3Q9UC

In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
157
Chain Sequence
b'FGQDLGKKLLEAAAAGQDDEVRILMANGADVNATDDNGLTPLHLAAANGQLEIVEVLLKNGADVNASDSAGITPLHLAAYDGHLEIVEVLLKHGADVNAYDRAGWTPLHLAALSGQLEIVEVLLKHGADVNAQDALGLTAFDISINQGQEDLAEILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CoA binding protein
publication title A de novo protein binding pair by computational design and directed evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding, de novo protein
total genus 45
structure length 157
sequence length 157
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3q9uC00
4HB5A 3UXGA 2XZDG 4J8YA 1K1BA 4LG6A 4F6RD 3IXEA 4YDYA 1G3NB 5AQ7A 4G8LA 3Q9NC 5AN8A 3UI2A 1DC2A 2F8XK 3T9KA 1MX2A 4OAVB 3J5PA 1MX4A 1SVXA 2NYJA 3JUEA 2FO1E 4BSZB 1IKND 2QYJA 1MX6A 2V5QC 4K5BA 3JXJA 4CYMD 5KBAA 1BU9A 3TWQA 5EIBE 5CERB 4BETA 4DX6D 1K3ZD 5HKPA 2AJAA 2DVWA 4DUIA 3J5QB 3W9GA 5KNHD 2DZNA 1MJ0A 3DEPA 4B93B 5FINA 1AP7A 5CBOA 3TWWA 4GMRA 5KNGA 4U8VD 1D9SA 4Z68A 5EYLA 4NIKA 4HBDA 5ENSD 3C5RA 1DCQA 2XEEA 2Y0BG 3F6QA 4K5CA 5AQBA 3AJIA 3EHQA 1OY3D 3V2XA 4O1PA 4O60A 1WG0A 5ENQD 2JABA 4A63B 2VGEA 4O1OA 4U95D 1A5EA 2L6BA 1UOHA 2F37A 2KBXA 3B95A 2ETBA 1WDYA 3NOCD 2V4HC 2PNNA 1MYOA 3ZNGA 1BLXB 3ZUVB 4LSZE 5BXOA 2A5EA 4HI9A 2P2CP 4U96D 2F8YA 2XENA 5JMND 4DX5D 5D66A 3EHRA 5EILA 3ZKJA 4HLLA 4HNAD 2HE0A 5AQ9A 4JB8P 3Q9UC 4U8YD 4HRLA 2ETAA 4HQDA 5EIDA 1K1AA 4QFVA 5AAOA 2B0OE 4K5AB 1YMPA 5ENRD 4BERA 2J8SD 3T8KA 4BESA 5CEDB 1AWCB 4RLYA 4CZ2D 4LNUD 3W9FA 5ITZF 1N0RA 4HI8A 4G8KA 2ZGDA 5AQAA 4N5QA 3V79K 1N0QA 4YDWA 4TUMA 1BI7B 1BI8B 1YYHA 3TWRA 3TWSA 4F1PA 4UUCA 1N11A 2DZOA 2MYOA 3EU9A 3HRAA 3TWVA 4BEPA 1S70B 3V31A 4ZFHA 3TWXA 3JXIA 1YCSB 2DWZA 3V2OA 4DX7D 5HS0A 5AARA 1IXVA 2QC9A 3NOGD 3V30A 4J7WA 2Y1LE 4HRMB 5HRYA 4ATZD 4GPMA 2RFMA 5CECB 3DEOA 4OAUC 5KWDA 2KXPC 2RFAA 4HRNA 1BD8A 3B7BA 2BKGA 5CBNA 3NBNB 5ENTD 2ZGGA 4C48B 5BXUA 3TWTA 3ZU7B 3AAAC 1NFIE 3HG0D 5CEAA 1OT8A 2XEHA 4DX1A 3D9HA 4DX2A 5ENPD 3LJNA 2XZTG 3SO8A 5ENOD 3UTMA 4DRXE 2BKKB 1IHBA 1TR4A 5JA4D 5FIOA 2ETCA 4QQIA 5EYPF 4ZHBA 1SW6A 5EN5D 3TWUA 3KEAA 1QYMA
chains in the Genus database with same CATH superfamily
3G2TA 4M7CA 4MKTA 4A1SA 3PDNA 2X6JA 2FO1E 1SVXA 4AY6A 3GW4A 4NACA 1IKND 4DJAA 4TXQA 4F1SA 4ILHB 3L54A 4MBGA 3EJNA 4N2QA 5J08A 2DYRE 3DSWA 5ANLA 3CVWA 5ENSD 4KXKB 1ELKA 2FULA 1OY3D 3T5VA 1OCRE 4HOQA 3QWVA 3ZYLA 1TNBA 2UY1A 4GTMA 4WUYA 2A5EA 3DSTA 4HLEA 4AM9A 4IULA 4J8DA 4JB8P 4PS3A 1O1TA 4HQDA 2EIKE 2B0OE 4BERA 4PUCA 4RLYA 4FULA 3RRMB 4B89A 2WB2A 5ITZF 4I1MA 4U0SA 3LY7A 1BI8B 4HVBA 3HRAA 5EX3A 1S63A 5HRYA 1INZA 3NBNB 5JJ7A 5CRVA 3ZU7B 1PAQA 1HF8A 4GZCA 1HG2A 1IHBA 1MQSA 3CVNA 4EHMA 2PQNA 1KT0A 2YNQA 3OXLA 1RW2A 1DC2A 4OAVB 1O1SA 3D9PA 3HXBA 4CYMD 2EINE 3PEVB 3TWQA 4Y6WA 4GPKA 4ATGA 1N54A 5FJYA 4KZCA 4B0ZA 5CBOA 3O4ZA 4EBAA 3BG0B 1KT1A 4Z68A 3UT8A 4B8CB 4BT9A 2IONA 3Q49B 4G25A 2IU1A 4CCAA 3VTXA 4HOTA 4U8HA 4O60A 5BPPA 3UUXA 2DYSE 5E75A 4HI9A 1NI1A 4ABNA 3PE4A 3ZKJA 4HRLA 1OXJA 2ETAA 5ARGA 1YMPA 3ASNE 5ENRD 1VDYA 2J8SD 4UQXA 3ML9A 3DSVA 2HR2A 4YDWA 1N4RA 1DCEA 4I17A 3S7JA 3LVRE 2IEJA 3U3WA 2P9SG 5B1BE 3OXFA 2RFMA 2R2LA 2RFAA 4C48B 5J90A 3Q5MA 4TV3A 5ENPD 4I6GA 2Q7FA 3CKCA 3CV0A 2R59A 1PY1A 3UXGA 3RO2A 3CQGB 4JD2G 1U3CA 1H6PA 4F6RD 4L23A 1JWGA 3SBSA 2M63A 1MX2A 3U9WA 4K5BA 3ASDA 2YHCA 1FVHA 2IOSA 3DEPA 3EHMA 2L0IA 3ESKA 3TXNA 1AP7A 1QBQA 3HHMA 4XI9A 2ONDA 2R03A 1UN8A 3AG4E 2Y3AA 3LEWA 2H6FA 3FU6A 3ULQA 1NP7A 3PZ2A 1WG0A 1IQRA 4GTTA 2XGMA 1S64A 2XRZA 2LO6A 2IFUA 1HG5A 3AG2E 2X38A 3KEZA 3PH0C 4GB9A 3SQVA 5EILA 4HNAD 1K1AA 4I6EA 4XE0A 1Z6TA 4YVOA 4JHKA 5AIJA 1LD7A 4L9PA 3ZYQA 4L7TA 4F1PA 3L9TA 2MYOA 3EU9A 3UMVA 4AEZC 3V31A 4J6IA 2NXPA 2WXLA 1ZBPA 5KWDA 1WAO1 5LP0A 2KC7A 5FTPA 2FBNA 3U66A 3EIQC 3UM0A 3FU0A 1KZOA 3Q75A 5FT9A 1SZ9A 4XEIG 4CGWA 3CSTA 4ME2A 3CHPA 3UM2A 2CFZA 4C0MA 2LXMA 3NB2A 2JLBA 4DI3A 3QB2A 4LRZA 1QNFA 4MRUA 3RO3A 2MRIA 4DUIA 4HOUA 2XS1A 2XPZA 3ZVVA 5LFAA 4V3IA 5CCMA 3CIAA 2XEEA 3ZN3A 2WQ6A 4A63B 2L6BA 1O1RA 5E76A 3TAXA 4UQYA 3LY9A 4UI9K 3SZ7A 4H7XA 4U96D 5JMND 2DIWA 3CVPA 1QQEA 1NZNA 4GTQA 3E33A 1P5QA 3CVXA 4GTSA 5AQAA 3ABLE 4GMLA 4UUCA 2DZOA 5DBKA 4WNFA 1IHGA 3MV3B 1S70B 2LAHA 3JXIA 3OAWA 4DX7D 4K03A 4A55A 4FADA 1FPPA 3RRNB 2LUHA 3ZXSA 3ZEFA 2C0MA 1ELRA 2J9QA 4ILGA 1OWNA 3HXFA 1Z3YA 1Y6IA 3HVEA 4Q69A 2X6FA 2HO1A 3O48A 4FHKA 3FY4A 3Q15A 1K1BA 1ELWA 2AXUA 4EBAG 3SNXA 1MX4A 3JXJA 4KZ0A 3FTVA 5EIBE 4FLBA 4AVXA 4BX8A 5HKPA 4HORA 3ENEA 2DZNA 2X6HA 4EQFA 3WG7E 2FO7A 5KJNA 3CHSA 2NSZA 2LXLA 3S2AA 3PZ3A 2Y0BG 4K5CA 2CHWA 4U95D 5LX8A 5A6CA 2KZTB 1SQMA 4UWGA 3ZUVB 2P2CP 5CMYA 5AJDA 3FTSA 3JCKC 4U04A 2J4BA 4HLLA 2V8SE 3KSLA 2GRLA 1S0PA 3RK6A 2WXQA 3MEKA 3D9LA 3RKVA 3TJPA 1N0QA 4KVOA 2R05A 1BI7B 2P58C 2XPYA 3D9KA 3NZUA 4GYYA 3LKUA 4UI9C 1E7VA 3BEEA 4WNEA 3TWXA 5AARA 3B7SA 4JL0A 5CBNA 5ENTD 2R02A 3CR3A 3AAAC 4U7EB 4FJZA 1OCOE 3KEAA 3IHVA 4GCOA 3JYSA 2X6IA 1FVFA 3SGHA 3VTYA 4DK5A 3IKOB 5T8IA 3JUEA 2XHEA 4UWHA 4JEHA 4YDEA 5BW8C 3SFZA 2DVWA 4JZYA 4JA7A 4C0EA 3ASOE 3I4RB 4CT0A 1OCCE 1D9SA 5EYLA 5LCWJ 5IY5E 1OWOA 2WM9A 2V4HC 4IRUA 1W3BA 1MYOA 3LXUX 4LSZE 2WVIA 4XKBA 4AY5A 3URZA 3SY2A 2XENA 4W9RA 5A23A 3SBTB 1UN9A 3PZ4A 4IYPA 3QNKA 1XGWA 1KLXA 3FHEA 3HVEB 4BESA 2I2OA 2ZGDA 4FC8A 4DLOA 3MJWA 4HS2A 1OWPA 3C3QA 3FTYA 1N11A 3E4BA 1MZCA 4B8AA 3V2OA 1OWMA 3DBSA 3MCXA 1V55E 1U2VG 4CDMA 3B7BA 3FP3A 1GW6A 2IQCA 5FQ6A 3HG0D 3E32A 3ZIMA 2IOLA 3L13A 1HFAA 5G05J 1H6KA 5JHAA 2PQRA 4QQIA 4ZHBA 5EN5D 3TWUA 2GROB 3I5PA 5LOZA 4HB5A 3L16A 2XZDG 5BUZA 3RJVA 2YHEA 2F8XK 3T9KA 4PDXA 5C2YA 3FU5A 2BUGA 2I6HA 2QYJA 2ZXWE 3Q79A 4GTRA 4DX6D 2VSXE 3N71A 4E6HA 1JPLA 2XEVA 2WXJA 4GZ5A 4L2LA 2A5UA 3AJIA 3FH5A 2LSVA 4F53A 4JPSA 2PNNA 3UT7A 4JHJA 5BXOA 3L22A 5G04J 1IYGA 2HE0A 2XGSA 4GA0A 5D0QD 4A1GA 1RZ4A 3T8KA 3LS8A 2VTBB 3FFLA 4FHJA 3FTXA 3B7TA 3ULEG 3UPVA 1YA0A 3D9MA 5HS0A 4BX9A 1TJFA 4JW1A 4MS6A 4EZKA 4CDRA 4ACLA 1FT2A 4AIFA 1JCRA 3CSFA 3EHNA 3LY8A 3FUKA 1L5JA 3ML8A 2GW1A 3LJNA 5D2MC 3L08A 2UWJG 2QFCA 1BPOA 2HYZA 1HO8A 3CK8A 3IXEA 4YDYA 1HE8A 3ZGQA 4TXRA 5HI7A 2J09A 4KT6B 3IBEA 2V5QC 1OUVA 4TRQA 1B89A 2V5FA 4NQ0A 4E85A 5FQ4A 3AS5A 3R7QA 3W9GA 2PL2A 2MOWA 4GTVA 1DNPA 1NL4A 4GCNA 1Q2ZA 1H2TC 3TGOA 3F6QA 4AP2A 5AENA 3PEUB 4YNDA 2AVPA 3G2VA 4UWFA 4EZJA 3G2SA 2VJ8A 3FEYA 3DRAA 3D9NA 1TN8A 2OCCE 4I2ZA 2VYIA 1XNFA 5FQ8A 3FULA 4DLQA 3Q7FA 1N0RA 2WXIA 3V79K 3DPYA 3U64A 4I6JA 1YYHA 3TWRA 1H0AA 1SZAA 3Q73A 1N95A 4ZFHA 2CG2A 5KJLA 3ABKE 4ATZD 2FEZA 4OAUC 4HRNA 3RIBA 2WXRA 1IQUA 2E0IA 3B7UX 2WXNA 2L0TB 5ENNA 3SO8A 2KZTA 5JA4D 3UIPC 4EPZA 3NF1A 1QYMA 2GRNB 3SFYA 1H19A 3AU4A 3CQCB 3D9OA 5HQ8A 3I4GA 3UINC 2ZISA 1QZ2A 2XCCA 3C3RA 1N52A 4U0UA 1HXIA 4KVMA 5AYWD 2NC9A 4GU5A 2E2EA 5CCLA 2P9KG 4WAFA 5KCMA 4KYOB 4O1PA 1EDUA 3BU8A 1X5BA 3UM3A 4BTAA 2Y69E 5BT1A 5EX0A 4NRHB 3RRUA 1Y8MA 4RQIA 4XIFA 4UQZA 1HS6A 3BUAA 3QOUA 4BEPA 3ZYKA 4XX5A 3NOGD 3V30A 4J7WA 4X8QA 2IF4A 3VLEA 2EIJE 1BD8A 4G2VA 4URKA 4BFRA 2FI7A 3S7DA 3ZFWA 3NZSA 4JEUA 5G2NA 5T4YA 3K9IA 4FJYA 2LSUA 3RAUA 4G8LA 1HU3A 5AN8A 3J5PA 2NYJA 4I43A 3KS2A 3FUFA 2IO2C 4AOFA 3EIJA 3UKUG 3SFXA 2AJAA 4ILIA 2LNIA 3FUHA 4G24A 4AV7A 5KNGA 4GYOA 3I3NA 3ISMC 1LTXA 3FUEA 4ANVA 2J4DA 3SF4A 2J07A 2JABA 4BSXA 2VGEA 4YVQC 2QYUA 3B95A 3C72A 2PM7A 3JUIA 4N5CA 2WQ7A 4Y6CA 4P29A 3TXMA 2WXFA 5BV0A 4WWNA 3L17A 4KMOA 3MKQA 4TXPA 4APFA 1EF1C 5G05C 4TUUA 3KAEA 4NURA 4N5QA 3ASFA 3TL5A 3CGHA 1FCHA 4LEUA 1FT1A 4GPMA 4RG9A 2BKGA 3FUMA 2ZGGA 2CHZA 4BY6A 4G11A 2XEHA 4U63A 1PC2A 3PZ1A 2A4ZA 2MHKA 3ZPJA 1Z5SC 3ASHA 2BTDA 4XI0A 3P2BA 3AS4A 2OVFA 1JWFA 1JCQA 3D9JA 4F7AA 4J8YA 5JHBA 2H6GA 4N3CA 2XS8A 4C9BB 5AQ7A 3JQ1A 3SI5A 4B94A 3G2WA 3Q78A 2VTBA 5G04C 4J8EA 2J08A 5DIZA 3FH8A 1ZB1A 2XQ0A 1E90A 3QC1A 1DCQA 3MKRA 3V2XA 4CDNA 1UOHA 3UQ3A 4AXHA 4I9EA 2IJGX 2WPVA 3DWLG 4I1AA 2WXOA 4UWLA 3CHMA 3EHRA 4WNGA 3DSUA 4FU3A 3BG1B 3CK9A 2AXVA 5B1AE 3CKBA 3RSEG 1AWCB 4RVBA 4O6FA 2LAIA 2C0LA 2AWIA 2C2LA 3HYMB 3TWSA 2GGFA 3ASGA 4WNDA 4XZ4A 1IXVA 2Y1LE 3Q4AB 4WWPA 3R9MA 2V4LA 1HZ4A 3OTNA 4I2WA 2V0PA 3NQPA 3TWTA 1HX8A 5CRUA 1X81A 1NFIE 2AXZA 3QWPA 3L6AA 1UG3A 4HFGA 3HIZA 2YINA 5D0OD 5FZRA 4JC8A 2CHXA 2CG3A 3ONKA 3MGBA 1G3NB 3FWVA 3Q9NC 2WXPA 5FZQA 1E8WA 1TNZA 4BSZB 3PE3A 4N39A 1MX6A 5KBAA 1BU9A 4LERA 5KNHD 1MJ0A 3E30A 3MKQB 4NIKA 2QY7A 3S7FA 3RU0A 2P9LG 2DCPA 1H6OA 3CVQA 4O1OA 1JUQA 3C98A 3ESLA 3LYAA 4MLPA 1SA4A 3ZNGA 4G26A 3AU5A 3JQ0A 1N4PA 2F8YA 4HOSA 4GTOA 1WY6A 4JA9A 4U8YD 5AAOA 4CGVA 1TEZA 4CZ2D 2RG8A 2AW6A 4A3VA 3QARA 4U07A 4GZ3A 3EUVA 1NA0A 4YDOA 3PNLB 3L82A 5AJLA 3QWWA 3TWVA 1SA5A 3GZ1A 3NAWA 4I1OB 4UI9J 4LCTA 4N3BA 5EKQD 4N3AA 3MYVA 2P9IG 3PREA 3GZSA 3CHOA 4K0RA 3FU3A 3D9HA 3DSXA 2WXKA 3OXGA 5ARFA 3APCA 2VSOE 3LVQE 4OYSA 2KCVA 1SW6A 1U3DA 3LPZA 4JXTA 3GZ2A 5KJKA 4EZLA 4LG6A 3APFA 3B13A 3UI2A 2GRPB 3MX3A 4GAAA 2R17C 2PM6A 4BETA 2L6JA 3J5QB 2P9UG 2WXGA 4PS7A 2J49A 4GMJA 5BV1A 3ZW3A 1E7UA 3Q7AA 4IN3B 5AQBA 3TG4A 2IY0C 4FP7A 3KSQA 1N4SA 3E37A 2KBXA 4ANWA 5FWQA 1KPSB 3CVUA 3PUKA 4DI4A 4RSYA 4I9CA 3EDTB 4DX5D 5D66A 3PVLA 1K8KG 3EU5A 2OV8A 3Q9UC 1D8DA 1OWLA 3B7RL 3HDXA 1JCSA 3G2UA 3UT4A 5A7DB 3ZRHA 1UJJA 3ULYA 1E8XA 3QKYA 2GRMA 1TN7A 3DXKG 4TUMA 3FH7A 1N4QA 4HXIA 2P9NG 1E8ZA 3ABME 3FUJA 4OVUA 4JHRA 3GYZA 1H2VC 2VGXA 1TNUA 3QK0A 1LD8A 2UY1B 3T8MA 1OT8A 3P1UA 3X2QE 4DX1A 3LJ3A 3UTMA 5ENOD 1TN6A 2VSNA 3CEQA 4CRWA 2RD0A 3FTUA 2WXMA 3ZYMA 5CHEE 2PZIA 2X3MA 4G1TA 1D8EA 3UIOC 3QDNA 3CK7A 2GRQB 2BF0X 3CHRA 2VQ2A 3WXXA 4B93B 1H2UA 1A17A 5FINA 2XCBA 4GMRA 1ZU2A 3T5XA 4ACKA 3FUNA 4U8VD 4FA6A 4CT4A 5EDSA 3FUDA 1WM5A 4N2SA 2OEWA 3SHFA 2ETBA 3FTZA 5JJ6A 3LDZA 3KD7A 3C3OA 1V54E 4APOA 3Q47B 3MA5A 5AQ9A 3MV2B 3IV0A 4LNUD 3IEGA 2KATA 2WMOA 1N9AA 4LUNU 5JJTA 1E8YA 2DWZA 2F0YA 4G23A 3BQOA 2QC9A 2OOEA 3PUJA 4HRMB 3AG1E 1LF8A 2L9BA 4OVVA 5CMWA 2WMNA 4CEMA 1TNYA 4A3TA 4ANUA 2RKKA 1OCZE 4U0ZA 3R7RA 2ETCA 3FUIA 2ZU6B 4PS8A 5BNWA 4FLHA 1EYHA 4L1BA 3ZHEA 5KJMA 2H6HA 4GA2A 3PS6A 3HXDA 5CERB 3MZLB 1K3ZD 4KBQA 5LCWC 3PRZA 4F3VA 1HH8A 2VGYA 3CVLA 1E96B 5ENQD 4BT8A 2F37A 1TNOA 1WDYA 2YQ8A 4EECA 3HXCA 5B3SE 4D10C 2IO3C 5M72A 3DXMG 2DBAA 4M3OA 3ZXPA 4GA1A 2VGXB 5ANRA 4DPRA 2OEVA 2P9PG 3CLJA 3FDHA 4J8SA 5CEDB 3HXEA 4BTBA 2Y4TA 3W9FA 1N94A 4G8KA 2EILE 4BWRA 5FQ7A 4ANXA 3CVYA 3VLFA 3QAQA 3D9IA 2GRRB 2KM4A 2OVBA 5C1DA 5CECB 2KXPC 2Y4UA 5BXUA 3PNTB 3ONLA 5CEAA 4DX2A 2XZTG 3UKRG 3PZDA 2FF4A 4LNBA 3D3MA 3U4TA 3CVVA 2BEDA 2BKKB 1TR4A 2H6IA 5EYPF 1TJCA 4J8FA 2X6KA 2EQXA 4L2YA 3QJZA 3LCAA 3UM1A 1NA3A 3SD5A 5FZSA 2XRYA 2QZAA 2CFUA 2WQHA 2ZIRA 2I1KA 4H7YA 2KCKA 2JEKA 1EPUA 4LNGA 2ILRA 4UWKA 1O5MA 3R9AB 3UX4A 1Z3XA 5G55A 3TWWA 3VLDA 4HBDA 3C5RA 5H7PA 4WWOA 3CHQA 1KZPA 2KCLA 3EHQA 1A5EA 2R5SA 3NOCD 3APDA 4XKCA 4JVSA 2I9CA 1BLXB 1TYQG 1DVPA 4GZ6A 4R7LA 2VSYA 4GTPA 3FTWA 1UW4B 5EIDA 4QFVA 4K5AB 3DPDA 4AJWA 4HI8A 4Q96A 3DSSA 5T3RA 4PH4B 3FEXA 3E34A 4J0UA 2B6CA 2EIME 2HM8A 1YCSB 3ZHEB 1MHQA 4RG6A 4GZDA 3TG5A 3IHYA 3DEOA 2WXHA 2XPIA 3AS8A 4GYWA 1UJKA 4DRXE 2I1JA 4Q94A 5FIOA 2XGOA 3S7BA 3AG3E
chains in the Genus database with same CATH topology
4HB5A 3UXGA 2XZDG 4J8YA 1K1BA 4LG6A 4F6RD 3IXEA 4YDYA 1G3NB 5AQ7A 4G8LA 3Q9NC 5AN8A 3UI2A 1DC2A 2F8XK 3T9KA 1MX2A 4OAVB 3J5PA 1MX4A 1SVXA 2NYJA 3JUEA 2FO1E 4BSZB 1IKND 2QYJA 1MX6A 2V5QC 4K5BA 3JXJA 4CYMD 5KBAA 1BU9A 3TWQA 5EIBE 5CERB 4BETA 4DX6D 1K3ZD 5HKPA 2AJAA 2DVWA 4DUIA 3J5QB 3W9GA 5KNHD 2DZNA 1MJ0A 3DEPA 4B93B 5FINA 1AP7A 5CBOA 3TWWA 4GMRA 5KNGA 4U8VD 1D9SA 4Z68A 5EYLA 4NIKA 4HBDA 5ENSD 3C5RA 1DCQA 2XEEA 2Y0BG 3F6QA 4K5CA 5AQBA 3AJIA 3EHQA 1OY3D 3V2XA 4O1PA 4O60A 1WG0A 5ENQD 2JABA 4A63B 2VGEA 4O1OA 4U95D 1A5EA 2L6BA 1UOHA 2F37A 2KBXA 3B95A 2ETBA 1WDYA 3NOCD 2V4HC 2PNNA 1MYOA 3ZNGA 1BLXB 3ZUVB 4LSZE 5BXOA 2A5EA 4HI9A 2P2CP 4U96D 2F8YA 2XENA 5JMND 4DX5D 5D66A 3EHRA 5EILA 3ZKJA 4HLLA 4HNAD 2HE0A 5AQ9A 4JB8P 3Q9UC 4U8YD 4HRLA 2ETAA 4HQDA 5EIDA 1K1AA 4QFVA 5AAOA 2B0OE 4K5AB 1YMPA 5ENRD 4BERA 2J8SD 3T8KA 4BESA 5CEDB 1AWCB 4RLYA 4CZ2D 4LNUD 3W9FA 5ITZF 1N0RA 4HI8A 4G8KA 2ZGDA 5AQAA 4N5QA 3V79K 1N0QA 4YDWA 4TUMA 1BI7B 1BI8B 1YYHA 3TWRA 3TWSA 4F1PA 4UUCA 1N11A 2DZOA 2MYOA 3EU9A 3HRAA 3TWVA 4BEPA 1S70B 3V31A 4ZFHA 3TWXA 3JXIA 1YCSB 2DWZA 3V2OA 4DX7D 5HS0A 5AARA 1IXVA 2QC9A 3NOGD 3V30A 4J7WA 2Y1LE 4HRMB 5HRYA 4ATZD 4GPMA 2RFMA 5CECB 3DEOA 4OAUC 5KWDA 2KXPC 2RFAA 4HRNA 1BD8A 3B7BA 2BKGA 5CBNA 3NBNB 5ENTD 2ZGGA 4C48B 5BXUA 3TWTA 3ZU7B 3AAAC 1NFIE 3HG0D 5CEAA 1OT8A 2XEHA 4DX1A 3D9HA 4DX2A 5ENPD 3LJNA 2XZTG 3SO8A 5ENOD 3UTMA 4DRXE 2BKKB 1IHBA 1TR4A 5JA4D 5FIOA 2ETCA 4QQIA 5EYPF 4ZHBA 1SW6A 5EN5D 3TWUA 3KEAA 1QYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB5 A;  3UXG A;  2XZD G;  4J8Y A;  1K1B A;  4LG6 A;  4F6R D;  3IXE A;  4YDY A;  1G3N B;  5AQ7 A;  4G8L A;  3Q9N C;  5AN8 A;  3UI2 A;  1DC2 A;  2F8X K;  3T9K A;  1MX2 A;  4OAV B;  3J5P A;  1MX4 A;  1SVX A;  2NYJ A;  3JUE A;  2FO1 E;  4BSZ B;  1IKN D;  2QYJ A;  1MX6 A;  2V5Q C;  4K5B A;  3JXJ A;  4CYM D;  5KBA A;  1BU9 A;  3TWQ A;  5EIB E;  5CER B;  4BET A;  4DX6 D;  1K3Z D;  5HKP A;  2AJA A;  2DVW A;  4DUI A;  3J5Q B;  3W9G A;  5KNH D;  2DZN A;  1MJ0 A;  3DEP A;  4B93 B;  5FIN A;  1AP7 A;  5CBO A;  3TWW A;  4GMR A;  5KNG A;  4U8V D;  1D9S A;  4Z68 A;  5EYL A;  4NIK A;  4HBD A;  5ENS D;  3C5R A;  1DCQ A;  2XEE A;  2Y0B G;  3F6Q A;  4K5C A;  5AQB A;  3AJI A;  3EHQ A;  1OY3 D;  3V2X A;  4O1P A;  4O60 A;  1WG0 A;  5ENQ D;  2JAB A;  4A63 B;  2VGE A;  4O1O A;  4U95 D;  1A5E A;  2L6B A;  1UOH A;  2F37 A;  2KBX A;  3B95 A;  2ETB A;  1WDY A;  3NOC D;  2V4H C;  2PNN A;  1MYO A;  3ZNG A;  1BLX B;  3ZUV B;  4LSZ E;  5BXO A;  2A5E A;  4HI9 A;  2P2C P;  4U96 D;  2F8Y A;  2XEN A;  5JMN D;  4DX5 D;  5D66 A;  3EHR A;  5EIL A;  3ZKJ A;  4HLL A;  4HNA D;  2HE0 A;  5AQ9 A;  4JB8 P;  3Q9U C;  4U8Y D;  4HRL A;  2ETA A;  4HQD A;  5EID A;  1K1A A;  4QFV A;  5AAO A;  2B0O E;  4K5A B;  1YMP A;  5ENR D;  4BER A;  2J8S D;  3T8K A;  4BES A;  5CED B;  1AWC B;  4RLY A;  4CZ2 D;  4LNU D;  3W9F A;  5ITZ F;  1N0R A;  4HI8 A;  4G8K A;  2ZGD A;  5AQA A;  4N5Q A;  3V79 K;  1N0Q A;  4YDW A;  4TUM A;  1BI7 B;  1BI8 B;  1YYH A;  3TWR A;  3TWS A;  4F1P A;  4UUC A;  1N11 A;  2DZO A;  2MYO A;  3EU9 A;  3HRA A;  3TWV A;  4BEP A;  1S70 B;  3V31 A;  4ZFH A;  3TWX A;  3JXI A;  1YCS B;  2DWZ A;  3V2O A;  4DX7 D;  5HS0 A;  5AAR A;  1IXV A;  2QC9 A;  3NOG D;  3V30 A;  4J7W A;  2Y1L E;  4HRM B;  5HRY A;  4ATZ D;  4GPM A;  2RFM A;  5CEC B;  3DEO A;  4OAU C;  5KWD A;  2KXP C;  2RFA A;  4HRN A;  1BD8 A;  3B7B A;  2BKG A;  5CBN A;  3NBN B;  5ENT D;  2ZGG A;  4C48 B;  5BXU A;  3TWT A;  3ZU7 B;  3AAA C;  1NFI E;  3HG0 D;  5CEA A;  1OT8 A;  2XEH A;  4DX1 A;  3D9H A;  4DX2 A;  5ENP D;  3LJN A;  2XZT G;  3SO8 A;  5ENO D;  3UTM A;  4DRX E;  2BKK B;  1IHB A;  1TR4 A;  5JA4 D;  5FIO A;  2ETC A;  4QQI A;  5EYP F;  4ZHB A;  1SW6 A;  5EN5 D;  3TWU A;  3KEA A;  1QYM A; 
#chains in the Genus database with same CATH topology
 3G2T A;  4M7C A;  4MKT A;  4A1S A;  3PDN A;  2X6J A;  2FO1 E;  1SVX A;  4AY6 A;  3GW4 A;  4NAC A;  1IKN D;  4DJA A;  4TXQ A;  4F1S A;  4ILH B;  3L54 A;  4MBG A;  3EJN A;  4N2Q A;  5J08 A;  2DYR E;  3DSW A;  5ANL A;  3CVW A;  5ENS D;  4KXK B;  1ELK A;  2FUL A;  1OY3 D;  3T5V A;  1OCR E;  4HOQ A;  3QWV A;  3ZYL A;  1TNB A;  2UY1 A;  4GTM A;  4WUY A;  2A5E A;  3DST A;  4HLE A;  4AM9 A;  4IUL A;  4J8D A;  4JB8 P;  4PS3 A;  1O1T A;  4HQD A;  2EIK E;  2B0O E;  4BER A;  4PUC A;  4RLY A;  4FUL A;  3RRM B;  4B89 A;  2WB2 A;  5ITZ F;  4I1M A;  4U0S A;  3LY7 A;  1BI8 B;  4HVB A;  3HRA A;  5EX3 A;  1S63 A;  5HRY A;  1INZ A;  3NBN B;  5JJ7 A;  5CRV A;  3ZU7 B;  1PAQ A;  1HF8 A;  4GZC A;  1HG2 A;  1IHB A;  1MQS A;  3CVN A;  4EHM A;  2PQN A;  1KT0 A;  2YNQ A;  3OXL A;  1RW2 A;  1DC2 A;  4OAV B;  1O1S A;  3D9P A;  3HXB A;  4CYM D;  2EIN E;  3PEV B;  3TWQ A;  4Y6W A;  4GPK A;  4ATG A;  1N54 A;  5FJY A;  4KZC A;  4B0Z A;  5CBO A;  3O4Z A;  4EBA A;  3BG0 B;  1KT1 A;  4Z68 A;  3UT8 A;  4B8C B;  4BT9 A;  2ION A;  3Q49 B;  4G25 A;  2IU1 A;  4CCA A;  3VTX A;  4HOT A;  4U8H A;  4O60 A;  5BPP A;  3UUX A;  2DYS E;  5E75 A;  4HI9 A;  1NI1 A;  4ABN A;  3PE4 A;  3ZKJ A;  4HRL A;  1OXJ A;  2ETA A;  5ARG A;  1YMP A;  3ASN E;  5ENR D;  1VDY A;  2J8S D;  4UQX A;  3ML9 A;  3DSV A;  2HR2 A;  4YDW A;  1N4R A;  1DCE A;  4I17 A;  3S7J A;  3LVR E;  2IEJ A;  3U3W A;  2P9S G;  5B1B E;  3OXF A;  2RFM A;  2R2L A;  2RFA A;  4C48 B;  5J90 A;  3Q5M A;  4TV3 A;  5ENP D;  4I6G A;  2Q7F A;  3CKC A;  3CV0 A;  2R59 A;  1PY1 A;  3UXG A;  3RO2 A;  3CQG B;  4JD2 G;  1U3C A;  1H6P A;  4F6R D;  4L23 A;  1JWG A;  3SBS A;  2M63 A;  1MX2 A;  3U9W A;  4K5B A;  3ASD A;  2YHC A;  1FVH A;  2IOS A;  3DEP A;  3EHM A;  2L0I A;  3ESK A;  3TXN A;  1AP7 A;  1QBQ A;  3HHM A;  4XI9 A;  2OND A;  2R03 A;  1UN8 A;  3AG4 E;  2Y3A A;  3LEW A;  2H6F A;  3FU6 A;  3ULQ A;  1NP7 A;  3PZ2 A;  1WG0 A;  1IQR A;  4GTT A;  2XGM A;  1S64 A;  2XRZ A;  2LO6 A;  2IFU A;  1HG5 A;  3AG2 E;  2X38 A;  3KEZ A;  3PH0 C;  4GB9 A;  3SQV A;  5EIL A;  4HNA D;  1K1A A;  4I6E A;  4XE0 A;  1Z6T A;  4YVO A;  4JHK A;  5AIJ A;  1LD7 A;  4L9P A;  3ZYQ A;  4L7T A;  4F1P A;  3L9T A;  2MYO A;  3EU9 A;  3UMV A;  4AEZ C;  3V31 A;  4J6I A;  2NXP A;  2WXL A;  1ZBP A;  5KWD A;  1WAO 1;  5LP0 A;  2KC7 A;  5FTP A;  2FBN A;  3U66 A;  3EIQ C;  3UM0 A;  3FU0 A;  1KZO A;  3Q75 A;  5FT9 A;  1SZ9 A;  4XEI G;  4CGW A;  3CST A;  4ME2 A;  3CHP A;  3UM2 A;  2CFZ A;  4C0M A;  2LXM A;  3NB2 A;  2JLB A;  4DI3 A;  3QB2 A;  4LRZ A;  1QNF A;  4MRU A;  3RO3 A;  2MRI A;  4DUI A;  4HOU A;  2XS1 A;  2XPZ A;  3ZVV A;  5LFA A;  4V3I A;  5CCM A;  3CIA A;  2XEE A;  3ZN3 A;  2WQ6 A;  4A63 B;  2L6B A;  1O1R A;  5E76 A;  3TAX A;  4UQY A;  3LY9 A;  4UI9 K;  3SZ7 A;  4H7X A;  4U96 D;  5JMN D;  2DIW A;  3CVP A;  1QQE A;  1NZN A;  4GTQ A;  3E33 A;  1P5Q A;  3CVX A;  4GTS A;  5AQA A;  3ABL E;  4GML A;  4UUC A;  2DZO A;  5DBK A;  4WNF A;  1IHG A;  3MV3 B;  1S70 B;  2LAH A;  3JXI A;  3OAW A;  4DX7 D;  4K03 A;  4A55 A;  4FAD A;  1FPP A;  3RRN B;  2LUH A;  3ZXS A;  3ZEF A;  2C0M A;  1ELR A;  2J9Q A;  4ILG A;  1OWN A;  3HXF A;  1Z3Y A;  1Y6I A;  3HVE A;  4Q69 A;  2X6F A;  2HO1 A;  3O48 A;  4FHK A;  3FY4 A;  3Q15 A;  1K1B A;  1ELW A;  2AXU A;  4EBA G;  3SNX A;  1MX4 A;  3JXJ A;  4KZ0 A;  3FTV A;  5EIB E;  4FLB A;  4AVX A;  4BX8 A;  5HKP A;  4HOR A;  3ENE A;  2DZN A;  2X6H A;  4EQF A;  3WG7 E;  2FO7 A;  5KJN A;  3CHS A;  2NSZ A;  2LXL A;  3S2A A;  3PZ3 A;  2Y0B G;  4K5C A;  2CHW A;  4U95 D;  5LX8 A;  5A6C A;  2KZT B;  1SQM A;  4UWG A;  3ZUV B;  2P2C P;  5CMY A;  5AJD A;  3FTS A;  3JCK C;  4U04 A;  2J4B A;  4HLL A;  2V8S E;  3KSL A;  2GRL A;  1S0P A;  3RK6 A;  2WXQ A;  3MEK A;  3D9L A;  3RKV A;  3TJP A;  1N0Q A;  4KVO A;  2R05 A;  1BI7 B;  2P58 C;  2XPY A;  3D9K A;  3NZU A;  4GYY A;  3LKU A;  4UI9 C;  1E7V A;  3BEE A;  4WNE A;  3TWX A;  5AAR A;  3B7S A;  4JL0 A;  5CBN A;  5ENT D;  2R02 A;  3CR3 A;  3AAA C;  4U7E B;  4FJZ A;  1OCO E;  3KEA A;  3IHV A;  4GCO A;  3JYS A;  2X6I A;  1FVF A;  3SGH A;  3VTY A;  4DK5 A;  3IKO B;  5T8I A;  3JUE A;  2XHE A;  4UWH A;  4JEH A;  4YDE A;  5BW8 C;  3SFZ A;  2DVW A;  4JZY A;  4JA7 A;  4C0E A;  3ASO E;  3I4R B;  4CT0 A;  1OCC E;  1D9S A;  5EYL A;  5LCW J;  5IY5 E;  1OWO A;  2WM9 A;  2V4H C;  4IRU A;  1W3B A;  1MYO A;  3LXU X;  4LSZ E;  2WVI A;  4XKB A;  4AY5 A;  3URZ A;  3SY2 A;  2XEN A;  4W9R A;  5A23 A;  3SBT B;  1UN9 A;  3PZ4 A;  4IYP A;  3QNK A;  1XGW A;  1KLX A;  3FHE A;  3HVE B;  4BES A;  2I2O A;  2ZGD A;  4FC8 A;  4DLO A;  3MJW A;  4HS2 A;  1OWP A;  3C3Q A;  3FTY A;  1N11 A;  3E4B A;  1MZC A;  4B8A A;  3V2O A;  1OWM A;  3DBS A;  3MCX A;  1V55 E;  1U2V G;  4CDM A;  3B7B A;  3FP3 A;  1GW6 A;  2IQC A;  5FQ6 A;  3HG0 D;  3E32 A;  3ZIM A;  2IOL A;  3L13 A;  1HFA A;  5G05 J;  1H6K A;  5JHA A;  2PQR A;  4QQI A;  4ZHB A;  5EN5 D;  3TWU A;  2GRO B;  3I5P A;  5LOZ A;  4HB5 A;  3L16 A;  2XZD G;  5BUZ A;  3RJV A;  2YHE A;  2F8X K;  3T9K A;  4PDX A;  5C2Y A;  3FU5 A;  2BUG A;  2I6H A;  2QYJ A;  2ZXW E;  3Q79 A;  4GTR A;  4DX6 D;  2VSX E;  3N71 A;  4E6H A;  1JPL A;  2XEV A;  2WXJ A;  4GZ5 A;  4L2L A;  2A5U A;  3AJI A;  3FH5 A;  2LSV A;  4F53 A;  4JPS A;  2PNN A;  3UT7 A;  4JHJ A;  5BXO A;  3L22 A;  5G04 J;  1IYG A;  2HE0 A;  2XGS A;  4GA0 A;  5D0Q D;  4A1G A;  1RZ4 A;  3T8K A;  3LS8 A;  2VTB B;  3FFL A;  4FHJ A;  3FTX A;  3B7T A;  3ULE G;  3UPV A;  1YA0 A;  3D9M A;  5HS0 A;  4BX9 A;  1TJF A;  4JW1 A;  4MS6 A;  4EZK A;  4CDR A;  4ACL A;  1FT2 A;  4AIF A;  1JCR A;  3CSF A;  3EHN A;  3LY8 A;  3FUK A;  1L5J A;  3ML8 A;  2GW1 A;  3LJN A;  5D2M C;  3L08 A;  2UWJ G;  2QFC A;  1BPO A;  2HYZ A;  1HO8 A;  3CK8 A;  3IXE A;  4YDY A;  1HE8 A;  3ZGQ A;  4TXR A;  5HI7 A;  2J09 A;  4KT6 B;  3IBE A;  2V5Q C;  1OUV A;  4TRQ A;  1B89 A;  2V5F A;  4NQ0 A;  4E85 A;  5FQ4 A;  3AS5 A;  3R7Q A;  3W9G A;  2PL2 A;  2MOW A;  4GTV A;  1DNP A;  1NL4 A;  4GCN A;  1Q2Z A;  1H2T C;  3TGO A;  3F6Q A;  4AP2 A;  5AEN A;  3PEU B;  4YND A;  2AVP A;  3G2V A;  4UWF A;  4EZJ A;  3G2S A;  2VJ8 A;  3FEY A;  3DRA A;  3D9N A;  1TN8 A;  2OCC E;  4I2Z A;  2VYI A;  1XNF A;  5FQ8 A;  3FUL A;  4DLQ A;  3Q7F A;  1N0R A;  2WXI A;  3V79 K;  3DPY A;  3U64 A;  4I6J A;  1YYH A;  3TWR A;  1H0A A;  1SZA A;  3Q73 A;  1N95 A;  4ZFH A;  2CG2 A;  5KJL A;  3ABK E;  4ATZ D;  2FEZ A;  4OAU C;  4HRN A;  3RIB A;  2WXR A;  1IQU A;  2E0I A;  3B7U X;  2WXN A;  2L0T B;  5ENN A;  3SO8 A;  2KZT A;  5JA4 D;  3UIP C;  4EPZ A;  3NF1 A;  1QYM A;  2GRN B;  3SFY A;  1H19 A;  3AU4 A;  3CQC B;  3D9O A;  5HQ8 A;  3I4G A;  3UIN C;  2ZIS A;  1QZ2 A;  2XCC A;  3C3R A;  1N52 A;  4U0U A;  1HXI A;  4KVM A;  5AYW D;  2NC9 A;  4GU5 A;  2E2E A;  5CCL A;  2P9K G;  4WAF A;  5KCM A;  4KYO B;  4O1P A;  1EDU A;  3BU8 A;  1X5B A;  3UM3 A;  4BTA A;  2Y69 E;  5BT1 A;  5EX0 A;  4NRH B;  3RRU A;  1Y8M A;  4RQI A;  4XIF A;  4UQZ A;  1HS6 A;  3BUA A;  3QOU A;  4BEP A;  3ZYK A;  4XX5 A;  3NOG D;  3V30 A;  4J7W A;  4X8Q A;  2IF4 A;  3VLE A;  2EIJ E;  1BD8 A;  4G2V A;  4URK A;  4BFR A;  2FI7 A;  3S7D A;  3ZFW A;  3NZS A;  4JEU A;  5G2N A;  5T4Y A;  3K9I A;  4FJY A;  2LSU A;  3RAU A;  4G8L A;  1HU3 A;  5AN8 A;  3J5P A;  2NYJ A;  4I43 A;  3KS2 A;  3FUF A;  2IO2 C;  4AOF A;  3EIJ A;  3UKU G;  3SFX A;  2AJA A;  4ILI A;  2LNI A;  3FUH A;  4G24 A;  4AV7 A;  5KNG A;  4GYO A;  3I3N A;  3ISM C;  1LTX A;  3FUE A;  4ANV A;  2J4D A;  3SF4 A;  2J07 A;  2JAB A;  4BSX A;  2VGE A;  4YVQ C;  2QYU A;  3B95 A;  3C72 A;  2PM7 A;  3JUI A;  4N5C A;  2WQ7 A;  4Y6C A;  4P29 A;  3TXM A;  2WXF A;  5BV0 A;  4WWN A;  3L17 A;  4KMO A;  3MKQ A;  4TXP A;  4APF A;  1EF1 C;  5G05 C;  4TUU A;  3KAE A;  4NUR A;  4N5Q A;  3ASF A;  3TL5 A;  3CGH A;  1FCH A;  4LEU A;  1FT1 A;  4GPM A;  4RG9 A;  2BKG A;  3FUM A;  2ZGG A;  2CHZ A;  4BY6 A;  4G11 A;  2XEH A;  4U63 A;  1PC2 A;  3PZ1 A;  2A4Z A;  2MHK A;  3ZPJ A;  1Z5S C;  3ASH A;  2BTD A;  4XI0 A;  3P2B A;  3AS4 A;  2OVF A;  1JWF A;  1JCQ A;  3D9J A;  4F7A A;  4J8Y A;  5JHB A;  2H6G A;  4N3C A;  2XS8 A;  4C9B B;  5AQ7 A;  3JQ1 A;  3SI5 A;  4B94 A;  3G2W A;  3Q78 A;  2VTB A;  5G04 C;  4J8E A;  2J08 A;  5DIZ A;  3FH8 A;  1ZB1 A;  2XQ0 A;  1E90 A;  3QC1 A;  1DCQ A;  3MKR A;  3V2X A;  4CDN A;  1UOH A;  3UQ3 A;  4AXH A;  4I9E A;  2IJG X;  2WPV A;  3DWL G;  4I1A A;  2WXO A;  4UWL A;  3CHM A;  3EHR A;  4WNG A;  3DSU A;  4FU3 A;  3BG1 B;  3CK9 A;  2AXV A;  5B1A E;  3CKB A;  3RSE G;  1AWC B;  4RVB A;  4O6F A;  2LAI A;  2C0L A;  2AWI A;  2C2L A;  3HYM B;  3TWS A;  2GGF A;  3ASG A;  4WND A;  4XZ4 A;  1IXV A;  2Y1L E;  3Q4A B;  4WWP A;  3R9M A;  2V4L A;  1HZ4 A;  3OTN A;  4I2W A;  2V0P A;  3NQP A;  3TWT A;  1HX8 A;  5CRU A;  1X81 A;  1NFI E;  2AXZ A;  3QWP A;  3L6A A;  1UG3 A;  4HFG A;  3HIZ A;  2YIN A;  5D0O D;  5FZR A;  4JC8 A;  2CHX A;  2CG3 A;  3ONK A;  3MGB A;  1G3N B;  3FWV A;  3Q9N C;  2WXP A;  5FZQ A;  1E8W A;  1TNZ A;  4BSZ B;  3PE3 A;  4N39 A;  1MX6 A;  5KBA A;  1BU9 A;  4LER A;  5KNH D;  1MJ0 A;  3E30 A;  3MKQ B;  4NIK A;  2QY7 A;  3S7F A;  3RU0 A;  2P9L G;  2DCP A;  1H6O A;  3CVQ A;  4O1O A;  1JUQ A;  3C98 A;  3ESL A;  3LYA A;  4MLP A;  1SA4 A;  3ZNG A;  4G26 A;  3AU5 A;  3JQ0 A;  1N4P A;  2F8Y A;  4HOS A;  4GTO A;  1WY6 A;  4JA9 A;  4U8Y D;  5AAO A;  4CGV A;  1TEZ A;  4CZ2 D;  2RG8 A;  2AW6 A;  4A3V A;  3QAR A;  4U07 A;  4GZ3 A;  3EUV A;  1NA0 A;  4YDO A;  3PNL B;  3L82 A;  5AJL A;  3QWW A;  3TWV A;  1SA5 A;  3GZ1 A;  3NAW A;  4I1O B;  4UI9 J;  4LCT A;  4N3B A;  5EKQ D;  4N3A A;  3MYV A;  2P9I G;  3PRE A;  3GZS A;  3CHO A;  4K0R A;  3FU3 A;  3D9H A;  3DSX A;  2WXK A;  3OXG A;  5ARF A;  3APC A;  2VSO E;  3LVQ E;  4OYS A;  2KCV A;  1SW6 A;  1U3D A;  3LPZ A;  4JXT A;  3GZ2 A;  5KJK A;  4EZL A;  4LG6 A;  3APF A;  3B13 A;  3UI2 A;  2GRP B;  3MX3 A;  4GAA A;  2R17 C;  2PM6 A;  4BET A;  2L6J A;  3J5Q B;  2P9U G;  2WXG A;  4PS7 A;  2J49 A;  4GMJ A;  5BV1 A;  3ZW3 A;  1E7U A;  3Q7A A;  4IN3 B;  5AQB A;  3TG4 A;  2IY0 C;  4FP7 A;  3KSQ A;  1N4S A;  3E37 A;  2KBX A;  4ANW A;  5FWQ A;  1KPS B;  3CVU A;  3PUK A;  4DI4 A;  4RSY A;  4I9C A;  3EDT B;  4DX5 D;  5D66 A;  3PVL A;  1K8K G;  3EU5 A;  2OV8 A;  3Q9U C;  1D8D A;  1OWL A;  3B7R L;  3HDX A;  1JCS A;  3G2U A;  3UT4 A;  5A7D B;  3ZRH A;  1UJJ A;  3ULY A;  1E8X A;  3QKY A;  2GRM A;  1TN7 A;  3DXK G;  4TUM A;  3FH7 A;  1N4Q A;  4HXI A;  2P9N G;  1E8Z A;  3ABM E;  3FUJ A;  4OVU A;  4JHR A;  3GYZ A;  1H2V C;  2VGX A;  1TNU A;  3QK0 A;  1LD8 A;  2UY1 B;  3T8M A;  1OT8 A;  3P1U A;  3X2Q E;  4DX1 A;  3LJ3 A;  3UTM A;  5ENO D;  1TN6 A;  2VSN A;  3CEQ A;  4CRW A;  2RD0 A;  3FTU A;  2WXM A;  3ZYM A;  5CHE E;  2PZI A;  2X3M A;  4G1T A;  1D8E A;  3UIO C;  3QDN A;  3CK7 A;  2GRQ B;  2BF0 X;  3CHR A;  2VQ2 A;  3WXX A;  4B93 B;  1H2U A;  1A17 A;  5FIN A;  2XCB A;  4GMR A;  1ZU2 A;  3T5X A;  4ACK A;  3FUN A;  4U8V D;  4FA6 A;  4CT4 A;  5EDS A;  3FUD A;  1WM5 A;  4N2S A;  2OEW A;  3SHF A;  2ETB A;  3FTZ A;  5JJ6 A;  3LDZ A;  3KD7 A;  3C3O A;  1V54 E;  4APO A;  3Q47 B;  3MA5 A;  5AQ9 A;  3MV2 B;  3IV0 A;  4LNU D;  3IEG A;  2KAT A;  2WMO A;  1N9A A;  4LUN U;  5JJT A;  1E8Y A;  2DWZ A;  2F0Y A;  4G23 A;  3BQO A;  2QC9 A;  2OOE A;  3PUJ A;  4HRM B;  3AG1 E;  1LF8 A;  2L9B A;  4OVV A;  5CMW A;  2WMN A;  4CEM A;  1TNY A;  4A3T A;  4ANU A;  2RKK A;  1OCZ E;  4U0Z A;  3R7R A;  2ETC A;  3FUI A;  2ZU6 B;  4PS8 A;  5BNW A;  4FLH A;  1EYH A;  4L1B A;  3ZHE A;  5KJM A;  2H6H A;  4GA2 A;  3PS6 A;  3HXD A;  5CER B;  3MZL B;  1K3Z D;  4KBQ A;  5LCW C;  3PRZ A;  4F3V A;  1HH8 A;  2VGY A;  3CVL A;  1E96 B;  5ENQ D;  4BT8 A;  2F37 A;  1TNO A;  1WDY A;  2YQ8 A;  4EEC A;  3HXC A;  5B3S E;  4D10 C;  2IO3 C;  5M72 A;  3DXM G;  2DBA A;  4M3O A;  3ZXP A;  4GA1 A;  2VGX B;  5ANR A;  4DPR A;  2OEV A;  2P9P G;  3CLJ A;  3FDH A;  4J8S A;  5CED B;  3HXE A;  4BTB A;  2Y4T A;  3W9F A;  1N94 A;  4G8K A;  2EIL E;  4BWR A;  5FQ7 A;  4ANX A;  3CVY A;  3VLF A;  3QAQ A;  3D9I A;  2GRR B;  2KM4 A;  2OVB A;  5C1D A;  5CEC B;  2KXP C;  2Y4U A;  5BXU A;  3PNT B;  3ONL A;  5CEA A;  4DX2 A;  2XZT G;  3UKR G;  3PZD A;  2FF4 A;  4LNB A;  3D3M A;  3U4T A;  3CVV A;  2BED A;  2BKK B;  1TR4 A;  2H6I A;  5EYP F;  1TJC A;  4J8F A;  2X6K A;  2EQX A;  4L2Y A;  3QJZ A;  3LCA A;  3UM1 A;  1NA3 A;  3SD5 A;  5FZS A;  2XRY A;  2QZA A;  2CFU A;  2WQH A;  2ZIR A;  2I1K A;  4H7Y A;  2KCK A;  2JEK A;  1EPU A;  4LNG A;  2ILR A;  4UWK A;  1O5M A;  3R9A B;  3UX4 A;  1Z3X A;  5G55 A;  3TWW A;  3VLD A;  4HBD A;  3C5R A;  5H7P A;  4WWO A;  3CHQ A;  1KZP A;  2KCL A;  3EHQ A;  1A5E A;  2R5S A;  3NOC D;  3APD A;  4XKC A;  4JVS A;  2I9C A;  1BLX B;  1TYQ G;  1DVP A;  4GZ6 A;  4R7L A;  2VSY A;  4GTP A;  3FTW A;  1UW4 B;  5EID A;  4QFV A;  4K5A B;  3DPD A;  4AJW A;  4HI8 A;  4Q96 A;  3DSS A;  5T3R A;  4PH4 B;  3FEX A;  3E34 A;  4J0U A;  2B6C A;  2EIM E;  2HM8 A;  1YCS B;  3ZHE B;  1MHQ A;  4RG6 A;  4GZD A;  3TG5 A;  3IHY A;  3DEO A;  2WXH A;  2XPI A;  3AS8 A;  4GYW A;  1UJK A;  4DRX E;  2I1J A;  4Q94 A;  5FIO A;  2XGO A;  3S7B A;  3AG3 E; 
#chains in the Genus database with same CATH homology
 4HB5 A;  3UXG A;  2XZD G;  4J8Y A;  1K1B A;  4LG6 A;  4F6R D;  3IXE A;  4YDY A;  1G3N B;  5AQ7 A;  4G8L A;  3Q9N C;  5AN8 A;  3UI2 A;  1DC2 A;  2F8X K;  3T9K A;  1MX2 A;  4OAV B;  3J5P A;  1MX4 A;  1SVX A;  2NYJ A;  3JUE A;  2FO1 E;  4BSZ B;  1IKN D;  2QYJ A;  1MX6 A;  2V5Q C;  4K5B A;  3JXJ A;  4CYM D;  5KBA A;  1BU9 A;  3TWQ A;  5EIB E;  5CER B;  4BET A;  4DX6 D;  1K3Z D;  5HKP A;  2AJA A;  2DVW A;  4DUI A;  3J5Q B;  3W9G A;  5KNH D;  2DZN A;  1MJ0 A;  3DEP A;  4B93 B;  5FIN A;  1AP7 A;  5CBO A;  3TWW A;  4GMR A;  5KNG A;  4U8V D;  1D9S A;  4Z68 A;  5EYL A;  4NIK A;  4HBD A;  5ENS D;  3C5R A;  1DCQ A;  2XEE A;  2Y0B G;  3F6Q A;  4K5C A;  5AQB A;  3AJI A;  3EHQ A;  1OY3 D;  3V2X A;  4O1P A;  4O60 A;  1WG0 A;  5ENQ D;  2JAB A;  4A63 B;  2VGE A;  4O1O A;  4U95 D;  1A5E A;  2L6B A;  1UOH A;  2F37 A;  2KBX A;  3B95 A;  2ETB A;  1WDY A;  3NOC D;  2V4H C;  2PNN A;  1MYO A;  3ZNG A;  1BLX B;  3ZUV B;  4LSZ E;  5BXO A;  2A5E A;  4HI9 A;  2P2C P;  4U96 D;  2F8Y A;  2XEN A;  5JMN D;  4DX5 D;  5D66 A;  3EHR A;  5EIL A;  3ZKJ A;  4HLL A;  4HNA D;  2HE0 A;  5AQ9 A;  4JB8 P;  3Q9U C;  4U8Y D;  4HRL A;  2ETA A;  4HQD A;  5EID A;  1K1A A;  4QFV A;  5AAO A;  2B0O E;  4K5A B;  1YMP A;  5ENR D;  4BER A;  2J8S D;  3T8K A;  4BES A;  5CED B;  1AWC B;  4RLY A;  4CZ2 D;  4LNU D;  3W9F A;  5ITZ F;  1N0R A;  4HI8 A;  4G8K A;  2ZGD A;  5AQA A;  4N5Q A;  3V79 K;  1N0Q A;  4YDW A;  4TUM A;  1BI7 B;  1BI8 B;  1YYH A;  3TWR A;  3TWS A;  4F1P A;  4UUC A;  1N11 A;  2DZO A;  2MYO A;  3EU9 A;  3HRA A;  3TWV A;  4BEP A;  1S70 B;  3V31 A;  4ZFH A;  3TWX A;  3JXI A;  1YCS B;  2DWZ A;  3V2O A;  4DX7 D;  5HS0 A;  5AAR A;  1IXV A;  2QC9 A;  3NOG D;  3V30 A;  4J7W A;  2Y1L E;  4HRM B;  5HRY A;  4ATZ D;  4GPM A;  2RFM A;  5CEC B;  3DEO A;  4OAU C;  5KWD A;  2KXP C;  2RFA A;  4HRN A;  1BD8 A;  3B7B A;  2BKG A;  5CBN A;  3NBN B;  5ENT D;  2ZGG A;  4C48 B;  5BXU A;  3TWT A;  3ZU7 B;  3AAA C;  1NFI E;  3HG0 D;  5CEA A;  1OT8 A;  2XEH A;  4DX1 A;  3D9H A;  4DX2 A;  5ENP D;  3LJN A;  2XZT G;  3SO8 A;  5ENO D;  3UTM A;  4DRX E;  2BKK B;  1IHB A;  1TR4 A;  5JA4 D;  5FIO A;  2ETC A;  4QQI A;  5EYP F;  4ZHB A;  1SW6 A;  5EN5 D;  3TWU A;  3KEA A;  1QYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...