3Q9UC

In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
157
Chain Sequence
FGQDLGKKLLEAAAAGQDDEVRILMANGADVNATDDNGLTPLHLAAANGQLEIVEVLLKNGADVNASDSAGITPLHLAAYDGHLEIVEVLLKHGADVNAYDRAGWTPLHLAALSGQLEIVEVLLKHGADVNAQDALGLTAFDISINQGQEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A de novo protein binding pair by computational design and directed evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding, de novo protein
molecule keywords CoA binding protein
total genus 45
structure length 157
sequence length 157
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3q9uC00
1UOHA 5CBOA 1BD8A 1OT8A 3DEPA 1IHBA 3TWTA 2ZGDA 3UTMA 5KBAA 4F1PA 3ZNGA 5FINA 5ENOD 2F37A 1MJ0A 1SVXA 4BERA 3JUEA 5ENTD 1D9SA 3IXEA 5FIOA 3B7BA 4UUCA 4YDYA 5D66A 4DX1A 2HE0A 1QYMA 2XEEA 2P2CP 1IXVA 2KBXA 4O1OA 2NYJA 4U8VD 4LSZE 3SO8A 2ETBA 1S70B 4GPMA 5ITZF 3AAAC 3C5RA 3DEOA 4HLLA 4J8YA 3UI2A 3V2XA 2QYJA 5EYPF 5AARA 5EIDA 2B0OE 5CECB 3NBNB 2DVWA 3LJNA 4LNUD 4BEPA 1SW6A 2JABA 2DZOA 3T9KA 1WG0A 4HB5A 4DX2A 4J7WA 3ZU7B 5EIBE 5EILA 3J5QB 4U96D 1N0RA 2RFMA 5BXOA 4TUMA 2A5EA 1MX4A 4A63B 2ETCA 4YDWA 5EN5D 3EHQA 4GMRA 2BKGA 2QC9A 1G3NB 3ZKJA 1YYHA 3NOGD 1WDYA 2RFAA 3JXJA 5CEAA 5BXUA 2BKKB 1BU9A 4HQDA 4O60A 2XEHA 3TWWA 1MYOA 4K5CA 3TWUA 2F8XK 5AAOA 1BLXB 4B93B 4HBDA 1AWCB 2ETAA 4HRNA 4BETA 3J5PA 1OY3D 3Q9UC 3V31A 4DUIA 5HKPA 3EU9A 5ENSD 1YCSB 5JMND 3TWQA 3T8KA 5AQBA 1DC2A 5EYLA 5AN8A 2V5QC 4K5BA 2Y1LE 4O1PA 4HRMB 4K5AB 3TWXA 2ZGGA 2PNNA 3EHRA 4G8KA 5KNGA 5ENRD 4CZ2D 4RLYA 4ZHBA 3TWVA 4Z68A 2L6BA 3V30A 4DX6D 3HG0D 4HRLA 1K1BA 2J8SD 2DZNA 5AQ7A 4NIKA 2V4HC 3ZUVB 4LG6A 4OAVB 1A5EA 1K1AA 1YMPA 2AJAA 5AQ9A 3NOCD 2XENA 3F6QA 5KWDA 4QFVA 3D9HA 2MYOA 5HS0A 1BI7B 4C48B 4QQIA 3V79K 1MX6A 1BI8B 4HI9A 4G8LA 1DCQA 5KNHD 3B95A 3JXIA 2Y0BG 3W9GA 5HRYA 5ENQD 1AP7A 4CYMD 4HNAD 5JA4D 4U95D 1N0QA 2XZDG 1MX2A 3KEAA 5ENPD 3TWRA 4BESA 5CEDB 3W9FA 4OAUC 4N5QA 5AQAA 3HRAA 1TR4A 3TWSA 2F8YA 4JB8P 4ATZD 4DX7D 4DRXE 4BSZB 4F6RD 3V2OA 2DWZA 2VGEA 4DX5D 4HI8A 3AJIA 3Q9NC 1NFIE 2KXPC 1K3ZD 2XZTG 3UXGA 4ZFHA 5CERB 4U8YD 5CBNA 2FO1E 1IKND 1N11A
chains in the Genus database with same CATH superfamily
3C3QA 2UY1B 4I43A 4GZ3A 3UUXA 1H6PA 4IRUA 1HG2A 4C0EA 3FUIA 3E32A 4GYYA 3APDA 5B1BE 1BPOA 4D10C 3RO2A 3DEOA 4HLLA 1HO8A 2L0TB 2XRYA 2WQHA 3T8MA 5JJTA 3CSTA 4UI9J 5EX0A 4UWGA 5EILA 2GRLA 5EKQD 4J8FA 4XZ4A 3LKUA 5LCWC 4GTMA 4F1SA 1TJCA 3KS2A 3ZXSA 2C2LA 3L13A 3ULQA 3PZ3A 2H6HA 3N71A 3GZSA 3SI5A 4UQXA 3ASHA 4XIFA 3UMVA 5ANRA 2YNQA 2GRMA 5AQ9A 4H7YA 4XE0A 5HS0A 5FQ8A 4C0MA 1FT1A 4BSXA 3RRUA 2XRZA 3D9IA 4HNAD 4CYMD 3D9KA 1ZBPA 2AW6A 1LD7A 5LCWJ 4UQZA 4F6RD 3HXEA 4OVUA 5AYWD 3V2OA 4Y6WA 1S64A 2J49A 3TGOA 4PS3A 5H7PA 4G24A 2ONDA 5FZSA 5BNWA 4TXRA 2J9QA 3UTMA 2P9KG 4ACLA 4NRHB 5FINA 5ENTD 4KYOB 4KVOA 2KBXA 2LUHA 2UWJG 4LSZE 2GRRB 3CVYA 1S70B 2KCVA 3QC1A 4H7XA 1ELRA 1ELWA 3G2TA 1O1SA 3ASDA 3TL5A 4Y6CA 2WXLA 3L6AA 2LSVA 4PH4B 3Q79A 2WXPA 1FPPA 5HI7A 1WDYA 3PUJA 4U0SA 2XEHA 3QAQA 2GROB 4I6JA 1HS6A 1Z3YA 5JHBA 3PNTB 2KCKA 5AQBA 1Q2ZA 5AN8A 3PUKA 3AS5A 2DYSE 1UW4B 3HDXA 2L6BA 4DX6D 2WXMA 4GYOA 3D9LA 5LX8A 4GA1A 4OAVB 3NOCD 1H2UA 3Q4AB 2MYOA 3ZEFA 5BV0A 4DJAA 4U63A 3MZLB 4YDOA 1MX2A 3KEAA 4G26A 1EF1C 4AOFA 4DX5D 3CQGB 4ILIA 3FH5A 4JC8A 4A55A 4KMOA 1TNYA 3SFYA 3PEVB 3TWTA 3E30A 2X6JA 4FULA 2KZTB 3QK0A 3ISMC 5FIOA 5FZRA 2LSUA 1S63A 1KLXA 2P2CP 3SO8A 4G23A 3AAAC 5EYPF 3UM3A 5CECB 1HXIA 3ESLA 3JQ0A 3MCXA 2WXRA 3FEXA 3R7QA 4J7WA 5DBKA 3MKQB 3CVWA 3NF1A 1N0RA 2WXHA 4U8HA 1RW2A 2GW1A 1QNFA 3UX4A 4JL0A 2J08A 4BFRA 4AEZC 1OY3D 4ILGA 4DUIA 1WM5A 2V5FA 4CCAA 3EHRA 4CGWA 3CVUA 2XPZA 5BUZA 3EDTB 3IKOB 1FVHA 4EECA 3KSQA 1NA0A 2J09A 3O48A 3CVVA 3ENEA 3MV2B 3F6QA 3C3RA 2XEVA 1OWLA 3QWVA 3V79K 2J4BA 4G8LA 5KNHD 3TAXA 3S7JA 4KT6B 3JXIA 3QNKA 3RRMB 3HVEA 3VLDA 1Y8MA 5ENPD 5KJNA 2A5UA 4N5CA 5KJLA 2YHEA 2V0PA 3R9MA 3CHPA 2IEJA 4K03A 3UKUG 3ASGA 3DWLG 4GYWA 3FH7A 2ZGDA 4G11A 5A7DB 5KBAA 3HXDA 4I2WA 2KCLA 4PS7A 2QY7A 3APCA 4Q94A 2XEEA 1IXVA 2C0LA 3SHFA 3FFLA 4BWRA 2QYJA 1OCZE 3DXKG 2WQ6A 2R5SA 3CHQA 3LJNA 3QARA 4GZ6A 3FU0A 1KZPA 2HR2A 4DX2A 3L16A 4URKA 2OVBA 4FC8A 4J8EA 1H0AA 4EPZA 3ZW3A 4HQDA 5DIZA 1D8EA 4XKBA 3B13A 1LD8A 4WUYA 4I6GA 3JYSA 4K5AB 2GRPB 5KNGA 3ZN3A 4LEUA 1N9AA 4AY5A 3CHSA 4HOUA 2L0IA 3TJPA 1UJKA 3G2SA 3ASNE 4LG6A 3SF4A 5ENNA 3QJZA 3DPDA 1RZ4A 4GTQA 2IOLA 4U95D 4EHMA 4E6HA 3W9FA 4OAUC 4N5QA 3U66A 2I1KA 1N4SA 3FEYA 4L23A 5CCMA 4I17A 2KXPC 3SFZA 4I6EA 4CGVA 4IYPA 2KATA 3AS8A 1OCCE 5BW8C 2FI7A 3FHEA 3JUEA 3ZYLA 1OUVA 5D66A 1TJFA 3IHYA 2H6GA 5A23A 2V4LA 3HIZA 4LNUD 4DLOA 3R9AB 1V55E 5KJMA 3MV3B 2F0YA 3EHQA 4BTBA 4GMRA 2BKGA 3D9MA 2UY1A 5T3RA 1SQMA 4K5CA 2PM7A 4JD2G 2OVFA 2I6HA 2YHCA 4J8DA 2PZIA 2XGSA 2QZAA 1XNFA 2X38A 4HRMB 2I1JA 3IV0A 2X3MA 1PAQA 1SZAA 5IY5E 5C2YA 2I2OA 3BQOA 2DZNA 2CHZA 2XPYA 3FP3A 5KWDA 4AJWA 1OWMA 3AU4A 5G55A 3UIOC 1B89A 2XS8A 3S7DA 3B95A 4A3VA 3ML9A 1N0QA 2AXUA 3MA5A 4U7EB 3VLEA 4ATZD 3LDZA 2A4ZA 4WNGA 1LTXA 1P5QA 4TXPA 4U8YD 1IKND 2FF4A 1N11A 1Z3XA 4JHKA 5KJKA 4RSYA 2XCCA 5D0OD 4U07A 2F37A 1JPLA 1MZCA 1D9SA 3OAWA 4O1OA 4XX5A 5T4YA 4HFGA 2NYJA 2HM8A 2EILE 4J8YA 2CHWA 5AARA 3R7RA 4A1GA 4NACA 1N52A 3AS4A 4WWNA 4GTTA 2VSOE 3JCKC 1IYGA 1S0PA 2IF4A 4HB5A 1E96B 5J08A 3CVPA 1XGWA 4TUMA 1MX4A 3P1UA 3JXJA 2HYZA 1Z5SC 4HBDA 3RJVA 3FTSA 1NL4A 2VYIA 1E7VA 2IY0C 4RG9A 4N2SA 3B7RL 3SBTB 3RKVA 3TWVA 4J6IA 3U9WA 1A5EA 5T8IA 2BUGA 4B8CB 3FU3A 5D2MC 3FH8A 1MHQA 1BI8B 3FU5A 4F7AA 2P9IG 3TWRA 2P58C 3ZYMA 4OVVA 3EIJA 1NA3A 3QKYA 4UI9C 4UWLA 2R02A 3DSTA 2R59A 4BX9A 1HH8A 3C98A 4GTRA 2CG2A 1WAO1 2VGYA 3DSUA 3FTUA 1K8KG 4F1PA 5ENOD 3IEGA 3CK8A 1SZ9A 3AG4E 4YDYA 3RAUA 1QYMA 3GZ2A 2E2EA 1SA5A 4DPRA 3C5RA 3QWPA 4U0UA 4A3TA 4EBAA 4OYSA 5EIDA 1TN7A 3PRZA 3NBNB 3RSEG 4J8SA 2R2LA 3RK6A 2VSXE 5EN5D 2RFAA 3DPYA 1MYOA 3UPVA 3TG5A 2VQ2A 1N94A 1ZB1A 2BF0X 3HHMA 5ENRD 1NZNA 3KSLA 3Q73A 4I9CA 2ZXWE 2PQRA 1U3CA 1PY1A 3HG0D 4NIKA 1N54A 1YMPA 1HX8A 5JHAA 2NC9A 4O6FA 1U3DA 3RU0A 1DCQA 5FZQA 4TUUA 4I1AA 4BT8A 5EX3A 3BG0B 3MEKA 2FULA 2X6FA 2IQCA 1VDYA 4YDEA 3Q9NC 1K3ZD 2XZTG 3PZ4A 3L22A 4WNEA 5CCLA 4EBAG 5FTPA 5CBOA 2PL2A 1H2VC 5CMYA 4JA9A 2J4DA 4JPSA 3ZXPA 3I4RB 4UUCA 2X6KA 2XCBA 4GTSA 2RD0A 5AJLA 2WMNA 3UT4A 2ETBA 3U64A 4AM9A 4UWKA 3D3MA 4J0UA 5FT9A 1TN8A 3OXGA 2C0MA 1ZU2A 3AG3E 1H19A 1BU9A 3CEQA 4BETA 2IJGX 3ASOE 1HZ4A 1E8WA 4LCTA 1YCSB 1OXJA 3ML8A 5JMND 5G04J 2XPIA 3UIPC 4IN3B 4N3BA 4XI9A 2WMOA 3SY2A 3LCAA 2FEZA 3FY4A 2VGXB 4JEUA 2P9LG 2EQXA 5CRUA 2Y0BG 4HXIA 4XKCA 3HRAA 1TR4A 1X5BA 1H6KA 4DX7D 1JCRA 4A1SA 3EHMA 1FVFA 4L1BA 3CHMA 3CHRA 3UT8A 3Q78A 5FWQA 2FO1E 4AY6A 4B94A 2OV8A 2XQ0A 4APOA 5CMWA 3AU5A 2WVIA 2H6FA 4JW1A 3WXXA 3ZNGA 2EIME 3B7BA 3PVLA 4UWFA 2MRIA 2JEKA 4FLBA 1JUQA 3UM1A 3Q75A 5B3SE 3FTZA 4L9PA 2P9UG 3Q7AA 4NURA 2H6IA 3EJNA 2AXZA 3PE4A 2WXJA 3RIBA 2WXKA 3ULEG 3ZU7B 5EIBE 2LXMA 5J90A 2QYUA 4FHKA 3URZA 4CDNA 3E34A 3FULA 3K9IA 1E8YA 3D9OA 1UJJA 4M3OA 4B89A 2ZIRA 3CVXA 3ZFWA 2MOWA 3EU9A 2L9BA 5EYLA 2GRNB 2VSYA 4G8KA 2WB2A 4JEHA 1O1RA 4KVMA 4AP2A 3I5PA 2YINA 1K1AA 2AJAA 2J07A 2AXVA 2DCPA 4FA6A 1OCOE 2EIKE 3SQVA 3D9HA 4ABNA 3LY9A 4GMJA 3CKCA 4APFA 3MGBA 3GYZA 4HOSA 3ZPJA 3W9GA 5CHEE 2OCCE 2YQ8A 3ESKA 2AWIA 5CERB 2R17C 4HS2A 1E8ZA 3PNLB 3CQCB 2VTBB 3FDHA 3QWWA 5LP0A 4NQ0A 3Q7FA 1GW6A 5CRVA 2R05A 4KZ0A 3PREA 3DBSA 3AG1E 3P2BA 2ILRA 4LERA 4U8VD 3G2VA 4F53A 4GPMA 4FJZA 1L5JA 4GCNA 1MQSA 3U4TA 4YNDA 4BEPA 3PZDA 4I9EA 2XS1A 1EYHA 3CIAA 4KXKB 1EPUA 4O60A 3TWUA 3CVQA 1AWCB 5ENSD 2WXGA 3HXBA 2DYRE 4FJYA 5AQ7A 2WPVA 2IO2C 4LNGA 3HXCA 2Y69E 3MYVA 4QFVA 2HO1A 5AENA 4QQIA 3LPZA 3TG4A 1UN8A 3L54A 4ANXA 4ILHB 3EHNA 1KT1A 3LVRE 3TXMA 4N39A 4WNDA 3UXGA 3CVNA 4CT4A 5CBNA 3I4GA 4WAFA 4AVXA 4RVBA 1Z6TA 3ZIMA 4DI4A 3MX3A 3D9PA 1H6OA 3HYMB 4JHJA 2BTDA 3UI2A 3L9TA 4L2LA 1N4QA 3BEEA 2EINE 3EU5A 4BX8A 3CKBA 2WQ7A 2EIJE 2ETCA 3UINC 1TNOA 2FBNA 3NZSA 5BXUA 5EDSA 2R03A 5AAOA 4FHJA 1JWGA 3FTYA 2OEVA 3SZ7A 3TWXA 1LF8A 3FU6A 3LXUX 4V3IA 4Z68A 3V30A 5BT1A 4HRLA 4ME2A 5E76A 3ZUVB 4LUNU 4RG6A 3VLFA 4E85A 3LY8A 1Y6IA 4YVOA 5JJ6A 4ACKA 5HRYA 3D9JA 1TEZA 2E0IA 2WXOA 2LO6A 3NZUA 3TWSA 4AV7A 2I9CA 3Q47B 2ZISA 3LY7A 1D8DA 3OTNA 3JUIA 4TV3A 3CK9A 1BD8A 4FU3A 2LAIA 5BPPA 2LXLA 1DCEA 1IQUA 3IXEA 2IOSA 4B8AA 3CK7A 2IO3C 4F3VA 3T5VA 5FJYA 4M7CA 4GTPA 4CRWA 1OWNA 5D0QD 3FTXA 1EDUA 4I2ZA 3SFXA 4LRZA 5C1DA 3FUNA 2L6JA 3ZKJA 3S7FA 3ASFA 4U0ZA 2BKKB 4FP7A 2DBAA 2GGFA 4L7TA 5ARFA 2WXIA 3CGHA 4B93B 1FT2A 3V31A 3Q9UC 5HKPA 3KEZA 3TWQA 4K5BA 2RG8A 3T5XA 2PNNA 3CHOA 1HE8A 3DRAA 3ULYA 5G04C 2LNIA 4GCOA 5E75A 2CG3A 3APFA 1WY6A 4BT9A 2WXNA 1UN9A 5KCMA 4HI9A 3CSFA 3UKRG 2KM4A 5BV1A 4GU5A 5JA4D 3E4BA 2F8YA 4HOTA 2VTBA 4UI9K 2CFZA 4ZFHA 1O5MA 3CR3A 4DLQA 3X2QE 4GPKA 3PEUB 3E33A 1V54E 1YA0A 1MJ0A 3ONLA 2HE0A 5M72A 4U04A 4PUCA 2ZU6B 3V2XA 1TNBA 2B0OE 4MS6A 3RO3A 2DVWA 3QB2A 1SW6A 2JABA 2OOEA 3T9KA 4Q96A 4U96D 2RFMA 5LOZA 4YDWA 4WWOA 3ZHEA 2IFUA 5FQ4A 2M63A 1BLXB 4K0RA 4GTVA 2ETAA 3B7TA 4G25A 4CDRA 4GTOA 3FTVA 3U3WA 2NSZA 4JZYA 3QOUA 4LNBA 1FCHA 4HVBA 1IHGA 4CZ2D 3DSXA 4RLYA 1HG5A 1PC2A 3VTYA 2Q7FA 4UQYA 1E8XA 4MRUA 4ANWA 4PDXA 1U2VG 3PDNA 4AXHA 4G2VA 3L08A 1IQRA 5ENQD 4MLPA 4JHRA 2JLBA 4TRQA 3C72A 4JB8P 3UT7A 4MBGA 2DWZA 4KZCA 3S7BA 1OCRE 3KAEA 4ANUA 2VSNA 1TNUA 4FLHA 1HU3A 3RRNB 1UOHA 4ANVA 5AIJA 5A6CA 4UWHA 3LEWA 1TNZA 3FTWA 3LJ3A 3CV0A 3FUFA 4HOQA 3ZGQA 3UQ3A 2VGXA 1UG3A 3NAWA 1JCQA 3ABME 4HLEA 5HQ8A 4I1MA 3EIQC 4BY6A 2DZOA 4WWPA 3SNXA 1N4PA 1TYQG 2AVPA 3DXMG 3CLJA 2FO7A 3GW4A 4GA2A 3B7SA 3MJWA 3PZ1A 2QC9A 1G3NB 1YYHA 4JXTA 5CEAA 2IU1A 4EZJA 2B6CA 1NP7A 3PS6A 4HRNA 1KZOA 2MHKA 1E7UA 4MKTA 3FUKA 4W9RA 4YVQC 3CVLA 3C3OA 4EZLA 3ZYKA 2WXFA 3IHVA 4GZCA 4XEIG 2XENA 4C48B 2NXPA 3ABKE 2XZDG 5CEDB 1W3BA 1KPSB 3DSVA 3KD7A 3FUJA 4N3AA 4P29A 4B0ZA 4XI0A 2X6HA 3FUMA 2P9SG 1OT8A 3DEPA 3LVQE 3LYAA 3AG2E 3FUEA 5G05J 3DSWA 3G2WA 3OXFA 4N2QA 4DX1A 1JWFA 1O1TA 2XGMA 1HFAA 4FADA 3ZRHA 3E37A 3VTXA 2X6IA 2Y4UA 3O4ZA 2KC7A 3UM2A 2LAHA 1SA4A 5G05C 4DI3A 2Y4TA 3J5QB 2VJ8A 2WM9A 2XGOA 5JJ7A 3QDNA 3TWWA 3GZ1A 2IONA 3MKRA 3WG7E 2F8XK 1TN6A 3IBEA 3J5PA 1DC2A 4Q69A 3T8KA 4CDMA 2Y1LE 2ZGGA 1NI1A 4C9BB 3D9NA 4ZHBA 1N95A 2GRQB 1ELKA 2V8SE 1K1BA 4X8QA 2V4HC 4L2YA 3FUDA 5FQ6A 4GB9A 2KZTA 4CT0A 4EQFA 2OEWA 3S2AA 1BI7B 2DIWA 1MX6A 2P9PG 1AP7A 3DSSA 3ZYQA 4CEMA 4BESA 1QBQA 4GA0A 1INZA 4DRXE 5LFAA 3Q5MA 4JA7A 3BUAA 1JCSA 3AJIA 1NFIE 4TXQA 3FWVA 4R7LA 5ANLA 3L17A 1H2TC 4PS8A 3HXFA 1IHBA 4GAAA 3ZVVA 1OWOA 3JQ1A 1SVXA 4WNFA 4BERA 2XHEA 2Y3AA 3TXNA 3L82A 1A17A 5ITZF 3ONKA 4DK5A 2WXQA 5B1AE 1N4RA 2PM6A 3OXLA 3ABLE 1WG0A 5G2NA 3PE3A 5BXOA 2A5EA 4A63B 4HORA 3NQPA 3NOGD 1DVPA 3PH0C 3Q15A 5AJDA 3HVEB 4IULA 2P9NG 2BEDA 2CFUA 2V5QC 2QFCA 4O1PA 4AIFA 3FUHA 4BTAA 3EUVA 1OWPA 5ARGA 2RKKA 4ATGA 3UM0A 1HF8A 2J8SD 1QZ2A 1X81A 4I1OB 1KT0A 4KBQA 4G1TA 2PQNA 5FQ7A 1DNPA 4GZ5A 3Q49B 4GZDA 3SBSA 3SD5A 4RQIA 3BU8A 3B7UX 3SGHA 3NB2A 5AQAA 4N3CA 3I3NA 2CHXA 3PZ2A 4BSZB 2VGEA 4GMLA 4HI8A 3LS8A 3MKQA 1E90A 3BG1B 4JVSA 4EZKA 1QQEA 3G2UA 3ZHEB
chains in the Genus database with same CATH topology
1UOHA 5CBOA 1BD8A 1OT8A 3DEPA 1IHBA 3TWTA 2ZGDA 3UTMA 5KBAA 4F1PA 3ZNGA 5FINA 5ENOD 2F37A 1MJ0A 1SVXA 4BERA 3JUEA 5ENTD 1D9SA 3IXEA 5FIOA 3B7BA 4UUCA 4YDYA 5D66A 4DX1A 2HE0A 1QYMA 2XEEA 2P2CP 1IXVA 2KBXA 4O1OA 2NYJA 4U8VD 4LSZE 3SO8A 2ETBA 1S70B 4GPMA 5ITZF 3AAAC 3C5RA 3DEOA 4HLLA 4J8YA 3UI2A 3V2XA 2QYJA 5EYPF 5AARA 5EIDA 2B0OE 5CECB 3NBNB 2DVWA 3LJNA 4LNUD 4BEPA 1SW6A 2JABA 2DZOA 3T9KA 1WG0A 4HB5A 4DX2A 4J7WA 3ZU7B 5EIBE 5EILA 3J5QB 4U96D 1N0RA 2RFMA 5BXOA 4TUMA 2A5EA 1MX4A 4A63B 2ETCA 4YDWA 5EN5D 3EHQA 4GMRA 2BKGA 2QC9A 1G3NB 3ZKJA 1YYHA 3NOGD 1WDYA 2RFAA 3JXJA 5CEAA 5BXUA 2BKKB 1BU9A 4HQDA 4O60A 2XEHA 3TWWA 1MYOA 4K5CA 3TWUA 2F8XK 5AAOA 1BLXB 4B93B 4HBDA 1AWCB 2ETAA 4HRNA 4BETA 3J5PA 1OY3D 3Q9UC 3V31A 4DUIA 5HKPA 3EU9A 5ENSD 1YCSB 5JMND 3TWQA 3T8KA 5AQBA 1DC2A 5EYLA 5AN8A 2V5QC 4K5BA 2Y1LE 4O1PA 4HRMB 4K5AB 3TWXA 2ZGGA 2PNNA 3EHRA 4G8KA 5KNGA 5ENRD 4CZ2D 4RLYA 4ZHBA 3TWVA 4Z68A 2L6BA 3V30A 4DX6D 3HG0D 4HRLA 1K1BA 2J8SD 2DZNA 5AQ7A 4NIKA 2V4HC 3ZUVB 4LG6A 4OAVB 1A5EA 1K1AA 1YMPA 2AJAA 5AQ9A 3NOCD 2XENA 3F6QA 5KWDA 4QFVA 3D9HA 2MYOA 5HS0A 1BI7B 4C48B 4QQIA 3V79K 1MX6A 1BI8B 4HI9A 4G8LA 1DCQA 5KNHD 3B95A 3JXIA 2Y0BG 3W9GA 5HRYA 5ENQD 1AP7A 4CYMD 4HNAD 5JA4D 4U95D 1N0QA 2XZDG 1MX2A 3KEAA 5ENPD 3TWRA 4BESA 5CEDB 3W9FA 4OAUC 4N5QA 5AQAA 3HRAA 1TR4A 3TWSA 2F8YA 4JB8P 4ATZD 4DX7D 4DRXE 4BSZB 4F6RD 3V2OA 2DWZA 2VGEA 4DX5D 4HI8A 3AJIA 3Q9NC 1NFIE 2KXPC 1K3ZD 2XZTG 3UXGA 4ZFHA 5CERB 4U8YD 5CBNA 2FO1E 1IKND 1N11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UOH A;  5CBO A;  1BD8 A;  1OT8 A;  3DEP A;  1IHB A;  3TWT A;  2ZGD A;  3UTM A;  5KBA A;  4F1P A;  3ZNG A;  5FIN A;  5ENO D;  2F37 A;  1MJ0 A;  1SVX A;  4BER A;  3JUE A;  5ENT D;  1D9S A;  3IXE A;  5FIO A;  3B7B A;  4UUC A;  4YDY A;  5D66 A;  4DX1 A;  2HE0 A;  1QYM A;  2XEE A;  2P2C P;  1IXV A;  2KBX A;  4O1O A;  2NYJ A;  4U8V D;  4LSZ E;  3SO8 A;  2ETB A;  1S70 B;  4GPM A;  5ITZ F;  3AAA C;  3C5R A;  3DEO A;  4HLL A;  4J8Y A;  3UI2 A;  3V2X A;  2QYJ A;  5EYP F;  5AAR A;  5EID A;  2B0O E;  5CEC B;  3NBN B;  2DVW A;  3LJN A;  4LNU D;  4BEP A;  1SW6 A;  2JAB A;  2DZO A;  3T9K A;  1WG0 A;  4HB5 A;  4DX2 A;  4J7W A;  3ZU7 B;  5EIB E;  5EIL A;  3J5Q B;  4U96 D;  1N0R A;  2RFM A;  5BXO A;  4TUM A;  2A5E A;  1MX4 A;  4A63 B;  2ETC A;  4YDW A;  5EN5 D;  3EHQ A;  4GMR A;  2BKG A;  2QC9 A;  1G3N B;  3ZKJ A;  1YYH A;  3NOG D;  1WDY A;  2RFA A;  3JXJ A;  5CEA A;  5BXU A;  2BKK B;  1BU9 A;  4HQD A;  4O60 A;  2XEH A;  3TWW A;  1MYO A;  4K5C A;  3TWU A;  2F8X K;  5AAO A;  1BLX B;  4B93 B;  4HBD A;  1AWC B;  2ETA A;  4HRN A;  4BET A;  3J5P A;  1OY3 D;  3Q9U C;  3V31 A;  4DUI A;  5HKP A;  3EU9 A;  5ENS D;  1YCS B;  5JMN D;  3TWQ A;  3T8K A;  5AQB A;  1DC2 A;  5EYL A;  5AN8 A;  2V5Q C;  4K5B A;  2Y1L E;  4O1P A;  4HRM B;  4K5A B;  3TWX A;  2ZGG A;  2PNN A;  3EHR A;  4G8K A;  5KNG A;  5ENR D;  4CZ2 D;  4RLY A;  4ZHB A;  3TWV A;  4Z68 A;  2L6B A;  3V30 A;  4DX6 D;  3HG0 D;  4HRL A;  1K1B A;  2J8S D;  2DZN A;  5AQ7 A;  4NIK A;  2V4H C;  3ZUV B;  4LG6 A;  4OAV B;  1A5E A;  1K1A A;  1YMP A;  2AJA A;  5AQ9 A;  3NOC D;  2XEN A;  3F6Q A;  5KWD A;  4QFV A;  3D9H A;  2MYO A;  5HS0 A;  1BI7 B;  4C48 B;  4QQI A;  3V79 K;  1MX6 A;  1BI8 B;  4HI9 A;  4G8L A;  1DCQ A;  5KNH D;  3B95 A;  3JXI A;  2Y0B G;  3W9G A;  5HRY A;  5ENQ D;  1AP7 A;  4CYM D;  4HNA D;  5JA4 D;  4U95 D;  1N0Q A;  2XZD G;  1MX2 A;  3KEA A;  5ENP D;  3TWR A;  4BES A;  5CED B;  3W9F A;  4OAU C;  4N5Q A;  5AQA A;  3HRA A;  1TR4 A;  3TWS A;  2F8Y A;  4JB8 P;  4ATZ D;  4DX7 D;  4DRX E;  4BSZ B;  4F6R D;  3V2O A;  2DWZ A;  2VGE A;  4DX5 D;  4HI8 A;  3AJI A;  3Q9N C;  1NFI E;  2KXP C;  1K3Z D;  2XZT G;  3UXG A;  4ZFH A;  5CER B;  4U8Y D;  5CBN A;  2FO1 E;  1IKN D;  1N11 A; 
#chains in the Genus database with same CATH topology
 3C3Q A;  2UY1 B;  4I43 A;  4GZ3 A;  3UUX A;  1H6P A;  4IRU A;  1HG2 A;  4C0E A;  3FUI A;  3E32 A;  4GYY A;  3APD A;  5B1B E;  1BPO A;  4D10 C;  3RO2 A;  3DEO A;  4HLL A;  1HO8 A;  2L0T B;  2XRY A;  2WQH A;  3T8M A;  5JJT A;  3CST A;  4UI9 J;  5EX0 A;  4UWG A;  5EIL A;  2GRL A;  5EKQ D;  4J8F A;  4XZ4 A;  3LKU A;  5LCW C;  4GTM A;  4F1S A;  1TJC A;  3KS2 A;  3ZXS A;  2C2L A;  3L13 A;  3ULQ A;  3PZ3 A;  2H6H A;  3N71 A;  3GZS A;  3SI5 A;  4UQX A;  3ASH A;  4XIF A;  3UMV A;  5ANR A;  2YNQ A;  2GRM A;  5AQ9 A;  4H7Y A;  4XE0 A;  5HS0 A;  5FQ8 A;  4C0M A;  1FT1 A;  4BSX A;  3RRU A;  2XRZ A;  3D9I A;  4HNA D;  4CYM D;  3D9K A;  1ZBP A;  2AW6 A;  1LD7 A;  5LCW J;  4UQZ A;  4F6R D;  3HXE A;  4OVU A;  5AYW D;  3V2O A;  4Y6W A;  1S64 A;  2J49 A;  3TGO A;  4PS3 A;  5H7P A;  4G24 A;  2OND A;  5FZS A;  5BNW A;  4TXR A;  2J9Q A;  3UTM A;  2P9K G;  4ACL A;  4NRH B;  5FIN A;  5ENT D;  4KYO B;  4KVO A;  2KBX A;  2LUH A;  2UWJ G;  4LSZ E;  2GRR B;  3CVY A;  1S70 B;  2KCV A;  3QC1 A;  4H7X A;  1ELR A;  1ELW A;  3G2T A;  1O1S A;  3ASD A;  3TL5 A;  4Y6C A;  2WXL A;  3L6A A;  2LSV A;  4PH4 B;  3Q79 A;  2WXP A;  1FPP A;  5HI7 A;  1WDY A;  3PUJ A;  4U0S A;  2XEH A;  3QAQ A;  2GRO B;  4I6J A;  1HS6 A;  1Z3Y A;  5JHB A;  3PNT B;  2KCK A;  5AQB A;  1Q2Z A;  5AN8 A;  3PUK A;  3AS5 A;  2DYS E;  1UW4 B;  3HDX A;  2L6B A;  4DX6 D;  2WXM A;  4GYO A;  3D9L A;  5LX8 A;  4GA1 A;  4OAV B;  3NOC D;  1H2U A;  3Q4A B;  2MYO A;  3ZEF A;  5BV0 A;  4DJA A;  4U63 A;  3MZL B;  4YDO A;  1MX2 A;  3KEA A;  4G26 A;  1EF1 C;  4AOF A;  4DX5 D;  3CQG B;  4ILI A;  3FH5 A;  4JC8 A;  4A55 A;  4KMO A;  1TNY A;  3SFY A;  3PEV B;  3TWT A;  3E30 A;  2X6J A;  4FUL A;  2KZT B;  3QK0 A;  3ISM C;  5FIO A;  5FZR A;  2LSU A;  1S63 A;  1KLX A;  2P2C P;  3SO8 A;  4G23 A;  3AAA C;  5EYP F;  3UM3 A;  5CEC B;  1HXI A;  3ESL A;  3JQ0 A;  3MCX A;  2WXR A;  3FEX A;  3R7Q A;  4J7W A;  5DBK A;  3MKQ B;  3CVW A;  3NF1 A;  1N0R A;  2WXH A;  4U8H A;  1RW2 A;  2GW1 A;  1QNF A;  3UX4 A;  4JL0 A;  2J08 A;  4BFR A;  4AEZ C;  1OY3 D;  4ILG A;  4DUI A;  1WM5 A;  2V5F A;  4CCA A;  3EHR A;  4CGW A;  3CVU A;  2XPZ A;  5BUZ A;  3EDT B;  3IKO B;  1FVH A;  4EEC A;  3KSQ A;  1NA0 A;  2J09 A;  3O48 A;  3CVV A;  3ENE A;  3MV2 B;  3F6Q A;  3C3R A;  2XEV A;  1OWL A;  3QWV A;  3V79 K;  2J4B A;  4G8L A;  5KNH D;  3TAX A;  3S7J A;  4KT6 B;  3JXI A;  3QNK A;  3RRM B;  3HVE A;  3VLD A;  1Y8M A;  5ENP D;  5KJN A;  2A5U A;  4N5C A;  5KJL A;  2YHE A;  2V0P A;  3R9M A;  3CHP A;  2IEJ A;  4K03 A;  3UKU G;  3ASG A;  3DWL G;  4GYW A;  3FH7 A;  2ZGD A;  4G11 A;  5A7D B;  5KBA A;  3HXD A;  4I2W A;  2KCL A;  4PS7 A;  2QY7 A;  3APC A;  4Q94 A;  2XEE A;  1IXV A;  2C0L A;  3SHF A;  3FFL A;  4BWR A;  2QYJ A;  1OCZ E;  3DXK G;  2WQ6 A;  2R5S A;  3CHQ A;  3LJN A;  3QAR A;  4GZ6 A;  3FU0 A;  1KZP A;  2HR2 A;  4DX2 A;  3L16 A;  4URK A;  2OVB A;  4FC8 A;  4J8E A;  1H0A A;  4EPZ A;  3ZW3 A;  4HQD A;  5DIZ A;  1D8E A;  4XKB A;  3B13 A;  1LD8 A;  4WUY A;  4I6G A;  3JYS A;  4K5A B;  2GRP B;  5KNG A;  3ZN3 A;  4LEU A;  1N9A A;  4AY5 A;  3CHS A;  4HOU A;  2L0I A;  3TJP A;  1UJK A;  3G2S A;  3ASN E;  4LG6 A;  3SF4 A;  5ENN A;  3QJZ A;  3DPD A;  1RZ4 A;  4GTQ A;  2IOL A;  4U95 D;  4EHM A;  4E6H A;  3W9F A;  4OAU C;  4N5Q A;  3U66 A;  2I1K A;  1N4S A;  3FEY A;  4L23 A;  5CCM A;  4I17 A;  2KXP C;  3SFZ A;  4I6E A;  4CGV A;  4IYP A;  2KAT A;  3AS8 A;  1OCC E;  5BW8 C;  2FI7 A;  3FHE A;  3JUE A;  3ZYL A;  1OUV A;  5D66 A;  1TJF A;  3IHY A;  2H6G A;  5A23 A;  2V4L A;  3HIZ A;  4LNU D;  4DLO A;  3R9A B;  1V55 E;  5KJM A;  3MV3 B;  2F0Y A;  3EHQ A;  4BTB A;  4GMR A;  2BKG A;  3D9M A;  2UY1 A;  5T3R A;  1SQM A;  4K5C A;  2PM7 A;  4JD2 G;  2OVF A;  2I6H A;  2YHC A;  4J8D A;  2PZI A;  2XGS A;  2QZA A;  1XNF A;  2X38 A;  4HRM B;  2I1J A;  3IV0 A;  2X3M A;  1PAQ A;  1SZA A;  5IY5 E;  5C2Y A;  2I2O A;  3BQO A;  2DZN A;  2CHZ A;  2XPY A;  3FP3 A;  5KWD A;  4AJW A;  1OWM A;  3AU4 A;  5G55 A;  3UIO C;  1B89 A;  2XS8 A;  3S7D A;  3B95 A;  4A3V A;  3ML9 A;  1N0Q A;  2AXU A;  3MA5 A;  4U7E B;  3VLE A;  4ATZ D;  3LDZ A;  2A4Z A;  4WNG A;  1LTX A;  1P5Q A;  4TXP A;  4U8Y D;  1IKN D;  2FF4 A;  1N11 A;  1Z3X A;  4JHK A;  5KJK A;  4RSY A;  2XCC A;  5D0O D;  4U07 A;  2F37 A;  1JPL A;  1MZC A;  1D9S A;  3OAW A;  4O1O A;  4XX5 A;  5T4Y A;  4HFG A;  2NYJ A;  2HM8 A;  2EIL E;  4J8Y A;  2CHW A;  5AAR A;  3R7R A;  4A1G A;  4NAC A;  1N52 A;  3AS4 A;  4WWN A;  4GTT A;  2VSO E;  3JCK C;  1IYG A;  1S0P A;  2IF4 A;  4HB5 A;  1E96 B;  5J08 A;  3CVP A;  1XGW A;  4TUM A;  1MX4 A;  3P1U A;  3JXJ A;  2HYZ A;  1Z5S C;  4HBD A;  3RJV A;  3FTS A;  1NL4 A;  2VYI A;  1E7V A;  2IY0 C;  4RG9 A;  4N2S A;  3B7R L;  3SBT B;  3RKV A;  3TWV A;  4J6I A;  3U9W A;  1A5E A;  5T8I A;  2BUG A;  4B8C B;  3FU3 A;  5D2M C;  3FH8 A;  1MHQ A;  1BI8 B;  3FU5 A;  4F7A A;  2P9I G;  3TWR A;  2P58 C;  3ZYM A;  4OVV A;  3EIJ A;  1NA3 A;  3QKY A;  4UI9 C;  4UWL A;  2R02 A;  3DST A;  2R59 A;  4BX9 A;  1HH8 A;  3C98 A;  4GTR A;  2CG2 A;  1WAO 1;  2VGY A;  3DSU A;  3FTU A;  1K8K G;  4F1P A;  5ENO D;  3IEG A;  3CK8 A;  1SZ9 A;  3AG4 E;  4YDY A;  3RAU A;  1QYM A;  3GZ2 A;  2E2E A;  1SA5 A;  4DPR A;  3C5R A;  3QWP A;  4U0U A;  4A3T A;  4EBA A;  4OYS A;  5EID A;  1TN7 A;  3PRZ A;  3NBN B;  3RSE G;  4J8S A;  2R2L A;  3RK6 A;  2VSX E;  5EN5 D;  2RFA A;  3DPY A;  1MYO A;  3UPV A;  3TG5 A;  2VQ2 A;  1N94 A;  1ZB1 A;  2BF0 X;  3HHM A;  5ENR D;  1NZN A;  3KSL A;  3Q73 A;  4I9C A;  2ZXW E;  2PQR A;  1U3C A;  1PY1 A;  3HG0 D;  4NIK A;  1N54 A;  1YMP A;  1HX8 A;  5JHA A;  2NC9 A;  4O6F A;  1U3D A;  3RU0 A;  1DCQ A;  5FZQ A;  4TUU A;  4I1A A;  4BT8 A;  5EX3 A;  3BG0 B;  3MEK A;  2FUL A;  2X6F A;  2IQC A;  1VDY A;  4YDE A;  3Q9N C;  1K3Z D;  2XZT G;  3PZ4 A;  3L22 A;  4WNE A;  5CCL A;  4EBA G;  5FTP A;  5CBO A;  2PL2 A;  1H2V C;  5CMY A;  4JA9 A;  2J4D A;  4JPS A;  3ZXP A;  3I4R B;  4UUC A;  2X6K A;  2XCB A;  4GTS A;  2RD0 A;  5AJL A;  2WMN A;  3UT4 A;  2ETB A;  3U64 A;  4AM9 A;  4UWK A;  3D3M A;  4J0U A;  5FT9 A;  1TN8 A;  3OXG A;  2C0M A;  1ZU2 A;  3AG3 E;  1H19 A;  1BU9 A;  3CEQ A;  4BET A;  2IJG X;  3ASO E;  1HZ4 A;  1E8W A;  4LCT A;  1YCS B;  1OXJ A;  3ML8 A;  5JMN D;  5G04 J;  2XPI A;  3UIP C;  4IN3 B;  4N3B A;  4XI9 A;  2WMO A;  3SY2 A;  3LCA A;  2FEZ A;  3FY4 A;  2VGX B;  4JEU A;  2P9L G;  2EQX A;  5CRU A;  2Y0B G;  4HXI A;  4XKC A;  3HRA A;  1TR4 A;  1X5B A;  1H6K A;  4DX7 D;  1JCR A;  4A1S A;  3EHM A;  1FVF A;  4L1B A;  3CHM A;  3CHR A;  3UT8 A;  3Q78 A;  5FWQ A;  2FO1 E;  4AY6 A;  4B94 A;  2OV8 A;  2XQ0 A;  4APO A;  5CMW A;  3AU5 A;  2WVI A;  2H6F A;  4JW1 A;  3WXX A;  3ZNG A;  2EIM E;  3B7B A;  3PVL A;  4UWF A;  2MRI A;  2JEK A;  4FLB A;  1JUQ A;  3UM1 A;  3Q75 A;  5B3S E;  3FTZ A;  4L9P A;  2P9U G;  3Q7A A;  4NUR A;  2H6I A;  3EJN A;  2AXZ A;  3PE4 A;  2WXJ A;  3RIB A;  2WXK A;  3ULE G;  3ZU7 B;  5EIB E;  2LXM A;  5J90 A;  2QYU A;  4FHK A;  3URZ A;  4CDN A;  3E34 A;  3FUL A;  3K9I A;  1E8Y A;  3D9O A;  1UJJ A;  4M3O A;  4B89 A;  2ZIR A;  3CVX A;  3ZFW A;  2MOW A;  3EU9 A;  2L9B A;  5EYL A;  2GRN B;  2VSY A;  4G8K A;  2WB2 A;  4JEH A;  1O1R A;  4KVM A;  4AP2 A;  3I5P A;  2YIN A;  1K1A A;  2AJA A;  2J07 A;  2AXV A;  2DCP A;  4FA6 A;  1OCO E;  2EIK E;  3SQV A;  3D9H A;  4ABN A;  3LY9 A;  4GMJ A;  3CKC A;  4APF A;  3MGB A;  3GYZ A;  4HOS A;  3ZPJ A;  3W9G A;  5CHE E;  2OCC E;  2YQ8 A;  3ESK A;  2AWI A;  5CER B;  2R17 C;  4HS2 A;  1E8Z A;  3PNL B;  3CQC B;  2VTB B;  3FDH A;  3QWW A;  5LP0 A;  4NQ0 A;  3Q7F A;  1GW6 A;  5CRV A;  2R05 A;  4KZ0 A;  3PRE A;  3DBS A;  3AG1 E;  3P2B A;  2ILR A;  4LER A;  4U8V D;  3G2V A;  4F53 A;  4GPM A;  4FJZ A;  1L5J A;  4GCN A;  1MQS A;  3U4T A;  4YND A;  4BEP A;  3PZD A;  4I9E A;  2XS1 A;  1EYH A;  3CIA A;  4KXK B;  1EPU A;  4O60 A;  3TWU A;  3CVQ A;  1AWC B;  5ENS D;  2WXG A;  3HXB A;  2DYR E;  4FJY A;  5AQ7 A;  2WPV A;  2IO2 C;  4LNG A;  3HXC A;  2Y69 E;  3MYV A;  4QFV A;  2HO1 A;  5AEN A;  4QQI A;  3LPZ A;  3TG4 A;  1UN8 A;  3L54 A;  4ANX A;  4ILH B;  3EHN A;  1KT1 A;  3LVR E;  3TXM A;  4N39 A;  4WND A;  3UXG A;  3CVN A;  4CT4 A;  5CBN A;  3I4G A;  4WAF A;  4AVX A;  4RVB A;  1Z6T A;  3ZIM A;  4DI4 A;  3MX3 A;  3D9P A;  1H6O A;  3HYM B;  4JHJ A;  2BTD A;  3UI2 A;  3L9T A;  4L2L A;  1N4Q A;  3BEE A;  2EIN E;  3EU5 A;  4BX8 A;  3CKB A;  2WQ7 A;  2EIJ E;  2ETC A;  3UIN C;  1TNO A;  2FBN A;  3NZS A;  5BXU A;  5EDS A;  2R03 A;  5AAO A;  4FHJ A;  1JWG A;  3FTY A;  2OEV A;  3SZ7 A;  3TWX A;  1LF8 A;  3FU6 A;  3LXU X;  4V3I A;  4Z68 A;  3V30 A;  5BT1 A;  4HRL A;  4ME2 A;  5E76 A;  3ZUV B;  4LUN U;  4RG6 A;  3VLF A;  4E85 A;  3LY8 A;  1Y6I A;  4YVO A;  5JJ6 A;  4ACK A;  5HRY A;  3D9J A;  1TEZ A;  2E0I A;  2WXO A;  2LO6 A;  3NZU A;  3TWS A;  4AV7 A;  2I9C A;  3Q47 B;  2ZIS A;  3LY7 A;  1D8D A;  3OTN A;  3JUI A;  4TV3 A;  3CK9 A;  1BD8 A;  4FU3 A;  2LAI A;  5BPP A;  2LXL A;  1DCE A;  1IQU A;  3IXE A;  2IOS A;  4B8A A;  3CK7 A;  2IO3 C;  4F3V A;  3T5V A;  5FJY A;  4M7C A;  4GTP A;  4CRW A;  1OWN A;  5D0Q D;  3FTX A;  1EDU A;  4I2Z A;  3SFX A;  4LRZ A;  5C1D A;  3FUN A;  2L6J A;  3ZKJ A;  3S7F A;  3ASF A;  4U0Z A;  2BKK B;  4FP7 A;  2DBA A;  2GGF A;  4L7T A;  5ARF A;  2WXI A;  3CGH A;  4B93 B;  1FT2 A;  3V31 A;  3Q9U C;  5HKP A;  3KEZ A;  3TWQ A;  4K5B A;  2RG8 A;  3T5X A;  2PNN A;  3CHO A;  1HE8 A;  3DRA A;  3ULY A;  5G04 C;  2LNI A;  4GCO A;  5E75 A;  2CG3 A;  3APF A;  1WY6 A;  4BT9 A;  2WXN A;  1UN9 A;  5KCM A;  4HI9 A;  3CSF A;  3UKR G;  2KM4 A;  5BV1 A;  4GU5 A;  5JA4 D;  3E4B A;  2F8Y A;  4HOT A;  2VTB A;  4UI9 K;  2CFZ A;  4ZFH A;  1O5M A;  3CR3 A;  4DLQ A;  3X2Q E;  4GPK A;  3PEU B;  3E33 A;  1V54 E;  1YA0 A;  1MJ0 A;  3ONL A;  2HE0 A;  5M72 A;  4U04 A;  4PUC A;  2ZU6 B;  3V2X A;  1TNB A;  2B0O E;  4MS6 A;  3RO3 A;  2DVW A;  3QB2 A;  1SW6 A;  2JAB A;  2OOE A;  3T9K A;  4Q96 A;  4U96 D;  2RFM A;  5LOZ A;  4YDW A;  4WWO A;  3ZHE A;  2IFU A;  5FQ4 A;  2M63 A;  1BLX B;  4K0R A;  4GTV A;  2ETA A;  3B7T A;  4G25 A;  4CDR A;  4GTO A;  3FTV A;  3U3W A;  2NSZ A;  4JZY A;  3QOU A;  4LNB A;  1FCH A;  4HVB A;  1IHG A;  4CZ2 D;  3DSX A;  4RLY A;  1HG5 A;  1PC2 A;  3VTY A;  2Q7F A;  4UQY A;  1E8X A;  4MRU A;  4ANW A;  4PDX A;  1U2V G;  3PDN A;  4AXH A;  4G2V A;  3L08 A;  1IQR A;  5ENQ D;  4MLP A;  4JHR A;  2JLB A;  4TRQ A;  3C72 A;  4JB8 P;  3UT7 A;  4MBG A;  2DWZ A;  4KZC A;  3S7B A;  1OCR E;  3KAE A;  4ANU A;  2VSN A;  1TNU A;  4FLH A;  1HU3 A;  3RRN B;  1UOH A;  4ANV A;  5AIJ A;  5A6C A;  4UWH A;  3LEW A;  1TNZ A;  3FTW A;  3LJ3 A;  3CV0 A;  3FUF A;  4HOQ A;  3ZGQ A;  3UQ3 A;  2VGX A;  1UG3 A;  3NAW A;  1JCQ A;  3ABM E;  4HLE A;  5HQ8 A;  4I1M A;  3EIQ C;  4BY6 A;  2DZO A;  4WWP A;  3SNX A;  1N4P A;  1TYQ G;  2AVP A;  3DXM G;  3CLJ A;  2FO7 A;  3GW4 A;  4GA2 A;  3B7S A;  3MJW A;  3PZ1 A;  2QC9 A;  1G3N B;  1YYH A;  4JXT A;  5CEA A;  2IU1 A;  4EZJ A;  2B6C A;  1NP7 A;  3PS6 A;  4HRN A;  1KZO A;  2MHK A;  1E7U A;  4MKT A;  3FUK A;  4W9R A;  4YVQ C;  3CVL A;  3C3O A;  4EZL A;  3ZYK A;  2WXF A;  3IHV A;  4GZC A;  4XEI G;  2XEN A;  4C48 B;  2NXP A;  3ABK E;  2XZD G;  5CED B;  1W3B A;  1KPS B;  3DSV A;  3KD7 A;  3FUJ A;  4N3A A;  4P29 A;  4B0Z A;  4XI0 A;  2X6H A;  3FUM A;  2P9S G;  1OT8 A;  3DEP A;  3LVQ E;  3LYA A;  3AG2 E;  3FUE A;  5G05 J;  3DSW A;  3G2W A;  3OXF A;  4N2Q A;  4DX1 A;  1JWF A;  1O1T A;  2XGM A;  1HFA A;  4FAD A;  3ZRH A;  3E37 A;  3VTX A;  2X6I A;  2Y4U A;  3O4Z A;  2KC7 A;  3UM2 A;  2LAH A;  1SA4 A;  5G05 C;  4DI3 A;  2Y4T A;  3J5Q B;  2VJ8 A;  2WM9 A;  2XGO A;  5JJ7 A;  3QDN A;  3TWW A;  3GZ1 A;  2ION A;  3MKR A;  3WG7 E;  2F8X K;  1TN6 A;  3IBE A;  3J5P A;  1DC2 A;  4Q69 A;  3T8K A;  4CDM A;  2Y1L E;  2ZGG A;  1NI1 A;  4C9B B;  3D9N A;  4ZHB A;  1N95 A;  2GRQ B;  1ELK A;  2V8S E;  1K1B A;  4X8Q A;  2V4H C;  4L2Y A;  3FUD A;  5FQ6 A;  4GB9 A;  2KZT A;  4CT0 A;  4EQF A;  2OEW A;  3S2A A;  1BI7 B;  2DIW A;  1MX6 A;  2P9P G;  1AP7 A;  3DSS A;  3ZYQ A;  4CEM A;  4BES A;  1QBQ A;  4GA0 A;  1INZ A;  4DRX E;  5LFA A;  3Q5M A;  4JA7 A;  3BUA A;  1JCS A;  3AJI A;  1NFI E;  4TXQ A;  3FWV A;  4R7L A;  5ANL A;  3L17 A;  1H2T C;  4PS8 A;  3HXF A;  1IHB A;  4GAA A;  3ZVV A;  1OWO A;  3JQ1 A;  1SVX A;  4WNF A;  4BER A;  2XHE A;  2Y3A A;  3TXN A;  3L82 A;  1A17 A;  5ITZ F;  3ONK A;  4DK5 A;  2WXQ A;  5B1A E;  1N4R A;  2PM6 A;  3OXL A;  3ABL E;  1WG0 A;  5G2N A;  3PE3 A;  5BXO A;  2A5E A;  4A63 B;  4HOR A;  3NQP A;  3NOG D;  1DVP A;  3PH0 C;  3Q15 A;  5AJD A;  3HVE B;  4IUL A;  2P9N G;  2BED A;  2CFU A;  2V5Q C;  2QFC A;  4O1P A;  4AIF A;  3FUH A;  4BTA A;  3EUV A;  1OWP A;  5ARG A;  2RKK A;  4ATG A;  3UM0 A;  1HF8 A;  2J8S D;  1QZ2 A;  1X81 A;  4I1O B;  1KT0 A;  4KBQ A;  4G1T A;  2PQN A;  5FQ7 A;  1DNP A;  4GZ5 A;  3Q49 B;  4GZD A;  3SBS A;  3SD5 A;  4RQI A;  3BU8 A;  3B7U X;  3SGH A;  3NB2 A;  5AQA A;  4N3C A;  3I3N A;  2CHX A;  3PZ2 A;  4BSZ B;  2VGE A;  4GML A;  4HI8 A;  3LS8 A;  3MKQ A;  1E90 A;  3BG1 B;  4JVS A;  4EZK A;  1QQE A;  3G2U A;  3ZHE B; 
#chains in the Genus database with same CATH homology
 1UOH A;  5CBO A;  1BD8 A;  1OT8 A;  3DEP A;  1IHB A;  3TWT A;  2ZGD A;  3UTM A;  5KBA A;  4F1P A;  3ZNG A;  5FIN A;  5ENO D;  2F37 A;  1MJ0 A;  1SVX A;  4BER A;  3JUE A;  5ENT D;  1D9S A;  3IXE A;  5FIO A;  3B7B A;  4UUC A;  4YDY A;  5D66 A;  4DX1 A;  2HE0 A;  1QYM A;  2XEE A;  2P2C P;  1IXV A;  2KBX A;  4O1O A;  2NYJ A;  4U8V D;  4LSZ E;  3SO8 A;  2ETB A;  1S70 B;  4GPM A;  5ITZ F;  3AAA C;  3C5R A;  3DEO A;  4HLL A;  4J8Y A;  3UI2 A;  3V2X A;  2QYJ A;  5EYP F;  5AAR A;  5EID A;  2B0O E;  5CEC B;  3NBN B;  2DVW A;  3LJN A;  4LNU D;  4BEP A;  1SW6 A;  2JAB A;  2DZO A;  3T9K A;  1WG0 A;  4HB5 A;  4DX2 A;  4J7W A;  3ZU7 B;  5EIB E;  5EIL A;  3J5Q B;  4U96 D;  1N0R A;  2RFM A;  5BXO A;  4TUM A;  2A5E A;  1MX4 A;  4A63 B;  2ETC A;  4YDW A;  5EN5 D;  3EHQ A;  4GMR A;  2BKG A;  2QC9 A;  1G3N B;  3ZKJ A;  1YYH A;  3NOG D;  1WDY A;  2RFA A;  3JXJ A;  5CEA A;  5BXU A;  2BKK B;  1BU9 A;  4HQD A;  4O60 A;  2XEH A;  3TWW A;  1MYO A;  4K5C A;  3TWU A;  2F8X K;  5AAO A;  1BLX B;  4B93 B;  4HBD A;  1AWC B;  2ETA A;  4HRN A;  4BET A;  3J5P A;  1OY3 D;  3Q9U C;  3V31 A;  4DUI A;  5HKP A;  3EU9 A;  5ENS D;  1YCS B;  5JMN D;  3TWQ A;  3T8K A;  5AQB A;  1DC2 A;  5EYL A;  5AN8 A;  2V5Q C;  4K5B A;  2Y1L E;  4O1P A;  4HRM B;  4K5A B;  3TWX A;  2ZGG A;  2PNN A;  3EHR A;  4G8K A;  5KNG A;  5ENR D;  4CZ2 D;  4RLY A;  4ZHB A;  3TWV A;  4Z68 A;  2L6B A;  3V30 A;  4DX6 D;  3HG0 D;  4HRL A;  1K1B A;  2J8S D;  2DZN A;  5AQ7 A;  4NIK A;  2V4H C;  3ZUV B;  4LG6 A;  4OAV B;  1A5E A;  1K1A A;  1YMP A;  2AJA A;  5AQ9 A;  3NOC D;  2XEN A;  3F6Q A;  5KWD A;  4QFV A;  3D9H A;  2MYO A;  5HS0 A;  1BI7 B;  4C48 B;  4QQI A;  3V79 K;  1MX6 A;  1BI8 B;  4HI9 A;  4G8L A;  1DCQ A;  5KNH D;  3B95 A;  3JXI A;  2Y0B G;  3W9G A;  5HRY A;  5ENQ D;  1AP7 A;  4CYM D;  4HNA D;  5JA4 D;  4U95 D;  1N0Q A;  2XZD G;  1MX2 A;  3KEA A;  5ENP D;  3TWR A;  4BES A;  5CED B;  3W9F A;  4OAU C;  4N5Q A;  5AQA A;  3HRA A;  1TR4 A;  3TWS A;  2F8Y A;  4JB8 P;  4ATZ D;  4DX7 D;  4DRX E;  4BSZ B;  4F6R D;  3V2O A;  2DWZ A;  2VGE A;  4DX5 D;  4HI8 A;  3AJI A;  3Q9N C;  1NFI E;  2KXP C;  1K3Z D;  2XZT G;  3UXG A;  4ZFH A;  5CER B;  4U8Y D;  5CBN A;  2FO1 E;  1IKN D;  1N11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...