D;  1D8D A;  4YDW A;  3HG0 D;  4N5C A;  4HI9 A;  3FTU A;  5HRY A;  2WM9 A;  2AJA A;  3RKV A;  2KZT A;  3FH7 A;  3T8K A;  4JHR A;  4CGV A;  2JEK A;  3UKU G;  3B7U X;  4U8Y D;  4U95 D;  2UWJ G;  1QQE A;  3DEP A;  2XRZ A;  2CHX A;  2V0P A;  3QJZ A;  4GPK A;  2MOW A;  5HKP A;  1EDU A;  3FUM A;  1HF8 A;  1TJF A;  4GU5 A;  4B94 A;  3TL5 A;  2ETB A;  3UMV A;  1O1T A;  5LCW C;  4O1O A;  2ZIS A;  3BUA A;  5BUZ A;  4UWH A;  5ITZ F;  4EBA G;  1BI7 B;  3SBT B;  1E7V A;  1UN9 A;  3FWV A;  5BV1 A;  1N54 A;  3FTZ A;  2FBN A;  4GZ3 A;  5LP0 A;  2X3M A;  5FTP A;  4KVO A;  1S63 A;  5AQ7 A;  3MEK A;  4RSY A;  3ZPJ A;  4G26 A;  3UM2 A;  1H6K A;  1SZA A;  1XGW A;  5EKQ D;  3S2A A;  5T4Y A;  3EIQ C;  5D66 A;  3JQ0 A;  4BFR A;  2OEW A;  2LNI A;  2WQ7 A;  3JCK C;  5FQ8 A;  1EF1 C;  3NZU A;  4C0E A;  1SZ9 A;  3ESL A;  4NUR A;  2F0Y A;  4AY6 A;  3SZ7 A;  4F7A A;  3NZS A;  2BKK B;  4NIK A;  2WXQ A;  3PH0 C;  1JWG A;  2QZA A;  5AIJ A;  3RO3 A;  1HG2 A;  1E96 B;  5EIB E;  5M72 A;  1Q2Z A;  4I1O B;  4KZC A;  2J4B A;  2EQX A;  1SA4 A;  1YCS B;  1INZ A;  2L0I A;  5JJ7 A;  1UG3 A;  3ZKJ A;  5C2Y A;  3MJW A;  3HXF A;  3QWP A;  3KSL A;  4GTP A;  3FU6 A;  3E33 A;  3ASD A;  5FQ4 A;  5LOZ A;  3RRN B;  3L6A A;  1VDY A;  3DSX A;  4I2Z A;  4Z68 A;  1OXJ A;  2MYO A;  1H0A A;  1E8Y A;  4EZL A;  2LAH A;  4ANW A;  4BEP A;  4CRW A;  3UPV A;  5ENO D;  4DLO A;  3SGH A;  1NZN A;  2CFU A;  1DCE A;  3O48 A;  5BPP A;  3PE4 A;  3S7B A;  1UJJ A;  2P9N G;  4U0Z A;  3FH5 A;  5HI7 A;  2IY0 C;  4X8Q A;  3TWV A;  4I6J A;  3E34 A;  2WXR A;  4DI3 A;  3E30 A;  5CMY A;  4G8L A;  3LCA A;  4YDE A;  3P1U A;  3UX4 A;  2V5F A;  5T8I A;  3BU8 A;  4LEU A;  4ANV A;  3ONK A;  4QFV A;  3R7R A;  2R17 C;  1UN8 A;  3LY8 A;  2OCC E;  2WXO A;  1E7U A;  3MX3 A;  1YYH A;  4JB8 P;  3DWL G;  5JMN D;  3B95 A;  3DPD A;  2ZXW E;  5BXU A;  3I4R B;  3TXN A;  2KXP C;  3Q7A A;  4GA0 A;  3UM1 A;  3HRA A;  3ML8 A;  4UQZ A;  4Q94 A;  1RZ4 A;  3MA5 A;  1IQU A;  4O1P A;  1SVX A;  3PNL B;  3UM0 A;  4GTR A;  4LNU D;  3CSF A;  2XPY A;  3SO8 A;  3RO2 A;  4I1A A;  1ELK A;  4F1S A;  1ELW A;  5FT9 A;  3ZIM A;  4G24 A;  4FJZ A;  1EYH A;  2XPZ A;  3Q9N C;  2P9P G;  1MHQ A;  2BUG A;  3ASN E;  3G2T A;  3G2W A;  3IHV A;  4HOS A;  3C98 A;  2XEN A;  3PZD A;  1SW6 A;  3V79 K;  5CCL A;  1FCH A;  2RKK A;  4B8C B;  2R59 A;  4L23 A;  5BNW A;  4GB9 A;  3NF1 A;  4PUC A;  3QAQ A;  4UWG A;  1BPO A;  2VTB A;  4EHM A;  2XGS A;  4LNB A;  4WWO A;  1KZP A;  2IEJ A;  2AW6 A;  4HOU A;  5D0O D;  4MBG A;  1G3N B;  5CEC B;  1LTX A;  5FZR A;  2OV8 A;  3IKO B;  3WG7 E;  1MYO A;  1QNF A;  1TYQ G;  3T8M A;  3TWU A;  3QWV A;  4XI9 A;  1V54 E;  3E32 A;  4AY5 A;  2H6F A;  2Y1L E;  2ZGG A;  3FU3 A;  5B3S E;  2LSU A;  1JWF A;  2PM6 A;  4UI9 J;  2YQ8 A;  2KBX A;  4I17 A;  3ASF A;  2HYZ A;  4EPZ A;  4E6H A;  3LY9 A;  3D9J A;  3TWS A;  4PS7 A;  1OWP A;  3PZ1 A;  4H7X A;  4C48 B;  2AXZ A;  3I3N A;  4TRQ A;  4JA7 A;  3ULE G;  1IXV A;  2F8Y A;  3L82 A;  4CDR A;  3FUJ A;  3DEO A;  2J4D A;  3FP3 A;  2VGX A;  3CHP A;  3AJI A;  3HVE B;  4UWL A;  4GPM A;  5KJL A;  1N9A A;  1HXI A;  4EEC A;  3VLF A;  3ASG A;  4BET A;  4EBA A;  3PZ4 A;  3CVY A;  5E76 A;  4GZ6 A;  4RQI A;  4N3B A;  2OOE A;  1UW4 B;  3U3W A;  3PDN A;  4GTS A;  1V55 E;  4GYO A;  2I1K A;  3NOC D;  2WMN A;  4HXI A;  4WWP A;  2J49 A;  5JJT A;  3RJV A;  4G25 A;  4LCT A;  4GZC A;  1MX4 A;  3J5Q B;  4O6F A;  2DZO A;  2CHW A;  1NI1 A;  2XPI A;  2V5Q C;  4JZY A;  4F53 A;  1O5M A;  3ZFW A;  2X6F A;  4GTT A;  3ZYL A;  1JUQ A;  2L6B A;  1K8K G;  5CBN A;  2J07 A;  2PL2 A;  1JCR A;  5KNH D;  1HU3 A;  3CGH A;  5AAO A;  3LVR E;  1WY6 A;  1H2V C;  3U9W A;  3L16 A;  3QOU A;  2FO7 A;  4CDN A;  3TGO A;  4K03 A;  3B7T A;  3HXB A;  3L08 A;  5G05 C;  1W3B A;  1N4P A;  4OAV B;  4I9E A;  4GA1 A;  1OWM A;  3QK0 A;  4BSZ B;  3SBS A;  5AN8 A;  2EIM E;  2WXM A;  3LXU X;  3UIO C;  2Y0B G;  2QYU A;  4F6R D;  3JQ1 A;  4PH4 B;  1HH8 A;  5FIO A;  5G04 J;  2UY1 B;  2X6I A;  3E37 A;  3MYV A;  3DPY A;  2ILR A;  2WXI A;  1JCQ A;  3BG1 B;  2R05 A;  3URZ A;  3DSW A;  3MV2 B;  3BEE A;  3CVW A;  4WND A;  4TXR A;  3ASO E;  3VTX A;  2R03 A;  4UUC A;  3UT7 A;  1HX8 A;  4B8A A;  3TWT A;  1PAQ A;  2J08 A;  4IUL A;  4BES A;  2MHK A;  2XGM A;  3L54 A;  3ML9 A;  5E75 A;  2FEZ A;  4UI9 C;  1JCS A;  2PQR A;  4HOR A;  3UIN C;  1TN6 A;  2Y3A A;  2L0T B;  3UT4 A;  3EHM A;  2RFM A;  1U3C A;  2XRY A;  4U04 A;  5AYW D;  4HNA D;  3CIA A;  2XS1 A;  2V8S E;  3AG3 E;  2DIW A;  3QDN A;  1NA0 A;  4HRN A;  2Y4U A;  2XS8 A;  3B13 A;  2OND A;  1NA3 A;  3C3R A;  4HVB A;  4CYM D;  4XE0 A;  3CQG B;  4OVV A;  3CHQ A;  2VSO E;  3Q73 A;  5BT1 A;  3TJP A;  3R7Q A;  3IBE A;  1KZO A;  4CGW A;  3GZS A;  3UT8 A;  3DRA A;  4N3C A;  1U2V G;  2VGX B;  1DVP A;  5BV0 A;  3MCX A;  4KMO A;  3TXM A;  4QQI A;  4UWK A;  1N4R A;  3TG4 A;  2YNQ A;  3CEQ A;  1A17 A;  3UTM A;  2AVP A;  2R2L A;  4C0M A;  2CG2 A;  3SQV A;  1TN7 A;  4JL0 A;  3UUX A;  1K1A A;  5KCM A;  5EN5 D;  1LD7 A;  3CK7 A;  4JEU A;  5BW8 C;  2IFU A;  3X2Q E;  4DX7 D;  5HQ8 A;  1IYG A;  4A3T A;  3PRE A;  2ZGD A;  3C5R A;  3Q5M A;  3S7D A;  3FUH A;  2VSN A;  3Q79 A;  3R9M A;  2LXL A;  2BF0 X;  3D9N A;  5CBO A;  3MKQ B;  2RG8 A;  3PRZ A;  4ACK A;  4N3A A;  1HZ4 A;  3SNX A;  2Q7F A;  2XCC A;  3CQC B;  3CVX A;  3V30 A;  2C2L A;  3FEX A;  3AS5 A;  3EU5 A;  1QBQ A;  2H6H A;  3APD A;  4K5B A;  3UQ3 A;  4DX2 A;  4GML A;  2WXH A;  3ZHE A;  3VTY A;  4L7T A;  3LY7 A;  3PNT B;  4GAA A;  3ABM E;  3ULY A;  4OVU A;  3G2U A;  3MZL B;  1OY3 D;  2GRR B;  3Q15 A;  4WWN A;  2IO3 C;  2FUL A;  3FUF A;  2QC9 A;  3MGB A;  4HS2 A;  2B6C A;  2P2C P;  4BX8 A;  4U0S A;  4AOF A;  1FPP A;  4FUL A;  4FLB A;  4XIF A;  3FHE A;  4TV3 A;  1OT8 A;  4FP7 A;  3PE3 A;  4LRZ A;  1BI8 B;  5BXO A;  2WXK A;  4RG9 A;  3CHO A;  3G2S A;  1S64 A;  2ZU6 B;  4GCN A;  2DWZ A;  3ULQ A;  2DVW A;  4EZJ A;  3P2B A;  3ISM C;  4AV7 A;  2KAT A;  3EJN A;  4P29 A;  4PS8 A;  2AWI A;  1KT1 A;  3PEU B;  2NC9 A;  2A4Z A;  3TWW A;  5AAR A;  5FQ7 A;  4XEI G;  1H6O A;  3L13 A;  4KZ0 A;  4AVX A;  1TNU A;  3Q49 B;  3WXX A;  1WM5 A;  4YDO A;  4JHK A;  4I43 A;  3CVN A;  3OXG A;  3JUI A;  4J7W A;  3CVP A;  4HFG A;  3T5V A;  1SA5 A;  2LSV A;  4DRX E;  2V4H C;  5EIL A;  3FTX A;  2QY7 A;  2XZT G;  4IYP A;  4I2W A;  2EIJ E;  4J8F A;  4U8V D;  1AWC B;  4OAU C;  1N52 A;  2P9U G;  3ZU7 B;  4YVQ C;  1Z5S C;  2GRN B;  1OCZ E;  4BER A;  1Z3Y A;  3NAW A;  4CT4 A;  3U64 A;  3OAW A;  1E8X A;  4XX5 A;  5KJM A;  2ETA A;  4WNE A;  4PS3 A;  5ARF A;  4R7L A;  4BTB A;  5CEA A;  4U7E B;  3IV0 A;  4E85 A;  3CVU A;  2BKG A;  4A1G A;  5EX3 A;  3D9K A;  4L1B A;  2GRO B;  3EDT B;  3RIB A;  2HR2 A;  4CZ2 D;  4HOT A;  3CVV A;  2MRI A;  3HVE A;  3AG4 E;  3LPZ A;  5G2N A;  2Y4T A;  3TG5 A;  2J9Q A;  4ILI A;  4CEM A;  5ENT D;  4AEZ C;  4GYW A;  2I2O A;  1H6P A;  4AXH A;  4RVB A;  3FTV A;  2WVI A;  5HS0 A;  4GZD A;  3Q78 A;  3QKY A;  4NRH B;  3EU9 A;  2R02 A;  3VLD A;  3HDX A;  3D9P A;  4JD2 G;  4EZK A;  1HE8 A;  1E8Z A;  3FU5 A;  3D9O A;  1JPL A;  3KS2 A;  2J09 A;  2ZIR A;  1OWN A;  5AQ9 A;  1X81 A;  3AU4 A;  4A1S A;  3ZW3 A;  4KVM A;  5A6C A;  2IO2 C;  3Q7F A;  4UQY A;  3FUE A;  4LER A;  2M63 A;  2E2E A;  1H2T C;  4FLH A;  4TXQ A;  5FZS A;  4DK5 A;  2KC7 A;  3CKC A;  4ZFH A;  4NAC A;  4W9R A;  3HHM A;  4ATZ D;  3OXL A;  3ZVV A;  3DSV A;  1L5J A;  5C1D A;  3CHS A;  4U8H A;  3IHY A;  2QYJ A;  4KT6 B;  4GA2 A;  4G11 A;  3LKU A;  3CHM A;  1Y8M A;  2LXM A;  3DBS A;  2LAI A;  3V2X A;  3EHR A;  3PS6 A;  5D2M C;  1ELR A;  2OEV A;  3JXI A;  3QNK A;  2C0L A;  5FIN A;  1TN8 A;  2JLB A;  1HS6 A;  4FJY A;  3ZNG A;  4A3V A;  4IN3 B;  1HG5 A;  2HO1 A;  3TWQ A;  4OYS A;  4WNG A;  3ZUV B;  3NOG D;  3C72 A;  4GTO A;  4YND A;  4XKC A;  4UQX A;  5CER B;  4MLP A;  2B0O E;  4WUY A;  1RW2 A;  4ILG A;  4AJW A;  4U63 A;  3FEY A;  5AQA A;  4J8E A;  2VGY A;  1OUV A;  1FVF A;  1Z3X A;  3CHR A;  5B1B E;  2IU1 A;  2LUH A;  2P9L G;  2IOS A;  3T5X A;  3UM3 A;  3ZXS A;  2XGO A;  3O4Z A;  5DIZ A;  5A7D B;  4EQF A;  3S7F A;  3ZYK A;  5KWD A;  3UI2 A;  3MV3 B;  1IHG A;  2C0M A;  2I6H A;  2P58 C;  2KCL A;  1N4S A;  3FTW A;  4L9P A;  3CVL A;  4C9B B;  2VTB B;  1TEZ A;  4G1T A;  4BWR A;  2DZN A;  3KD7 A;  4AIF A;  3K9I A;  3LVQ E;  4I9C A;  3FTY A;  4F1P A;  3FUN A;  4HBD A;  4CDM A;  3PZ3 A;  2YIN A;  2DCP A;  4U96 D;  2ETC A;  2XHE A;  2VSY A;  3EHQ A;  3AU5 A;  1GW6 A;  1OCR E;  1E90 A;  1OWL A;  2IQC A;  3ZRH A;  4HI8 A;  5ENS D;  1BLX B;  3APC A;  3AS8 A;  5JJ6 A;  3RAU A;  3GW4 A;  1N11 A;  2Y69 E;  4M3O A;  4DX6 D;  1O1R A;  1N0Q A;  4UWF A;  4Y6C A;  5CHE E;  3UIP C;  4J0U A;  4Q69 A;  4LG6 A;  3DXM G;  3GZ2 A;  2P9K G;  5ENP D;  4A63 B;  4HRM B;  3ZHE B;  4APF A;  5AQB A;  4J8Y A;  4CCA A;  1O1S A;  4GMJ A;  1KLX A;  3CK9 A;  4M7C A;  1S0P A;  4MS6 A;  1NFI E;  2BTD A;  5CMW A;  1TNY A;  2IJG X;  5G55 A;  1MJ0 A;  2FI7 A;  3IXE A;  3ZEF A;  3RSE G;  5LCW J;  3EIJ A;  4JHJ A;  2A5U A;  2WB2 A;  2J8S D;  3MKQ A;  3D9M A;  2GRP B;  5G05 J;  4KXK B;  2VJ8 A;  2NXP A;  5FZQ A;  4DJA A;  1ZBP A;  4LNG A;  1OCC E;  2RD0 A;  3AAA C;  4JEH A;  4V3I A;  2I9C A;  3Q9U C;  2XEV A;  2KZT B;  4GZ5 A;  4G23 A;  3W9F A;  5CRV A;  3VLE A;  2L6J A;  3FU0 A;  1KT0 A;  3HXC A;  2X6J A;  5KJN A;  2X38 A;  4DPR A;  3LJ3 A;  5JHA A;  2IOL A;  2YHC A;  1IKN D;  4JXT A;  3FUI A;  5JA4 D;  3B7S A;  2AXU A;  2DBA A;  1YMP A;  4I1M A;  2FO1 E;  4ANX A;  3SI5 A;  3SFX A;  4HLL A;  3EUV A;  2KM4 A;  4N2Q A;  5EDS A;  5EYP F;  4L2L A;  1N94 A;  4B89 A;  3RU0 A;  4HQD A;  3HIZ A;  3HXD A;  3FFL A;  4ABN A;  2L9B A;  3CK8 A;  1PC2 A;  4DX1 A;  1UOH A;  2I1J A;  4JVS A;  2VGE A;  4J8D A;  2P9I G;  2HM8 A;  3QWW A;  2WQH A;  1DCQ A;  3NB2 A;  3GZ1 A;  1TNB A;  5T3R A;  2R5S A;  1S70 B;  3C3O A;  4K5A B;  4WNF A;  3CV0 A;  2ION A;  3CR3 A;  4TUU A;  1Z6T A;  1TNZ A;  3RRM B;  4BY6 A;  2GRL A;  1FVH A;  2P9S G;  2RFA A;  1LF8 A;  4XI0 A;  1NL4 A;  2JAB A;  3QB2 A;  5B1A E;  3ASH A;  3TWX A;  1K3Z D;  4O60 A;  1KPS B;  3CVQ A;  5AJL A;  5FWQ A;  4YVO A;  2XZD G;  3PUK A;  3HXE A;  3TWR A;  4G8K A;  1H19 A;  2XQ0 A;  5ENR D;  3LEW A;  3ZYM A;  1IHB A;  2PM7 A;  3ABK E;  1TNO A;  4JC8 A;  3I4G A;  3PUJ A;  4XZ4 A;  3DXK G;  5KBA A;  4I6E A;  1X5B A;  3SD5 A;  5IY5 E;  1N0R A;  3DST A;  3JXJ A;  3PEV B;  3CST A;  4GTQ A;  2X6K A;  2WPV A;  4LSZ E;  2AXV A;  2XEH A;  2FF4 A;  4L2Y A;  3E4B A;  1SQM A;  5ANR A;  1XNF A;  3KEA A;  4WAF A;  4K0R A;  3UXG A;  1MX6 A;  3FUL A;  4N5Q A;  3FTS A;  2A5E A;  2XEE A;  3D9L A;  4ATG A;  1TJC A;  4GYY A;  5A23 A;  3ZYQ A;  5KJK A;  4D10 C;  3V31 A;  5ENQ D;  1QZ2 A;  2WXP A;  3F6Q A;  2E0I A;  1OCO E;  4MKT A;  2LO6 A;  4AM9 A;  2F8X K;  4ACL A;  4RLY A;  2NSZ A;  1WDY A;  2VSX E;  1DC2 A;  4U0U A;  3PZ2 A;  5LX8 A;  3UKR G;  3LJN A;  5ARG A;  2HE0 A;  2PNN A;  2CG3 A;  4JW1 A;  4DLQ A;  4GTV A;  4B0Z A;  4K5C A;  4XKB A;  3JYS A;  2BED A;  4BT8 A;  1NP7 A;  5ANL A;  5KNG A;  3D9I A;  1MX2 A;  1PY1 A;  4APO A;  3GYZ A;  3S7J A;  3LDZ A;  4ZHB A;  2GRQ B;  3PVL A;  4HLE A;  2X6H A;  4KBQ A;  3QAR A;  1E8W A;  3JUE A;  4GMR A;  3NBN B;  1MQS A;  3SF4 A;  4LUN U;  4ME2 A;  4I6G A;  4BX9 A;  3BG0 B;  2WQ6 A;  3B7R L;  5CRU A;  2WMO A;  3ONL A;  2CHZ A;  4YDY A;  3ZGQ A;  3KSQ A;  3AG1 E;  2NYJ A;  1HFA A;  3FH8 A;  4RG6 A;  4G2V A;  3ENE A;  3I5P A;  5EYL A;  4BT9 A;  3L17 A;  1IQR A;  4GCO A;  3N71 A;  3APF A;  3Q4A B;  3ESK A;  1TR4 A;  3MKR A;  2F37 A;  4BTA A;  3BQO A;  4HOQ A;  2WXL A;  1N4Q A;  4URK A;  1LD8 A;  1EPU A;  4DX5 D;  3ABL E;  3KEZ A;  1OWO A;  4FU3 A;  4N39 A;  3QC1 A;  4IRU A;  3V2O A;  1WAO 1;  1B89 A;  2PQN A;  2GGF A;  3G2V A;  4TUM A;  1Y6I A;  4A55 A;  3D9H A;  3KAE A;  5EX0 A;  1N95 A;  5EID A;  2KCV A;  2XCB A;  1DNP A;  4DUI A;  3HYM B;  2OVB A;  2WXJ A;  3CLJ A;  3FY4 A;  5JHB A;  1P5Q A;  2IF4 A;  3D3M A;  3TAX A;  3Q47 B;  4GTM A;  1YA0 A;  4BSX A;  1MZC A;  3LS8 A;  3L22 A;  4JA9 A;  4FA6 A;  2PZI A;  1A5E A;  1ZB1 A;  4JPS A;  3J5P A;  4MRU A;  1WG0 A;  4B93 B;  4HRL A;  4F3V A;  3U66 A;  2YHE A;  1HO8 A;  2V4L A;  3DSU A;  3NQP A;  2VYI A;  3R9A B;  2WXF A;  4UI9 K;  1K1B A;  2UY1 A;  5AJD A;  5FQ6 A;  2DYS E;  3IEG A;  4H7Y A;  1UJK A;  1BU9 A;  5FJY A;  3AG2 E;  3SHF A;  3AS4 A;  2WXN A;  2GRM A;  4J8S A;  5G04 C;  3SFY A;  5DBK A;  3W9G A;  1U3D A;  4J6I A;  5AEN A;  5CCM A;  1FT2 A;  5CED B;  3LYA A;  3RK6 A;  3C3Q A;  3FDH A;  5LFA A;  5H7P A;  4ILH B;  3RRU A;  3OTN A;  3T9K A;  2H6G A;  3EHN A;  3OXF A;  3FUK A;  2DYR E;  4HB5 A;  2KCK A;  4AP2 A;  1D9S A;  4Q96 A;  4KYO B;  2EIL E;  3SFZ A;  4CT0 A;  4FHJ A;  5ENN A;  4DI4 A;  3B7B A;  4TXP A;  1D8E A;  1AP7 A;  1H2U A;  2QFC A;  3CKB A;  3SY2 A;  2VQ2 A;  3Q75 A;  2OVF A;  2GW1 A;  3ZXP A;  4FHK A;  4ANU A;  5J90 A;  4Y6W A;  4PDX A;  4FAD A;  3L9T A;  3U4T A;  2WXG A;  2EIN E;  3ZN3 A;  1FT1 A;  2EIK E;  2H6I A;  4U07 A;  1ZU2 A;  1QYM A;  1BD8 A;  4N2S A;  5J08 A; 
#chains in the Genus database with same CATH homology
 4RLY A;  2RFM A;  5CBN A;  1WDY A;  3AAA C;  1MYO A;  2BKK B;  5HS0 A;  3TWQ A;  1DC2 A;  3TWW A;  3Q9U C;  3ZUV B;  2JAB A;  4NIK A;  5AAR A;  3NOG D;  4U96 D;  2ETC A;  3LJN A;  3TWU A;  2HE0 A;  2PNN A;  3TWX A;  1K3Z D;  4HNA D;  3HG0 D;  4O60 A;  4YDW A;  4DX5 D;  3W9F A;  1YYH A;  3EU9 A;  4HI9 A;  5KNH D;  4JB8 P;  2ZGG A;  2Y1L E;  5JMN D;  3B95 A;  3W9G A;  5CER B;  2XZD G;  5BXU A;  4HRN A;  3V2O A;  5AAO A;  2B0O E;  2KBX A;  5HRY A;  3V30 A;  5EIB E;  2KXP C;  3EHQ A;  3TWR A;  2AJA A;  4K5C A;  3HRA A;  4TUM A;  4G8K A;  3TWS A;  4J7W A;  3T8K A;  5ENR D;  1YCS B;  4CYM D;  4HI8 A;  4DRX E;  5KNG A;  5CED B;  3D9H A;  4O1P A;  4OAV B;  5ENS D;  4K5B A;  1BLX B;  2V4H C;  1IHB A;  1IKN D;  1SVX A;  5EIL A;  3ZKJ A;  4DX2 A;  4C48 B;  4BSZ B;  2XZT G;  5AN8 A;  1MX2 A;  4U8Y D;  5AQA A;  1N11 A;  4U95 D;  5EID A;  2Y0B G;  4F6R D;  5JA4 D;  4DX6 D;  4U8V D;  4LNU D;  1IXV A;  1YMP A;  2F8Y A;  3DEP A;  5AQ9 A;  4ZHB A;  1AWC B;  1N0Q A;  2FO1 E;  3ZU7 B;  2F8X K;  4OAU C;  3SO8 A;  5KBA A;  3JUE A;  4GMR A;  3T9K A;  4DUI A;  3NBN B;  5FIO A;  4HLL A;  4LG6 A;  5HKP A;  1OY3 D;  3DEO A;  4BER A;  5ENP D;  4A63 B;  2QC9 A;  4HB5 A;  2ETB A;  1D9S A;  3AJI A;  4QQI A;  4Z68 A;  4HRM B;  2MYO A;  5EYP F;  1N0R A;  3Q9N C;  4O1O A;  3JXJ A;  4ZFH A;  2ETA A;  4GPM A;  5AQB A;  4J8Y A;  3UTM A;  2P2C P;  5KWD A;  3B7B A;  3UI2 A;  4ATZ D;  1AP7 A;  4HQD A;  5CEA A;  5ITZ F;  1BI7 B;  4LSZ E;  4BET A;  4BEP A;  2XEH A;  5ENO D;  2BKG A;  4YDY A;  1A5E A;  1NFI E;  2NYJ A;  2QYJ A;  2XEN A;  1K1A A;  4DX1 A;  3J5P A;  3KEA A;  1MJ0 A;  1SW6 A;  1OT8 A;  1UOH A;  5EN5 D;  5AQ7 A;  3V79 K;  1WG0 A;  4CZ2 D;  3NOC D;  3IXE A;  3UXG A;  1MX6 A;  2VGE A;  4N5Q A;  4B93 B;  2A5E A;  2XEE A;  4UUC A;  1BI8 B;  4HRL A;  5EYL A;  3V2X A;  2DZN A;  4DX7 D;  5BXO A;  1DCQ A;  3TWV A;  3EHR A;  3TWT A;  1MX4 A;  4BES A;  2ZGD A;  3J5Q B;  2DWZ A;  1S70 B;  2DZO A;  2J8S D;  4K5A B;  5D66 A;  3JXI A;  2DVW A;  3C5R A;  3V31 A;  1K1B A;  1TR4 A;  5ENQ D;  5FIN A;  2V5Q C;  4G8L A;  2F37 A;  1BU9 A;  3F6Q A;  4F1P A;  4HBD A;  5ENT D;  1G3N B;  2L6B A;  2RFA A;  5CEC B;  3ZNG A;  5CBO A;  4QFV A;  1QYM A;  1BD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...