3Q9NC

In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
157
structure length
157
Chain Sequence
FGQDLGKKLLEAAAAGQDDEVRILMANGADVNATDDNGLTPLHLAAANGQLEIVEVLLKNGADVNASDSAGITPLHLAAYDGHLEIVEVLLKHGADVNAYDRAGWTPLHLAALSGQLEIVEVLLKHGADVNAQDALGLTAFDISINQGQEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A de novo protein binding pair by computational design and directed evolution.
pubmed doi rcsb
molecule keywords CoA binding protein
molecule tags Protein binding, de novo protein
source organism Escherichia coli
total genus 53
structure length 157
sequence length 157
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3q9nC00
4HRNA 3ZUVB 4TUMA 1UOHA 1AP7A 5EIBE 4NIKA 4G8KA 4U96D 5HKPA 4G8LA 5BXOA 4F6RD 5JA4D 1OT8A 4LSZE 4ZFHA 3B95A 5CBOA 4HRMB 4HB5A 4N5QA 4HRLA 1WG0A 5FIOA 4ZHBA 2ETBA 3JXJA 1N0RA 2RFAA 1BLXB 4DRXE 4HLLA 4BERA 2NYJA 5AQAA 3W9GA 4HQDA 1YYHA 1SW6A 2DZOA 4F1PA 4DX6D 4OAVB 3TWVA 5KNGA 2ZGGA 5ITZF 3D9HA 4HI8A 3EHQA 3UTMA 3DEPA 3Q9UC 2XZDG 4DX5D 1BI8B 5ENRD 4BEPA 1BI7B 2JABA 1N11A 5EILA 1YCSB 4QFVA 2F8YA 5EYLA 1MJ0A 2A5EA 2V4HC 1IHBA 3W9FA 2F37A 3JXIA 3V2XA 4J8YA 1MYOA 3SO8A 1K1BA 2FO1E 1D9SA 1IXVA 4DX2A 3Q9NC 5CERB 3TWRA 3V2OA 4U95D 3V79K 5AQ9A 3TWXA 4K5CA 2B0OE 4O1PA 3TWUA 5AQ7A 2HE0A 3ZU7B 5AARA 5ENOD 3UI2A 1K3ZD 1OY3D 1S70B 5ENPD 4J7WA 5JMND 4LG6A 5FINA 4CZ2D 1BU9A 2BKGA 4LNUD 5KBAA 1NFIE 3UXGA 4Z68A 4OAUC 4HI9A 2V5QC 4GMRA 4JB8P 1A5EA 2ZGDA 3IXEA 4RLYA 3TWQA 4HNAD 5BXUA 1N0QA 4K5AB 4QQIA 2F8XK 3C5RA 4DUIA 3TWTA 4O60A 3V31A 3KEAA 1SVXA 5HRYA 1BD8A 2KXPC 1G3NB 2P2CP 2XEHA 3F6QA 4C48B 2RFMA 2DVWA 2XEEA 3DEOA 3JUEA 5CECB 3V30A 4A63B 4B93B 5EN5D 2VGEA 4K5BA 1MX4A 4U8VD 5KNHD 2DWZA 5AAOA 3ZNGA 4YDWA 5EYPF 2MYOA 2QC9A 5EIDA 4BESA 1AWCB 2KBXA 1MX6A 2DZNA 3B7BA 3J5QB 4O1OA 3TWWA 4UUCA 4CYMD 1IKND 1WDYA 3J5PA 1MX2A 4BSZB 2L6BA 1YMPA 5CEAA 3NOCD 3AAAC 3LJNA 2J8SD 1K1AA 5ENQD 3ZKJA 3HRAA 3T9KA 3TWSA 5D66A 1QYMA 4DX1A 4U8YD 5HS0A 3EHRA 2XZTG 4GPMA 5CEDB 2Y0BG 4HBDA 2PNNA 2QYJA 5ENTD 4YDYA 1TR4A 3T8KA 4DX7D 3EU9A 5AN8A 2BKKB 2ETAA 3NBNB 5KWDA 5ENSD 4ATZD 2Y1LE 5AQBA 1DCQA 4BETA 3AJIA 2XENA 1DC2A 2ETCA 2AJAA 3HG0D 5CBNA 3NOGD
chains in the Genus database with same CATH superfamily
2E0IA 1UOHA 4NIKA 4G8KA 1OT8A 3RK6A 3PUJA 4HRLA 2P9LG 2IFUA 3UPVA 2XRYA 3CGHA 3RRMB 2DIWA 4L2YA 4OYSA 4GA1A 4DLQA 1SW6A 4AY6A 4OAVB 3Q7AA 4CGVA 4QFVA 2A5EA 2F37A 3AG3E 2FO1E 3AG1E 3Q9NC 2YNQA 4GYOA 2V8SE 4K5CA 3FU6A 4FJYA 3TXMA 2GRRB 1QQEA 2VSNA 1JUQA 4CT4A 3TG4A 5KBAA 3BG1B 3HXDA 2ZGDA 3MZLB 4APOA 3L82A 2PZIA 4EECA 3UM2A 2KXPC 3DXKG 4CEMA 4K0RA 2GRPB 4HORA 3SF4A 4BY6A 2X38A 4LUNU 1Z3YA 3DBSA 3Q15A 3EUVA 3Q79A 3EIQC 1OWOA 5B1BE 1HS6A 1NZNA 4U0SA 3GZ1A 4ILIA 4ATZD 4O6FA 2WXKA 3LVQE 3ZYLA 3L13A 4HRNA 3ZUVB 3FUIA 3DPDA 1ELWA 4JZYA 2R2LA 5FIOA 3CSTA 3PE3A 3W9GA 4N3CA 3AG4E 5LOZA 5KNGA 3ULYA 4GTQA 2WXOA 4WNGA 1BI8B 3PS6A 1N9AA 4GPKA 1YCSB 4RG9A 1N95A 3DSWA 3SFZA 4YVOA 4WNDA 5B1AE 2KCLA 2LXLA 2R03A 2Q7FA 3HHMA 3PH0C 2HE0A 3S7DA 1S70B 5ENPD 5G05C 4Z68A 2EIME 3VTXA 3E37A 3C3RA 4U63A 4RLYA 4GCOA 1DCEA 4U04A 3ESLA 1W3BA 2XPYA 4C48B 4I9EA 5AJLA 2CHWA 3FTZA 3FUDA 2VGEA 4U8VD 2OCCE 4UI9C 5BNWA 3MKQA 4LERA 5EIDA 3KAEA 5A23A 3TWWA 1DNPA 4MKTA 3ENEA 4HFGA 4N2QA 3FTWA 4OVUA 4U8YD 4CCAA 3AS5A 2UWJG 4UQXA 3ZYKA 3T8KA 3O4ZA 2LSVA 4A3VA 4OVVA 4KMOA 4UWKA 3CVUA 5FT9A 5EIBE 3IBEA 3D9MA 5CBOA 3PNTB 3JXJA 2ZU6B 2X6FA 2PQRA 2PM6A 3JYSA 3HXFA 1LD7A 1UN8A 4X8QA 4Q94A 1MYOA 1HZ4A 4UWFA 3MKRA 1H19A 4U95D 4KVOA 1H6PA 4G26A 4F53A 4KT6B 3UIPC 2KZTA 2CFUA 2GROB 4GB9A 1FCHA 2WB2A 2XCBA 4CZ2D 2OEVA 2WXLA 1NP7A 4WUYA 3P2BA 4CDMA 4KZ0A 2BF0X 1G3NB 4IYPA 1HO8A 4I6JA 2XS8A 1FT1A 4P29A 2X6HA 5ANLA 1JWFA 2OVFA 4K5BA 5C2YA 4WNFA 4YDWA 4BT9A 3FUNA 2VJ8A 3ASHA 4ILGA 4HOTA 3HDXA 1MX2A 1E96B 3Q78A 3AAAC 3PEVB 2J8SD 1K1AA 1O5MA 2PQNA 2XZTG 2Y0BG 3ASOE 1HX8A 3FHEA 3APCA 2DCPA 2YQ8A 5KWDA 1XGWA 4BWRA 2ETCA 3HG0D 3FUJA 3R9MA 1AP7A 4IULA 4Y6WA 4B94A 4BFRA 2RKKA 3C72A 2H6FA 3RKVA 3ABLE 3HVEB 3ZIMA 4H7XA 4B0ZA 4TV3A 1H2UA 1RW2A 1WAO1 4NRHB 2XGSA 4U8HA 5EILA 1NI1A 2WXGA 4FHJA 3D9NA 3PZ1A 3UT8A 5EDSA 1IXVA 3MV2B 3UKUG 3FWVA 1N4PA 3V79K 3LY7A 3E32A 3NZUA 4ANXA 4IRUA 2ZISA 5G55A 2LSUA 2WXPA 3LXUX 4ANWA 3HXBA 3JCKC 4EBAA 3UQ3A 5FQ7A 4WWNA 4K5AB 2R59A 4I2WA 1LTXA 4O60A 3V31A 2IOSA 2X3MA 3EHMA 2XEHA 3DXMG 2XEEA 3LVRE 3QWVA 1TJFA 4B93B 5KNHD 1VDYA 5FJYA 1HFAA 1H2TC 2AW6A 1IQRA 2VTBB 1FVHA 4PUCA 2WM9A 2VGXB 2KM4A 2KCVA 4UWLA 1EYHA 3QOUA 3ZPJA 5ENNA 3EU9A 5FZQA 2WMNA 5AN8A 4YDOA 4BETA 1Z5SC 4I6GA 3UKRG 3CQCB 1V55E 4KZCA 5JJTA 4TXQA 4GTTA 4DLOA 2QYUA 1OWMA 3QWPA 4Q96A 3MGBA 1E90A 2LO6A 4HXIA 3R7QA 4BERA 3FTSA 3Q49B 4KYOB 2PL2A 4HI8A 3TL5A 2WQ6A 2CG2A 3LYAA 5FWQA 3NZSA 1JWGA 1N94A 2BUGA 1D9SA 3FH8A 3CVNA 3T5XA 4FP7A 4J7WA 4LRZA 2J09A 4LNUD 2IU1A 3FUEA 3GZ2A 4I9CA 4HS2A 3SGHA 3D9LA 3CVXA 4N5CA 4U7EB 2DVWA 3CSFA 4GA0A 3V30A 2C0MA 3DSTA 3HXEA 3ZNGA 1N4RA 2MYOA 2P58C 1U3CA 4ILHB 4J6IA 1OUVA 2FULA 3J5PA 4BSZB 5G04C 5T4YA 2WQ7A 3ZKJA 2C0LA 1O1SA 4AXHA 5DBKA 4EQFA 3NBNB 5T3RA 3ZW3A 4GTOA 4N3BA 3AS8A 2XENA 2OOEA 4LNBA 3CEQA 4U96D 5BXOA 5JA4D 1ELRA 2IOLA 1TNYA 4JVSA 1N0RA 4UI9K 3DRAA 5FZRA 2QZAA 3Q5MA 2VSXE 3APFA 3Q73A 1EDUA 4DX5D 1SA4A 2V4HC 2I9CA 4L23A 4J8FA 3OTNA 1ZB1A 3TJPA 1HU3A 2B6CA 2FEZA 5ARFA 4GAAA 4V3IA 3E4BA 4C9BB 2J49A 5FINA 3ZVVA 3LKUA 4GMRA 3I5PA 4GTRA 2WXMA 3OXFA 2IF4A 4DPRA 4JA9A 2EILE 2VSOE 3JUIA 3UUXA 4U0ZA 3G2TA 5AAOA 2I6HA 1MHQA 2KBXA 1N4QA 3J5QB 2F0YA 3DWLG 1YMPA 3L08A 4ME2A 3ULEG 4J8EA 3OXLA 2XPZA 1E7VA 1Q2ZA 3CKCA 3GZSA 4G25A 1OWPA 2KCKA 3GW4A 5JHAA 4CRWA 2CG3A 4A1GA 5CBNA 3N71A 4TUMA 3PZ2A 1TN8A 5KJMA 4HOUA 3IHYA 5AJDA 3IHVA 1NA3A 5AQAA 4DI4A 1JCSA 4I2ZA 2DZOA 4R7LA 2IY0C 3C98A 4W9RA 4H7YA 2PM7A 4GTMA 2C2LA 3JXIA 3SO8A 2Y4TA 2QFCA 5AARA 5H7PA 3UI2A 5JJ7A 3TGOA 3QB2A 5ARGA 3C3OA 3S2AA 1NFIE 5ANRA 3CIAA 4HI9A 1B89A 1HXIA 1TNBA 3MA5A 4M3OA 4YDEA 1N0QA 3JQ1A 4DUIA 1Z3XA 3KD7A 3UIOC 1TN6A 3KEAA 4JHKA 5J90A 2RFMA 3MX3A 4WAFA 3DEOA 3K9IA 2VYIA 3LY9A 1NL4A 3ASGA 4LNGA 1MX4A 2GRNB 1U2VG 2VGYA 4EBAG 4ATGA 2L0TB 3CVVA 3B7BA 3CKBA 2WXRA 4L9PA 2QY7A 2E2EA 3NB2A 3NF1A 1H6KA 3SQVA 1FPPA 3SD5A 4HOSA 5ENTD 1PC2A 4A55A 3DSUA 2KATA 4HOQA 3AJIA 3SI5A 3UM1A 3NOGD 4I1AA 4GZCA 4BTAA 1IYGA 4A3TA 3U9WA 3CR3A 1H0AA 1Y8MA 1OWLA 5CRUA 4PH4B 4F1PA 1WY6A 4JXTA 3CVYA 4G1TA 1BI7B 1TNZA 4CDRA 3DSSA 2DBAA 1MJ0A 3ASNE 4J8YA 3UMVA 4WNEA 5CERB 3CHPA 2CHXA 4RQIA 3E34A 2XS1A 2DYRE 2WXQA 5BPPA 1EF1C 4FHKA 4I1OB 3TWQA 3MV3B 3BQOA 3LEWA 5CCMA 4GZDA 3MKQB 3QAQA 1N52A 4ABNA 2Y3AA 1JPLA 5D0OD 2WXIA 4EHMA 3SHFA 3UM3A 4UUCA 3SBTB 1L5JA 4JHJA 2LAHA 3NOCD 2WVIA 5ENQD 1XNFA 2AWIA 4L1BA 3D3MA 1Z6TA 3UT7A 5KCMA 2WXJA 3QWWA 3QARA 2YINA 3BEEA 3PEUB 5HKPA 4GU5A 4JD2G 4F6RD 2BTDA 2AXVA 4HB5A 4GZ3A 2L9BA 3RSEG 3HIZA 4LEUA 2ETBA 3Q47B 3G2UA 4DRXE 4BT8A 2X6IA 3KEZA 3TWVA 4AVXA 2L6JA 5CRVA 2IQCA 2KZTB 1K1BA 1ELKA 3B7SA 1NA0A 5AENA 3FU5A 4BX9A 2WXHA 3TWUA 4C0EA 4F1SA 4LG6A 1IHGA 1TNOA 2BEDA 2FI7A 2UY1A 4XI0A 3OXGA 3Q7FA 3IXEA 3PUKA 2H6GA 4GYYA 2OV8A 1ZBPA 5LX8A 1LD8A 2NC9A 4URKA 1E8ZA 2EIKE 2XHEA 1E7UA 3PNLB 3LY8A 2P9PG 3NQPA 4UWHA 3L54A 2LAIA 3LJNA 4GMJA 3G2VA 2NSZA 5HS0A 2EINE 4GPMA 4APFA 4J8DA 3RRNB 3SY2A 1DC2A 1K8KG 2P9IG 2MRIA 2Y4UA 4AOFA 3RU0A 1OXJA 3ZN3A 3G2SA 3EIJA 4HRMB 3QK0A 1GW6A 1HE8A 4PS8A 4K03A 3VLEA 1IQUA 4HQDA 3L6AA 3CHRA 2XZDG 1N11A 4YNDA 4ANVA 4KBQA 2F8YA 2RG8A 3KSLA 3ZHEA 3TG5A 3ZGQA 3KSQA 1U3DA 4GTSA 5KJLA 4BX8A 4I6EA 3S7BA 5BV0A 2EIJE 3QDNA 5ENOD 1K3ZD 1QBQA 5CHEE 2BKGA 4XI9A 3QJZA 2FF4A 2OVBA 2LNIA 3BG0B 3CVPA 2IEJA 1SVXA 1BD8A 3ZYMA 3IKOB 4G2VA 1TN7A 4RVBA 4FA6A 5BUZA 4AEZC 2LUHA 3L17A 5EYPF 1UN9A 2HO1A 3AS4A 1MX6A 4XZ4A 4JL0A 4CDNA 3FTUA 3Q4AB 4UQZA 4NACA 1E8YA 2FO7A 3FY4A 1ZU2A 3FUHA 2ETAA 3VTYA 3PE4A 1P5QA 4XE0A 3LPZA 5BV1A 4ZFHA 4B8AA 1S64A 3CHMA 4AJWA 4XEIG 3QC1A 2GRLA 3D9HA 2OEWA 3UTMA 4Y6CA 3Q9UC 1O1TA 2JABA 5KJNA 2ZIRA 3V2XA 3B7TA 5C1DA 3DSVA 4DX2A 3TWRA 2MHKA 3L16A 5AQ9A 2B0OE 2IJGX 3R9AB 1HF8A 3WXXA 2V0PA 1UW4B 3ZXSA 2L0IA 3ZFWA 1LF8A 3QNKA 1KLXA 5LCWJ 3S7FA 5JHBA 3Q75A 5HQ8A 4HLEA 1BPOA 3JUEA 4XKBA 4A63B 3CVLA 3MEKA 2H6HA 4BTBA 2P9SG 5EN5D 1FVFA 2DWZA 3CK9A 5KJKA 3RO2A 3JQ0A 4BESA 5CEAA 2KC7A 3B7RL 3HRAA 5CCLA 3SFYA 3EHRA 1N54A 4NQ0A 4I43A 3PDNA 2I1KA 3I3NA 4TUUA 1X5BA 4N5QA 1WG0A 2ILRA 3O48A 3MCXA 4MRUA 3FUFA 3RRUA 4HLLA 4F3VA 1KPSB 4DX6D 1OCCE 1SQMA 2V5FA 2J4BA 4MBGA 3EHQA 3PZ4A 3ABME 2WQHA 3D9PA 2WXNA 1IHBA 3LJ3A 3S7JA 4TRQA 4CGWA 3FH7A 5BW8C 2JEKA 4B8CB 3D9JA 5EX3A 3ZU7B 1OY3D 3PZDA 5G2NA 2YHEA 2R05A 4JB8P 2GRQB 1A5EA 2I2OA 4HNAD 2VSYA 1TJCA 3FULA 5HRYA 1UJKA 2J07A 5E76A 1PAQA 3HXCA 3ML8A 2AVPA 4G11A 4EPZA 3LCAA 3ABKE 1AWCB 4GTVA 4N3AA 4CYMD 4I17A 4DI3A 1IKND 2CFZA 5LFAA 5D66A 4L2LA 3HYMB 5CEDB 4HBDA 4TXPA 4YDYA 4DX7D 5FQ4A 4XX5A 4AV7A 2X6KA 5FQ8A 3EDTB 4LSZE 4EZKA 1HG2A 1KZPA 2ZXWE 1YYHA 3B7UX 5G05J 3DEPA 1S63A 3IV0A 4C0MA 5A7DB 3W9FA 2IO3C 3PZ3A 4JA7A 4FADA 1E8WA 4DJAA 4KXKB 4RSYA 4UI9J 4D10C 1TYQG 3SBSA 2M63A 1UG3A 4JEUA 4OAUC 2WPVA 4M7CA 2F8XK 4WWPA 3GYZA 4GZ6A 3RJVA 3ESKA 2ONDA 3B13A 3X2QE 5EKQD 2R17C 3QKYA 2R02A 2GRMA 4L7TA 4GCNA 2IONA 4O1OA 3ASFA 2NXPA 4EZLA 5M72A 2A5UA 4KVMA 3T8MA 4AY5A 3T9KA 3TWSA 3PREA 4DX1A 3L9TA 2GGFA 3I4RB 5EX0A 5B3SE 2H6IA 3ZRHA 2R5SA 4A1SA 4GYWA 2BKKB 1S0PA 5ENSD 4JPSA 4CT0A 5CMWA 3SFXA 3UM0A 5FQ6A 4G8LA 3T5VA 4ANUA 4DK5A 1OCRE 4GTPA 4BSXA 3CVWA 2XRZA 3OAWA 3ZXPA 5T8IA 3G2WA 2J08A 4G23A 2NYJA 2HYZA 2JLBA 3CHQA 1V54E 3HVEA 5BT1A 3CVQA 4BEPA 4FLHA 4PS7A 3E30A 3FH5A 5EYLA 5HI7A 5DIZA 2XQ0A 4RG6A 3ONLA 3V2OA 4O1PA 4FULA 2P9KG 3U4TA 4E6HA 5LP0A 3FTVA 2A4ZA 5AIJA 3CHSA 1QNFA 4GA2A 4XIFA 4QQIA 5FZSA 3TWTA 4JW1A 3EHNA 4LCTA 3FDHA 1KT0A 1EPUA 5J08A 4AM9A 2Y69E 2QC9A 3FTYA 2DZNA 3UINC 3ASDA 3LDZA 1DVPA 2RD0A 5E75A 1QYMA 2XGMA 2VTBA 3D9IA 3I4GA 2VGXA 4I1MA 1HH8A 2J4DA 2Y1LE 3UX4A 5D0QD 3ZEFA 3ULQA 3SZ7A 4PS3A 1WM5A 1QZ2A 3NAWA 3E33A 5IY5E 2P9NG 5JJ6A 3B95A 4MLPA 2J9QA 4ZHBA 4XKCA 3CV0A 4GZ5A 3TXNA 2RFAA 1BLXB 4JEHA 3VLFA 2MOWA 3R7RA 2WMOA 2ZGGA 5ITZF 1H2VC 2XEVA 5AYWD 1KZOA 4AIFA 2IO2C 2XCCA 3CK7A 4JC8A 3FU0A 2UY1B 4F7AA 2VQ2A 1H6OA 5AQ7A 2AXZA 1OCZE 3FU3A 3DPYA 5JMND 1UJJA 3EJNA 4E85A 3FTXA 1JCRA 1BU9A 1TEZA 2V5QC 2GW1A 5BXUA 1SA5A 3C5RA 3PVLA 3KS2A 4EZJA 1D8DA 3FP3A 3U66A 3C3QA 4ACLA 3D9KA 3TAXA 1D8EA 4FU3A 3D9OA 3PRZA 3MYVA 2LXMA 1Y6IA 3L22A 4FC8A 3U64A 4J0UA 3RAUA 1WDYA 1INZA 2XGOA 3RIBA 4TXRA 2X6JA 2QYJA 4B89A 2WXFA 4G24A 3FUKA 1OWNA 1DCQA 2HM8A 5AQBA 3FEXA 3FUMA 1RZ4A 3P1UA 3BU8A 4WWOA 5CMYA 2P9UG 3VLDA 1X81A 1JCQA 1KT1A 3APDA 1E8XA 4GMLA 4U0UA 4IN3B 3CK8A 3EU5A 4MS6A 3CLJA 4FLBA 1MZCA 1FT2A 3ZHEB 2DYSE 4J8SA 2XPIA 3FEYA 4Q69A 5ENRD 2V4LA 3URZA 3BUAA 4N39A 1HG5A 2EQXA 1SZAA 3RO3A 3TWXA 4N2SA 2YHCA 4UQYA 2AXUA 3MJWA 3SNXA 4ACKA 1SZ9A 3UXGA 2FBNA 5G04J 3WG7E 1MQSA 4AP2A 3DSXA 1OCOE 2CHZA 3AU4A 3ONKA 3CHOA 2P2CP 3IEGA 3F6QA 3AU5A 4NURA 3FFLA 4PDXA 5CECB 3U3WA 4U07A 3LS8A 5A6CA 4HVBA 1N4SA 1A17A 1YA0A 1PY1A 3ML9A 4UWGA 2L6BA 1TNUA 5FTPA 2I1JA 5LCWC 2PNNA 1O1RA 4JHRA 1TR4A 3CQGB 4FJZA 2HR2A 3ISMC 3ZYQA 3UT4A 5D2MC 2AJAA 4YVQC 3AG2E
chains in the Genus database with same CATH topology
4HRNA 3ZUVB 4TUMA 1UOHA 1AP7A 5EIBE 4NIKA 4G8KA 4U96D 5HKPA 4G8LA 5BXOA 4F6RD 5JA4D 1OT8A 4LSZE 4ZFHA 3B95A 5CBOA 4HRMB 4HB5A 4N5QA 4HRLA 1WG0A 5FIOA 4ZHBA 2ETBA 3JXJA 1N0RA 2RFAA 1BLXB 4DRXE 4HLLA 4BERA 2NYJA 5AQAA 3W9GA 4HQDA 1YYHA 1SW6A 2DZOA 4F1PA 4DX6D 4OAVB 3TWVA 5KNGA 2ZGGA 5ITZF 3D9HA 4HI8A 3EHQA 3UTMA 3DEPA 3Q9UC 2XZDG 4DX5D 1BI8B 5ENRD 4BEPA 1BI7B 2JABA 1N11A 5EILA 1YCSB 4QFVA 2F8YA 5EYLA 1MJ0A 2A5EA 2V4HC 1IHBA 3W9FA 2F37A 3JXIA 3V2XA 4J8YA 1MYOA 3SO8A 1K1BA 2FO1E 1D9SA 1IXVA 4DX2A 3Q9NC 5CERB 3TWRA 3V2OA 4U95D 3V79K 5AQ9A 3TWXA 4K5CA 2B0OE 4O1PA 3TWUA 5AQ7A 2HE0A 3ZU7B 5AARA 5ENOD 3UI2A 1K3ZD 1OY3D 1S70B 5ENPD 4J7WA 5JMND 4LG6A 5FINA 4CZ2D 1BU9A 2BKGA 4LNUD 5KBAA 1NFIE 3UXGA 4Z68A 4OAUC 4HI9A 2V5QC 4GMRA 4JB8P 1A5EA 2ZGDA 3IXEA 4RLYA 3TWQA 4HNAD 5BXUA 1N0QA 4K5AB 4QQIA 2F8XK 3C5RA 4DUIA 3TWTA 4O60A 3V31A 3KEAA 1SVXA 5HRYA 1BD8A 2KXPC 1G3NB 2P2CP 2XEHA 3F6QA 4C48B 2RFMA 2DVWA 2XEEA 3DEOA 3JUEA 5CECB 3V30A 4A63B 4B93B 5EN5D 2VGEA 4K5BA 1MX4A 4U8VD 5KNHD 2DWZA 5AAOA 3ZNGA 4YDWA 5EYPF 2MYOA 2QC9A 5EIDA 4BESA 1AWCB 2KBXA 1MX6A 2DZNA 3B7BA 3J5QB 4O1OA 3TWWA 4UUCA 4CYMD 1IKND 1WDYA 3J5PA 1MX2A 4BSZB 2L6BA 1YMPA 5CEAA 3NOCD 3AAAC 3LJNA 2J8SD 1K1AA 5ENQD 3ZKJA 3HRAA 3T9KA 3TWSA 5D66A 1QYMA 4DX1A 4U8YD 5HS0A 3EHRA 2XZTG 4GPMA 5CEDB 2Y0BG 4HBDA 2PNNA 2QYJA 5ENTD 4YDYA 1TR4A 3T8KA 4DX7D 3EU9A 5AN8A 2BKKB 2ETAA 3NBNB 5KWDA 5ENSD 4ATZD 2Y1LE 5AQBA 1DCQA 4BETA 3AJIA 2XENA 1DC2A 2ETCA 2AJAA 3HG0D 5CBNA 3NOGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HRN A;  3ZUV B;  4TUM A;  1UOH A;  1AP7 A;  5EIB E;  4NIK A;  4G8K A;  4U96 D;  5HKP A;  4G8L A;  5BXO A;  4F6R D;  5JA4 D;  1OT8 A;  4LSZ E;  4ZFH A;  3B95 A;  5CBO A;  4HRM B;  4HB5 A;  4N5Q A;  4HRL A;  1WG0 A;  5FIO A;  4ZHB A;  2ETB A;  3JXJ A;  1N0R A;  2RFA A;  1BLX B;  4DRX E;  4HLL A;  4BER A;  2NYJ A;  5AQA A;  3W9G A;  4HQD A;  1YYH A;  1SW6 A;  2DZO A;  4F1P A;  4DX6 D;  4OAV B;  3TWV A;  5KNG A;  2ZGG A;  5ITZ F;  3D9H A;  4HI8 A;  3EHQ A;  3UTM A;  3DEP A;  3Q9U C;  2XZD G;  4DX5 D;  1BI8 B;  5ENR D;  4BEP A;  1BI7 B;  2JAB A;  1N11 A;  5EIL A;  1YCS B;  4QFV A;  2F8Y A;  5EYL A;  1MJ0 A;  2A5E A;  2V4H C;  1IHB A;  3W9F A;  2F37 A;  3JXI A;  3V2X A;  4J8Y A;  1MYO A;  3SO8 A;  1K1B A;  2FO1 E;  1D9S A;  1IXV A;  4DX2 A;  3Q9N C;  5CER B;  3TWR A;  3V2O A;  4U95 D;  3V79 K;  5AQ9 A;  3TWX A;  4K5C A;  2B0O E;  4O1P A;  3TWU A;  5AQ7 A;  2HE0 A;  3ZU7 B;  5AAR A;  5ENO D;  3UI2 A;  1K3Z D;  1OY3 D;  1S70 B;  5ENP D;  4J7W A;  5JMN D;  4LG6 A;  5FIN A;  4CZ2 D;  1BU9 A;  2BKG A;  4LNU D;  5KBA A;  1NFI E;  3UXG A;  4Z68 A;  4OAU C;  4HI9 A;  2V5Q C;  4GMR A;  4JB8 P;  1A5E A;  2ZGD A;  3IXE A;  4RLY A;  3TWQ A;  4HNA D;  5BXU A;  1N0Q A;  4K5A B;  4QQI A;  2F8X K;  3C5R A;  4DUI A;  3TWT A;  4O60 A;  3V31 A;  3KEA A;  1SVX A;  5HRY A;  1BD8 A;  2KXP C;  1G3N B;  2P2C P;  2XEH A;  3F6Q A;  4C48 B;  2RFM A;  2DVW A;  2XEE A;  3DEO A;  3JUE A;  5CEC B;  3V30 A;  4A63 B;  4B93 B;  5EN5 D;  2VGE A;  4K5B A;  1MX4 A;  4U8V D;  5KNH D;  2DWZ A;  5AAO A;  3ZNG A;  4YDW A;  5EYP F;  2MYO A;  2QC9 A;  5EID A;  4BES A;  1AWC B;  2KBX A;  1MX6 A;  2DZN A;  3B7B A;  3J5Q B;  4O1O A;  3TWW A;  4UUC A;  4CYM D;  1IKN D;  1WDY A;  3J5P A;  1MX2 A;  4BSZ B;  2L6B A;  1YMP A;  5CEA A;  3NOC D;  3AAA C;  3LJN A;  2J8S D;  1K1A A;  5ENQ D;  3ZKJ A;  3HRA A;  3T9K A;  3TWS A;  5D66 A;  1QYM A;  4DX1 A;  4U8Y D;  5HS0 A;  3EHR A;  2XZT G;  4GPM A;  5CED B;  2Y0B G;  4HBD A;  2PNN A;  2QYJ A;  5ENT D;  4YDY A;  1TR4 A;  3T8K A;  4DX7 D;  3EU9 A;  5AN8 A;  2BKK B;  2ETA A;  3NBN B;  5KWD A;  5ENS D;  4ATZ D;  2Y1L E;  5AQB A;  1DCQ A;  4BET A;  3AJI A;  2XEN A;  1DC2 A;  2ETC A;  2AJA A;  3HG0 D;  5CBN A;  3NOG D; 
#chains in the Genus database with same CATH topology
 2E0I A;  1UOH A;  4NIK A;  4G8K A;  1OT8 A;  3RK6 A;  3PUJ A;  4HRL A;  2P9L G;  2IFU A;  3UPV A;  2XRY A;  3CGH A;  3RRM B;  2DIW A;  4L2Y A;  4OYS A;  4GA1 A;  4DLQ A;  1SW6 A;  4AY6 A;  4OAV B;  3Q7A A;  4CGV A;  4QFV A;  2A5E A;  2F37 A;  3AG3 E;  2FO1 E;  3AG1 E;  3Q9N C;  2YNQ A;  4GYO A;  2V8S E;  4K5C A;  3FU6 A;  4FJY A;  3TXM A;  2GRR B;  1QQE A;  2VSN A;  1JUQ A;  4CT4 A;  3TG4 A;  5KBA A;  3BG1 B;  3HXD A;  2ZGD A;  3MZL B;  4APO A;  3L82 A;  2PZI A;  4EEC A;  3UM2 A;  2KXP C;  3DXK G;  4CEM A;  4K0R A;  2GRP B;  4HOR A;  3SF4 A;  4BY6 A;  2X38 A;  4LUN U;  1Z3Y A;  3DBS A;  3Q15 A;  3EUV A;  3Q79 A;  3EIQ C;  1OWO A;  5B1B E;  1HS6 A;  1NZN A;  4U0S A;  3GZ1 A;  4ILI A;  4ATZ D;  4O6F A;  2WXK A;  3LVQ E;  3ZYL A;  3L13 A;  4HRN A;  3ZUV B;  3FUI A;  3DPD A;  1ELW A;  4JZY A;  2R2L A;  5FIO A;  3CST A;  3PE3 A;  3W9G A;  4N3C A;  3AG4 E;  5LOZ A;  5KNG A;  3ULY A;  4GTQ A;  2WXO A;  4WNG A;  1BI8 B;  3PS6 A;  1N9A A;  4GPK A;  1YCS B;  4RG9 A;  1N95 A;  3DSW A;  3SFZ A;  4YVO A;  4WND A;  5B1A E;  2KCL A;  2LXL A;  2R03 A;  2Q7F A;  3HHM A;  3PH0 C;  2HE0 A;  3S7D A;  1S70 B;  5ENP D;  5G05 C;  4Z68 A;  2EIM E;  3VTX A;  3E37 A;  3C3R A;  4U63 A;  4RLY A;  4GCO A;  1DCE A;  4U04 A;  3ESL A;  1W3B A;  2XPY A;  4C48 B;  4I9E A;  5AJL A;  2CHW A;  3FTZ A;  3FUD A;  2VGE A;  4U8V D;  2OCC E;  4UI9 C;  5BNW A;  3MKQ A;  4LER A;  5EID A;  3KAE A;  5A23 A;  3TWW A;  1DNP A;  4MKT A;  3ENE A;  4HFG A;  4N2Q A;  3FTW A;  4OVU A;  4U8Y D;  4CCA A;  3AS5 A;  2UWJ G;  4UQX A;  3ZYK A;  3T8K A;  3O4Z A;  2LSV A;  4A3V A;  4OVV A;  4KMO A;  4UWK A;  3CVU A;  5FT9 A;  5EIB E;  3IBE A;  3D9M A;  5CBO A;  3PNT B;  3JXJ A;  2ZU6 B;  2X6F A;  2PQR A;  2PM6 A;  3JYS A;  3HXF A;  1LD7 A;  1UN8 A;  4X8Q A;  4Q94 A;  1MYO A;  1HZ4 A;  4UWF A;  3MKR A;  1H19 A;  4U95 D;  4KVO A;  1H6P A;  4G26 A;  4F53 A;  4KT6 B;  3UIP C;  2KZT A;  2CFU A;  2GRO B;  4GB9 A;  1FCH A;  2WB2 A;  2XCB A;  4CZ2 D;  2OEV A;  2WXL A;  1NP7 A;  4WUY A;  3P2B A;  4CDM A;  4KZ0 A;  2BF0 X;  1G3N B;  4IYP A;  1HO8 A;  4I6J A;  2XS8 A;  1FT1 A;  4P29 A;  2X6H A;  5ANL A;  1JWF A;  2OVF A;  4K5B A;  5C2Y A;  4WNF A;  4YDW A;  4BT9 A;  3FUN A;  2VJ8 A;  3ASH A;  4ILG A;  4HOT A;  3HDX A;  1MX2 A;  1E96 B;  3Q78 A;  3AAA C;  3PEV B;  2J8S D;  1K1A A;  1O5M A;  2PQN A;  2XZT G;  2Y0B G;  3ASO E;  1HX8 A;  3FHE A;  3APC A;  2DCP A;  2YQ8 A;  5KWD A;  1XGW A;  4BWR A;  2ETC A;  3HG0 D;  3FUJ A;  3R9M A;  1AP7 A;  4IUL A;  4Y6W A;  4B94 A;  4BFR A;  2RKK A;  3C72 A;  2H6F A;  3RKV A;  3ABL E;  3HVE B;  3ZIM A;  4H7X A;  4B0Z A;  4TV3 A;  1H2U A;  1RW2 A;  1WAO 1;  4NRH B;  2XGS A;  4U8H A;  5EIL A;  1NI1 A;  2WXG A;  4FHJ A;  3D9N A;  3PZ1 A;  3UT8 A;  5EDS A;  1IXV A;  3MV2 B;  3UKU G;  3FWV A;  1N4P A;  3V79 K;  3LY7 A;  3E32 A;  3NZU A;  4ANX A;  4IRU A;  2ZIS A;  5G55 A;  2LSU A;  2WXP A;  3LXU X;  4ANW A;  3HXB A;  3JCK C;  4EBA A;  3UQ3 A;  5FQ7 A;  4WWN A;  4K5A B;  2R59 A;  4I2W A;  1LTX A;  4O60 A;  3V31 A;  2IOS A;  2X3M A;  3EHM A;  2XEH A;  3DXM G;  2XEE A;  3LVR E;  3QWV A;  1TJF A;  4B93 B;  5KNH D;  1VDY A;  5FJY A;  1HFA A;  1H2T C;  2AW6 A;  1IQR A;  2VTB B;  1FVH A;  4PUC A;  2WM9 A;  2VGX B;  2KM4 A;  2KCV A;  4UWL A;  1EYH A;  3QOU A;  3ZPJ A;  5ENN A;  3EU9 A;  5FZQ A;  2WMN A;  5AN8 A;  4YDO A;  4BET A;  1Z5S C;  4I6G A;  3UKR G;  3CQC B;  1V55 E;  4KZC A;  5JJT A;  4TXQ A;  4GTT A;  4DLO A;  2QYU A;  1OWM A;  3QWP A;  4Q96 A;  3MGB A;  1E90 A;  2LO6 A;  4HXI A;  3R7Q A;  4BER A;  3FTS A;  3Q49 B;  4KYO B;  2PL2 A;  4HI8 A;  3TL5 A;  2WQ6 A;  2CG2 A;  3LYA A;  5FWQ A;  3NZS A;  1JWG A;  1N94 A;  2BUG A;  1D9S A;  3FH8 A;  3CVN A;  3T5X A;  4FP7 A;  4J7W A;  4LRZ A;  2J09 A;  4LNU D;  2IU1 A;  3FUE A;  3GZ2 A;  4I9C A;  4HS2 A;  3SGH A;  3D9L A;  3CVX A;  4N5C A;  4U7E B;  2DVW A;  3CSF A;  4GA0 A;  3V30 A;  2C0M A;  3DST A;  3HXE A;  3ZNG A;  1N4R A;  2MYO A;  2P58 C;  1U3C A;  4ILH B;  4J6I A;  1OUV A;  2FUL A;  3J5P A;  4BSZ B;  5G04 C;  5T4Y A;  2WQ7 A;  3ZKJ A;  2C0L A;  1O1S A;  4AXH A;  5DBK A;  4EQF A;  3NBN B;  5T3R A;  3ZW3 A;  4GTO A;  4N3B A;  3AS8 A;  2XEN A;  2OOE A;  4LNB A;  3CEQ A;  4U96 D;  5BXO A;  5JA4 D;  1ELR A;  2IOL A;  1TNY A;  4JVS A;  1N0R A;  4UI9 K;  3DRA A;  5FZR A;  2QZA A;  3Q5M A;  2VSX E;  3APF A;  3Q73 A;  1EDU A;  4DX5 D;  1SA4 A;  2V4H C;  2I9C A;  4L23 A;  4J8F A;  3OTN A;  1ZB1 A;  3TJP A;  1HU3 A;  2B6C A;  2FEZ A;  5ARF A;  4GAA A;  4V3I A;  3E4B A;  4C9B B;  2J49 A;  5FIN A;  3ZVV A;  3LKU A;  4GMR A;  3I5P A;  4GTR A;  2WXM A;  3OXF A;  2IF4 A;  4DPR A;  4JA9 A;  2EIL E;  2VSO E;  3JUI A;  3UUX A;  4U0Z A;  3G2T A;  5AAO A;  2I6H A;  1MHQ A;  2KBX A;  1N4Q A;  3J5Q B;  2F0Y A;  3DWL G;  1YMP A;  3L08 A;  4ME2 A;  3ULE G;  4J8E A;  3OXL A;  2XPZ A;  1E7V A;  1Q2Z A;  3CKC A;  3GZS A;  4G25 A;  1OWP A;  2KCK A;  3GW4 A;  5JHA A;  4CRW A;  2CG3 A;  4A1G A;  5CBN A;  3N71 A;  4TUM A;  3PZ2 A;  1TN8 A;  5KJM A;  4HOU A;  3IHY A;  5AJD A;  3IHV A;  1NA3 A;  5AQA A;  4DI4 A;  1JCS A;  4I2Z A;  2DZO A;  4R7L A;  2IY0 C;  3C98 A;  4W9R A;  4H7Y A;  2PM7 A;  4GTM A;  2C2L A;  3JXI A;  3SO8 A;  2Y4T A;  2QFC A;  5AAR A;  5H7P A;  3UI2 A;  5JJ7 A;  3TGO A;  3QB2 A;  5ARG A;  3C3O A;  3S2A A;  1NFI E;  5ANR A;  3CIA A;  4HI9 A;  1B89 A;  1HXI A;  1TNB A;  3MA5 A;  4M3O A;  4YDE A;  1N0Q A;  3JQ1 A;  4DUI A;  1Z3X A;  3KD7 A;  3UIO C;  1TN6 A;  3KEA A;  4JHK A;  5J90 A;  2RFM A;  3MX3 A;  4WAF A;  3DEO A;  3K9I A;  2VYI A;  3LY9 A;  1NL4 A;  3ASG A;  4LNG A;  1MX4 A;  2GRN B;  1U2V G;  2VGY A;  4EBA G;  4ATG A;  2L0T B;  3CVV A;  3B7B A;  3CKB A;  2WXR A;  4L9P A;  2QY7 A;  2E2E A;  3NB2 A;  3NF1 A;  1H6K A;  3SQV A;  1FPP A;  3SD5 A;  4HOS A;  5ENT D;  1PC2 A;  4A55 A;  3DSU A;  2KAT A;  4HOQ A;  3AJI A;  3SI5 A;  3UM1 A;  3NOG D;  4I1A A;  4GZC A;  4BTA A;  1IYG A;  4A3T A;  3U9W A;  3CR3 A;  1H0A A;  1Y8M A;  1OWL A;  5CRU A;  4PH4 B;  4F1P A;  1WY6 A;  4JXT A;  3CVY A;  4G1T A;  1BI7 B;  1TNZ A;  4CDR A;  3DSS A;  2DBA A;  1MJ0 A;  3ASN E;  4J8Y A;  3UMV A;  4WNE A;  5CER B;  3CHP A;  2CHX A;  4RQI A;  3E34 A;  2XS1 A;  2DYR E;  2WXQ A;  5BPP A;  1EF1 C;  4FHK A;  4I1O B;  3TWQ A;  3MV3 B;  3BQO A;  3LEW A;  5CCM A;  4GZD A;  3MKQ B;  3QAQ A;  1N52 A;  4ABN A;  2Y3A A;  1JPL A;  5D0O D;  2WXI A;  4EHM A;  3SHF A;  3UM3 A;  4UUC A;  3SBT B;  1L5J A;  4JHJ A;  2LAH A;  3NOC D;  2WVI A;  5ENQ D;  1XNF A;  2AWI A;  4L1B A;  3D3M A;  1Z6T A;  3UT7 A;  5KCM A;  2WXJ A;  3QWW A;  3QAR A;  2YIN A;  3BEE A;  3PEU B;  5HKP A;  4GU5 A;  4JD2 G;  4F6R D;  2BTD A;  2AXV A;  4HB5 A;  4GZ3 A;  2L9B A;  3RSE G;  3HIZ A;  4LEU A;  2ETB A;  3Q47 B;  3G2U A;  4DRX E;  4BT8 A;  2X6I A;  3KEZ A;  3TWV A;  4AVX A;  2L6J A;  5CRV A;  2IQC A;  2KZT B;  1K1B A;  1ELK A;  3B7S A;  1NA0 A;  5AEN A;  3FU5 A;  4BX9 A;  2WXH A;  3TWU A;  4C0E A;  4F1S A;  4LG6 A;  1IHG A;  1TNO A;  2BED A;  2FI7 A;  2UY1 A;  4XI0 A;  3OXG A;  3Q7F A;  3IXE A;  3PUK A;  2H6G A;  4GYY A;  2OV8 A;  1ZBP A;  5LX8 A;  1LD8 A;  2NC9 A;  4URK A;  1E8Z A;  2EIK E;  2XHE A;  1E7U A;  3PNL B;  3LY8 A;  2P9P G;  3NQP A;  4UWH A;  3L54 A;  2LAI A;  3LJN A;  4GMJ A;  3G2V A;  2NSZ A;  5HS0 A;  2EIN E;  4GPM A;  4APF A;  4J8D A;  3RRN B;  3SY2 A;  1DC2 A;  1K8K G;  2P9I G;  2MRI A;  2Y4U A;  4AOF A;  3RU0 A;  1OXJ A;  3ZN3 A;  3G2S A;  3EIJ A;  4HRM B;  3QK0 A;  1GW6 A;  1HE8 A;  4PS8 A;  4K03 A;  3VLE A;  1IQU A;  4HQD A;  3L6A A;  3CHR A;  2XZD G;  1N11 A;  4YND A;  4ANV A;  4KBQ A;  2F8Y A;  2RG8 A;  3KSL A;  3ZHE A;  3TG5 A;  3ZGQ A;  3KSQ A;  1U3D A;  4GTS A;  5KJL A;  4BX8 A;  4I6E A;  3S7B A;  5BV0 A;  2EIJ E;  3QDN A;  5ENO D;  1K3Z D;  1QBQ A;  5CHE E;  2BKG A;  4XI9 A;  3QJZ A;  2FF4 A;  2OVB A;  2LNI A;  3BG0 B;  3CVP A;  2IEJ A;  1SVX A;  1BD8 A;  3ZYM A;  3IKO B;  4G2V A;  1TN7 A;  4RVB A;  4FA6 A;  5BUZ A;  4AEZ C;  2LUH A;  3L17 A;  5EYP F;  1UN9 A;  2HO1 A;  3AS4 A;  1MX6 A;  4XZ4 A;  4JL0 A;  4CDN A;  3FTU A;  3Q4A B;  4UQZ A;  4NAC A;  1E8Y A;  2FO7 A;  3FY4 A;  1ZU2 A;  3FUH A;  2ETA A;  3VTY A;  3PE4 A;  1P5Q A;  4XE0 A;  3LPZ A;  5BV1 A;  4ZFH A;  4B8A A;  1S64 A;  3CHM A;  4AJW A;  4XEI G;  3QC1 A;  2GRL A;  3D9H A;  2OEW A;  3UTM A;  4Y6C A;  3Q9U C;  1O1T A;  2JAB A;  5KJN A;  2ZIR A;  3V2X A;  3B7T A;  5C1D A;  3DSV A;  4DX2 A;  3TWR A;  2MHK A;  3L16 A;  5AQ9 A;  2B0O E;  2IJG X;  3R9A B;  1HF8 A;  3WXX A;  2V0P A;  1UW4 B;  3ZXS A;  2L0I A;  3ZFW A;  1LF8 A;  3QNK A;  1KLX A;  5LCW J;  3S7F A;  5JHB A;  3Q75 A;  5HQ8 A;  4HLE A;  1BPO A;  3JUE A;  4XKB A;  4A63 B;  3CVL A;  3MEK A;  2H6H A;  4BTB A;  2P9S G;  5EN5 D;  1FVF A;  2DWZ A;  3CK9 A;  5KJK A;  3RO2 A;  3JQ0 A;  4BES A;  5CEA A;  2KC7 A;  3B7R L;  3HRA A;  5CCL A;  3SFY A;  3EHR A;  1N54 A;  4NQ0 A;  4I43 A;  3PDN A;  2I1K A;  3I3N A;  4TUU A;  1X5B A;  4N5Q A;  1WG0 A;  2ILR A;  3O48 A;  3MCX A;  4MRU A;  3FUF A;  3RRU A;  4HLL A;  4F3V A;  1KPS B;  4DX6 D;  1OCC E;  1SQM A;  2V5F A;  2J4B A;  4MBG A;  3EHQ A;  3PZ4 A;  3ABM E;  2WQH A;  3D9P A;  2WXN A;  1IHB A;  3LJ3 A;  3S7J A;  4TRQ A;  4CGW A;  3FH7 A;  5BW8 C;  2JEK A;  4B8C B;  3D9J A;  5EX3 A;  3ZU7 B;  1OY3 D;  3PZD A;  5G2N A;  2YHE A;  2R05 A;  4JB8 P;  2GRQ B;  1A5E A;  2I2O A;  4HNA D;  2VSY A;  1TJC A;  3FUL A;  5HRY A;  1UJK A;  2J07 A;  5E76 A;  1PAQ A;  3HXC A;  3ML8 A;  2AVP A;  4G11 A;  4EPZ A;  3LCA A;  3ABK E;  1AWC B;  4GTV A;  4N3A A;  4CYM D;  4I17 A;  4DI3 A;  1IKN D;  2CFZ A;  5LFA A;  5D66 A;  4L2L A;  3HYM B;  5CED B;  4HBD A;  4TXP A;  4YDY A;  4DX7 D;  5FQ4 A;  4XX5 A;  4AV7 A;  2X6K A;  5FQ8 A;  3EDT B;  4LSZ E;  4EZK A;  1HG2 A;  1KZP A;  2ZXW E;  1YYH A;  3B7U X;  5G05 J;  3DEP A;  1S63 A;  3IV0 A;  4C0M A;  5A7D B;  3W9F A;  2IO3 C;  3PZ3 A;  4JA7 A;  4FAD A;  1E8W A;  4DJA A;  4KXK B;  4RSY A;  4UI9 J;  4D10 C;  1TYQ G;  3SBS A;  2M63 A;  1UG3 A;  4JEU A;  4OAU C;  2WPV A;  4M7C A;  2F8X K;  4WWP A;  3GYZ A;  4GZ6 A;  3RJV A;  3ESK A;  2OND A;  3B13 A;  3X2Q E;  5EKQ D;  2R17 C;  3QKY A;  2R02 A;  2GRM A;  4L7T A;  4GCN A;  2ION A;  4O1O A;  3ASF A;  2NXP A;  4EZL A;  5M72 A;  2A5U A;  4KVM A;  3T8M A;  4AY5 A;  3T9K A;  3TWS A;  3PRE A;  4DX1 A;  3L9T A;  2GGF A;  3I4R B;  5EX0 A;  5B3S E;  2H6I A;  3ZRH A;  2R5S A;  4A1S A;  4GYW A;  2BKK B;  1S0P A;  5ENS D;  4JPS A;  4CT0 A;  5CMW A;  3SFX A;  3UM0 A;  5FQ6 A;  4G8L A;  3T5V A;  4ANU A;  4DK5 A;  1OCR E;  4GTP A;  4BSX A;  3CVW A;  2XRZ A;  3OAW A;  3ZXP A;  5T8I A;  3G2W A;  2J08 A;  4G23 A;  2NYJ A;  2HYZ A;  2JLB A;  3CHQ A;  1V54 E;  3HVE A;  5BT1 A;  3CVQ A;  4BEP A;  4FLH A;  4PS7 A;  3E30 A;  3FH5 A;  5EYL A;  5HI7 A;  5DIZ A;  2XQ0 A;  4RG6 A;  3ONL A;  3V2O A;  4O1P A;  4FUL A;  2P9K G;  3U4T A;  4E6H A;  5LP0 A;  3FTV A;  2A4Z A;  5AIJ A;  3CHS A;  1QNF A;  4GA2 A;  4XIF A;  4QQI A;  5FZS A;  3TWT A;  4JW1 A;  3EHN A;  4LCT A;  3FDH A;  1KT0 A;  1EPU A;  5J08 A;  4AM9 A;  2Y69 E;  2QC9 A;  3FTY A;  2DZN A;  3UIN C;  3ASD A;  3LDZ A;  1DVP A;  2RD0 A;  5E75 A;  1QYM A;  2XGM A;  2VTB A;  3D9I A;  3I4G A;  2VGX A;  4I1M A;  1HH8 A;  2J4D A;  2Y1L E;  3UX4 A;  5D0Q D;  3ZEF A;  3ULQ A;  3SZ7 A;  4PS3 A;  1WM5 A;  1QZ2 A;  3NAW A;  3E33 A;  5IY5 E;  2P9N G;  5JJ6 A;  3B95 A;  4MLP A;  2J9Q A;  4ZHB A;  4XKC A;  3CV0 A;  4GZ5 A;  3TXN A;  2RFA A;  1BLX B;  4JEH A;  3VLF A;  2MOW A;  3R7R A;  2WMO A;  2ZGG A;  5ITZ F;  1H2V C;  2XEV A;  5AYW D;  1KZO A;  4AIF A;  2IO2 C;  2XCC A;  3CK7 A;  4JC8 A;  3FU0 A;  2UY1 B;  4F7A A;  2VQ2 A;  1H6O A;  5AQ7 A;  2AXZ A;  1OCZ E;  3FU3 A;  3DPY A;  5JMN D;  1UJJ A;  3EJN A;  4E85 A;  3FTX A;  1JCR A;  1BU9 A;  1TEZ A;  2V5Q C;  2GW1 A;  5BXU A;  1SA5 A;  3C5R A;  3PVL A;  3KS2 A;  4EZJ A;  1D8D A;  3FP3 A;  3U66 A;  3C3Q A;  4ACL A;  3D9K A;  3TAX A;  1D8E A;  4FU3 A;  3D9O A;  3PRZ A;  3MYV A;  2LXM A;  1Y6I A;  3L22 A;  4FC8 A;  3U64 A;  4J0U A;  3RAU A;  1WDY A;  1INZ A;  2XGO A;  3RIB A;  4TXR A;  2X6J A;  2QYJ A;  4B89 A;  2WXF A;  4G24 A;  3FUK A;  1OWN A;  1DCQ A;  2HM8 A;  5AQB A;  3FEX A;  3FUM A;  1RZ4 A;  3P1U A;  3BU8 A;  4WWO A;  5CMY A;  2P9U G;  3VLD A;  1X81 A;  1JCQ A;  1KT1 A;  3APD A;  1E8X A;  4GML A;  4U0U A;  4IN3 B;  3CK8 A;  3EU5 A;  4MS6 A;  3CLJ A;  4FLB A;  1MZC A;  1FT2 A;  3ZHE B;  2DYS E;  4J8S A;  2XPI A;  3FEY A;  4Q69 A;  5ENR D;  2V4L A;  3URZ A;  3BUA A;  4N39 A;  1HG5 A;  2EQX A;  1SZA A;  3RO3 A;  3TWX A;  4N2S A;  2YHC A;  4UQY A;  2AXU A;  3MJW A;  3SNX A;  4ACK A;  1SZ9 A;  3UXG A;  2FBN A;  5G04 J;  3WG7 E;  1MQS A;  4AP2 A;  3DSX A;  1OCO E;  2CHZ A;  3AU4 A;  3ONK A;  3CHO A;  2P2C P;  3IEG A;  3F6Q A;  3AU5 A;  4NUR A;  3FFL A;  4PDX A;  5CEC B;  3U3W A;  4U07 A;  3LS8 A;  5A6C A;  4HVB A;  1N4S A;  1A17 A;  1YA0 A;  1PY1 A;  3ML9 A;  4UWG A;  2L6B A;  1TNU A;  5FTP A;  2I1J A;  5LCW C;  2PNN A;  1O1R A;  4JHR A;  1TR4 A;  3CQG B;  4FJZ A;  2HR2 A;  3ISM C;  3ZYQ A;  3UT4 A;  5D2M C;  2AJA A;  4YVQ C;  3AG2 E; 
#chains in the Genus database with same CATH homology
 4HRN A;  3ZUV B;  4TUM A;  1UOH A;  1AP7 A;  5EIB E;  4NIK A;  4G8K A;  4U96 D;  5HKP A;  4G8L A;  5BXO A;  4F6R D;  5JA4 D;  1OT8 A;  4LSZ E;  4ZFH A;  3B95 A;  5CBO A;  4HRM B;  4HB5 A;  4N5Q A;  4HRL A;  1WG0 A;  5FIO A;  4ZHB A;  2ETB A;  3JXJ A;  1N0R A;  2RFA A;  1BLX B;  4DRX E;  4HLL A;  4BER A;  2NYJ A;  5AQA A;  3W9G A;  4HQD A;  1YYH A;  1SW6 A;  2DZO A;  4F1P A;  4DX6 D;  4OAV B;  3TWV A;  5KNG A;  2ZGG A;  5ITZ F;  3D9H A;  4HI8 A;  3EHQ A;  3UTM A;  3DEP A;  3Q9U C;  2XZD G;  4DX5 D;  1BI8 B;  5ENR D;  4BEP A;  1BI7 B;  2JAB A;  1N11 A;  5EIL A;  1YCS B;  4QFV A;  2F8Y A;  5EYL A;  1MJ0 A;  2A5E A;  2V4H C;  1IHB A;  3W9F A;  2F37 A;  3JXI A;  3V2X A;  4J8Y A;  1MYO A;  3SO8 A;  1K1B A;  2FO1 E;  1D9S A;  1IXV A;  4DX2 A;  3Q9N C;  5CER B;  3TWR A;  3V2O A;  4U95 D;  3V79 K;  5AQ9 A;  3TWX A;  4K5C A;  2B0O E;  4O1P A;  3TWU A;  5AQ7 A;  2HE0 A;  3ZU7 B;  5AAR A;  5ENO D;  3UI2 A;  1K3Z D;  1OY3 D;  1S70 B;  5ENP D;  4J7W A;  5JMN D;  4LG6 A;  5FIN A;  4CZ2 D;  1BU9 A;  2BKG A;  4LNU D;  5KBA A;  1NFI E;  3UXG A;  4Z68 A;  4OAU C;  4HI9 A;  2V5Q C;  4GMR A;  4JB8 P;  1A5E A;  2ZGD A;  3IXE A;  4RLY A;  3TWQ A;  4HNA D;  5BXU A;  1N0Q A;  4K5A B;  4QQI A;  2F8X K;  3C5R A;  4DUI A;  3TWT A;  4O60 A;  3V31 A;  3KEA A;  1SVX A;  5HRY A;  1BD8 A;  2KXP C;  1G3N B;  2P2C P;  2XEH A;  3F6Q A;  4C48 B;  2RFM A;  2DVW A;  2XEE A;  3DEO A;  3JUE A;  5CEC B;  3V30 A;  4A63 B;  4B93 B;  5EN5 D;  2VGE A;  4K5B A;  1MX4 A;  4U8V D;  5KNH D;  2DWZ A;  5AAO A;  3ZNG A;  4YDW A;  5EYP F;  2MYO A;  2QC9 A;  5EID A;  4BES A;  1AWC B;  2KBX A;  1MX6 A;  2DZN A;  3B7B A;  3J5Q B;  4O1O A;  3TWW A;  4UUC A;  4CYM D;  1IKN D;  1WDY A;  3J5P A;  1MX2 A;  4BSZ B;  2L6B A;  1YMP A;  5CEA A;  3NOC D;  3AAA C;  3LJN A;  2J8S D;  1K1A A;  5ENQ D;  3ZKJ A;  3HRA A;  3T9K A;  3TWS A;  5D66 A;  1QYM A;  4DX1 A;  4U8Y D;  5HS0 A;  3EHR A;  2XZT G;  4GPM A;  5CED B;  2Y0B G;  4HBD A;  2PNN A;  2QYJ A;  5ENT D;  4YDY A;  1TR4 A;  3T8K A;  4DX7 D;  3EU9 A;  5AN8 A;  2BKK B;  2ETA A;  3NBN B;  5KWD A;  5ENS D;  4ATZ D;  2Y1L E;  5AQB A;  1DCQ A;  4BET A;  3AJI A;  2XEN A;  1DC2 A;  2ETC A;  2AJA A;  3HG0 D;  5CBN A;  3NOG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...