3Q9UC

In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
157
Chain Sequence
FGQDLGKKLLEAAAAGQDDEVRILMANGADVNATDDNGLTPLHLAAANGQLEIVEVLLKNGADVNASDSAGITPLHLAAYDGHLEIVEVLLKHGADVNAYDRAGWTPLHLAALSGQLEIVEVLLKHGADVNAQDALGLTAFDISINQGQEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A de novo protein binding pair by computational design and directed evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding, de novo protein
molecule keywords CoA binding protein
total genus 45
structure length 157
sequence length 157
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3q9uC00
4QFVA 5AAOA 4U8YD 5ENTD 5AQ9A 4HRNA 2XENA 4O1PA 1DCQA 2XEEA 5HS0A 3ZKJA 4F6RD 1K3ZD 3AJIA 3EU9A 5HRYA 3ZUVB 1SVXA 2NYJA 3DEOA 3IXEA 1IHBA 3ZU7B 4CYMD 4UUCA 5BXOA 4HNAD 4DUIA 4LNUD 1BU9A 3V2OA 2RFAA 4DRXE 3V79K 1DC2A 1MX2A 3ZNGA 3NBNB 4HBDA 5ENPD 3V31A 1N0QA 4NIKA 5D66A 4BERA 5FIOA 3TWVA 2ETAA 5ENQD 4HRLA 2A5EA 4N5QA 3B95A 4O1OA 3SO8A 3TWRA 4OAVB 3TWXA 2DWZA 4J7WA 2XZTG 3Q9NC 4QQIA 2PNNA 5CBNA 3HRAA 3HG0D 5CEDB 4LG6A 3TWUA 3NOGD 4O60A 4F1PA 2MYOA 3EHQA 4ATZD 2ETCA 3F6QA 5ENSD 5FINA 5KNGA 2VGEA 5EIBE 2J8SD 4U96D 3TWQA 1IXVA 4TUMA 3KEAA 5JMND 4BEPA 1MX6A 4C48B 1IKND 2XZDG 5BXUA 2RFMA 2Y0BG 3TWTA 2XEHA 3UTMA 4BETA 4LSZE 4B93B 5AQAA 3UXGA 1WDYA 4U95D 5EILA 1BI8B 1G3NB 2DZNA 4J8YA 5CBOA 3T9KA 1YMPA 5KWDA 5AQBA 1OY3D 2DVWA 1AP7A 2F8YA 3TWSA 1WG0A 5HKPA 5ITZF 5AQ7A 2QC9A 2V4HC 3JXIA 4GMRA 5EYPF 2F8XK 1N0RA 1QYMA 3C5RA 1S70B 5JA4D 4CZ2D 1OT8A 4HB5A 2V5QC 2ETBA 3LJNA 2AJAA 1BD8A 1BI7B 1BLXB 1K1BA 2F37A 3JXJA 4HLLA 2JABA 4K5BA 2KBXA 5EIDA 5EN5D 5KNHD 3AAAC 2BKGA 1SW6A 2P2CP 5ENOD 2L6BA 1A5EA 2DZOA 2KXPC 3TWWA 4DX6D 5CERB 2ZGGA 1N11A 1YCSB 1K1AA 1MJ0A 1MX4A 1TR4A 4HRMB 4A63B 2Y1LE 2QYJA 3J5PA 2HE0A 3EHRA 4K5AB 4U8VD 1D9SA 2FO1E 5EYLA 3JUEA 4RLYA 4ZHBA 4BESA 1YYHA 1UOHA 3D9HA 5AN8A 2ZGDA 4DX7D 3W9FA 3W9GA 4DX1A 4DX2A 5KBAA 3NOCD 4GPMA 5AARA 4ZFHA 4YDWA 1AWCB 4YDYA 4DX5D 4HI8A 4G8KA 5CEAA 4BSZB 4Z68A 4K5CA 3T8KA 4G8LA 4HI9A 3V30A 2BKKB 2B0OE 1NFIE 3B7BA 5ENRD 3Q9UC 4HQDA 3V2XA 3UI2A 4OAUC 5CECB 4JB8P 3DEPA 3J5QB 1MYOA
chains in the Genus database with same CATH superfamily
5ENTD 2KATA 2XENA 3T5XA 5T4YA 5HS0A 5KJMA 2WQHA 2XEVA 1O1RA 2FULA 3SD5A 3FTSA 3I5PA 3MGBA 3NBNB 2CG3A 1OCZE 4BERA 4AM9A 5FIOA 4W9RA 3TWXA 1KPSB 2V4LA 1N9AA 3HXCA 2PNNA 3CQCB 2WXKA 3E4BA 4URKA 1TN8A 3S2AA 1N95A 2EIJE 5JMND 4B89A 2VTBA 2RFMA 3NQPA 2ILRA 2VGXA 3L54A 1S64A 3IV0A 3RO2A 2HO1A 2RKKA 5A6CA 4PS8A 3KAEA 3CVLA 1S70B 5FZRA 4RG6A 2KCKA 3FUJA 1A5EA 1TN7A 2P9SG 4GA1A 1N54A 2MHKA 2ZGGA 1K1AA 4MRUA 2HE0A 4DK5A 3CVXA 4N39A 4RVBA 1NZNA 1S63A 3HIZA 5FTPA 2Y69E 2X6IA 1OCCE 3GZSA 4ACLA 4G8LA 3VLEA 3DXMG 3V2XA 3JCKC 4OVVA 2H6HA 3J5QB 4AEZC 2NSZA 5ENNA 3DWLG 5LX8A 2XS8A 3ML8A 4G11A 3L13A 3CLJA 3Q7FA 3R9MA 4H7XA 3KD7A 1H6KA 5T3RA 4J0UA 2DCPA 4GYOA 3BG1B 4UWGA 3NOGD 3UINC 4XZ4A 4F1PA 3BG0B 3ZN3A 1TNOA 3AG2E 3CGHA 5EX0A 3CVPA 1IXVA 4HLEA 4HOUA 2AXUA 1TNYA 5G05J 4JVSA 3FP3A 3CVUA 5AIJA 3ISMC 1O1TA 3CEQA 2HYZA 1OT8A 2OEWA 2UY1A 4AY6A 4RG9A 3SFYA 3PREA 5KNHD 2BKGA 2GRRB 1YCSB 3FTYA 4HFGA 4HRMB 4CEMA 4N2QA 3UUXA 2FO1E 3E30A 1FT2A 4ANXA 4ZFHA 4I43A 3ZHEB 1QQEA 4PS3A 3NZUA 2B0OE 2EILE 4B94A 2IU1A 4U8YD 1DCEA 2FF4A 3CHMA 3QK0A 4GYYA 4CYMD 3D9PA 4BTAA 1BU9A 4TXPA 1Z5SC 2ETAA 3TWRA 4I1MA 4A3TA 3HRAA 4M7CA 5CMYA 5G05C 3EDTB 3F6QA 2IEJA 3TG4A 2J8SD 4JZYA 4AV7A 2L9BA 3UXGA 4U95D 2R02A 5DBKA 4V3IA 4HXIA 3PS6A 4HB5A 1V54E 1D9SA 3ZIMA 4LERA 5FQ7A 2PM6A 3LVRE 4IN3B 4F1SA 2KXPC 4LUNU 1Z3XA 3AU5A 4J8DA 4O6FA 2WM9A 3Q15A 3PE4A 2ONDA 1HFAA 1HX8A 2PL2A 4KZCA 3WG7E 4YDOA 1UOHA 4ILGA 3D9HA 2RG8A 3PUKA 3ASGA 3Q75A 5FWQA 1LD8A 3B7TA 1NA0A 4DLQA 5ENRD 1MYOA 4F7AA 1OCOE 3N71A 2EINE 5AJLA 4BT9A 3EU9A 4U0UA 1FT1A 3DEOA 3PZ2A 4YNDA 1GW6A 3CK7A 3V2OA 2RFAA 2YQ8A 3ULQA 2ZIRA 2L0IA 4EBAG 1TN6A 4PS7A 5JHBA 3L82A 4ANWA 2FO7A 2MYOA 1WM5A 2WXPA 4GTVA 4GB9A 2WQ6A 4ME2A 2VGYA 1VDYA 3OXLA 1K8KG 2X6HA 2RD0A 2WXJA 4LSZE 3ASOE 4J8YA 2YHEA 5KWDA 1AP7A 3QJZA 1WG0A 4F3VA 5ITZF 1P5QA 4H7YA 5CCMA 2FEZA 3MYVA 3E32A 2ETBA 2F37A 2AJAA 1U3CA 2KCVA 4K5BA 2DYRE 3G2TA 1BPOA 5H7PA 3S7FA 2L0TB 3O48A 3TWWA 2H6FA 4FHJA 5KJLA 4XE0A 1N4RA 4DI3A 3ZYMA 4E6HA 4XIFA 2KC7A 4DX7D 3W9FA 4GZCA 3E33A 1PAQA 3BUAA 3FTUA 3RK6A 2WXQA 4DPRA 4ANVA 3PEUB 4JB8P 3ASHA 2VJ8A 1DCQA 2GRPB 5HI7A 3QC1A 2R5SA 4N3CA 3EHNA 1E7VA 1N0QA 3QAQA 4B0ZA 3TWVA 1RW2A 4YDEA 3FTZA 2BUGA 3SY2A 2WXOA 2VYIA 2WMNA 2OV8A 3TWUA 4O60A 4I2WA 2ETCA 4IULA 4NQ0A 4JA9A 3FY4A 4APFA 3TWQA 3PZ4A 1UJJA 1MX6A 2V8SE 3D9LA 3MV2B 1QZ2A 4AOFA 4JL0A 5EILA 1NL4A 5G04C 4ILIA 1O1SA 4HOSA 3FUMA 4OVUA 2F8XK 3ML9A 3MZLB 3ZYQA 5B1BE 3JXJA 5KCMA 4CGVA 3SBSA 2BTDA 3FDHA 2L6BA 1A17A 1E7UA 2VSXE 3G2SA 4UQXA 4KBQA 1E8XA 2ZISA 3ZYKA 4TUUA 4JHKA 4BESA 2OOEA 2PQNA 3HXBA 1IHGA 1HU3A 1NP7A 5AARA 1IYGA 5LFAA 2BKKB 1NFIE 3AG4E 3UM2A 4MS6A 4ABNA 4GTQA 4XKBA 3VTYA 1XGWA 2B6CA 2J08A 3C98A 3HYMB 1IHBA 4I9CA 5BXOA 4F53A 5A7DB 2IY0C 3C72A 1DC2A 5HQ8A 3PNTB 4UI9J 3SO8A 2XGOA 4J7WA 1E8YA 3PNLB 4MLPA 1E8ZA 1EDUA 5ENSD 1YA0A 3Q73A 2VGEA 4U07A 3KS2A 4TV3A 4L2LA 4FJYA 1QNFA 2XZDG 1KZOA 1UJKA 4BETA 5AQAA 2DZNA 1JCQA 2VTBB 5LP0A 4FADA 5ARFA 4KXKB 4TXQA 3OXFA 4DLOA 2NXPA 2JEKA 2XRZA 4PH4B 2GROB 1BD8A 4A55A 2XPYA 1Q2ZA 3FEYA 5D0QD 3HXEA 4B8CB 3D9KA 5FQ4A 4A63B 4CDMA 4FP7A 3GZ2A 3QNKA 4I9EA 2I2OA 4RLYA 4J8EA 5FZQA 3FUFA 2ZXWE 3GZ1A 4N3AA 4I1AA 3APFA 3LS8A 2X38A 3T8KA 4I2ZA 4HQDA 5CECB 4KT6B 3KSLA 5AAOA 4HRNA 1HH8A 2Y4UA 2L6JA 1SVXA 1Y6IA 2J49A 1UW4B 5E75A 4JD2G 3TG5A 3UT4A 2WB2A 1MQSA 3C3QA 1JPLA 3DSVA 5D66A 4KMOA 2BF0X 5EDSA 4U0ZA 5CMWA 2V0PA 3FWVA 4HORA 1TNUA 2P9LG 3CQGB 3AG1E 2R17C 2J09A 2F0YA 4BWRA 1H2UA 3MJWA 3LY9A 3DPDA 4DJAA 3CR3A 4Q94A 2I9CA 4HS2A 1XNFA 3RKVA 1BI8B 4U04A 3FTVA 5AYWD 3UT8A 1JUQA 3CVWA 4I17A 2C2LA 4WWPA 1H6PA 4TRQA 3ZEFA 1H2TC 5JA4D 2R59A 2I1JA 2KM4A 3FTWA 2V5QC 1BLXB 2JABA 2WXMA 2KZTB 3SGHA 5CRVA 1ZU2A 2IF4A 2WXRA 1H19A 4WNGA 2XPIA 4FULA 4X8QA 3JUIA 1ELRA 4U8VD 3IEGA 4UWKA 2CHWA 4ZHBA 2LAHA 3D9IA 3EU5A 5AJDA 5AN8A 2ZGDA 5EX3A 4EBAA 4I6EA 4C9BB 1LTXA 4Q96A 5J08A 1AWCB 4DX5D 3CVQA 3IHVA 4G2VA 4OAUC 2XGSA 3Q78A 4J8SA 3RJVA 1JCRA 3KSQA 2QZAA 1INZA 3UPVA 3VLFA 4UUCA 5LCWJ 4Q69A 3QARA 4HBDA 5ENPD 2R03A 4UQZA 4CDRA 3Q5MA 3SF4A 2CFUA 5C1DA 3RRMB 1MHQA 3KEAA 4YVQC 4U7EB 3L9TA 1HO8A 4GTRA 5FQ6A 3UT7A 1YMPA 4PDXA 3CK8A 5HKPA 3HVEA 1D8EA 3D3MA 4UWLA 4ILHB 2IFUA 2P9KG 4GTTA 2E2EA 2WVIA 4A1GA 4N2SA 3LJNA 1IQRA 5EIDA 3OTNA 3L08A 4DX6D 5CERB 1E8WA 3AS8A 1MJ0A 3PDNA 4EZJA 3ENEA 5EYLA 3TXNA 4CDNA 1YYHA 2LXMA 4BSXA 4G26A 3NOCD 4JW1A 3LXUX 3ZRHA 4Z68A 3MCXA 3R7QA 3VTXA 3RAUA 3LCAA 4J6IA 3LVQE 3MKQB 1N94A 3S7JA 5M72A 4Y6WA 3NF1A 4LEUA 1UN8A 2NYJA 2WXHA 4L9PA 3AS4A 3FUDA 4BX9A 1N4PA 5AENA 3V79K 2IO3C 4G23A 3IKOB 1Z6TA 3FUEA 5FJYA 2OVBA 1TYQG 5CBNA 1FVFA 3APCA 4XKCA 4ATZD 2H6IA 3G2VA 3NZSA 4AJWA 4BEPA 4G25A 3TWTA 2XEHA 3FULA 3UM3A 3LY8A 3TWSA 4LNBA 4GCNA 4BY6A 5AQ7A 4K03A 1TNBA 2QC9A 1KZPA 1N0RA 1QBQA 2XHEA 3TL5A 3ZHEA 5B3SE 4L1BA 1K1BA 1ELWA 3O4ZA 5ENOD 3I4GA 3FU5A 4ACKA 4D10C 3CHOA 4ANUA 4GU5A 3PE3A 5JJTA 2ZU6B 3W9GA 4A3VA 2WPVA 1HG5A 2KCLA 4JXTA 4G8KA 4GAAA 2C0MA 3CHPA 5CEAA 4K5CA 3B7UX 5EKQD 4EQFA 1W3BA 3UI2A 3MEKA 2WQ7A 2PZIA 2MRIA 1OWNA 3UM0A 3AJIA 5HRYA 4R7LA 2J07A 5JHAA 3Q49B 3ZU7B 3LDZA 5FZSA 4DUIA 2XGMA 3CHRA 5JJ7A 1N52A 2WXFA 1JCSA 3SBTB 5ENQD 4TXRA 3FH8A 4A1SA 5CCLA 3UIOC 3CKCA 2X6KA 3GW4A 4C0MA 4EZLA 4E85A 4GPKA 2IOLA 4C0EA 3C3RA 3U66A 3FH7A 2P9UG 1OWPA 3D9JA 3QDNA 4U96D 2AW6A 2X3MA 2YINA 1IKND 1O5MA 4KVOA 4WNFA 2JLBA 3QKYA 3UTMA 3UX4A 2P9PG 2VSNA 2P9IG 3FUKA 5CBOA 5BPPA 3LY7A 3CSTA 2DVWA 4EHMA 5G55A 4KYOB 3C5RA 4LRZA 3AS5A 4GTPA 4FU3A 2DBAA 3QWPA 1H6OA 2PQRA 4K0RA 3NB2A 3MKRA 3FU6A 3CK9A 2Y3AA 4AIFA 2LSUA 4JHRA 3SFZA 2R05A 3JQ1A 4G24A 3PVLA 3ZW3A 4DX1A 3FEXA 2E0IA 3D9MA 2NC9A 1ZB1A 2GRNB 5G04J 3MX3A 3RIBA 2P58C 1NA3A 3DEPA 3U9WA 3OAWA 5FQ8A 4AY5A 4XEIG 4O1PA 3DSUA 4IRUA 3ZKJA 3TGOA 5J90A 2CHXA 3AG3E 3ASNE 3HXFA 3R9AB 1EF1C 1N4QA 4LNUD 1UN9A 3CVNA 4DRXE 3ZPJA 2OEVA 2A5EA 3FU3A 3RRUA 3WXXA 3FUIA 4FHKA 5CEDB 4LG6A 3ESLA 1WAO1 2LSVA 4I1OB 3DSSA 3QB2A 4BTBA 4C48B 1IQUA 2WXNA 1SZ9A 3ASFA 1D8DA 3ZXSA 3CV0A 2I1KA 3JXIA 4GMRA 3SHFA 1NI1A 4BT8A 4NRHB 2MOWA 2GRMA 1OWOA 1X5BA 2KBXA 1OCRE 1MZCA 1N11A 4GYWA 1TR4A 2Y1LE 2XCBA 2FI7A 1PY1A 3J5PA 2HM8A 3JUEA 3FHEA 5BV0A 2BEDA 3SNXA 3AU4A 3URZA 1H0AA 3JQ0A 1B89A 3V30A 2OCCE 1N4SA 5LOZA 3Q9UC 1FPPA 5BV1A 4GZDA 3OXGA 3UM1A 3PZDA 4WWNA 2X6JA 3QWWA 1L5JA 3IXEA 1HF8A 4CGWA 3CVVA 4HNAD 2XPZA 2AXZA 3ZNGA 4JPSA 2X6FA 3LJ3A 3CKBA 4XX5A 4HRLA 4N5QA 4OAVB 3ONKA 2R2LA 4QQIA 2QY7A 4N5CA 3LPZA 2WMOA 2VSYA 2LAIA 2GRQB 4NACA 3FUNA 5JJ6A 3R7RA 4N3BA 2DIWA 4MBGA 2Y0BG 2QFCA 4KVMA 3B7RL 5AQBA 3C3OA 3G2UA 3PEVB 1E96B 2QYUA 5CRUA 2V4HC 5EYPF 1QYMA 4APOA 2IOSA 5EN5D 5B1AE 2P2CP 3Q7AA 1KT0A 3BQOA 3ZYLA 3APDA 3SQVA 3IHYA 3Q47B 2M63A 3U4TA 3SZ7A 3EIQC 3FFLA 2VSOE 2YNQA 3FUHA 3DRAA 4UQYA 4GTSA 1TJFA 1UG3A 2AWIA 4BSZB 2I6HA 4QFVA 5AQ9A 4IYPA 1V55E 3ZUVB 3CSFA 4LNGA 2EIME 4EECA 4FJZA 4RSYA 1U3DA 1MX2A 3V31A 1HZ4A 2WXIA 3TAXA 4CT4A 1SA4A 4GMJA 3BU8A 3D9NA 3ZXPA 4WAFA 3EHQA 4AP2A 5BUZA 5KNGA 3ONLA 3ZVVA 4XI0A 4UI9C 3PRZA 5EIBE 5ANRA 1Z3YA 2Y4TA 4RQIA 4I6GA 1DVPA 3LYAA 3T9KA 1LF8A 1OY3D 2CHZA 2F8YA 3DSWA 3HHMA 4CCAA 5CHEE 2CFZA 4M3OA 3IBEA 3S7DA 3DXKG 5D2MC 5D0OD 3K9IA 1OUVA 1SW6A 3UIPC 3GYZA 3CIAA 2DZOA 4L23A 4JA7A 1MX4A 4WNDA 2Q7FA 4K5AB 1U2VG 4GA2A 4YDYA 3EJNA 3Q4AB 1HS6A 3RU0A 5BT1A 4FLHA 4FLBA 3EIJA 3PUJA 3FTXA 3PZ3A 4EZKA 4NURA 3EUVA 1ELKA 3KEZA 3T8MA 3U3WA 4MKTA 3E34A 3L22A 2UWJG 1LD7A 3P1UA 5KJKA 2LNIA 3DSXA 3Q9NC 3SFXA 4WUYA 3DPYA 5IY5E 3HG0D 5FINA 1WY6A 4FA6A 1JWGA 4TUMA 2YHCA 4B8AA 3ZFWA 4U0SA 2PM7A 2A4ZA 3TJPA 1G3NB 2XCCA 4YVOA 1HXIA 3PH0C 1DNPA 4GZ3A 3UKUG 1EYHA 4HVBA 5G2NA 3ESKA 4L2YA 2EIKE 3BEEA 1TNZA 4WNEA 2A5UA 4BFRA 3I3NA 3ASDA 3TXMA 4JC8A 4P29A 3FU0A 1FVHA 1FCHA 3ABME 3HVEB 3UKRG 1HG2A 3EHMA 1EPUA 3T5VA 3VLDA 1HE8A 2GGFA 3U64A 2GRLA 3RRNB 2XEEA 3LEWA 4GA0A 4F6RD 1K3ZD 3P2BA 1SZAA 2WXLA 4CRWA 4JEUA 1H2VC 2KZTA 5LCWC 2IONA 3HDXA 4O1OA 3B95A 1RZ4A 4GCOA 3S7BA 4AVXA 5DIZA 2J4BA 3L17A 4CT0A 4U63A 1JWFA 3SI5A 3MKQA 2FBNA 3ZGQA 4UI9K 2GW1A 3RO3A 5E76A 4B93B 3NAWA 2DYSE 2XRYA 3JYSA 2J4DA 1E90A 3ABKE 2VQ2A 4BX8A 4PUCA 4GZ5A 4UWHA 4KZ0A 5ARGA 3ULEG 3MV3B 1BI7B 1S0PA 3QWVA 2UY1B 1OXJA 5FT9A 3EHRA 5C2YA 4HOQA 2J9QA 4JHJA 2LO6A 2IJGX 3B7SA 4DX2A 4WWOA 5KBAA 3PZ1A 4YDWA 4XI9A 4HI8A 1SQMA 4U8HA 4HI9A 4G1TA 2HR2A 3L16A 4GZ6A 3E37A 5KJNA 2CG2A 3ABLE 4LCTA 3L6AA 4FC8A 4I6JA 3D9OA 2OVFA 3G2WA 4GMLA 1PC2A 1Y8MA 4Y6CA 1OWLA 4GTMA 3HXDA 4NIKA 4JEHA 2DWZA 2XZTG 3CHQA 3DBSA 1KLXA 1TJCA 1SA5A 3QOUA 4ATGA 1ZBPA 3UQ3A 5BXUA 3LKUA 3FH5A 5ANLA 1WDYA 4J8FA 3UMVA 2LXLA 3CHSA 4HOTA 4AXHA 2LUHA 2IO2C 4UWFA 3Q79A 3DSTA 2AVPA 2XS1A 4CZ2D 4EPZA 3RSEG 4HLLA 1X81A 3MA5A 3AAAC 2IQCA 1OWMA 2WXGA 5BW8C 1TEZA 2VGXB 4GTOA 5A23A 4OYSA 2V5FA 2P9NG 3X2QE 3CVYA 2EQXA 2QYJA 5T8IA 2H6GA 2AXVA 1KT1A 5BNWA 4DI4A 3B13A 4L7TA 4GPMA 2C0LA 2XQ0A 3I4RB 3ULYA 3B7BA
chains in the Genus database with same CATH topology
4QFVA 5AAOA 4U8YD 5ENTD 5AQ9A 4HRNA 2XENA 4O1PA 1DCQA 2XEEA 5HS0A 3ZKJA 4F6RD 1K3ZD 3AJIA 3EU9A 5HRYA 3ZUVB 1SVXA 2NYJA 3DEOA 3IXEA 1IHBA 3ZU7B 4CYMD 4UUCA 5BXOA 4HNAD 4DUIA 4LNUD 1BU9A 3V2OA 2RFAA 4DRXE 3V79K 1DC2A 1MX2A 3ZNGA 3NBNB 4HBDA 5ENPD 3V31A 1N0QA 4NIKA 5D66A 4BERA 5FIOA 3TWVA 2ETAA 5ENQD 4HRLA 2A5EA 4N5QA 3B95A 4O1OA 3SO8A 3TWRA 4OAVB 3TWXA 2DWZA 4J7WA 2XZTG 3Q9NC 4QQIA 2PNNA 5CBNA 3HRAA 3HG0D 5CEDB 4LG6A 3TWUA 3NOGD 4O60A 4F1PA 2MYOA 3EHQA 4ATZD 2ETCA 3F6QA 5ENSD 5FINA 5KNGA 2VGEA 5EIBE 2J8SD 4U96D 3TWQA 1IXVA 4TUMA 3KEAA 5JMND 4BEPA 1MX6A 4C48B 1IKND 2XZDG 5BXUA 2RFMA 2Y0BG 3TWTA 2XEHA 3UTMA 4BETA 4LSZE 4B93B 5AQAA 3UXGA 1WDYA 4U95D 5EILA 1BI8B 1G3NB 2DZNA 4J8YA 5CBOA 3T9KA 1YMPA 5KWDA 5AQBA 1OY3D 2DVWA 1AP7A 2F8YA 3TWSA 1WG0A 5HKPA 5ITZF 5AQ7A 2QC9A 2V4HC 3JXIA 4GMRA 5EYPF 2F8XK 1N0RA 1QYMA 3C5RA 1S70B 5JA4D 4CZ2D 1OT8A 4HB5A 2V5QC 2ETBA 3LJNA 2AJAA 1BD8A 1BI7B 1BLXB 1K1BA 2F37A 3JXJA 4HLLA 2JABA 4K5BA 2KBXA 5EIDA 5EN5D 5KNHD 3AAAC 2BKGA 1SW6A 2P2CP 5ENOD 2L6BA 1A5EA 2DZOA 2KXPC 3TWWA 4DX6D 5CERB 2ZGGA 1N11A 1YCSB 1K1AA 1MJ0A 1MX4A 1TR4A 4HRMB 4A63B 2Y1LE 2QYJA 3J5PA 2HE0A 3EHRA 4K5AB 4U8VD 1D9SA 2FO1E 5EYLA 3JUEA 4RLYA 4ZHBA 4BESA 1YYHA 1UOHA 3D9HA 5AN8A 2ZGDA 4DX7D 3W9FA 3W9GA 4DX1A 4DX2A 5KBAA 3NOCD 4GPMA 5AARA 4ZFHA 4YDWA 1AWCB 4YDYA 4DX5D 4HI8A 4G8KA 5CEAA 4BSZB 4Z68A 4K5CA 3T8KA 4G8LA 4HI9A 3V30A 2BKKB 2B0OE 1NFIE 3B7BA 5ENRD 3Q9UC 4HQDA 3V2XA 3UI2A 4OAUC 5CECB 4JB8P 3DEPA 3J5QB 1MYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QFV A;  5AAO A;  4U8Y D;  5ENT D;  5AQ9 A;  4HRN A;  2XEN A;  4O1P A;  1DCQ A;  2XEE A;  5HS0 A;  3ZKJ A;  4F6R D;  1K3Z D;  3AJI A;  3EU9 A;  5HRY A;  3ZUV B;  1SVX A;  2NYJ A;  3DEO A;  3IXE A;  1IHB A;  3ZU7 B;  4CYM D;  4UUC A;  5BXO A;  4HNA D;  4DUI A;  4LNU D;  1BU9 A;  3V2O A;  2RFA A;  4DRX E;  3V79 K;  1DC2 A;  1MX2 A;  3ZNG A;  3NBN B;  4HBD A;  5ENP D;  3V31 A;  1N0Q A;  4NIK A;  5D66 A;  4BER A;  5FIO A;  3TWV A;  2ETA A;  5ENQ D;  4HRL A;  2A5E A;  4N5Q A;  3B95 A;  4O1O A;  3SO8 A;  3TWR A;  4OAV B;  3TWX A;  2DWZ A;  4J7W A;  2XZT G;  3Q9N C;  4QQI A;  2PNN A;  5CBN A;  3HRA A;  3HG0 D;  5CED B;  4LG6 A;  3TWU A;  3NOG D;  4O60 A;  4F1P A;  2MYO A;  3EHQ A;  4ATZ D;  2ETC A;  3F6Q A;  5ENS D;  5FIN A;  5KNG A;  2VGE A;  5EIB E;  2J8S D;  4U96 D;  3TWQ A;  1IXV A;  4TUM A;  3KEA A;  5JMN D;  4BEP A;  1MX6 A;  4C48 B;  1IKN D;  2XZD G;  5BXU A;  2RFM A;  2Y0B G;  3TWT A;  2XEH A;  3UTM A;  4BET A;  4LSZ E;  4B93 B;  5AQA A;  3UXG A;  1WDY A;  4U95 D;  5EIL A;  1BI8 B;  1G3N B;  2DZN A;  4J8Y A;  5CBO A;  3T9K A;  1YMP A;  5KWD A;  5AQB A;  1OY3 D;  2DVW A;  1AP7 A;  2F8Y A;  3TWS A;  1WG0 A;  5HKP A;  5ITZ F;  5AQ7 A;  2QC9 A;  2V4H C;  3JXI A;  4GMR A;  5EYP F;  2F8X K;  1N0R A;  1QYM A;  3C5R A;  1S70 B;  5JA4 D;  4CZ2 D;  1OT8 A;  4HB5 A;  2V5Q C;  2ETB A;  3LJN A;  2AJA A;  1BD8 A;  1BI7 B;  1BLX B;  1K1B A;  2F37 A;  3JXJ A;  4HLL A;  2JAB A;  4K5B A;  2KBX A;  5EID A;  5EN5 D;  5KNH D;  3AAA C;  2BKG A;  1SW6 A;  2P2C P;  5ENO D;  2L6B A;  1A5E A;  2DZO A;  2KXP C;  3TWW A;  4DX6 D;  5CER B;  2ZGG A;  1N11 A;  1YCS B;  1K1A A;  1MJ0 A;  1MX4 A;  1TR4 A;  4HRM B;  4A63 B;  2Y1L E;  2QYJ A;  3J5P A;  2HE0 A;  3EHR A;  4K5A B;  4U8V D;  1D9S A;  2FO1 E;  5EYL A;  3JUE A;  4RLY A;  4ZHB A;  4BES A;  1YYH A;  1UOH A;  3D9H A;  5AN8 A;  2ZGD A;  4DX7 D;  3W9F A;  3W9G A;  4DX1 A;  4DX2 A;  5KBA A;  3NOC D;  4GPM A;  5AAR A;  4ZFH A;  4YDW A;  1AWC B;  4YDY A;  4DX5 D;  4HI8 A;  4G8K A;  5CEA A;  4BSZ B;  4Z68 A;  4K5C A;  3T8K A;  4G8L A;  4HI9 A;  3V30 A;  2BKK B;  2B0O E;  1NFI E;  3B7B A;  5ENR D;  3Q9U C;  4HQD A;  3V2X A;  3UI2 A;  4OAU C;  5CEC B;  4JB8 P;  3DEP A;  3J5Q B;  1MYO A; 
#chains in the Genus database with same CATH topology
 5ENT D;  2KAT A;  2XEN A;  3T5X A;  5T4Y A;  5HS0 A;  5KJM A;  2WQH A;  2XEV A;  1O1R A;  2FUL A;  3SD5 A;  3FTS A;  3I5P A;  3MGB A;  3NBN B;  2CG3 A;  1OCZ E;  4BER A;  4AM9 A;  5FIO A;  4W9R A;  3TWX A;  1KPS B;  2V4L A;  1N9A A;  3HXC A;  2PNN A;  3CQC B;  2WXK A;  3E4B A;  4URK A;  1TN8 A;  3S2A A;  1N95 A;  2EIJ E;  5JMN D;  4B89 A;  2VTB A;  2RFM A;  3NQP A;  2ILR A;  2VGX A;  3L54 A;  1S64 A;  3IV0 A;  3RO2 A;  2HO1 A;  2RKK A;  5A6C A;  4PS8 A;  3KAE A;  3CVL A;  1S70 B;  5FZR A;  4RG6 A;  2KCK A;  3FUJ A;  1A5E A;  1TN7 A;  2P9S G;  4GA1 A;  1N54 A;  2MHK A;  2ZGG A;  1K1A A;  4MRU A;  2HE0 A;  4DK5 A;  3CVX A;  4N39 A;  4RVB A;  1NZN A;  1S63 A;  3HIZ A;  5FTP A;  2Y69 E;  2X6I A;  1OCC E;  3GZS A;  4ACL A;  4G8L A;  3VLE A;  3DXM G;  3V2X A;  3JCK C;  4OVV A;  2H6H A;  3J5Q B;  4AEZ C;  2NSZ A;  5ENN A;  3DWL G;  5LX8 A;  2XS8 A;  3ML8 A;  4G11 A;  3L13 A;  3CLJ A;  3Q7F A;  3R9M A;  4H7X A;  3KD7 A;  1H6K A;  5T3R A;  4J0U A;  2DCP A;  4GYO A;  3BG1 B;  4UWG A;  3NOG D;  3UIN C;  4XZ4 A;  4F1P A;  3BG0 B;  3ZN3 A;  1TNO A;  3AG2 E;  3CGH A;  5EX0 A;  3CVP A;  1IXV A;  4HLE A;  4HOU A;  2AXU A;  1TNY A;  5G05 J;  4JVS A;  3FP3 A;  3CVU A;  5AIJ A;  3ISM C;  1O1T A;  3CEQ A;  2HYZ A;  1OT8 A;  2OEW A;  2UY1 A;  4AY6 A;  4RG9 A;  3SFY A;  3PRE A;  5KNH D;  2BKG A;  2GRR B;  1YCS B;  3FTY A;  4HFG A;  4HRM B;  4CEM A;  4N2Q A;  3UUX A;  2FO1 E;  3E30 A;  1FT2 A;  4ANX A;  4ZFH A;  4I43 A;  3ZHE B;  1QQE A;  4PS3 A;  3NZU A;  2B0O E;  2EIL E;  4B94 A;  2IU1 A;  4U8Y D;  1DCE A;  2FF4 A;  3CHM A;  3QK0 A;  4GYY A;  4CYM D;  3D9P A;  4BTA A;  1BU9 A;  4TXP A;  1Z5S C;  2ETA A;  3TWR A;  4I1M A;  4A3T A;  3HRA A;  4M7C A;  5CMY A;  5G05 C;  3EDT B;  3F6Q A;  2IEJ A;  3TG4 A;  2J8S D;  4JZY A;  4AV7 A;  2L9B A;  3UXG A;  4U95 D;  2R02 A;  5DBK A;  4V3I A;  4HXI A;  3PS6 A;  4HB5 A;  1V54 E;  1D9S A;  3ZIM A;  4LER A;  5FQ7 A;  2PM6 A;  3LVR E;  4IN3 B;  4F1S A;  2KXP C;  4LUN U;  1Z3X A;  3AU5 A;  4J8D A;  4O6F A;  2WM9 A;  3Q15 A;  3PE4 A;  2OND A;  1HFA A;  1HX8 A;  2PL2 A;  4KZC A;  3WG7 E;  4YDO A;  1UOH A;  4ILG A;  3D9H A;  2RG8 A;  3PUK A;  3ASG A;  3Q75 A;  5FWQ A;  1LD8 A;  3B7T A;  1NA0 A;  4DLQ A;  5ENR D;  1MYO A;  4F7A A;  1OCO E;  3N71 A;  2EIN E;  5AJL A;  4BT9 A;  3EU9 A;  4U0U A;  1FT1 A;  3DEO A;  3PZ2 A;  4YND A;  1GW6 A;  3CK7 A;  3V2O A;  2RFA A;  2YQ8 A;  3ULQ A;  2ZIR A;  2L0I A;  4EBA G;  1TN6 A;  4PS7 A;  5JHB A;  3L82 A;  4ANW A;  2FO7 A;  2MYO A;  1WM5 A;  2WXP A;  4GTV A;  4GB9 A;  2WQ6 A;  4ME2 A;  2VGY A;  1VDY A;  3OXL A;  1K8K G;  2X6H A;  2RD0 A;  2WXJ A;  4LSZ E;  3ASO E;  4J8Y A;  2YHE A;  5KWD A;  1AP7 A;  3QJZ A;  1WG0 A;  4F3V A;  5ITZ F;  1P5Q A;  4H7Y A;  5CCM A;  2FEZ A;  3MYV A;  3E32 A;  2ETB A;  2F37 A;  2AJA A;  1U3C A;  2KCV A;  4K5B A;  2DYR E;  3G2T A;  1BPO A;  5H7P A;  3S7F A;  2L0T B;  3O48 A;  3TWW A;  2H6F A;  4FHJ A;  5KJL A;  4XE0 A;  1N4R A;  4DI3 A;  3ZYM A;  4E6H A;  4XIF A;  2KC7 A;  4DX7 D;  3W9F A;  4GZC A;  3E33 A;  1PAQ A;  3BUA A;  3FTU A;  3RK6 A;  2WXQ A;  4DPR A;  4ANV A;  3PEU B;  4JB8 P;  3ASH A;  2VJ8 A;  1DCQ A;  2GRP B;  5HI7 A;  3QC1 A;  2R5S A;  4N3C A;  3EHN A;  1E7V A;  1N0Q A;  3QAQ A;  4B0Z A;  3TWV A;  1RW2 A;  4YDE A;  3FTZ A;  2BUG A;  3SY2 A;  2WXO A;  2VYI A;  2WMN A;  2OV8 A;  3TWU A;  4O60 A;  4I2W A;  2ETC A;  4IUL A;  4NQ0 A;  4JA9 A;  3FY4 A;  4APF A;  3TWQ A;  3PZ4 A;  1UJJ A;  1MX6 A;  2V8S E;  3D9L A;  3MV2 B;  1QZ2 A;  4AOF A;  4JL0 A;  5EIL A;  1NL4 A;  5G04 C;  4ILI A;  1O1S A;  4HOS A;  3FUM A;  4OVU A;  2F8X K;  3ML9 A;  3MZL B;  3ZYQ A;  5B1B E;  3JXJ A;  5KCM A;  4CGV A;  3SBS A;  2BTD A;  3FDH A;  2L6B A;  1A17 A;  1E7U A;  2VSX E;  3G2S A;  4UQX A;  4KBQ A;  1E8X A;  2ZIS A;  3ZYK A;  4TUU A;  4JHK A;  4BES A;  2OOE A;  2PQN A;  3HXB A;  1IHG A;  1HU3 A;  1NP7 A;  5AAR A;  1IYG A;  5LFA A;  2BKK B;  1NFI E;  3AG4 E;  3UM2 A;  4MS6 A;  4ABN A;  4GTQ A;  4XKB A;  3VTY A;  1XGW A;  2B6C A;  2J08 A;  3C98 A;  3HYM B;  1IHB A;  4I9C A;  5BXO A;  4F53 A;  5A7D B;  2IY0 C;  3C72 A;  1DC2 A;  5HQ8 A;  3PNT B;  4UI9 J;  3SO8 A;  2XGO A;  4J7W A;  1E8Y A;  3PNL B;  4MLP A;  1E8Z A;  1EDU A;  5ENS D;  1YA0 A;  3Q73 A;  2VGE A;  4U07 A;  3KS2 A;  4TV3 A;  4L2L A;  4FJY A;  1QNF A;  2XZD G;  1KZO A;  1UJK A;  4BET A;  5AQA A;  2DZN A;  1JCQ A;  2VTB B;  5LP0 A;  4FAD A;  5ARF A;  4KXK B;  4TXQ A;  3OXF A;  4DLO A;  2NXP A;  2JEK A;  2XRZ A;  4PH4 B;  2GRO B;  1BD8 A;  4A55 A;  2XPY A;  1Q2Z A;  3FEY A;  5D0Q D;  3HXE A;  4B8C B;  3D9K A;  5FQ4 A;  4A63 B;  4CDM A;  4FP7 A;  3GZ2 A;  3QNK A;  4I9E A;  2I2O A;  4RLY A;  4J8E A;  5FZQ A;  3FUF A;  2ZXW E;  3GZ1 A;  4N3A A;  4I1A A;  3APF A;  3LS8 A;  2X38 A;  3T8K A;  4I2Z A;  4HQD A;  5CEC B;  4KT6 B;  3KSL A;  5AAO A;  4HRN A;  1HH8 A;  2Y4U A;  2L6J A;  1SVX A;  1Y6I A;  2J49 A;  1UW4 B;  5E75 A;  4JD2 G;  3TG5 A;  3UT4 A;  2WB2 A;  1MQS A;  3C3Q A;  1JPL A;  3DSV A;  5D66 A;  4KMO A;  2BF0 X;  5EDS A;  4U0Z A;  5CMW A;  2V0P A;  3FWV A;  4HOR A;  1TNU A;  2P9L G;  3CQG B;  3AG1 E;  2R17 C;  2J09 A;  2F0Y A;  4BWR A;  1H2U A;  3MJW A;  3LY9 A;  3DPD A;  4DJA A;  3CR3 A;  4Q94 A;  2I9C A;  4HS2 A;  1XNF A;  3RKV A;  1BI8 B;  4U04 A;  3FTV A;  5AYW D;  3UT8 A;  1JUQ A;  3CVW A;  4I17 A;  2C2L A;  4WWP A;  1H6P A;  4TRQ A;  3ZEF A;  1H2T C;  5JA4 D;  2R59 A;  2I1J A;  2KM4 A;  3FTW A;  2V5Q C;  1BLX B;  2JAB A;  2WXM A;  2KZT B;  3SGH A;  5CRV A;  1ZU2 A;  2IF4 A;  2WXR A;  1H19 A;  4WNG A;  2XPI A;  4FUL A;  4X8Q A;  3JUI A;  1ELR A;  4U8V D;  3IEG A;  4UWK A;  2CHW A;  4ZHB A;  2LAH A;  3D9I A;  3EU5 A;  5AJD A;  5AN8 A;  2ZGD A;  5EX3 A;  4EBA A;  4I6E A;  4C9B B;  1LTX A;  4Q96 A;  5J08 A;  1AWC B;  4DX5 D;  3CVQ A;  3IHV A;  4G2V A;  4OAU C;  2XGS A;  3Q78 A;  4J8S A;  3RJV A;  1JCR A;  3KSQ A;  2QZA A;  1INZ A;  3UPV A;  3VLF A;  4UUC A;  5LCW J;  4Q69 A;  3QAR A;  4HBD A;  5ENP D;  2R03 A;  4UQZ A;  4CDR A;  3Q5M A;  3SF4 A;  2CFU A;  5C1D A;  3RRM B;  1MHQ A;  3KEA A;  4YVQ C;  4U7E B;  3L9T A;  1HO8 A;  4GTR A;  5FQ6 A;  3UT7 A;  1YMP A;  4PDX A;  3CK8 A;  5HKP A;  3HVE A;  1D8E A;  3D3M A;  4UWL A;  4ILH B;  2IFU A;  2P9K G;  4GTT A;  2E2E A;  2WVI A;  4A1G A;  4N2S A;  3LJN A;  1IQR A;  5EID A;  3OTN A;  3L08 A;  4DX6 D;  5CER B;  1E8W A;  3AS8 A;  1MJ0 A;  3PDN A;  4EZJ A;  3ENE A;  5EYL A;  3TXN A;  4CDN A;  1YYH A;  2LXM A;  4BSX A;  4G26 A;  3NOC D;  4JW1 A;  3LXU X;  3ZRH A;  4Z68 A;  3MCX A;  3R7Q A;  3VTX A;  3RAU A;  3LCA A;  4J6I A;  3LVQ E;  3MKQ B;  1N94 A;  3S7J A;  5M72 A;  4Y6W A;  3NF1 A;  4LEU A;  1UN8 A;  2NYJ A;  2WXH A;  4L9P A;  3AS4 A;  3FUD A;  4BX9 A;  1N4P A;  5AEN A;  3V79 K;  2IO3 C;  4G23 A;  3IKO B;  1Z6T A;  3FUE A;  5FJY A;  2OVB A;  1TYQ G;  5CBN A;  1FVF A;  3APC A;  4XKC A;  4ATZ D;  2H6I A;  3G2V A;  3NZS A;  4AJW A;  4BEP A;  4G25 A;  3TWT A;  2XEH A;  3FUL A;  3UM3 A;  3LY8 A;  3TWS A;  4LNB A;  4GCN A;  4BY6 A;  5AQ7 A;  4K03 A;  1TNB A;  2QC9 A;  1KZP A;  1N0R A;  1QBQ A;  2XHE A;  3TL5 A;  3ZHE A;  5B3S E;  4L1B A;  1K1B A;  1ELW A;  3O4Z A;  5ENO D;  3I4G A;  3FU5 A;  4ACK A;  4D10 C;  3CHO A;  4ANU A;  4GU5 A;  3PE3 A;  5JJT A;  2ZU6 B;  3W9G A;  4A3V A;  2WPV A;  1HG5 A;  2KCL A;  4JXT A;  4G8K A;  4GAA A;  2C0M A;  3CHP A;  5CEA A;  4K5C A;  3B7U X;  5EKQ D;  4EQF A;  1W3B A;  3UI2 A;  3MEK A;  2WQ7 A;  2PZI A;  2MRI A;  1OWN A;  3UM0 A;  3AJI A;  5HRY A;  4R7L A;  2J07 A;  5JHA A;  3Q49 B;  3ZU7 B;  3LDZ A;  5FZS A;  4DUI A;  2XGM A;  3CHR A;  5JJ7 A;  1N52 A;  2WXF A;  1JCS A;  3SBT B;  5ENQ D;  4TXR A;  3FH8 A;  4A1S A;  5CCL A;  3UIO C;  3CKC A;  2X6K A;  3GW4 A;  4C0M A;  4EZL A;  4E85 A;  4GPK A;  2IOL A;  4C0E A;  3C3R A;  3U66 A;  3FH7 A;  2P9U G;  1OWP A;  3D9J A;  3QDN A;  4U96 D;  2AW6 A;  2X3M A;  2YIN A;  1IKN D;  1O5M A;  4KVO A;  4WNF A;  2JLB A;  3QKY A;  3UTM A;  3UX4 A;  2P9P G;  2VSN A;  2P9I G;  3FUK A;  5CBO A;  5BPP A;  3LY7 A;  3CST A;  2DVW A;  4EHM A;  5G55 A;  4KYO B;  3C5R A;  4LRZ A;  3AS5 A;  4GTP A;  4FU3 A;  2DBA A;  3QWP A;  1H6O A;  2PQR A;  4K0R A;  3NB2 A;  3MKR A;  3FU6 A;  3CK9 A;  2Y3A A;  4AIF A;  2LSU A;  4JHR A;  3SFZ A;  2R05 A;  3JQ1 A;  4G24 A;  3PVL A;  3ZW3 A;  4DX1 A;  3FEX A;  2E0I A;  3D9M A;  2NC9 A;  1ZB1 A;  2GRN B;  5G04 J;  3MX3 A;  3RIB A;  2P58 C;  1NA3 A;  3DEP A;  3U9W A;  3OAW A;  5FQ8 A;  4AY5 A;  4XEI G;  4O1P A;  3DSU A;  4IRU A;  3ZKJ A;  3TGO A;  5J90 A;  2CHX A;  3AG3 E;  3ASN E;  3HXF A;  3R9A B;  1EF1 C;  1N4Q A;  4LNU D;  1UN9 A;  3CVN A;  4DRX E;  3ZPJ A;  2OEV A;  2A5E A;  3FU3 A;  3RRU A;  3WXX A;  3FUI A;  4FHK A;  5CED B;  4LG6 A;  3ESL A;  1WAO 1;  2LSV A;  4I1O B;  3DSS A;  3QB2 A;  4BTB A;  4C48 B;  1IQU A;  2WXN A;  1SZ9 A;  3ASF A;  1D8D A;  3ZXS A;  3CV0 A;  2I1K A;  3JXI A;  4GMR A;  3SHF A;  1NI1 A;  4BT8 A;  4NRH B;  2MOW A;  2GRM A;  1OWO A;  1X5B A;  2KBX A;  1OCR E;  1MZC A;  1N11 A;  4GYW A;  1TR4 A;  2Y1L E;  2XCB A;  2FI7 A;  1PY1 A;  3J5P A;  2HM8 A;  3JUE A;  3FHE A;  5BV0 A;  2BED A;  3SNX A;  3AU4 A;  3URZ A;  1H0A A;  3JQ0 A;  1B89 A;  3V30 A;  2OCC E;  1N4S A;  5LOZ A;  3Q9U C;  1FPP A;  5BV1 A;  4GZD A;  3OXG A;  3UM1 A;  3PZD A;  4WWN A;  2X6J A;  3QWW A;  1L5J A;  3IXE A;  1HF8 A;  4CGW A;  3CVV A;  4HNA D;  2XPZ A;  2AXZ A;  3ZNG A;  4JPS A;  2X6F A;  3LJ3 A;  3CKB A;  4XX5 A;  4HRL A;  4N5Q A;  4OAV B;  3ONK A;  2R2L A;  4QQI A;  2QY7 A;  4N5C A;  3LPZ A;  2WMO A;  2VSY A;  2LAI A;  2GRQ B;  4NAC A;  3FUN A;  5JJ6 A;  3R7R A;  4N3B A;  2DIW A;  4MBG A;  2Y0B G;  2QFC A;  4KVM A;  3B7R L;  5AQB A;  3C3O A;  3G2U A;  3PEV B;  1E96 B;  2QYU A;  5CRU A;  2V4H C;  5EYP F;  1QYM A;  4APO A;  2IOS A;  5EN5 D;  5B1A E;  2P2C P;  3Q7A A;  1KT0 A;  3BQO A;  3ZYL A;  3APD A;  3SQV A;  3IHY A;  3Q47 B;  2M63 A;  3U4T A;  3SZ7 A;  3EIQ C;  3FFL A;  2VSO E;  2YNQ A;  3FUH A;  3DRA A;  4UQY A;  4GTS A;  1TJF A;  1UG3 A;  2AWI A;  4BSZ B;  2I6H A;  4QFV A;  5AQ9 A;  4IYP A;  1V55 E;  3ZUV B;  3CSF A;  4LNG A;  2EIM E;  4EEC A;  4FJZ A;  4RSY A;  1U3D A;  1MX2 A;  3V31 A;  1HZ4 A;  2WXI A;  3TAX A;  4CT4 A;  1SA4 A;  4GMJ A;  3BU8 A;  3D9N A;  3ZXP A;  4WAF A;  3EHQ A;  4AP2 A;  5BUZ A;  5KNG A;  3ONL A;  3ZVV A;  4XI0 A;  4UI9 C;  3PRZ A;  5EIB E;  5ANR A;  1Z3Y A;  2Y4T A;  4RQI A;  4I6G A;  1DVP A;  3LYA A;  3T9K A;  1LF8 A;  1OY3 D;  2CHZ A;  2F8Y A;  3DSW A;  3HHM A;  4CCA A;  5CHE E;  2CFZ A;  4M3O A;  3IBE A;  3S7D A;  3DXK G;  5D2M C;  5D0O D;  3K9I A;  1OUV A;  1SW6 A;  3UIP C;  3GYZ A;  3CIA A;  2DZO A;  4L23 A;  4JA7 A;  1MX4 A;  4WND A;  2Q7F A;  4K5A B;  1U2V G;  4GA2 A;  4YDY A;  3EJN A;  3Q4A B;  1HS6 A;  3RU0 A;  5BT1 A;  4FLH A;  4FLB A;  3EIJ A;  3PUJ A;  3FTX A;  3PZ3 A;  4EZK A;  4NUR A;  3EUV A;  1ELK A;  3KEZ A;  3T8M A;  3U3W A;  4MKT A;  3E34 A;  3L22 A;  2UWJ G;  1LD7 A;  3P1U A;  5KJK A;  2LNI A;  3DSX A;  3Q9N C;  3SFX A;  4WUY A;  3DPY A;  5IY5 E;  3HG0 D;  5FIN A;  1WY6 A;  4FA6 A;  1JWG A;  4TUM A;  2YHC A;  4B8A A;  3ZFW A;  4U0S A;  2PM7 A;  2A4Z A;  3TJP A;  1G3N B;  2XCC A;  4YVO A;  1HXI A;  3PH0 C;  1DNP A;  4GZ3 A;  3UKU G;  1EYH A;  4HVB A;  5G2N A;  3ESK A;  4L2Y A;  2EIK E;  3BEE A;  1TNZ A;  4WNE A;  2A5U A;  4BFR A;  3I3N A;  3ASD A;  3TXM A;  4JC8 A;  4P29 A;  3FU0 A;  1FVH A;  1FCH A;  3ABM E;  3HVE B;  3UKR G;  1HG2 A;  3EHM A;  1EPU A;  3T5V A;  3VLD A;  1HE8 A;  2GGF A;  3U64 A;  2GRL A;  3RRN B;  2XEE A;  3LEW A;  4GA0 A;  4F6R D;  1K3Z D;  3P2B A;  1SZA A;  2WXL A;  4CRW A;  4JEU A;  1H2V C;  2KZT A;  5LCW C;  2ION A;  3HDX A;  4O1O A;  3B95 A;  1RZ4 A;  4GCO A;  3S7B A;  4AVX A;  5DIZ A;  2J4B A;  3L17 A;  4CT0 A;  4U63 A;  1JWF A;  3SI5 A;  3MKQ A;  2FBN A;  3ZGQ A;  4UI9 K;  2GW1 A;  3RO3 A;  5E76 A;  4B93 B;  3NAW A;  2DYS E;  2XRY A;  3JYS A;  2J4D A;  1E90 A;  3ABK E;  2VQ2 A;  4BX8 A;  4PUC A;  4GZ5 A;  4UWH A;  4KZ0 A;  5ARG A;  3ULE G;  3MV3 B;  1BI7 B;  1S0P A;  3QWV A;  2UY1 B;  1OXJ A;  5FT9 A;  3EHR A;  5C2Y A;  4HOQ A;  2J9Q A;  4JHJ A;  2LO6 A;  2IJG X;  3B7S A;  4DX2 A;  4WWO A;  5KBA A;  3PZ1 A;  4YDW A;  4XI9 A;  4HI8 A;  1SQM A;  4U8H A;  4HI9 A;  4G1T A;  2HR2 A;  3L16 A;  4GZ6 A;  3E37 A;  5KJN A;  2CG2 A;  3ABL E;  4LCT A;  3L6A A;  4FC8 A;  4I6J A;  3D9O A;  2OVF A;  3G2W A;  4GML A;  1PC2 A;  1Y8M A;  4Y6C A;  1OWL A;  4GTM A;  3HXD A;  4NIK A;  4JEH A;  2DWZ A;  2XZT G;  3CHQ A;  3DBS A;  1KLX A;  1TJC A;  1SA5 A;  3QOU A;  4ATG A;  1ZBP A;  3UQ3 A;  5BXU A;  3LKU A;  3FH5 A;  5ANL A;  1WDY A;  4J8F A;  3UMV A;  2LXL A;  3CHS A;  4HOT A;  4AXH A;  2LUH A;  2IO2 C;  4UWF A;  3Q79 A;  3DST A;  2AVP A;  2XS1 A;  4CZ2 D;  4EPZ A;  3RSE G;  4HLL A;  1X81 A;  3MA5 A;  3AAA C;  2IQC A;  1OWM A;  2WXG A;  5BW8 C;  1TEZ A;  2VGX B;  4GTO A;  5A23 A;  4OYS A;  2V5F A;  2P9N G;  3X2Q E;  3CVY A;  2EQX A;  2QYJ A;  5T8I A;  2H6G A;  2AXV A;  1KT1 A;  5BNW A;  4DI4 A;  3B13 A;  4L7T A;  4GPM A;  2C0L A;  2XQ0 A;  3I4R B;  3ULY A;  3B7B A; 
#chains in the Genus database with same CATH homology
 4QFV A;  5AAO A;  4U8Y D;  5ENT D;  5AQ9 A;  4HRN A;  2XEN A;  4O1P A;  1DCQ A;  2XEE A;  5HS0 A;  3ZKJ A;  4F6R D;  1K3Z D;  3AJI A;  3EU9 A;  5HRY A;  3ZUV B;  1SVX A;  2NYJ A;  3DEO A;  3IXE A;  1IHB A;  3ZU7 B;  4CYM D;  4UUC A;  5BXO A;  4HNA D;  4DUI A;  4LNU D;  1BU9 A;  3V2O A;  2RFA A;  4DRX E;  3V79 K;  1DC2 A;  1MX2 A;  3ZNG A;  3NBN B;  4HBD A;  5ENP D;  3V31 A;  1N0Q A;  4NIK A;  5D66 A;  4BER A;  5FIO A;  3TWV A;  2ETA A;  5ENQ D;  4HRL A;  2A5E A;  4N5Q A;  3B95 A;  4O1O A;  3SO8 A;  3TWR A;  4OAV B;  3TWX A;  2DWZ A;  4J7W A;  2XZT G;  3Q9N C;  4QQI A;  2PNN A;  5CBN A;  3HRA A;  3HG0 D;  5CED B;  4LG6 A;  3TWU A;  3NOG D;  4O60 A;  4F1P A;  2MYO A;  3EHQ A;  4ATZ D;  2ETC A;  3F6Q A;  5ENS D;  5FIN A;  5KNG A;  2VGE A;  5EIB E;  2J8S D;  4U96 D;  3TWQ A;  1IXV A;  4TUM A;  3KEA A;  5JMN D;  4BEP A;  1MX6 A;  4C48 B;  1IKN D;  2XZD G;  5BXU A;  2RFM A;  2Y0B G;  3TWT A;  2XEH A;  3UTM A;  4BET A;  4LSZ E;  4B93 B;  5AQA A;  3UXG A;  1WDY A;  4U95 D;  5EIL A;  1BI8 B;  1G3N B;  2DZN A;  4J8Y A;  5CBO A;  3T9K A;  1YMP A;  5KWD A;  5AQB A;  1OY3 D;  2DVW A;  1AP7 A;  2F8Y A;  3TWS A;  1WG0 A;  5HKP A;  5ITZ F;  5AQ7 A;  2QC9 A;  2V4H C;  3JXI A;  4GMR A;  5EYP F;  2F8X K;  1N0R A;  1QYM A;  3C5R A;  1S70 B;  5JA4 D;  4CZ2 D;  1OT8 A;  4HB5 A;  2V5Q C;  2ETB A;  3LJN A;  2AJA A;  1BD8 A;  1BI7 B;  1BLX B;  1K1B A;  2F37 A;  3JXJ A;  4HLL A;  2JAB A;  4K5B A;  2KBX A;  5EID A;  5EN5 D;  5KNH D;  3AAA C;  2BKG A;  1SW6 A;  2P2C P;  5ENO D;  2L6B A;  1A5E A;  2DZO A;  2KXP C;  3TWW A;  4DX6 D;  5CER B;  2ZGG A;  1N11 A;  1YCS B;  1K1A A;  1MJ0 A;  1MX4 A;  1TR4 A;  4HRM B;  4A63 B;  2Y1L E;  2QYJ A;  3J5P A;  2HE0 A;  3EHR A;  4K5A B;  4U8V D;  1D9S A;  2FO1 E;  5EYL A;  3JUE A;  4RLY A;  4ZHB A;  4BES A;  1YYH A;  1UOH A;  3D9H A;  5AN8 A;  2ZGD A;  4DX7 D;  3W9F A;  3W9G A;  4DX1 A;  4DX2 A;  5KBA A;  3NOC D;  4GPM A;  5AAR A;  4ZFH A;  4YDW A;  1AWC B;  4YDY A;  4DX5 D;  4HI8 A;  4G8K A;  5CEA A;  4BSZ B;  4Z68 A;  4K5C A;  3T8K A;  4G8L A;  4HI9 A;  3V30 A;  2BKK B;  2B0O E;  1NFI E;  3B7B A;  5ENR D;  3Q9U C;  4HQD A;  3V2X A;  3UI2 A;  4OAU C;  5CEC B;  4JB8 P;  3DEP A;  3J5Q B;  1MYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...