3Q9NC

In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
157
structure length
157
Chain Sequence
FGQDLGKKLLEAAAAGQDDEVRILMANGADVNATDDNGLTPLHLAAANGQLEIVEVLLKNGADVNASDSAGITPLHLAAYDGHLEIVEVLLKHGADVNAYDRAGWTPLHLAALSGQLEIVEVLLKHGADVNAQDALGLTAFDISINQGQEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CoA binding protein
publication title A de novo protein binding pair by computational design and directed evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding, de novo protein
total genus 53
structure length 157
sequence length 157
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3q9nC00
4ZFHA 1G3NB 2ZGDA 3EU9A 5FIOA 3V30A 4ZHBA 1S70B 5EILA 4DUIA 5KNHD 5EYPF 4YDYA 4OAUC 2KXPC 5AQ7A 1K1BA 2P2CP 5CEDB 2BKKB 4QQIA 4O1PA 1K3ZD 1SW6A 2XZDG 5JMND 3SO8A 5CECB 4HRMB 1BU9A 2B0OE 4HRNA 1DCQA 4HB5A 3J5QB 1BLXB 4N5QA 2J8SD 3B95A 4GPMA 3UTMA 2VGEA 3HG0D 5HRYA 4DX6D 3JXJA 5BXOA 3T8KA 3V2XA 3W9GA 1AWCB 1N0RA 4NIKA 3T9KA 2V4HC 5ENOD 4DRXE 3TWRA 3TWWA 1OY3D 1MYOA 3W9FA 4BESA 4BERA 1QYMA 4DX5D 1UOHA 2XZTG 3B7BA 3DEPA 2QYJA 4F1PA 4C48B 4TUMA 2V5QC 2ETBA 5ENTD 5CERB 2A5EA 5EN5D 3ZNGA 1TR4A 4U8VD 2XEHA 4DX7D 4HRLA 3LJNA 3ZU7B 5CBNA 4HLLA 3HRAA 4U95D 4HI8A 5EIDA 2Y0BG 2F8XK 4U8YD 2HE0A 1NFIE 2L6BA 4J8YA 3JXIA 2QC9A 5HKPA 4A63B 1N11A 5EYLA 4F6RD 3EHRA 2DWZA 1BD8A 2NYJA 5AARA 2DVWA 3NBNB 4QFVA 4JB8P 2XEEA 1YYHA 5AQBA 5AQ9A 4LNUD 5ENRD 3TWUA 1IKND 3TWTA 5CBOA 2F8YA 4HQDA 4ATZD 4K5AB 1DC2A 3F6QA 2KBXA 1OT8A 4BEPA 3AJIA 4UUCA 4Z68A 5KWDA 3TWSA 4G8LA 4J7WA 1MX4A 3ZKJA 5AN8A 5CEAA 1IXVA 3NOGD 3TWXA 4BETA 2ETAA 3Q9UC 2ETCA 5ITZF 1N0QA 1WDYA 5ENPD 3UXGA 2BKGA 2DZOA 3EHQA 1MJ0A 4GMRA 4OAVB 2FO1E 4YDWA 3ZUVB 3NOCD 4K5BA 4RLYA 2JABA 1A5EA 3Q9NC 5ENSD 4DX2A 1IHBA 3V79K 2RFAA 1YMPA 5EIBE 2MYOA 3UI2A 4HBDA 5HS0A 4DX1A 4CZ2D 1MX6A 3KEAA 5FINA 1AP7A 2XENA 1BI8B 3C5RA 3AAAC 2ZGGA 3D9HA 1K1AA 5AQAA 2AJAA 3TWQA 1MX2A 5JA4D 4LSZE 1BI7B 4HNAD 5KBAA 1D9SA 5D66A 3TWVA 4U96D 5AAOA 4G8KA 2DZNA 5BXUA 2RFMA 4HI9A 1SVXA 3DEOA 4CYMD 3V31A 3JUEA 4LG6A 2F37A 2Y1LE 4O60A 4K5CA 1YCSB 5ENQD 5KNGA 3J5PA 4O1OA 1WG0A 4B93B 3IXEA 2PNNA 4BSZB 3V2OA
chains in the Genus database with same CATH superfamily
3JCKC 3E37A 2MHKA 4LCTA 1H2TC 5J90A 2H6IA 2X38A 1K3ZD 1BU9A 2H6FA 3LEWA 1N4QA 2P9PG 3PEVB 3JUIA 3D3MA 5EDSA 4GCNA 4PH4B 3KSLA 1QYMA 1U3CA 3ML9A 3KS2A 1U2VG 3NB2A 5ENTD 3ZNGA 1TJFA 3RKVA 4N3AA 1P5QA 4JHRA 4G2VA 2P9NG 4HXIA 1Y8MA 4EZKA 4UQYA 2WQHA 4JB8P 5AYWD 5AQ9A 4YVQC 3DXKG 3PNTB 5H7PA 3ZEFA 5CEAA 3Q49B 2MRIA 4XI9A 4V3IA 1QQEA 3SZ7A 5G2NA 5ITZF 1KPSB 3UXGA 3ASOE 4OAVB 3N71A 3LS8A 2RFAA 4C0MA 2MYOA 3D9IA 4AY6A 1MZCA 1GW6A 5AQAA 2DIWA 1RZ4A 2GW1A 4JHKA 5BXUA 5G04C 4A1SA 3KEZA 4CYMD 3AG3E 3U4TA 3EUVA 4I1MA 2WXFA 3BUAA 4HVBA 3V2OA 4AEZC 3UT8A 5ARFA 3BU8A 5AQ7A 4GB9A 2CG2A 3CQGB 1HS6A 3DSUA 3EDTB 4HB5A 2V4LA 2YQ8A 4BX9A 2GRRB 4NIKA 2EIME 2XHEA 3ONLA 4KVMA 4C48B 3RIBA 3RSEG 2Y0BG 4I2ZA 5A23A 5CMWA 1NFIE 4J8YA 2ZXWE 4BT9A 4WWOA 4GMLA 4LNUD 4EPZA 3RAUA 1EF1C 3LYAA 4IYPA 2NSZA 2WXLA 3ZYQA 4CT0A 2ETCA 2BKGA 3B7UX 4F3VA 4IRUA 1O5MA 3ZN3A 2KCVA 3U64A 3SF4A 2KZTA 3IHYA 2ONDA 4XKCA 4CZ2D 5FINA 5A6CA 2ZGGA 3PZDA 3ESLA 4XEIG 4I2WA 3Q4AB 4ILGA 1S63A 3QWVA 4LG6A 3HYMB 1O1TA 4GTSA 4DPRA 2VJ8A 4JW1A 1UJJA 2FO7A 4RG6A 5KNHD 3PUKA 1D8DA 4FLBA 3T8MA 2CFUA 1S0PA 2GGFA 3GW4A 4L9PA 4ANXA 3UKRG 1W3BA 3UTMA 2VGEA 3AS4A 5D2MC 5BXOA 4JXTA 5JHAA 3ZGQA 2V4HC 1U3DA 3W9FA 4BFRA 3HXEA 1NZNA 3CK8A 3ZFWA 1D8EA 4DX7D 3FDHA 1TNUA 1O1SA 5HQ8A 5CBNA 3DBSA 3FU0A 4HS2A 4GYOA 4NRHB 1N52A 4GPKA 4L7TA 3QJZA 3GZ2A 2P9IG 4G8LA 4JC8A 2YHCA 2LAIA 4BETA 3ZIMA 2OVFA 2AXVA 3G2SA 1NA3A 2PQRA 4NQ0A 1HE8A 2DYRE 4UI9J 4MRUA 2Y3AA 4KBQA 3UM2A 4FLHA 3CVUA 2R59A 3CEQA 3EIJA 3UINC 3RJVA 3S7FA 3EU9A 1N95A 2HYZA 4DUIA 2WXKA 2Y69E 2MOWA 4OAUC 1MQSA 4I1AA 4YDEA 5BPPA 4CDRA 1UJKA 3PREA 5CECB 3MJWA 3APDA 2B0OE 4XI0A 4HOUA 2CFZA 4UWHA 3B95A 2XS1A 5HRYA 4GMJA 4AVXA 2VTBB 3TXNA 2J08A 1N0RA 3T9KA 3ABKE 4CCAA 4F1PA 1NL4A 3FTUA 3Q7FA 5EN5D 2UWJG 4Q96A 2IFUA 3FFLA 4G23A 4HI8A 2L6BA 1H6KA 4UI9C 5D0QD 2J07A 2E2EA 3FUNA 4U0UA 2XEEA 3AG1E 1HH8A 4GTQA 4LNGA 2WXPA 2WQ7A 3F6QA 2YINA 4UUCA 4Z68A 1ELRA 1ZU2A 2IOSA 3D9NA 2Q7FA 5JHBA 5KJKA 3L54A 3NOGD 3GZSA 3P2BA 3UT7A 5KJMA 4AV7A 4YDWA 4WUYA 4TV3A 4KMOA 3UI2A 5HS0A 4J6IA 4U0ZA 1MX6A 5DBKA 3ASGA 3SGHA 3UMVA 4RVBA 4G8KA 3T5VA 3FUKA 3QKYA 1JUQA 5G55A 4PS7A 3ZHEA 4ANVA 3ASNE 3S7JA 2GROB 3MV2B 3UPVA 2WMNA 4DLQA 3AU5A 4JEUA 2QFCA 1N9AA 4TXQA 4O6FA 3IHVA 1HU3A 2BKKB 3SY2A 3SO8A 4B94A 2XPIA 5CCLA 4G26A 3DSWA 4DLOA 3B7BA 4EBAA 2FBNA 3I5PA 3MCXA 1SA4A 1X81A 3OAWA 5EIDA 1XGWA 1HF8A 3SQVA 3EHRA 3FUDA 5AARA 2DBAA 4WNDA 2AVPA 3OXGA 3BQOA 3Q79A 3FUEA 1IKND 3ISMC 3FUIA 2GRLA 3UT4A 4DJAA 2JEKA 1LTXA 3Q5MA 3VLDA 1ZBPA 4E85A 3E34A 3C98A 3L08A 3TJPA 1UW4B 3ZUVB 4GYYA 4B89A 1YA0A 1YMPA 3T5XA 2GRPB 2WXIA 4GZ6A 1IQRA 2XENA 3L17A 1K1AA 3R9MA 4G11A 1MX2A 1TNZA 4GA1A 1ELKA 2J09A 3HXBA 1NI1A 2YHEA 3PE3A 3DEOA 2DYSE 2LXLA 2XCCA 4N2QA 4BSZB 1TN6A 3DSTA 3UX4A 5EILA 4YDYA 3ULQA 3FH8A 3C3OA 2KM4A 4AIFA 4GTPA 2KC7A 2VSOE 4O1PA 5KCMA 4ANWA 3CVXA 3ABME 2IJGX 4AM9A 3CVWA 4MLPA 4UWKA 3CVQA 4R7LA 3UM1A 4I43A 5BNWA 5KJLA 2HO1A 4BERA 1TN7A 2P9SG 3ZVVA 5EX0A 2QYUA 4K03A 4U8YD 1E8ZA 1OXJA 3PUJA 2WXGA 4GTVA 2XRYA 4UQZA 4GZ3A 4GYWA 3HDXA 2XGSA 1DC2A 2BF0X 3PVLA 3EHMA 3ZKJA 1OWNA 3BG1B 4FULA 5C2YA 3EHQA 3MZLB 3NAWA 4K5BA 2VTBA 3OXFA 1Z3XA 4J0UA 2L0TB 3PEUB 4CRWA 2WXMA 3C5RA 3CHQA 4P29A 1D9SA 4JA9A 1FT2A 3B7SA 3I4RB 1KT1A 3GZ1A 3CK7A 5LOZA 1JWGA 5ANRA 2WQ6A 2LUHA 3DSSA 3UIOC 4CGVA 1UN8A 4I9CA 4I9EA 3QDNA 4ZHBA 3FP3A 1IHGA 3APCA 3FTYA 3FULA 1OWOA 5C1DA 3D9LA 2X6KA 1QBQA 4U07A 4LUNU 3LXUX 1OWLA 3MKQB 3D9OA 3W9GA 4FP7A 5D0OD 3APFA 3QNKA 2VGXB 1JCQA 5FZQA 3CHMA 3OXLA 4N5CA 4HRLA 1PC2A 4WNEA 3KAEA 5EYLA 3URZA 4F7AA 3LY7A 4HOTA 5ENRD 4A3VA 1E8YA 3PDNA 4KZ0A 1MX4A 3QWPA 3HXDA 1DVPA 3E4BA 3MA5A 4EQFA 2XEVA 4HLEA 4GMRA 2VSNA 4EECA 5EKQD 2GRQB 2C0MA 2P9LG 2EILE 3QK0A 4WWNA 3ZHEB 2WXRA 4JVSA 4PS8A 2VQ2A 3D9KA 2OEWA 5J08A 3SBSA 1FT1A 1SQMA 1BI7B 3AS8A 3C3QA 1N94A 3ONKA 4C0EA 1PAQA 1HG5A 3IXEA 4AJWA 4ZFHA 1K8KG 1OWPA 4N2SA 2LAHA 3UM3A 2P2CP 2I6HA 3G2UA 3Q7AA 3TG4A 5E75A 4HRNA 3ZYMA 2H6GA 1DCQA 3ZRHA 3MYVA 3B7TA 3BEEA 2BUGA 3TWWA 2PL2A 2H6HA 1E90A 4GZDA 1TEZA 5T3RA 3TXMA 3HRAA 3SI5A 4K0RA 5CMYA 3ASFA 2WB2A 3NQPA 3FTXA 5FQ8A 2IO3C 3VLFA 3CVVA 3SBTB 3IEGA 3R7RA 3HHMA 2WXJA 4J7WA 3I3NA 4M7CA 3TWXA 2BTDA 4E6HA 1WDYA 1LD8A 4EZJA 4URKA 3ULYA 5JJTA 3DSVA 5EIBE 2IOLA 3CQCB 3KEAA 4N3CA 5AIJA 3AAAC 3PE4A 3FTVA 4JD2G 1N4PA 5B3SE 3CV0A 4AP2A 2RFMA 2J4BA 5LFAA 3V31A 3JUEA 2F37A 4I6EA 1FPPA 5KNGA 4LRZA 2PNNA 1E7UA 1TYQG 4FJZA 4WNFA 2PM7A 1OCCE 4BT8A 3VTXA 4BX8A 1K1BA 4LNBA 3X2QE 2J49A 3UQ3A 5B1BE 4FHKA 3L82A 2R05A 4HOQA 3DRAA 4N5QA 2WM9A 4A3TA 3SD5A 1MHQA 1VDYA 1AWCB 2R2LA 3TWRA 4APOA 1E8XA 4DX5D 2L0IA 1TR4A 3AU4A 3ZPJA 3ZU7B 2UY1A 3ABLE 2QC9A 3PRZA 2OCCE 4U04A 3CVPA 4UWLA 2FEZA 5IY5E 2EQXA 4J8EA 1FVFA 1Q2ZA 2KBXA 3FEXA 5BT1A 2E0IA 2X6IA 5FZSA 4FU3A 3TG5A 1WY6A 2F0YA 3Q9UC 2CHZA 3FY4A 2AWIA 2VSYA 4B0ZA 3MKQA 4J8DA 5ENSD 4ILIA 4YNDA 4HBDA 5FTPA 2VGXA 1E96B 4ABNA 4J8FA 4BSXA 1INZA 3G2VA 4DI4A 4HNAD 5KBAA 5D66A 3RRMB 3RK6A 3L6AA 2R03A 2XGMA 5JJ7A 4MKTA 4EHMA 4UWFA 2XGOA 4KYOB 5AJDA 2P58C 4QQIA 4PS3A 3G2TA 4F53A 2VYIA 3PZ4A 1TNBA 4DX6D 3T8KA 3CHPA 4OYSA 4TXPA 4FA6A 5CERB 2KATA 5AJLA 2GRMA 2R02A 2OOEA 2V0PA 4LERA 5FWQA 3EJNA 3JXIA 1N11A 3JQ0A 4MS6A 4YDOA 5AQBA 5E76A 1UG3A 3ESKA 2FI7A 1OT8A 2J4DA 3FEYA 3FTSA 2DCPA 1SZAA 3WG7E 4B8AA 1EDUA 4MBGA 2LO6A 5ENPD 1MJ0A 3FUMA 1DNPA 4J8SA 4WAFA 3FUHA 2C2LA 2WXQA 4DI3A 4FJYA 1SZ9A 4CT4A 1H2VC 3SFZA 3C72A 3LVQE 4JHJA 4M3OA 3QARA 5B1AE 1JCSA 1DCEA 5ARGA 2XPZA 4WNGA 3RO2A 1A17A 1N4SA 1EPUA 4B8CB 3LKUA 5CRVA 3CHSA 4KZCA 3Q73A 2XZDG 2AW6A 1L5JA 1Y6IA 1BLXB 4FADA 4HFGA 3R9AB 4G1TA 1OY3D 4BESA 3IV0A 1UOHA 2XZTG 3RRNB 2QYJA 3LJ3A 3RU0A 3ZXPA 2LXMA 4I1OB 4Y6CA 4EBAG 5ANLA 3RO3A 4L23A 5HKPA 2DWZA 3LY8A 3NZSA 1YYHA 1H6PA 2V5FA 1HG2A 2ILRA 1NP7A 3FUJA 2F8YA 2Y4UA 3AJIA 2CHXA 3JQ1A 1IXVA 1WAO1 3EHNA 1N0QA 4ILHB 4YVOA 1H19A 2JABA 3Q9NC 2IF4A 4AXHA 5CHEE 3P1UA 3KD7A 4A1GA 2WXHA 2QZAA 3S7DA 3TWVA 3CVLA 3LDZA 4L2LA 3FU5A 2IO2C 3JYSA 1HX8A 3PZ2A 4PUCA 3MGBA 2Y1LE 4O60A 4AY5A 1WG0A 5G04J 1G3NB 4U7EB 5A7DB 3E30A 1V54E 2IU1A 5CEDB 5EX3A 2OVBA 3HXFA 4UI9K 1HZ4A 2IY0C 1O1RA 2UY1B 4GPMA 2PM6A 2XQ0A 4I17A 4OVUA 1KT0A 2ETBA 5FJYA 4AOFA 5LX8A 4U8HA 2ZISA 3LJNA 5BUZA 4HLLA 2EIKE 1Z3YA 4JPSA 5G05J 1LD7A 3SFYA 3CVNA 3CKBA 4CDNA 4UQXA 4DK5A 3TWTA 4XE0A 5CCMA 4K5AB 4RSYA 4ANUA 1KZPA 2FF4A 3D9JA 1OUVA 2WMOA 3ML8A 3ASDA 1IYGA 3TL5A 3LY9A 3AS5A 2LNIA 3PH0C 5LCWJ 3DXMG 4CGWA 3C3RA 4I6JA 3QWWA 2LSUA 4TRQA 1WM5A 3QOUA 4XIFA 2AXZA 4U96D 1HFAA 3FU6A 4ACLA 2Y4TA 4FC8A 1TJCA 2PQNA 3ASHA 2WPVA 4ACKA 3DPYA 5T8IA 2HM8A 3J5PA 2P9KG 3FH7A 3MX3A 4B93B 1N54A 2L6JA 4GTTA 2C0LA 4NACA 1V55E 2GRNB 2J9QA 1SA5A 5G05C 2CG3A 4CDMA 1FVHA 1E8WA 1SW6A 2X6HA 3NZUA 5JMND 3HG0D 3PNLB 5JJ6A 5LP0A 1MYOA 4JZYA 2V5QC 1KLXA 1Z5SC 2R5SA 4OVVA 3EIQC 5LCWC 2WVIA 3E33A 4ATGA 5ENNA 3MKRA 4F6RD 1BD8A 3FU3A 4QFVA 1ZB1A 4HQDA 4BTAA 3CLJA 4GTRA 5KWDA 4XKBA 1HXIA 4JA7A 2CHWA 1NA0A 4GTOA 3CGHA 3CSTA 3D9MA 3ZW3A 4KVOA 2FULA 3B13A 5M72A 1IHBA 2WXOA 3HVEA 4L1BA 2I1KA 2X3MA 1X5BA 3Q75A 3DSXA 2WXNA 2V8SE 2EIJE 4GCOA 4BWRA 4IN3B 1QNFA 2NXPA 3RRUA 4K5CA 2OV8A 4NURA 3QC1A 5JA4D 5KJNA 3O48A 4GZ5A 1JWFA 1RW2A 5AENA 2I1JA 3GYZA 1H0AA 4RQIA 2KCKA 3IKOB 2IONA 3SFXA 3JXJA 3MV3B 4GA2A 3D9PA 1JCRA 3WXXA 3TAXA 1EYHA 3FTWA 1HO8A 4TUMA 3I4GA 3Q47B 3EU5A 3QB2A 2XS8A 3B7RL 4KT6B 4A63B 2I2OA 4N39A 3DPDA 1H2UA 1FCHA 4I6GA 3PZ3A 2HR2A 5HI7A 3ZYLA 3ZXSA 5CBOA 4HOSA 4D10C 1ELWA 4PDXA 1N4RA 4GU5A 4WWPA 1B89A 2ETAA 3S7BA 2DZOA 4GZCA 2B6CA 2LSVA 4RG9A 4RLYA 4GA0A 1H6OA 4DX2A 1KZOA 3V79K 3FTZA 2X6FA 4ME2A 3U3WA 2ZU6B 5DIZA 4X8QA 3D9HA 4L2YA 3G2WA 4LSZE 4JL0A 2QY7A 1LF8A 1XNFA 2XCBA 3Q15A 1YCSB 4CEMA 4O1OA 5BV1A 3K9IA 4JEHA 2XPYA 3V30A 4A55A 4TUUA 5EYPF 4TXRA 2KXPC 1QZ2A 3ENEA 1OCOE 4G25A 4HRMB 3HXCA 2PZIA 1Z6TA 4GAAA 3DWLG 3V2XA 1JPLA 3SNXA 3DEPA 2EINE 2OEVA 3QAQA 3L9TA 3ULEG 2VSXE 4Q69A 3L22A 3LCAA 2XEHA 4U95D 4Y6WA 3S2AA 2F8XK 3FWVA 2HE0A 2P9UG 4APFA 4H7XA 3CHOA 3CHRA 5T4YA 2RG8A 3AG2E 3TWUA 3ZYKA 4ATZD 3AG4E 3TWSA 4XX5A 2AXUA 5AN8A 4HORA 4BY6A 3UUXA 2A4ZA 2FO1E 3U9WA 3NOCD 4IULA 3E32A 2I9CA 3NF1A 3BG0B 5FQ4A 4LEUA 2RKKA 1OCZE 2NC9A 1AP7A 1BI8B 3TWQA 4U63A 2IQCA 4KXKB 4GTMA 5AAOA 3OTNA 3IBEA 3KSQA 3CVYA 5BW8C 1OWMA 5FQ7A 3CK9A 5ENQD 3NBNB 2ZGDA 5FIOA 3VTYA 1S70B 3LPZA 5FQ6A 1OCRE 1UN9A 3J5QB 2J8SD 2IEJA 1IQUA 5ENOD 4DRXE 1S64A 2XRZA 2KZTB 4C9BB 2X6JA 3R7QA 2A5EA 4EZLA 4U8VD 2A5UA 2L9BA 5FZRA 2R17C 3O4ZA 5CRUA 1TNYA 3PZ1A 4W9RA 3L13A 2BEDA 4N3BA 3UIPC 2NYJA 2DVWA 3TGOA 2RD0A 2ZIRA 4BEPA 3HVEB 3CR3A 4XZ4A 2JLBA 3LVRE 4Q94A 1E7VA 1PY1A 3MEKA 4UWGA 4BTBA 2VGYA 4F1SA 3PS6A 1A5EA 1BPOA 1TNOA 3FHEA 3CIAA 3SHFA 4DX1A 4H7YA 3FH5A 2AJAA 2KCLA 3UM0A 4G24A 2YNQA 3VLEA 1TN8A 4U0SA 3Q78A 2DZNA 5FT9A 4HI9A 1SVXA 3L16A 3HIZA 2M63A 3U66A 4FHJA 3CKCA 5BV0A 3FUFA 3UKUG 3CSFA
chains in the Genus database with same CATH topology
4ZFHA 1G3NB 2ZGDA 3EU9A 5FIOA 3V30A 4ZHBA 1S70B 5EILA 4DUIA 5KNHD 5EYPF 4YDYA 4OAUC 2KXPC 5AQ7A 1K1BA 2P2CP 5CEDB 2BKKB 4QQIA 4O1PA 1K3ZD 1SW6A 2XZDG 5JMND 3SO8A 5CECB 4HRMB 1BU9A 2B0OE 4HRNA 1DCQA 4HB5A 3J5QB 1BLXB 4N5QA 2J8SD 3B95A 4GPMA 3UTMA 2VGEA 3HG0D 5HRYA 4DX6D 3JXJA 5BXOA 3T8KA 3V2XA 3W9GA 1AWCB 1N0RA 4NIKA 3T9KA 2V4HC 5ENOD 4DRXE 3TWRA 3TWWA 1OY3D 1MYOA 3W9FA 4BESA 4BERA 1QYMA 4DX5D 1UOHA 2XZTG 3B7BA 3DEPA 2QYJA 4F1PA 4C48B 4TUMA 2V5QC 2ETBA 5ENTD 5CERB 2A5EA 5EN5D 3ZNGA 1TR4A 4U8VD 2XEHA 4DX7D 4HRLA 3LJNA 3ZU7B 5CBNA 4HLLA 3HRAA 4U95D 4HI8A 5EIDA 2Y0BG 2F8XK 4U8YD 2HE0A 1NFIE 2L6BA 4J8YA 3JXIA 2QC9A 5HKPA 4A63B 1N11A 5EYLA 4F6RD 3EHRA 2DWZA 1BD8A 2NYJA 5AARA 2DVWA 3NBNB 4QFVA 4JB8P 2XEEA 1YYHA 5AQBA 5AQ9A 4LNUD 5ENRD 3TWUA 1IKND 3TWTA 5CBOA 2F8YA 4HQDA 4ATZD 4K5AB 1DC2A 3F6QA 2KBXA 1OT8A 4BEPA 3AJIA 4UUCA 4Z68A 5KWDA 3TWSA 4G8LA 4J7WA 1MX4A 3ZKJA 5AN8A 5CEAA 1IXVA 3NOGD 3TWXA 4BETA 2ETAA 3Q9UC 2ETCA 5ITZF 1N0QA 1WDYA 5ENPD 3UXGA 2BKGA 2DZOA 3EHQA 1MJ0A 4GMRA 4OAVB 2FO1E 4YDWA 3ZUVB 3NOCD 4K5BA 4RLYA 2JABA 1A5EA 3Q9NC 5ENSD 4DX2A 1IHBA 3V79K 2RFAA 1YMPA 5EIBE 2MYOA 3UI2A 4HBDA 5HS0A 4DX1A 4CZ2D 1MX6A 3KEAA 5FINA 1AP7A 2XENA 1BI8B 3C5RA 3AAAC 2ZGGA 3D9HA 1K1AA 5AQAA 2AJAA 3TWQA 1MX2A 5JA4D 4LSZE 1BI7B 4HNAD 5KBAA 1D9SA 5D66A 3TWVA 4U96D 5AAOA 4G8KA 2DZNA 5BXUA 2RFMA 4HI9A 1SVXA 3DEOA 4CYMD 3V31A 3JUEA 4LG6A 2F37A 2Y1LE 4O60A 4K5CA 1YCSB 5ENQD 5KNGA 3J5PA 4O1OA 1WG0A 4B93B 3IXEA 2PNNA 4BSZB 3V2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZFH A;  1G3N B;  2ZGD A;  3EU9 A;  5FIO A;  3V30 A;  4ZHB A;  1S70 B;  5EIL A;  4DUI A;  5KNH D;  5EYP F;  4YDY A;  4OAU C;  2KXP C;  5AQ7 A;  1K1B A;  2P2C P;  5CED B;  2BKK B;  4QQI A;  4O1P A;  1K3Z D;  1SW6 A;  2XZD G;  5JMN D;  3SO8 A;  5CEC B;  4HRM B;  1BU9 A;  2B0O E;  4HRN A;  1DCQ A;  4HB5 A;  3J5Q B;  1BLX B;  4N5Q A;  2J8S D;  3B95 A;  4GPM A;  3UTM A;  2VGE A;  3HG0 D;  5HRY A;  4DX6 D;  3JXJ A;  5BXO A;  3T8K A;  3V2X A;  3W9G A;  1AWC B;  1N0R A;  4NIK A;  3T9K A;  2V4H C;  5ENO D;  4DRX E;  3TWR A;  3TWW A;  1OY3 D;  1MYO A;  3W9F A;  4BES A;  4BER A;  1QYM A;  4DX5 D;  1UOH A;  2XZT G;  3B7B A;  3DEP A;  2QYJ A;  4F1P A;  4C48 B;  4TUM A;  2V5Q C;  2ETB A;  5ENT D;  5CER B;  2A5E A;  5EN5 D;  3ZNG A;  1TR4 A;  4U8V D;  2XEH A;  4DX7 D;  4HRL A;  3LJN A;  3ZU7 B;  5CBN A;  4HLL A;  3HRA A;  4U95 D;  4HI8 A;  5EID A;  2Y0B G;  2F8X K;  4U8Y D;  2HE0 A;  1NFI E;  2L6B A;  4J8Y A;  3JXI A;  2QC9 A;  5HKP A;  4A63 B;  1N11 A;  5EYL A;  4F6R D;  3EHR A;  2DWZ A;  1BD8 A;  2NYJ A;  5AAR A;  2DVW A;  3NBN B;  4QFV A;  4JB8 P;  2XEE A;  1YYH A;  5AQB A;  5AQ9 A;  4LNU D;  5ENR D;  3TWU A;  1IKN D;  3TWT A;  5CBO A;  2F8Y A;  4HQD A;  4ATZ D;  4K5A B;  1DC2 A;  3F6Q A;  2KBX A;  1OT8 A;  4BEP A;  3AJI A;  4UUC A;  4Z68 A;  5KWD A;  3TWS A;  4G8L A;  4J7W A;  1MX4 A;  3ZKJ A;  5AN8 A;  5CEA A;  1IXV A;  3NOG D;  3TWX A;  4BET A;  2ETA A;  3Q9U C;  2ETC A;  5ITZ F;  1N0Q A;  1WDY A;  5ENP D;  3UXG A;  2BKG A;  2DZO A;  3EHQ A;  1MJ0 A;  4GMR A;  4OAV B;  2FO1 E;  4YDW A;  3ZUV B;  3NOC D;  4K5B A;  4RLY A;  2JAB A;  1A5E A;  3Q9N C;  5ENS D;  4DX2 A;  1IHB A;  3V79 K;  2RFA A;  1YMP A;  5EIB E;  2MYO A;  3UI2 A;  4HBD A;  5HS0 A;  4DX1 A;  4CZ2 D;  1MX6 A;  3KEA A;  5FIN A;  1AP7 A;  2XEN A;  1BI8 B;  3C5R A;  3AAA C;  2ZGG A;  3D9H A;  1K1A A;  5AQA A;  2AJA A;  3TWQ A;  1MX2 A;  5JA4 D;  4LSZ E;  1BI7 B;  4HNA D;  5KBA A;  1D9S A;  5D66 A;  3TWV A;  4U96 D;  5AAO A;  4G8K A;  2DZN A;  5BXU A;  2RFM A;  4HI9 A;  1SVX A;  3DEO A;  4CYM D;  3V31 A;  3JUE A;  4LG6 A;  2F37 A;  2Y1L E;  4O60 A;  4K5C A;  1YCS B;  5ENQ D;  5KNG A;  3J5P A;  4O1O A;  1WG0 A;  4B93 B;  3IXE A;  2PNN A;  4BSZ B;  3V2O A; 
#chains in the Genus database with same CATH topology
 3JCK C;  3E37 A;  2MHK A;  4LCT A;  1H2T C;  5J90 A;  2H6I A;  2X38 A;  1K3Z D;  1BU9 A;  2H6F A;  3LEW A;  1N4Q A;  2P9P G;  3PEV B;  3JUI A;  3D3M A;  5EDS A;  4GCN A;  4PH4 B;  3KSL A;  1QYM A;  1U3C A;  3ML9 A;  3KS2 A;  1U2V G;  3NB2 A;  5ENT D;  3ZNG A;  1TJF A;  3RKV A;  4N3A A;  1P5Q A;  4JHR A;  4G2V A;  2P9N G;  4HXI A;  1Y8M A;  4EZK A;  4UQY A;  2WQH A;  4JB8 P;  5AYW D;  5AQ9 A;  4YVQ C;  3DXK G;  3PNT B;  5H7P A;  3ZEF A;  5CEA A;  3Q49 B;  2MRI A;  4XI9 A;  4V3I A;  1QQE A;  3SZ7 A;  5G2N A;  5ITZ F;  1KPS B;  3UXG A;  3ASO E;  4OAV B;  3N71 A;  3LS8 A;  2RFA A;  4C0M A;  2MYO A;  3D9I A;  4AY6 A;  1MZC A;  1GW6 A;  5AQA A;  2DIW A;  1RZ4 A;  2GW1 A;  4JHK A;  5BXU A;  5G04 C;  4A1S A;  3KEZ A;  4CYM D;  3AG3 E;  3U4T A;  3EUV A;  4I1M A;  2WXF A;  3BUA A;  4HVB A;  3V2O A;  4AEZ C;  3UT8 A;  5ARF A;  3BU8 A;  5AQ7 A;  4GB9 A;  2CG2 A;  3CQG B;  1HS6 A;  3DSU A;  3EDT B;  4HB5 A;  2V4L A;  2YQ8 A;  4BX9 A;  2GRR B;  4NIK A;  2EIM E;  2XHE A;  3ONL A;  4KVM A;  4C48 B;  3RIB A;  3RSE G;  2Y0B G;  4I2Z A;  5A23 A;  5CMW A;  1NFI E;  4J8Y A;  2ZXW E;  4BT9 A;  4WWO A;  4GML A;  4LNU D;  4EPZ A;  3RAU A;  1EF1 C;  3LYA A;  4IYP A;  2NSZ A;  2WXL A;  3ZYQ A;  4CT0 A;  2ETC A;  2BKG A;  3B7U X;  4F3V A;  4IRU A;  1O5M A;  3ZN3 A;  2KCV A;  3U64 A;  3SF4 A;  2KZT A;  3IHY A;  2OND A;  4XKC A;  4CZ2 D;  5FIN A;  5A6C A;  2ZGG A;  3PZD A;  3ESL A;  4XEI G;  4I2W A;  3Q4A B;  4ILG A;  1S63 A;  3QWV A;  4LG6 A;  3HYM B;  1O1T A;  4GTS A;  4DPR A;  2VJ8 A;  4JW1 A;  1UJJ A;  2FO7 A;  4RG6 A;  5KNH D;  3PUK A;  1D8D A;  4FLB A;  3T8M A;  2CFU A;  1S0P A;  2GGF A;  3GW4 A;  4L9P A;  4ANX A;  3UKR G;  1W3B A;  3UTM A;  2VGE A;  3AS4 A;  5D2M C;  5BXO A;  4JXT A;  5JHA A;  3ZGQ A;  2V4H C;  1U3D A;  3W9F A;  4BFR A;  3HXE A;  1NZN A;  3CK8 A;  3ZFW A;  1D8E A;  4DX7 D;  3FDH A;  1TNU A;  1O1S A;  5HQ8 A;  5CBN A;  3DBS A;  3FU0 A;  4HS2 A;  4GYO A;  4NRH B;  1N52 A;  4GPK A;  4L7T A;  3QJZ A;  3GZ2 A;  2P9I G;  4G8L A;  4JC8 A;  2YHC A;  2LAI A;  4BET A;  3ZIM A;  2OVF A;  2AXV A;  3G2S A;  1NA3 A;  2PQR A;  4NQ0 A;  1HE8 A;  2DYR E;  4UI9 J;  4MRU A;  2Y3A A;  4KBQ A;  3UM2 A;  4FLH A;  3CVU A;  2R59 A;  3CEQ A;  3EIJ A;  3UIN C;  3RJV A;  3S7F A;  3EU9 A;  1N95 A;  2HYZ A;  4DUI A;  2WXK A;  2Y69 E;  2MOW A;  4OAU C;  1MQS A;  4I1A A;  4YDE A;  5BPP A;  4CDR A;  1UJK A;  3PRE A;  5CEC B;  3MJW A;  3APD A;  2B0O E;  4XI0 A;  4HOU A;  2CFZ A;  4UWH A;  3B95 A;  2XS1 A;  5HRY A;  4GMJ A;  4AVX A;  2VTB B;  3TXN A;  2J08 A;  1N0R A;  3T9K A;  3ABK E;  4CCA A;  4F1P A;  1NL4 A;  3FTU A;  3Q7F A;  5EN5 D;  2UWJ G;  4Q96 A;  2IFU A;  3FFL A;  4G23 A;  4HI8 A;  2L6B A;  1H6K A;  4UI9 C;  5D0Q D;  2J07 A;  2E2E A;  3FUN A;  4U0U A;  2XEE A;  3AG1 E;  1HH8 A;  4GTQ A;  4LNG A;  2WXP A;  2WQ7 A;  3F6Q A;  2YIN A;  4UUC A;  4Z68 A;  1ELR A;  1ZU2 A;  2IOS A;  3D9N A;  2Q7F A;  5JHB A;  5KJK A;  3L54 A;  3NOG D;  3GZS A;  3P2B A;  3UT7 A;  5KJM A;  4AV7 A;  4YDW A;  4WUY A;  4TV3 A;  4KMO A;  3UI2 A;  5HS0 A;  4J6I A;  4U0Z A;  1MX6 A;  5DBK A;  3ASG A;  3SGH A;  3UMV A;  4RVB A;  4G8K A;  3T5V A;  3FUK A;  3QKY A;  1JUQ A;  5G55 A;  4PS7 A;  3ZHE A;  4ANV A;  3ASN E;  3S7J A;  2GRO B;  3MV2 B;  3UPV A;  2WMN A;  4DLQ A;  3AU5 A;  4JEU A;  2QFC A;  1N9A A;  4TXQ A;  4O6F A;  3IHV A;  1HU3 A;  2BKK B;  3SY2 A;  3SO8 A;  4B94 A;  2XPI A;  5CCL A;  4G26 A;  3DSW A;  4DLO A;  3B7B A;  4EBA A;  2FBN A;  3I5P A;  3MCX A;  1SA4 A;  1X81 A;  3OAW A;  5EID A;  1XGW A;  1HF8 A;  3SQV A;  3EHR A;  3FUD A;  5AAR A;  2DBA A;  4WND A;  2AVP A;  3OXG A;  3BQO A;  3Q79 A;  3FUE A;  1IKN D;  3ISM C;  3FUI A;  2GRL A;  3UT4 A;  4DJA A;  2JEK A;  1LTX A;  3Q5M A;  3VLD A;  1ZBP A;  4E85 A;  3E34 A;  3C98 A;  3L08 A;  3TJP A;  1UW4 B;  3ZUV B;  4GYY A;  4B89 A;  1YA0 A;  1YMP A;  3T5X A;  2GRP B;  2WXI A;  4GZ6 A;  1IQR A;  2XEN A;  3L17 A;  1K1A A;  3R9M A;  4G11 A;  1MX2 A;  1TNZ A;  4GA1 A;  1ELK A;  2J09 A;  3HXB A;  1NI1 A;  2YHE A;  3PE3 A;  3DEO A;  2DYS E;  2LXL A;  2XCC A;  4N2Q A;  4BSZ B;  1TN6 A;  3DST A;  3UX4 A;  5EIL A;  4YDY A;  3ULQ A;  3FH8 A;  3C3O A;  2KM4 A;  4AIF A;  4GTP A;  2KC7 A;  2VSO E;  4O1P A;  5KCM A;  4ANW A;  3CVX A;  3ABM E;  2IJG X;  4AM9 A;  3CVW A;  4MLP A;  4UWK A;  3CVQ A;  4R7L A;  3UM1 A;  4I43 A;  5BNW A;  5KJL A;  2HO1 A;  4BER A;  1TN7 A;  2P9S G;  3ZVV A;  5EX0 A;  2QYU A;  4K03 A;  4U8Y D;  1E8Z A;  1OXJ A;  3PUJ A;  2WXG A;  4GTV A;  2XRY A;  4UQZ A;  4GZ3 A;  4GYW A;  3HDX A;  2XGS A;  1DC2 A;  2BF0 X;  3PVL A;  3EHM A;  3ZKJ A;  1OWN A;  3BG1 B;  4FUL A;  5C2Y A;  3EHQ A;  3MZL B;  3NAW A;  4K5B A;  2VTB A;  3OXF A;  1Z3X A;  4J0U A;  2L0T B;  3PEU B;  4CRW A;  2WXM A;  3C5R A;  3CHQ A;  4P29 A;  1D9S A;  4JA9 A;  1FT2 A;  3B7S A;  3I4R B;  1KT1 A;  3GZ1 A;  3CK7 A;  5LOZ A;  1JWG A;  5ANR A;  2WQ6 A;  2LUH A;  3DSS A;  3UIO C;  4CGV A;  1UN8 A;  4I9C A;  4I9E A;  3QDN A;  4ZHB A;  3FP3 A;  1IHG A;  3APC A;  3FTY A;  3FUL A;  1OWO A;  5C1D A;  3D9L A;  2X6K A;  1QBQ A;  4U07 A;  4LUN U;  3LXU X;  1OWL A;  3MKQ B;  3D9O A;  3W9G A;  4FP7 A;  5D0O D;  3APF A;  3QNK A;  2VGX B;  1JCQ A;  5FZQ A;  3CHM A;  3OXL A;  4N5C A;  4HRL A;  1PC2 A;  4WNE A;  3KAE A;  5EYL A;  3URZ A;  4F7A A;  3LY7 A;  4HOT A;  5ENR D;  4A3V A;  1E8Y A;  3PDN A;  4KZ0 A;  1MX4 A;  3QWP A;  3HXD A;  1DVP A;  3E4B A;  3MA5 A;  4EQF A;  2XEV A;  4HLE A;  4GMR A;  2VSN A;  4EEC A;  5EKQ D;  2GRQ B;  2C0M A;  2P9L G;  2EIL E;  3QK0 A;  4WWN A;  3ZHE B;  2WXR A;  4JVS A;  4PS8 A;  2VQ2 A;  3D9K A;  2OEW A;  5J08 A;  3SBS A;  1FT1 A;  1SQM A;  1BI7 B;  3AS8 A;  3C3Q A;  1N94 A;  3ONK A;  4C0E A;  1PAQ A;  1HG5 A;  3IXE A;  4AJW A;  4ZFH A;  1K8K G;  1OWP A;  4N2S A;  2LAH A;  3UM3 A;  2P2C P;  2I6H A;  3G2U A;  3Q7A A;  3TG4 A;  5E75 A;  4HRN A;  3ZYM A;  2H6G A;  1DCQ A;  3ZRH A;  3MYV A;  3B7T A;  3BEE A;  2BUG A;  3TWW A;  2PL2 A;  2H6H A;  1E90 A;  4GZD A;  1TEZ A;  5T3R A;  3TXM A;  3HRA A;  3SI5 A;  4K0R A;  5CMY A;  3ASF A;  2WB2 A;  3NQP A;  3FTX A;  5FQ8 A;  2IO3 C;  3VLF A;  3CVV A;  3SBT B;  3IEG A;  3R7R A;  3HHM A;  2WXJ A;  4J7W A;  3I3N A;  4M7C A;  3TWX A;  2BTD A;  4E6H A;  1WDY A;  1LD8 A;  4EZJ A;  4URK A;  3ULY A;  5JJT A;  3DSV A;  5EIB E;  2IOL A;  3CQC B;  3KEA A;  4N3C A;  5AIJ A;  3AAA C;  3PE4 A;  3FTV A;  4JD2 G;  1N4P A;  5B3S E;  3CV0 A;  4AP2 A;  2RFM A;  2J4B A;  5LFA A;  3V31 A;  3JUE A;  2F37 A;  4I6E A;  1FPP A;  5KNG A;  4LRZ A;  2PNN A;  1E7U A;  1TYQ G;  4FJZ A;  4WNF A;  2PM7 A;  1OCC E;  4BT8 A;  3VTX A;  4BX8 A;  1K1B A;  4LNB A;  3X2Q E;  2J49 A;  3UQ3 A;  5B1B E;  4FHK A;  3L82 A;  2R05 A;  4HOQ A;  3DRA A;  4N5Q A;  2WM9 A;  4A3T A;  3SD5 A;  1MHQ A;  1VDY A;  1AWC B;  2R2L A;  3TWR A;  4APO A;  1E8X A;  4DX5 D;  2L0I A;  1TR4 A;  3AU4 A;  3ZPJ A;  3ZU7 B;  2UY1 A;  3ABL E;  2QC9 A;  3PRZ A;  2OCC E;  4U04 A;  3CVP A;  4UWL A;  2FEZ A;  5IY5 E;  2EQX A;  4J8E A;  1FVF A;  1Q2Z A;  2KBX A;  3FEX A;  5BT1 A;  2E0I A;  2X6I A;  5FZS A;  4FU3 A;  3TG5 A;  1WY6 A;  2F0Y A;  3Q9U C;  2CHZ A;  3FY4 A;  2AWI A;  2VSY A;  4B0Z A;  3MKQ A;  4J8D A;  5ENS D;  4ILI A;  4YND A;  4HBD A;  5FTP A;  2VGX A;  1E96 B;  4ABN A;  4J8F A;  4BSX A;  1INZ A;  3G2V A;  4DI4 A;  4HNA D;  5KBA A;  5D66 A;  3RRM B;  3RK6 A;  3L6A A;  2R03 A;  2XGM A;  5JJ7 A;  4MKT A;  4EHM A;  4UWF A;  2XGO A;  4KYO B;  5AJD A;  2P58 C;  4QQI A;  4PS3 A;  3G2T A;  4F53 A;  2VYI A;  3PZ4 A;  1TNB A;  4DX6 D;  3T8K A;  3CHP A;  4OYS A;  4TXP A;  4FA6 A;  5CER B;  2KAT A;  5AJL A;  2GRM A;  2R02 A;  2OOE A;  2V0P A;  4LER A;  5FWQ A;  3EJN A;  3JXI A;  1N11 A;  3JQ0 A;  4MS6 A;  4YDO A;  5AQB A;  5E76 A;  1UG3 A;  3ESK A;  2FI7 A;  1OT8 A;  2J4D A;  3FEY A;  3FTS A;  2DCP A;  1SZA A;  3WG7 E;  4B8A A;  1EDU A;  4MBG A;  2LO6 A;  5ENP D;  1MJ0 A;  3FUM A;  1DNP A;  4J8S A;  4WAF A;  3FUH A;  2C2L A;  2WXQ A;  4DI3 A;  4FJY A;  1SZ9 A;  4CT4 A;  1H2V C;  3SFZ A;  3C72 A;  3LVQ E;  4JHJ A;  4M3O A;  3QAR A;  5B1A E;  1JCS A;  1DCE A;  5ARG A;  2XPZ A;  4WNG A;  3RO2 A;  1A17 A;  1N4S A;  1EPU A;  4B8C B;  3LKU A;  5CRV A;  3CHS A;  4KZC A;  3Q73 A;  2XZD G;  2AW6 A;  1L5J A;  1Y6I A;  1BLX B;  4FAD A;  4HFG A;  3R9A B;  4G1T A;  1OY3 D;  4BES A;  3IV0 A;  1UOH A;  2XZT G;  3RRN B;  2QYJ A;  3LJ3 A;  3RU0 A;  3ZXP A;  2LXM A;  4I1O B;  4Y6C A;  4EBA G;  5ANL A;  3RO3 A;  4L23 A;  5HKP A;  2DWZ A;  3LY8 A;  3NZS A;  1YYH A;  1H6P A;  2V5F A;  1HG2 A;  2ILR A;  1NP7 A;  3FUJ A;  2F8Y A;  2Y4U A;  3AJI A;  2CHX A;  3JQ1 A;  1IXV A;  1WAO 1;  3EHN A;  1N0Q A;  4ILH B;  4YVO A;  1H19 A;  2JAB A;  3Q9N C;  2IF4 A;  4AXH A;  5CHE E;  3P1U A;  3KD7 A;  4A1G A;  2WXH A;  2QZA A;  3S7D A;  3TWV A;  3CVL A;  3LDZ A;  4L2L A;  3FU5 A;  2IO2 C;  3JYS A;  1HX8 A;  3PZ2 A;  4PUC A;  3MGB A;  2Y1L E;  4O60 A;  4AY5 A;  1WG0 A;  5G04 J;  1G3N B;  4U7E B;  5A7D B;  3E30 A;  1V54 E;  2IU1 A;  5CED B;  5EX3 A;  2OVB A;  3HXF A;  4UI9 K;  1HZ4 A;  2IY0 C;  1O1R A;  2UY1 B;  4GPM A;  2PM6 A;  2XQ0 A;  4I17 A;  4OVU A;  1KT0 A;  2ETB A;  5FJY A;  4AOF A;  5LX8 A;  4U8H A;  2ZIS A;  3LJN A;  5BUZ A;  4HLL A;  2EIK E;  1Z3Y A;  4JPS A;  5G05 J;  1LD7 A;  3SFY A;  3CVN A;  3CKB A;  4CDN A;  4UQX A;  4DK5 A;  3TWT A;  4XE0 A;  5CCM A;  4K5A B;  4RSY A;  4ANU A;  1KZP A;  2FF4 A;  3D9J A;  1OUV A;  2WMO A;  3ML8 A;  3ASD A;  1IYG A;  3TL5 A;  3LY9 A;  3AS5 A;  2LNI A;  3PH0 C;  5LCW J;  3DXM G;  4CGW A;  3C3R A;  4I6J A;  3QWW A;  2LSU A;  4TRQ A;  1WM5 A;  3QOU A;  4XIF A;  2AXZ A;  4U96 D;  1HFA A;  3FU6 A;  4ACL A;  2Y4T A;  4FC8 A;  1TJC A;  2PQN A;  3ASH A;  2WPV A;  4ACK A;  3DPY A;  5T8I A;  2HM8 A;  3J5P A;  2P9K G;  3FH7 A;  3MX3 A;  4B93 B;  1N54 A;  2L6J A;  4GTT A;  2C0L A;  4NAC A;  1V55 E;  2GRN B;  2J9Q A;  1SA5 A;  5G05 C;  2CG3 A;  4CDM A;  1FVH A;  1E8W A;  1SW6 A;  2X6H A;  3NZU A;  5JMN D;  3HG0 D;  3PNL B;  5JJ6 A;  5LP0 A;  1MYO A;  4JZY A;  2V5Q C;  1KLX A;  1Z5S C;  2R5S A;  4OVV A;  3EIQ C;  5LCW C;  2WVI A;  3E33 A;  4ATG A;  5ENN A;  3MKR A;  4F6R D;  1BD8 A;  3FU3 A;  4QFV A;  1ZB1 A;  4HQD A;  4BTA A;  3CLJ A;  4GTR A;  5KWD A;  4XKB A;  1HXI A;  4JA7 A;  2CHW A;  1NA0 A;  4GTO A;  3CGH A;  3CST A;  3D9M A;  3ZW3 A;  4KVO A;  2FUL A;  3B13 A;  5M72 A;  1IHB A;  2WXO A;  3HVE A;  4L1B A;  2I1K A;  2X3M A;  1X5B A;  3Q75 A;  3DSX A;  2WXN A;  2V8S E;  2EIJ E;  4GCO A;  4BWR A;  4IN3 B;  1QNF A;  2NXP A;  3RRU A;  4K5C A;  2OV8 A;  4NUR A;  3QC1 A;  5JA4 D;  5KJN A;  3O48 A;  4GZ5 A;  1JWF A;  1RW2 A;  5AEN A;  2I1J A;  3GYZ A;  1H0A A;  4RQI A;  2KCK A;  3IKO B;  2ION A;  3SFX A;  3JXJ A;  3MV3 B;  4GA2 A;  3D9P A;  1JCR A;  3WXX A;  3TAX A;  1EYH A;  3FTW A;  1HO8 A;  4TUM A;  3I4G A;  3Q47 B;  3EU5 A;  3QB2 A;  2XS8 A;  3B7R L;  4KT6 B;  4A63 B;  2I2O A;  4N39 A;  3DPD A;  1H2U A;  1FCH A;  4I6G A;  3PZ3 A;  2HR2 A;  5HI7 A;  3ZYL A;  3ZXS A;  5CBO A;  4HOS A;  4D10 C;  1ELW A;  4PDX A;  1N4R A;  4GU5 A;  4WWP A;  1B89 A;  2ETA A;  3S7B A;  2DZO A;  4GZC A;  2B6C A;  2LSV A;  4RG9 A;  4RLY A;  4GA0 A;  1H6O A;  4DX2 A;  1KZO A;  3V79 K;  3FTZ A;  2X6F A;  4ME2 A;  3U3W A;  2ZU6 B;  5DIZ A;  4X8Q A;  3D9H A;  4L2Y A;  3G2W A;  4LSZ E;  4JL0 A;  2QY7 A;  1LF8 A;  1XNF A;  2XCB A;  3Q15 A;  1YCS B;  4CEM A;  4O1O A;  5BV1 A;  3K9I A;  4JEH A;  2XPY A;  3V30 A;  4A55 A;  4TUU A;  5EYP F;  4TXR A;  2KXP C;  1QZ2 A;  3ENE A;  1OCO E;  4G25 A;  4HRM B;  3HXC A;  2PZI A;  1Z6T A;  4GAA A;  3DWL G;  3V2X A;  1JPL A;  3SNX A;  3DEP A;  2EIN E;  2OEV A;  3QAQ A;  3L9T A;  3ULE G;  2VSX E;  4Q69 A;  3L22 A;  3LCA A;  2XEH A;  4U95 D;  4Y6W A;  3S2A A;  2F8X K;  3FWV A;  2HE0 A;  2P9U G;  4APF A;  4H7X A;  3CHO A;  3CHR A;  5T4Y A;  2RG8 A;  3AG2 E;  3TWU A;  3ZYK A;  4ATZ D;  3AG4 E;  3TWS A;  4XX5 A;  2AXU A;  5AN8 A;  4HOR A;  4BY6 A;  3UUX A;  2A4Z A;  2FO1 E;  3U9W A;  3NOC D;  4IUL A;  3E32 A;  2I9C A;  3NF1 A;  3BG0 B;  5FQ4 A;  4LEU A;  2RKK A;  1OCZ E;  2NC9 A;  1AP7 A;  1BI8 B;  3TWQ A;  4U63 A;  2IQC A;  4KXK B;  4GTM A;  5AAO A;  3OTN A;  3IBE A;  3KSQ A;  3CVY A;  5BW8 C;  1OWM A;  5FQ7 A;  3CK9 A;  5ENQ D;  3NBN B;  2ZGD A;  5FIO A;  3VTY A;  1S70 B;  3LPZ A;  5FQ6 A;  1OCR E;  1UN9 A;  3J5Q B;  2J8S D;  2IEJ A;  1IQU A;  5ENO D;  4DRX E;  1S64 A;  2XRZ A;  2KZT B;  4C9B B;  2X6J A;  3R7Q A;  2A5E A;  4EZL A;  4U8V D;  2A5U A;  2L9B A;  5FZR A;  2R17 C;  3O4Z A;  5CRU A;  1TNY A;  3PZ1 A;  4W9R A;  3L13 A;  2BED A;  4N3B A;  3UIP C;  2NYJ A;  2DVW A;  3TGO A;  2RD0 A;  2ZIR A;  4BEP A;  3HVE B;  3CR3 A;  4XZ4 A;  2JLB A;  3LVR E;  4Q94 A;  1E7V A;  1PY1 A;  3MEK A;  4UWG A;  4BTB A;  2VGY A;  4F1S A;  3PS6 A;  1A5E A;  1BPO A;  1TNO A;  3FHE A;  3CIA A;  3SHF A;  4DX1 A;  4H7Y A;  3FH5 A;  2AJA A;  2KCL A;  3UM0 A;  4G24 A;  2YNQ A;  3VLE A;  1TN8 A;  4U0S A;  3Q78 A;  2DZN A;  5FT9 A;  4HI9 A;  1SVX A;  3L16 A;  3HIZ A;  2M63 A;  3U66 A;  4FHJ A;  3CKC A;  5BV0 A;  3FUF A;  3UKU G;  3CSF A; 
#chains in the Genus database with same CATH homology
 4ZFH A;  1G3N B;  2ZGD A;  3EU9 A;  5FIO A;  3V30 A;  4ZHB A;  1S70 B;  5EIL A;  4DUI A;  5KNH D;  5EYP F;  4YDY A;  4OAU C;  2KXP C;  5AQ7 A;  1K1B A;  2P2C P;  5CED B;  2BKK B;  4QQI A;  4O1P A;  1K3Z D;  1SW6 A;  2XZD G;  5JMN D;  3SO8 A;  5CEC B;  4HRM B;  1BU9 A;  2B0O E;  4HRN A;  1DCQ A;  4HB5 A;  3J5Q B;  1BLX B;  4N5Q A;  2J8S D;  3B95 A;  4GPM A;  3UTM A;  2VGE A;  3HG0 D;  5HRY A;  4DX6 D;  3JXJ A;  5BXO A;  3T8K A;  3V2X A;  3W9G A;  1AWC B;  1N0R A;  4NIK A;  3T9K A;  2V4H C;  5ENO D;  4DRX E;  3TWR A;  3TWW A;  1OY3 D;  1MYO A;  3W9F A;  4BES A;  4BER A;  1QYM A;  4DX5 D;  1UOH A;  2XZT G;  3B7B A;  3DEP A;  2QYJ A;  4F1P A;  4C48 B;  4TUM A;  2V5Q C;  2ETB A;  5ENT D;  5CER B;  2A5E A;  5EN5 D;  3ZNG A;  1TR4 A;  4U8V D;  2XEH A;  4DX7 D;  4HRL A;  3LJN A;  3ZU7 B;  5CBN A;  4HLL A;  3HRA A;  4U95 D;  4HI8 A;  5EID A;  2Y0B G;  2F8X K;  4U8Y D;  2HE0 A;  1NFI E;  2L6B A;  4J8Y A;  3JXI A;  2QC9 A;  5HKP A;  4A63 B;  1N11 A;  5EYL A;  4F6R D;  3EHR A;  2DWZ A;  1BD8 A;  2NYJ A;  5AAR A;  2DVW A;  3NBN B;  4QFV A;  4JB8 P;  2XEE A;  1YYH A;  5AQB A;  5AQ9 A;  4LNU D;  5ENR D;  3TWU A;  1IKN D;  3TWT A;  5CBO A;  2F8Y A;  4HQD A;  4ATZ D;  4K5A B;  1DC2 A;  3F6Q A;  2KBX A;  1OT8 A;  4BEP A;  3AJI A;  4UUC A;  4Z68 A;  5KWD A;  3TWS A;  4G8L A;  4J7W A;  1MX4 A;  3ZKJ A;  5AN8 A;  5CEA A;  1IXV A;  3NOG D;  3TWX A;  4BET A;  2ETA A;  3Q9U C;  2ETC A;  5ITZ F;  1N0Q A;  1WDY A;  5ENP D;  3UXG A;  2BKG A;  2DZO A;  3EHQ A;  1MJ0 A;  4GMR A;  4OAV B;  2FO1 E;  4YDW A;  3ZUV B;  3NOC D;  4K5B A;  4RLY A;  2JAB A;  1A5E A;  3Q9N C;  5ENS D;  4DX2 A;  1IHB A;  3V79 K;  2RFA A;  1YMP A;  5EIB E;  2MYO A;  3UI2 A;  4HBD A;  5HS0 A;  4DX1 A;  4CZ2 D;  1MX6 A;  3KEA A;  5FIN A;  1AP7 A;  2XEN A;  1BI8 B;  3C5R A;  3AAA C;  2ZGG A;  3D9H A;  1K1A A;  5AQA A;  2AJA A;  3TWQ A;  1MX2 A;  5JA4 D;  4LSZ E;  1BI7 B;  4HNA D;  5KBA A;  1D9S A;  5D66 A;  3TWV A;  4U96 D;  5AAO A;  4G8K A;  2DZN A;  5BXU A;  2RFM A;  4HI9 A;  1SVX A;  3DEO A;  4CYM D;  3V31 A;  3JUE A;  4LG6 A;  2F37 A;  2Y1L E;  4O60 A;  4K5C A;  1YCS B;  5ENQ D;  5KNG A;  3J5P A;  4O1O A;  1WG0 A;  4B93 B;  3IXE A;  2PNN A;  4BSZ B;  3V2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...