3Q9UC

In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
157
Chain Sequence
FGQDLGKKLLEAAAAGQDDEVRILMANGADVNATDDNGLTPLHLAAANGQLEIVEVLLKNGADVNASDSAGITPLHLAAYDGHLEIVEVLLKHGADVNAYDRAGWTPLHLAALSGQLEIVEVLLKHGADVNAQDALGLTAFDISINQGQEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CoA binding protein
publication title A de novo protein binding pair by computational design and directed evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding, de novo protein
total genus 45
structure length 157
sequence length 157
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3q9uC00
3V2XA 3ZUVB 5CBOA 4BERA 5JA4D 3HRAA 4F6RD 2XEEA 5CBNA 5KBAA 4TUMA 2L6BA 5ENOD 4BEPA 3B95A 4DX7D 4DX1A 1WDYA 3ZKJA 5EIDA 3W9GA 2ZGGA 1N11A 1SVXA 1YCSB 5JMND 2DVWA 4DRXE 3V79K 1S70B 4ZFHA 2XZDG 3EHRA 2ETBA 3HG0D 4HBDA 5CERB 3V2OA 3J5QB 3KEAA 4J7WA 5ENSD 2AJAA 4N5QA 5EYLA 5ENTD 1SW6A 1YMPA 1YYHA 4G8LA 4O1PA 2DZOA 4U8VD 4HB5A 4YDWA 5AARA 3F6QA 3J5PA 3V30A 4BESA 4DX5D 2Y1LE 3LJNA 2RFAA 2XENA 4O1OA 5CECB 1A5EA 3DEOA 5AQ9A 5ITZF 3T9KA 1QYMA 4OAVB 4Z68A 4LSZE 3TWWA 1K1AA 4YDYA 4CZ2D 2F37A 3JXIA 1NFIE 1IXVA 3TWRA 2Y0BG 5KWDA 3TWQA 5BXUA 1K3ZD 4J8YA 4QFVA 2BKGA 1BU9A 2HE0A 3UTMA 2RFMA 4LG6A 1DC2A 4G8KA 3V31A 3Q9UC 2ETAA 3W9FA 1K1BA 4ATZD 4A63B 2DWZA 5EIBE 3DEPA 5EYPF 4K5CA 2V4HC 5FIOA 2QYJA 4K5AB 3AJIA 5AAOA 5FINA 2PNNA 4CYMD 5HKPA 4HRMB 3EHQA 3JUEA 4B93B 2A5EA 3UXGA 3B7BA 3D9HA 3C5RA 4LNUD 5ENQD 2V5QC 2BKKB 1IHBA 5CEDB 2QC9A 2ZGDA 1G3NB 4U8YD 3T8KA 3UI2A 1OT8A 2F8XK 2ETCA 4BSZB 1N0QA 1D9SA 1WG0A 1OY3D 2NYJA 1DCQA 2XZTG 4DX6D 5CEAA 3TWTA 4ZHBA 1MYOA 4HI9A 4F1PA 4U95D 2F8YA 5AQBA 2P2CP 3ZU7B 5KNGA 1IKND 2KBXA 5D66A 3TWSA 5BXOA 4BETA 1MX2A 4QQIA 4GPMA 2VGEA 3Q9NC 3TWXA 1BLXB 1AP7A 3NOCD 5ENRD 2MYOA 1UOHA 3ZNGA 1BD8A 4HI8A 2B0OE 5EILA 1MJ0A 4U96D 1TR4A 4HQDA 4O60A 1MX4A 1N0RA 5HRYA 2KXPC 4GMRA 3AAAC 4JB8P 2JABA 4HRLA 5ENPD 4DUIA 4K5BA 2FO1E 3TWUA 5EN5D 5KNHD 1AWCB 4HLLA 1BI7B 3SO8A 4DX2A 2DZNA 3JXJA 4HNAD 4HRNA 4C48B 5AQ7A 3NBNB 2XEHA 4OAUC 3IXEA 5AN8A 3TWVA 3NOGD 5HS0A 4NIKA 1MX6A 4UUCA 4RLYA 2J8SD 5AQAA 1BI8B 3EU9A
chains in the Genus database with same CATH superfamily
2BTDA 3ZYLA 4EBAA 2WXQA 2XEEA 4GZDA 4GA0A 2BEDA 3UT4A 3DXKG 4PH4B 2GRLA 4TXRA 4UWGA 2IO3C 3J5QB 2AJAA 4L1BA 1YMPA 4ANWA 3V30A 2E2EA 3C3QA 1P5QA 4LNGA 3UUXA 2Y1LE 2XPZA 4CDMA 1IYGA 5EX0A 3CHOA 4OAVB 4GYYA 3UPVA 3PH0C 3Q5MA 4QFVA 1TJFA 5FZRA 2EINE 1ELWA 2IOSA 2LAIA 2IQCA 4G2VA 3ZHEB 3ZIMA 4GMJA 4HRMB 5T3RA 3EHMA 4LNUD 1JWGA 2BKKB 2ZGDA 3T8KA 4A1SA 5B1AE 1EYHA 5LFAA 2UWJG 4I1AA 1ZB1A 4ATGA 4YDEA 4XEIG 2P2CP 3CGHA 3BQOA 2J4BA 1MX2A 3CHSA 3HVEB 4AVXA 4GMRA 4I43A 2UY1B 5BPPA 2JABA 5CCMA 5M72A 1U3DA 4K5BA 3S7DA 3RO2A 4HNAD 3C3RA 1O1SA 3UM0A 4NIKA 2WXIA 4WWOA 3CVLA 5JA4D 4L23A 3Q75A 5AJDA 2X6FA 3R9MA 4DPRA 4GTSA 4RG6A 5T4YA 5EIDA 2DYRE 3TAXA 4DRXE 3UM3A 4EHMA 5ENSD 5ENTD 2WXRA 3L13A 3Q73A 3I4RB 4HB5A 4KVOA 4JEUA 5CECB 1K8KG 4Q69A 3E32A 5ITZF 4YDOA 2XGOA 3DSUA 3AS8A 3Q49B 3B7RL 3ABME 2F37A 3UT7A 3JQ1A 2XCBA 2X6JA 4N3CA 3CHPA 3O48A 4CDRA 4A63B 2WM9A 3K9IA 2AWIA 1TNOA 3EHNA 2QFCA 3FH5A 2XCCA 3KAEA 1H6PA 1DNPA 3CHQA 3GZ1A 3IEGA 1L5JA 5D66A 3FUFA 3FTYA 2WXJA 3LCAA 5D0OD 4ACLA 4U96D 3DRAA 4O60A 1DVPA 3TGOA 3IHYA 4UQZA 4HS2A 3HIZA 4UI9C 5EN5D 4UQYA 2LXLA 2PM7A 4IRUA 4FULA 2OEVA 4AEZC 4GU5A 3UX4A 4D10C 2XEHA 4WNFA 3NQPA 1SQMA 3SFZA 4E6HA 2IEJA 3ABLE 5HQ8A 5LP0A 1JWFA 3PEVB 3PZDA 5CCLA 4JW1A 1UG3A 3DSTA 2XHEA 2I1JA 3IV0A 1LF8A 5BT1A 5CMWA 1S63A 1SW6A 2WXGA 1E7UA 2WXLA 3F6QA 3FTUA 4UQXA 2AW6A 2QZAA 3TXNA 2WB2A 3WG7E 3KEZA 4X8QA 2QYUA 2BF0X 2P9SG 1K1AA 4CZ2D 4CGWA 2IONA 3B13A 5D0QD 5KWDA 1FT1A 3FTSA 2DYSE 2CHWA 2WVIA 4HVBA 5H7PA 1H19A 2F0YA 4CYMD 5HKPA 2LSVA 1N95A 2P9PG 3AU4A 4WNGA 2ETCA 1GW6A 2YHCA 5A7DB 4U07A 2CHXA 5ARGA 1IHGA 3RAUA 2MYOA 2VSYA 3R7QA 3RU0A 3SNXA 1S64A 4A3VA 4HRLA 2FI7A 4JHJA 3TWUA 3CQCB 3JUIA 4FADA 1SZ9A 3NBNB 2R2LA 4G23A 2C0LA 4AXHA 3C72A 4P29A 2V8SE 2P9LG 2KZTA 1ELRA 3U4TA 4GMLA 3TJPA 2HYZA 2OCCE 4FJZA 2XZDG 3PS6A 1YYHA 3D9OA 3PZ4A 4PS8A 1PY1A 3EJNA 1OUVA 2YINA 2PZIA 4BTAA 4MLPA 2Y0BG 3CVNA 3E34A 2HE0A 3HXEA 4DI3A 5ANLA 3E4BA 4IYPA 3RRNB 3E33A 3I5PA 3LKUA 3AJIA 1TNUA 4U04A 2WQ7A 4J8EA 3RRMB 1FVHA 1ELKA 2V5QC 4K03A 1HE8A 1QZ2A 4ME2A 5G04C 3ENEA 3D3MA 1MQSA 3SQVA 2XQ0A 3CVQA 4HOQA 3D9JA 3NAWA 4HXIA 4AIFA 3URZA 4DLOA 1IKND 4ILHB 4AM9A 1QQEA 3KSQA 4B89A 4BT9A 1N0RA 2LNIA 3APDA 3FTZA 2FO1E 1U2VG 3OXLA 4JA7A 1TNBA 3KSLA 4HLLA 3ZXPA 1Z3XA 3IXEA 3FUNA 3B7UX 4GTTA 2C0MA 1ZBPA 3DSSA 3RIBA 4UI9K 2KZTB 3LVRE 4EQFA 3FEYA 2OOEA 4DX1A 1N4SA 4FC8A 3NZSA 4F1SA 3HXBA 2AVPA 3V79K 4HOUA 4WAFA 5JJ6A 3VTYA 3QWVA 4N5CA 5FJYA 4TV3A 4GZ6A 5C1DA 2KCLA 4RQIA 1IQUA 4JZYA 3UM1A 1UJJA 3PRZA 4HORA 3UTMA 1D8EA 5KCMA 1DCEA 3T5XA 3CHMA 3PE4A 4EPZA 4K5CA 3ASOE 2V4HC 1MHQA 1TN8A 2WXHA 5BNWA 1EPUA 4BY6A 2ZIRA 3TG5A 3BG1B 4DI4A 3DSWA 2EIME 3LVQE 3ULYA 2GRPB 2NXPA 1HFAA 3D9KA 4GTOA 4KBQA 3R7RA 3FY4A 1HZ4A 3ZVVA 2IOLA 1BI7B 1TNYA 5ARFA 4C48B 3S7JA 4Y6WA 1MX6A 4RLYA 1QBQA 4L7TA 3ASDA 4UWHA 4H7XA 3QARA 2GRMA 2MOWA 3B95A 3D9PA 1S0PA 3HYMB 2ZGGA 3RO3A 4YVQC 2CG3A 3EHRA 2WXMA 5CERB 2WQHA 4N5QA 5DBKA 3CK7A 3RRUA 2R59A 2C2LA 3ABKE 2I9CA 2VSNA 4U7EB 3T9KA 1NI1A 4Z68A 3MEKA 5KJNA 2A4ZA 3KD7A 4XIFA 4CRWA 3KS2A 3Q9UC 2CFUA 2ETAA 1OXJA 2JLBA 2L6JA 2I6HA 1KZOA 2VGXA 2QY7A 3CK8A 2NC9A 4NQ0A 2PNNA 4WWPA 2QC9A 3FTVA 4BSZB 3APCA 1UJKA 3QWWA 1N52A 4C0MA 4DX6D 4ZHBA 1MYOA 3MYVA 4F1PA 4LEUA 4UWLA 2V5FA 5BXOA 3FU0A 4HFGA 4GCOA 1H2TC 2Q7FA 1N4RA 5E75A 3PREA 3ZN3A 2PQNA 3MA5A 3SO8A 1E96B 3U9WA 2J49A 4U0UA 4JD2G 3TG4A 4UUCA 2EQXA 2VGYA 1LD7A 5CBOA 5B3SE 4BERA 2FBNA 4KZCA 3VLDA 5ENOD 2B6CA 3CR3A 4O6FA 3T8MA 5AIJA 3ZKJA 3W9GA 1TN7A 1S70B 3ZFWA 1O1RA 3CVPA 3UINC 1LD8A 3SBTB 4BESA 3SF4A 4L2LA 4GTQA 3P2BA 4FHKA 2WXFA 3HXFA 3MGBA 3FTXA 3PNTB 4XKBA 4APOA 2NSZA 3Q78A 3PE3A 3EIJA 1WAO1 2M63A 1Y8MA 2VGXB 5CRUA 1HXIA 1E8YA 4KT6B 4FHJA 3QKYA 2R05A 4JL0A 3LY8A 4IULA 2LAHA 5CRVA 4U95D 5G05J 4Y6CA 2Y69E 3D9MA 3LEWA 4QQIA 3MKRA 3TWXA 4GB9A 1KLXA 2E0IA 1UOHA 3CV0A 4AY5A 3L17A 4CEMA 2DCPA 3QAQA 1EF1C 2LO6A 3B7TA 3JXJA 3QC1A 3AS4A 4G25A 3S2AA 1E8XA 2J8SD 1BI8B 3EU9A 4RVBA 3ZUVB 4XI9A 2P9IG 4V3IA 4FJYA 1H6OA 3D9LA 3EIQC 1XGWA 5ENNA 3ZYKA 1V54E 3CIAA 1E7VA 3SZ7A 5LCWJ 1A17A 4J7WA 3SBSA 3AU5A 4GYWA 5DIZA 2J4DA 3CSFA 4O1PA 2DZOA 1H2UA 2XENA 4LRZA 1H6KA 5FQ4A 2GGFA 1OWLA 4GYOA 1H0AA 3G2TA 4GTRA 1OWOA 2V0PA 3PVLA 4ABNA 2WMNA 2LUHA 4KXKB 5A23A 1HF8A 2WXPA 1KT0A 4I6EA 3ZYQA 1INZA 4LNBA 1X5BA 4G24A 2F8XK 3SFYA 4XE0A 1D9SA 2P9KG 3SFXA 1NP7A 4MBGA 4OVVA 2NYJA 5CEAA 3ASGA 4HI9A 1WM5A 5AQBA 3T5VA 3FUDA 4J6IA 4FLBA 3L9TA 1Z5SC 4J8SA 1BD8A 4L9PA 5EILA 2OEWA 3NZUA 3G2SA 2KXPC 1N94A 5ENPD 3LY9A 1JCRA 3SY2A 3E37A 2CFZA 4OAUC 5D2MC 2DIWA 1N54A 1HO8A 2XRZA 4GZ3A 4XI0A 4YVOA 2RG8A 1N11A 2DVWA 4ZFHA 3QWPA 4PS3A 2PL2A 3FUMA 4U8VD 3ZEFA 2KCVA 3FWVA 2IFUA 3GZSA 3OXGA 2RFAA 4BSXA 3FTWA 4PUCA 3B7SA 5B1BE 5E76A 3DXMG 4LSZE 4DK5A 4UI9J 3TWQA 4BWRA 3MX3A 3UIOC 4G26A 3FHEA 1OWPA 3UMVA 4AY6A 4F7AA 3QK0A 3SI5A 4L2YA 5FT9A 3Q79A 5JJ7A 4K5AB 2OVBA 1HX8A 3NB2A 4JVSA 4A55A 2A5EA 4U8YD 1W3BA 2WMOA 1WG0A 2VQ2A 3JQ0A 2F8YA 5KNGA 4ANVA 2HO1A 3CKBA 5FQ8A 1QNFA 4N2SA 4WNDA 2AXVA 4DUIA 4M7CA 3HXDA 3OAWA 5BV1A 1TNZA 1TEZA 3AG4E 4GTMA 3S7BA 5T8IA 3L08A 4TXPA 1N4PA 3HHMA 4YDWA 4N3BA 2LSUA 3GYZA 2L0IA 1HG2A 5KBAA 4RG9A 3I3NA 4B8AA 3L6AA 2GRNB 2X3MA 3PZ1A 2XEVA 3V2OA 4WWNA 4CT4A 3G2UA 3FDHA 5EYLA 2ZISA 4ANXA 4GZCA 5J08A 3VTXA 4W9RA 4I6GA 1NFIE 1JCQA 1K3ZD 1TJCA 2FF4A 3DPDA 5KJMA 3ULQA 3JYSA 5AJLA 4ANUA 1DC2A 2GROB 3DBSA 5EYPF 4WUYA 1B89A 4OVUA 1V55E 4A1GA 2IF4A 4ILIA 2X38A 3FH8A 1IHBA 1OT8A 4GTVA 4E85A 1OY3D 3ML9A 2R5SA 3TWTA 1SA4A 3HXCA 3PUKA 3ZU7B 2VGEA 3Q9NC 2Y4TA 3NOCD 4MKTA 3UKRG 3CVXA 1MX4A 2EIKE 3WXXA 3HDXA 5KNHD 3ZGQA 4XKCA 4DX2A 4HRNA 5AQ7A 3TWVA 5HS0A 3DWLG 3D9IA 2AXUA 3PEUB 5AQAA 4EZLA 2OVFA 3CHRA 1BPOA 4F6RD 5FZSA 3S7FA 3CLJA 1YCSB 2XGSA 5G04J 2FO7A 3SD5A 4R7LA 2PM6A 3FFLA 3FUHA 3ZHEA 4N2QA 1WY6A 1NA3A 1FCHA 4DX7D 3ASHA 2DBAA 3NF1A 4U0SA 3RSEG 4LERA 5AQ9A 1QYMA 5CMYA 3DSXA 2XS8A 4GCNA 3TWWA 4F3VA 2VTBA 2ILRA 3TWRA 2WXOA 4EZJA 3HVEA 4TXQA 2H6GA 4HOTA 1E8WA 2X6HA 2J9QA 3QJZA 3RKVA 2I1KA 1RZ4A 3G2VA 1N0QA 2P9NG 3ISMC 4J8FA 1PC2A 4G1TA 5KJLA 4PDXA 3CVUA 4HQDA 3AAAC 3FUIA 4RSYA 3N71A 4JEHA 1FT2A 1Z6TA 5G05C 4I2WA 4BT8A 3ASNE 4I1OB 4Q96A 3ZW3A 3HRAA 1HS6A 5CBNA 4BEPA 4PS7A 3RJVA 5JMND 1N9AA 3PUJA 3UM2A 3HG0D 4HBDA 5BW8C 1IQRA 2IY0C 2YNQA 3BU8A 4CT0A 4J0UA 4FA6A 4GA2A 3TL5A 1Z3YA 1HU3A 2FULA 3Q7FA 4JC8A 5LCWC 3ZXSA 2MRIA 2VTBB 2FEZA 2RFMA 1LTXA 4MS6A 1K1BA 5FQ6A 4GAAA 4BTBA 2PQRA 3UKUG 4B93B 3ESKA 4GPKA 2CHZA 2IO2C 2RKKA 3O4ZA 2CG2A 4KVMA 5BV0A 3TXMA 3ASFA 3LJ3A 3FP3A 3Q47B 3CVYA 4TUUA 3BUAA 3FU5A 5EKQD 3PZ2A 4BX8A 3FU6A 4URKA 5FWQA 1N4QA 2GRRB 3PZ3A 5LX8A 4A3TA 1KPSB 3CQGB 4DJAA 1UN8A 5IY5E 3R9AB 2H6HA 5J90A 4HLEA 3CK9A 3QDNA 2VJ8A 2XPYA 2H6IA 3LS8A 2L6BA 3C3OA 1OCCE 3MJWA 3Q7AA 5G2NA 3Q4AB 4XZ4A 4KYOB 3CVVA 4JXTA 3L16A 4I6JA 3CVWA 3BG0B 3J5PA 2KC7A 3DPYA 4O1OA 1A5EA 4B8CB 1X81A 2WPVA 1E90A 3ZRHA 3ONKA 1BU9A 2HR2A 4G8KA 3V31A 4I9CA 2DWZA 4AP2A 4U63A 3FUKA 2QYJA 3APFA 3BEEA 4CDNA 5AAOA 3AG3E 5FINA 2JEKA 1FPPA 3UI2A 4FLHA 1EDUA 4B94A 1FVFA 4KMOA 1SA5A 1DCQA 3ZYMA 4U0ZA 1TYQG 1KT1A 3AG2E 3I4GA 4F53A 4UWFA 4IN3B 4HI8A 3GZ2A 4JB8P 2VSOE 5LOZA 3CSTA 3ESLA 3ULEG 4I9EA 4AV7A 2R03A 4AJWA 3L54A 4U8HA 3NOGD 2XGMA 2RD0A 4C9BB 1E8ZA 3V2XA 3LY7A 5EX3A 1NA0A 1HH8A 1NL4A 2P9UG 3LDZA 1WDYA 4FU3A 4LUNU 1JPLA 1Q2ZA 5AENA 3L22A 3UT8A 5BUZA 3FU3A 2Y3AA 5C2YA 3AG1E 5CHEE 2VYIA 5AARA 2X6KA 5JJTA 4GZ5A 2LXMA 5FQ7A 5FZQA 3JXIA 2YHEA 2XRYA 4NURA 2V4LA 4WNEA 3Q15A 1Y6IA 2X6IA 3L82A 3LPZA 1U3CA 4CGVA 4JA9A 3PDNA 1MZCA 3VLEA 4ACKA 4EZKA 3EUVA 3FUJA 3JUEA 3MCXA 3C5RA 3OTNA 1NZNA 4G11A 2XZTG 4EECA 3VLFA 4BX9A 2HM8A 3MKQA 1AP7A 2EILE 1H2VC 3CEQA 4N3AA 2R17C 1OCZE 3FH7A 1HG5A 4K0RA 3GW4A 2KM4A 1D8DA 2Y4UA 2DZNA 4BFRA 1OCRE 4EBAG 2H6FA 2J09A 4I17A 2J07A 1OWNA 4JHKA 3E30A 3G2WA 3EDTB 3X2QE 3SGHA 4KZ0A 1SVXA 3SHFA 3CKCA 3JCKC 3IBEA 1PAQA 3KEAA 4UWKA 3QNKA 1RW2A 1XNFA 4DX5D 3LJNA 4CCAA 2IU1A 3LYAA 3MZLB 4TRQA 3U64A 4FP7A 4YDYA 4JPSA 1IXVA 5BXUA 1OWMA 1VDYA 1UW4B 4LG6A 2VSXE 2ZU6B 3W9FA 2AXZA 4C0EA 3P1UA 4I2ZA 1OCOE 1JUQA 1UN9A 2GW1A 3AS5A 3QOUA 5ENQD 2IJGX 1G3NB 2WXKA 3EU5A 2XS1A 4APFA 5HI7A 1SZAA 5AYWD 3MV2B 4BETA 4GPMA 4GA1A 5ANRA 5ENRD 3ZPJA 4N39A 5A6CA 2B0OE 3MKQB 4M3OA 5G55A 5EDSA 3C98A 3UQ3A 4MRUA 4XX5A 3FULA 2WQ6A 2EIJE 1AWCB 4JHRA 4J8DA 3RK6A 5AN8A 1ZU2A 5KJKA 2A5UA 2J08A 4NACA 2L9BA 5JHBA 5FTPA 3LXUX 3PNLB 4TUMA 4ILGA 1KZPA 3U3WA 3UIPC 4Q94A 4AOFA 4DLQA 1O5MA 2P58C 3MV3B 2ETBA 3OXFA 2R02A 4I1MA 4G8LA 2MHKA 4B0ZA 3ONLA 1TN6A 2L0TB 2WXNA 4YNDA 2KCKA 3DEOA 2OV8A 2XPIA 3U66A 3DSVA 4J8YA 2I2OA 2BKGA 2YQ8A 2ZXWE 3FEXA 5EIBE 4ATZD 4LCTA 1YA0A 3DEPA 5FIOA 3ML8A 3QB2A 3IKOB 2KATA 3EHQA 3UXGA 3B7BA 3D9HA 2BUGA 4OYSA 2GRQB 5CEDB 2KBXA 3TWSA 4H7YA 3D9NA 4GTPA 1BLXB 5JHAA 1JCSA 3ZNGA 2UY1A 1MJ0A 5HRYA 1TR4A 3FUEA 3IHVA 1O1TA 2ONDA 4NRHB 4HOSA
chains in the Genus database with same CATH topology
3V2XA 3ZUVB 5CBOA 4BERA 5JA4D 3HRAA 4F6RD 2XEEA 5CBNA 5KBAA 4TUMA 2L6BA 5ENOD 4BEPA 3B95A 4DX7D 4DX1A 1WDYA 3ZKJA 5EIDA 3W9GA 2ZGGA 1N11A 1SVXA 1YCSB 5JMND 2DVWA 4DRXE 3V79K 1S70B 4ZFHA 2XZDG 3EHRA 2ETBA 3HG0D 4HBDA 5CERB 3V2OA 3J5QB 3KEAA 4J7WA 5ENSD 2AJAA 4N5QA 5EYLA 5ENTD 1SW6A 1YMPA 1YYHA 4G8LA 4O1PA 2DZOA 4U8VD 4HB5A 4YDWA 5AARA 3F6QA 3J5PA 3V30A 4BESA 4DX5D 2Y1LE 3LJNA 2RFAA 2XENA 4O1OA 5CECB 1A5EA 3DEOA 5AQ9A 5ITZF 3T9KA 1QYMA 4OAVB 4Z68A 4LSZE 3TWWA 1K1AA 4YDYA 4CZ2D 2F37A 3JXIA 1NFIE 1IXVA 3TWRA 2Y0BG 5KWDA 3TWQA 5BXUA 1K3ZD 4J8YA 4QFVA 2BKGA 1BU9A 2HE0A 3UTMA 2RFMA 4LG6A 1DC2A 4G8KA 3V31A 3Q9UC 2ETAA 3W9FA 1K1BA 4ATZD 4A63B 2DWZA 5EIBE 3DEPA 5EYPF 4K5CA 2V4HC 5FIOA 2QYJA 4K5AB 3AJIA 5AAOA 5FINA 2PNNA 4CYMD 5HKPA 4HRMB 3EHQA 3JUEA 4B93B 2A5EA 3UXGA 3B7BA 3D9HA 3C5RA 4LNUD 5ENQD 2V5QC 2BKKB 1IHBA 5CEDB 2QC9A 2ZGDA 1G3NB 4U8YD 3T8KA 3UI2A 1OT8A 2F8XK 2ETCA 4BSZB 1N0QA 1D9SA 1WG0A 1OY3D 2NYJA 1DCQA 2XZTG 4DX6D 5CEAA 3TWTA 4ZHBA 1MYOA 4HI9A 4F1PA 4U95D 2F8YA 5AQBA 2P2CP 3ZU7B 5KNGA 1IKND 2KBXA 5D66A 3TWSA 5BXOA 4BETA 1MX2A 4QQIA 4GPMA 2VGEA 3Q9NC 3TWXA 1BLXB 1AP7A 3NOCD 5ENRD 2MYOA 1UOHA 3ZNGA 1BD8A 4HI8A 2B0OE 5EILA 1MJ0A 4U96D 1TR4A 4HQDA 4O60A 1MX4A 1N0RA 5HRYA 2KXPC 4GMRA 3AAAC 4JB8P 2JABA 4HRLA 5ENPD 4DUIA 4K5BA 2FO1E 3TWUA 5EN5D 5KNHD 1AWCB 4HLLA 1BI7B 3SO8A 4DX2A 2DZNA 3JXJA 4HNAD 4HRNA 4C48B 5AQ7A 3NBNB 2XEHA 4OAUC 3IXEA 5AN8A 3TWVA 3NOGD 5HS0A 4NIKA 1MX6A 4UUCA 4RLYA 2J8SD 5AQAA 1BI8B 3EU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2X A;  3ZUV B;  5CBO A;  4BER A;  5JA4 D;  3HRA A;  4F6R D;  2XEE A;  5CBN A;  5KBA A;  4TUM A;  2L6B A;  5ENO D;  4BEP A;  3B95 A;  4DX7 D;  4DX1 A;  1WDY A;  3ZKJ A;  5EID A;  3W9G A;  2ZGG A;  1N11 A;  1SVX A;  1YCS B;  5JMN D;  2DVW A;  4DRX E;  3V79 K;  1S70 B;  4ZFH A;  2XZD G;  3EHR A;  2ETB A;  3HG0 D;  4HBD A;  5CER B;  3V2O A;  3J5Q B;  3KEA A;  4J7W A;  5ENS D;  2AJA A;  4N5Q A;  5EYL A;  5ENT D;  1SW6 A;  1YMP A;  1YYH A;  4G8L A;  4O1P A;  2DZO A;  4U8V D;  4HB5 A;  4YDW A;  5AAR A;  3F6Q A;  3J5P A;  3V30 A;  4BES A;  4DX5 D;  2Y1L E;  3LJN A;  2RFA A;  2XEN A;  4O1O A;  5CEC B;  1A5E A;  3DEO A;  5AQ9 A;  5ITZ F;  3T9K A;  1QYM A;  4OAV B;  4Z68 A;  4LSZ E;  3TWW A;  1K1A A;  4YDY A;  4CZ2 D;  2F37 A;  3JXI A;  1NFI E;  1IXV A;  3TWR A;  2Y0B G;  5KWD A;  3TWQ A;  5BXU A;  1K3Z D;  4J8Y A;  4QFV A;  2BKG A;  1BU9 A;  2HE0 A;  3UTM A;  2RFM A;  4LG6 A;  1DC2 A;  4G8K A;  3V31 A;  3Q9U C;  2ETA A;  3W9F A;  1K1B A;  4ATZ D;  4A63 B;  2DWZ A;  5EIB E;  3DEP A;  5EYP F;  4K5C A;  2V4H C;  5FIO A;  2QYJ A;  4K5A B;  3AJI A;  5AAO A;  5FIN A;  2PNN A;  4CYM D;  5HKP A;  4HRM B;  3EHQ A;  3JUE A;  4B93 B;  2A5E A;  3UXG A;  3B7B A;  3D9H A;  3C5R A;  4LNU D;  5ENQ D;  2V5Q C;  2BKK B;  1IHB A;  5CED B;  2QC9 A;  2ZGD A;  1G3N B;  4U8Y D;  3T8K A;  3UI2 A;  1OT8 A;  2F8X K;  2ETC A;  4BSZ B;  1N0Q A;  1D9S A;  1WG0 A;  1OY3 D;  2NYJ A;  1DCQ A;  2XZT G;  4DX6 D;  5CEA A;  3TWT A;  4ZHB A;  1MYO A;  4HI9 A;  4F1P A;  4U95 D;  2F8Y A;  5AQB A;  2P2C P;  3ZU7 B;  5KNG A;  1IKN D;  2KBX A;  5D66 A;  3TWS A;  5BXO A;  4BET A;  1MX2 A;  4QQI A;  4GPM A;  2VGE A;  3Q9N C;  3TWX A;  1BLX B;  1AP7 A;  3NOC D;  5ENR D;  2MYO A;  1UOH A;  3ZNG A;  1BD8 A;  4HI8 A;  2B0O E;  5EIL A;  1MJ0 A;  4U96 D;  1TR4 A;  4HQD A;  4O60 A;  1MX4 A;  1N0R A;  5HRY A;  2KXP C;  4GMR A;  3AAA C;  4JB8 P;  2JAB A;  4HRL A;  5ENP D;  4DUI A;  4K5B A;  2FO1 E;  3TWU A;  5EN5 D;  5KNH D;  1AWC B;  4HLL A;  1BI7 B;  3SO8 A;  4DX2 A;  2DZN A;  3JXJ A;  4HNA D;  4HRN A;  4C48 B;  5AQ7 A;  3NBN B;  2XEH A;  4OAU C;  3IXE A;  5AN8 A;  3TWV A;  3NOG D;  5HS0 A;  4NIK A;  1MX6 A;  4UUC A;  4RLY A;  2J8S D;  5AQA A;  1BI8 B;  3EU9 A; 
#chains in the Genus database with same CATH topology
 2BTD A;  3ZYL A;  4EBA A;  2WXQ A;  2XEE A;  4GZD A;  4GA0 A;  2BED A;  3UT4 A;  3DXK G;  4PH4 B;  2GRL A;  4TXR A;  4UWG A;  2IO3 C;  3J5Q B;  2AJA A;  4L1B A;  1YMP A;  4ANW A;  3V30 A;  2E2E A;  3C3Q A;  1P5Q A;  4LNG A;  3UUX A;  2Y1L E;  2XPZ A;  4CDM A;  1IYG A;  5EX0 A;  3CHO A;  4OAV B;  4GYY A;  3UPV A;  3PH0 C;  3Q5M A;  4QFV A;  1TJF A;  5FZR A;  2EIN E;  1ELW A;  2IOS A;  2LAI A;  2IQC A;  4G2V A;  3ZHE B;  3ZIM A;  4GMJ A;  4HRM B;  5T3R A;  3EHM A;  4LNU D;  1JWG A;  2BKK B;  2ZGD A;  3T8K A;  4A1S A;  5B1A E;  1EYH A;  5LFA A;  2UWJ G;  4I1A A;  1ZB1 A;  4ATG A;  4YDE A;  4XEI G;  2P2C P;  3CGH A;  3BQO A;  2J4B A;  1MX2 A;  3CHS A;  3HVE B;  4AVX A;  4GMR A;  4I43 A;  2UY1 B;  5BPP A;  2JAB A;  5CCM A;  5M72 A;  1U3D A;  4K5B A;  3S7D A;  3RO2 A;  4HNA D;  3C3R A;  1O1S A;  3UM0 A;  4NIK A;  2WXI A;  4WWO A;  3CVL A;  5JA4 D;  4L23 A;  3Q75 A;  5AJD A;  2X6F A;  3R9M A;  4DPR A;  4GTS A;  4RG6 A;  5T4Y A;  5EID A;  2DYR E;  3TAX A;  4DRX E;  3UM3 A;  4EHM A;  5ENS D;  5ENT D;  2WXR A;  3L13 A;  3Q73 A;  3I4R B;  4HB5 A;  4KVO A;  4JEU A;  5CEC B;  1K8K G;  4Q69 A;  3E32 A;  5ITZ F;  4YDO A;  2XGO A;  3DSU A;  3AS8 A;  3Q49 B;  3B7R L;  3ABM E;  2F37 A;  3UT7 A;  3JQ1 A;  2XCB A;  2X6J A;  4N3C A;  3CHP A;  3O48 A;  4CDR A;  4A63 B;  2WM9 A;  3K9I A;  2AWI A;  1TNO A;  3EHN A;  2QFC A;  3FH5 A;  2XCC A;  3KAE A;  1H6P A;  1DNP A;  3CHQ A;  3GZ1 A;  3IEG A;  1L5J A;  5D66 A;  3FUF A;  3FTY A;  2WXJ A;  3LCA A;  5D0O D;  4ACL A;  4U96 D;  3DRA A;  4O60 A;  1DVP A;  3TGO A;  3IHY A;  4UQZ A;  4HS2 A;  3HIZ A;  4UI9 C;  5EN5 D;  4UQY A;  2LXL A;  2PM7 A;  4IRU A;  4FUL A;  2OEV A;  4AEZ C;  4GU5 A;  3UX4 A;  4D10 C;  2XEH A;  4WNF A;  3NQP A;  1SQM A;  3SFZ A;  4E6H A;  2IEJ A;  3ABL E;  5HQ8 A;  5LP0 A;  1JWF A;  3PEV B;  3PZD A;  5CCL A;  4JW1 A;  1UG3 A;  3DST A;  2XHE A;  2I1J A;  3IV0 A;  1LF8 A;  5BT1 A;  5CMW A;  1S63 A;  1SW6 A;  2WXG A;  1E7U A;  2WXL A;  3F6Q A;  3FTU A;  4UQX A;  2AW6 A;  2QZA A;  3TXN A;  2WB2 A;  3WG7 E;  3KEZ A;  4X8Q A;  2QYU A;  2BF0 X;  2P9S G;  1K1A A;  4CZ2 D;  4CGW A;  2ION A;  3B13 A;  5D0Q D;  5KWD A;  1FT1 A;  3FTS A;  2DYS E;  2CHW A;  2WVI A;  4HVB A;  5H7P A;  1H19 A;  2F0Y A;  4CYM D;  5HKP A;  2LSV A;  1N95 A;  2P9P G;  3AU4 A;  4WNG A;  2ETC A;  1GW6 A;  2YHC A;  5A7D B;  4U07 A;  2CHX A;  5ARG A;  1IHG A;  3RAU A;  2MYO A;  2VSY A;  3R7Q A;  3RU0 A;  3SNX A;  1S64 A;  4A3V A;  4HRL A;  2FI7 A;  4JHJ A;  3TWU A;  3CQC B;  3JUI A;  4FAD A;  1SZ9 A;  3NBN B;  2R2L A;  4G23 A;  2C0L A;  4AXH A;  3C72 A;  4P29 A;  2V8S E;  2P9L G;  2KZT A;  1ELR A;  3U4T A;  4GML A;  3TJP A;  2HYZ A;  2OCC E;  4FJZ A;  2XZD G;  3PS6 A;  1YYH A;  3D9O A;  3PZ4 A;  4PS8 A;  1PY1 A;  3EJN A;  1OUV A;  2YIN A;  2PZI A;  4BTA A;  4MLP A;  2Y0B G;  3CVN A;  3E34 A;  2HE0 A;  3HXE A;  4DI3 A;  5ANL A;  3E4B A;  4IYP A;  3RRN B;  3E33 A;  3I5P A;  3LKU A;  3AJI A;  1TNU A;  4U04 A;  2WQ7 A;  4J8E A;  3RRM B;  1FVH A;  1ELK A;  2V5Q C;  4K03 A;  1HE8 A;  1QZ2 A;  4ME2 A;  5G04 C;  3ENE A;  3D3M A;  1MQS A;  3SQV A;  2XQ0 A;  3CVQ A;  4HOQ A;  3D9J A;  3NAW A;  4HXI A;  4AIF A;  3URZ A;  4DLO A;  1IKN D;  4ILH B;  4AM9 A;  1QQE A;  3KSQ A;  4B89 A;  4BT9 A;  1N0R A;  2LNI A;  3APD A;  3FTZ A;  2FO1 E;  1U2V G;  3OXL A;  4JA7 A;  1TNB A;  3KSL A;  4HLL A;  3ZXP A;  1Z3X A;  3IXE A;  3FUN A;  3B7U X;  4GTT A;  2C0M A;  1ZBP A;  3DSS A;  3RIB A;  4UI9 K;  2KZT B;  3LVR E;  4EQF A;  3FEY A;  2OOE A;  4DX1 A;  1N4S A;  4FC8 A;  3NZS A;  4F1S A;  3HXB A;  2AVP A;  3V79 K;  4HOU A;  4WAF A;  5JJ6 A;  3VTY A;  3QWV A;  4N5C A;  5FJY A;  4TV3 A;  4GZ6 A;  5C1D A;  2KCL A;  4RQI A;  1IQU A;  4JZY A;  3UM1 A;  1UJJ A;  3PRZ A;  4HOR A;  3UTM A;  1D8E A;  5KCM A;  1DCE A;  3T5X A;  3CHM A;  3PE4 A;  4EPZ A;  4K5C A;  3ASO E;  2V4H C;  1MHQ A;  1TN8 A;  2WXH A;  5BNW A;  1EPU A;  4BY6 A;  2ZIR A;  3TG5 A;  3BG1 B;  4DI4 A;  3DSW A;  2EIM E;  3LVQ E;  3ULY A;  2GRP B;  2NXP A;  1HFA A;  3D9K A;  4GTO A;  4KBQ A;  3R7R A;  3FY4 A;  1HZ4 A;  3ZVV A;  2IOL A;  1BI7 B;  1TNY A;  5ARF A;  4C48 B;  3S7J A;  4Y6W A;  1MX6 A;  4RLY A;  1QBQ A;  4L7T A;  3ASD A;  4UWH A;  4H7X A;  3QAR A;  2GRM A;  2MOW A;  3B95 A;  3D9P A;  1S0P A;  3HYM B;  2ZGG A;  3RO3 A;  4YVQ C;  2CG3 A;  3EHR A;  2WXM A;  5CER B;  2WQH A;  4N5Q A;  5DBK A;  3CK7 A;  3RRU A;  2R59 A;  2C2L A;  3ABK E;  2I9C A;  2VSN A;  4U7E B;  3T9K A;  1NI1 A;  4Z68 A;  3MEK A;  5KJN A;  2A4Z A;  3KD7 A;  4XIF A;  4CRW A;  3KS2 A;  3Q9U C;  2CFU A;  2ETA A;  1OXJ A;  2JLB A;  2L6J A;  2I6H A;  1KZO A;  2VGX A;  2QY7 A;  3CK8 A;  2NC9 A;  4NQ0 A;  2PNN A;  4WWP A;  2QC9 A;  3FTV A;  4BSZ B;  3APC A;  1UJK A;  3QWW A;  1N52 A;  4C0M A;  4DX6 D;  4ZHB A;  1MYO A;  3MYV A;  4F1P A;  4LEU A;  4UWL A;  2V5F A;  5BXO A;  3FU0 A;  4HFG A;  4GCO A;  1H2T C;  2Q7F A;  1N4R A;  5E75 A;  3PRE A;  3ZN3 A;  2PQN A;  3MA5 A;  3SO8 A;  1E96 B;  3U9W A;  2J49 A;  4U0U A;  4JD2 G;  3TG4 A;  4UUC A;  2EQX A;  2VGY A;  1LD7 A;  5CBO A;  5B3S E;  4BER A;  2FBN A;  4KZC A;  3VLD A;  5ENO D;  2B6C A;  3CR3 A;  4O6F A;  3T8M A;  5AIJ A;  3ZKJ A;  3W9G A;  1TN7 A;  1S70 B;  3ZFW A;  1O1R A;  3CVP A;  3UIN C;  1LD8 A;  3SBT B;  4BES A;  3SF4 A;  4L2L A;  4GTQ A;  3P2B A;  4FHK A;  2WXF A;  3HXF A;  3MGB A;  3FTX A;  3PNT B;  4XKB A;  4APO A;  2NSZ A;  3Q78 A;  3PE3 A;  3EIJ A;  1WAO 1;  2M63 A;  1Y8M A;  2VGX B;  5CRU A;  1HXI A;  1E8Y A;  4KT6 B;  4FHJ A;  3QKY A;  2R05 A;  4JL0 A;  3LY8 A;  4IUL A;  2LAH A;  5CRV A;  4U95 D;  5G05 J;  4Y6C A;  2Y69 E;  3D9M A;  3LEW A;  4QQI A;  3MKR A;  3TWX A;  4GB9 A;  1KLX A;  2E0I A;  1UOH A;  3CV0 A;  4AY5 A;  3L17 A;  4CEM A;  2DCP A;  3QAQ A;  1EF1 C;  2LO6 A;  3B7T A;  3JXJ A;  3QC1 A;  3AS4 A;  4G25 A;  3S2A A;  1E8X A;  2J8S D;  1BI8 B;  3EU9 A;  4RVB A;  3ZUV B;  4XI9 A;  2P9I G;  4V3I A;  4FJY A;  1H6O A;  3D9L A;  3EIQ C;  1XGW A;  5ENN A;  3ZYK A;  1V54 E;  3CIA A;  1E7V A;  3SZ7 A;  5LCW J;  1A17 A;  4J7W A;  3SBS A;  3AU5 A;  4GYW A;  5DIZ A;  2J4D A;  3CSF A;  4O1P A;  2DZO A;  1H2U A;  2XEN A;  4LRZ A;  1H6K A;  5FQ4 A;  2GGF A;  1OWL A;  4GYO A;  1H0A A;  3G2T A;  4GTR A;  1OWO A;  2V0P A;  3PVL A;  4ABN A;  2WMN A;  2LUH A;  4KXK B;  5A23 A;  1HF8 A;  2WXP A;  1KT0 A;  4I6E A;  3ZYQ A;  1INZ A;  4LNB A;  1X5B A;  4G24 A;  2F8X K;  3SFY A;  4XE0 A;  1D9S A;  2P9K G;  3SFX A;  1NP7 A;  4MBG A;  4OVV A;  2NYJ A;  5CEA A;  3ASG A;  4HI9 A;  1WM5 A;  5AQB A;  3T5V A;  3FUD A;  4J6I A;  4FLB A;  3L9T A;  1Z5S C;  4J8S A;  1BD8 A;  4L9P A;  5EIL A;  2OEW A;  3NZU A;  3G2S A;  2KXP C;  1N94 A;  5ENP D;  3LY9 A;  1JCR A;  3SY2 A;  3E37 A;  2CFZ A;  4OAU C;  5D2M C;  2DIW A;  1N54 A;  1HO8 A;  2XRZ A;  4GZ3 A;  4XI0 A;  4YVO A;  2RG8 A;  1N11 A;  2DVW A;  4ZFH A;  3QWP A;  4PS3 A;  2PL2 A;  3FUM A;  4U8V D;  3ZEF A;  2KCV A;  3FWV A;  2IFU A;  3GZS A;  3OXG A;  2RFA A;  4BSX A;  3FTW A;  4PUC A;  3B7S A;  5B1B E;  5E76 A;  3DXM G;  4LSZ E;  4DK5 A;  4UI9 J;  3TWQ A;  4BWR A;  3MX3 A;  3UIO C;  4G26 A;  3FHE A;  1OWP A;  3UMV A;  4AY6 A;  4F7A A;  3QK0 A;  3SI5 A;  4L2Y A;  5FT9 A;  3Q79 A;  5JJ7 A;  4K5A B;  2OVB A;  1HX8 A;  3NB2 A;  4JVS A;  4A55 A;  2A5E A;  4U8Y D;  1W3B A;  2WMO A;  1WG0 A;  2VQ2 A;  3JQ0 A;  2F8Y A;  5KNG A;  4ANV A;  2HO1 A;  3CKB A;  5FQ8 A;  1QNF A;  4N2S A;  4WND A;  2AXV A;  4DUI A;  4M7C A;  3HXD A;  3OAW A;  5BV1 A;  1TNZ A;  1TEZ A;  3AG4 E;  4GTM A;  3S7B A;  5T8I A;  3L08 A;  4TXP A;  1N4P A;  3HHM A;  4YDW A;  4N3B A;  2LSU A;  3GYZ A;  2L0I A;  1HG2 A;  5KBA A;  4RG9 A;  3I3N A;  4B8A A;  3L6A A;  2GRN B;  2X3M A;  3PZ1 A;  2XEV A;  3V2O A;  4WWN A;  4CT4 A;  3G2U A;  3FDH A;  5EYL A;  2ZIS A;  4ANX A;  4GZC A;  5J08 A;  3VTX A;  4W9R A;  4I6G A;  1NFI E;  1JCQ A;  1K3Z D;  1TJC A;  2FF4 A;  3DPD A;  5KJM A;  3ULQ A;  3JYS A;  5AJL A;  4ANU A;  1DC2 A;  2GRO B;  3DBS A;  5EYP F;  4WUY A;  1B89 A;  4OVU A;  1V55 E;  4A1G A;  2IF4 A;  4ILI A;  2X38 A;  3FH8 A;  1IHB A;  1OT8 A;  4GTV A;  4E85 A;  1OY3 D;  3ML9 A;  2R5S A;  3TWT A;  1SA4 A;  3HXC A;  3PUK A;  3ZU7 B;  2VGE A;  3Q9N C;  2Y4T A;  3NOC D;  4MKT A;  3UKR G;  3CVX A;  1MX4 A;  2EIK E;  3WXX A;  3HDX A;  5KNH D;  3ZGQ A;  4XKC A;  4DX2 A;  4HRN A;  5AQ7 A;  3TWV A;  5HS0 A;  3DWL G;  3D9I A;  2AXU A;  3PEU B;  5AQA A;  4EZL A;  2OVF A;  3CHR A;  1BPO A;  4F6R D;  5FZS A;  3S7F A;  3CLJ A;  1YCS B;  2XGS A;  5G04 J;  2FO7 A;  3SD5 A;  4R7L A;  2PM6 A;  3FFL A;  3FUH A;  3ZHE A;  4N2Q A;  1WY6 A;  1NA3 A;  1FCH A;  4DX7 D;  3ASH A;  2DBA A;  3NF1 A;  4U0S A;  3RSE G;  4LER A;  5AQ9 A;  1QYM A;  5CMY A;  3DSX A;  2XS8 A;  4GCN A;  3TWW A;  4F3V A;  2VTB A;  2ILR A;  3TWR A;  2WXO A;  4EZJ A;  3HVE A;  4TXQ A;  2H6G A;  4HOT A;  1E8W A;  2X6H A;  2J9Q A;  3QJZ A;  3RKV A;  2I1K A;  1RZ4 A;  3G2V A;  1N0Q A;  2P9N G;  3ISM C;  4J8F A;  1PC2 A;  4G1T A;  5KJL A;  4PDX A;  3CVU A;  4HQD A;  3AAA C;  3FUI A;  4RSY A;  3N71 A;  4JEH A;  1FT2 A;  1Z6T A;  5G05 C;  4I2W A;  4BT8 A;  3ASN E;  4I1O B;  4Q96 A;  3ZW3 A;  3HRA A;  1HS6 A;  5CBN A;  4BEP A;  4PS7 A;  3RJV A;  5JMN D;  1N9A A;  3PUJ A;  3UM2 A;  3HG0 D;  4HBD A;  5BW8 C;  1IQR A;  2IY0 C;  2YNQ A;  3BU8 A;  4CT0 A;  4J0U A;  4FA6 A;  4GA2 A;  3TL5 A;  1Z3Y A;  1HU3 A;  2FUL A;  3Q7F A;  4JC8 A;  5LCW C;  3ZXS A;  2MRI A;  2VTB B;  2FEZ A;  2RFM A;  1LTX A;  4MS6 A;  1K1B A;  5FQ6 A;  4GAA A;  4BTB A;  2PQR A;  3UKU G;  4B93 B;  3ESK A;  4GPK A;  2CHZ A;  2IO2 C;  2RKK A;  3O4Z A;  2CG2 A;  4KVM A;  5BV0 A;  3TXM A;  3ASF A;  3LJ3 A;  3FP3 A;  3Q47 B;  3CVY A;  4TUU A;  3BUA A;  3FU5 A;  5EKQ D;  3PZ2 A;  4BX8 A;  3FU6 A;  4URK A;  5FWQ A;  1N4Q A;  2GRR B;  3PZ3 A;  5LX8 A;  4A3T A;  1KPS B;  3CQG B;  4DJA A;  1UN8 A;  5IY5 E;  3R9A B;  2H6H A;  5J90 A;  4HLE A;  3CK9 A;  3QDN A;  2VJ8 A;  2XPY A;  2H6I A;  3LS8 A;  2L6B A;  3C3O A;  1OCC E;  3MJW A;  3Q7A A;  5G2N A;  3Q4A B;  4XZ4 A;  4KYO B;  3CVV A;  4JXT A;  3L16 A;  4I6J A;  3CVW A;  3BG0 B;  3J5P A;  2KC7 A;  3DPY A;  4O1O A;  1A5E A;  4B8C B;  1X81 A;  2WPV A;  1E90 A;  3ZRH A;  3ONK A;  1BU9 A;  2HR2 A;  4G8K A;  3V31 A;  4I9C A;  2DWZ A;  4AP2 A;  4U63 A;  3FUK A;  2QYJ A;  3APF A;  3BEE A;  4CDN A;  5AAO A;  3AG3 E;  5FIN A;  2JEK A;  1FPP A;  3UI2 A;  4FLH A;  1EDU A;  4B94 A;  1FVF A;  4KMO A;  1SA5 A;  1DCQ A;  3ZYM A;  4U0Z A;  1TYQ G;  1KT1 A;  3AG2 E;  3I4G A;  4F53 A;  4UWF A;  4IN3 B;  4HI8 A;  3GZ2 A;  4JB8 P;  2VSO E;  5LOZ A;  3CST A;  3ESL A;  3ULE G;  4I9E A;  4AV7 A;  2R03 A;  4AJW A;  3L54 A;  4U8H A;  3NOG D;  2XGM A;  2RD0 A;  4C9B B;  1E8Z A;  3V2X A;  3LY7 A;  5EX3 A;  1NA0 A;  1HH8 A;  1NL4 A;  2P9U G;  3LDZ A;  1WDY A;  4FU3 A;  4LUN U;  1JPL A;  1Q2Z A;  5AEN A;  3L22 A;  3UT8 A;  5BUZ A;  3FU3 A;  2Y3A A;  5C2Y A;  3AG1 E;  5CHE E;  2VYI A;  5AAR A;  2X6K A;  5JJT A;  4GZ5 A;  2LXM A;  5FQ7 A;  5FZQ A;  3JXI A;  2YHE A;  2XRY A;  4NUR A;  2V4L A;  4WNE A;  3Q15 A;  1Y6I A;  2X6I A;  3L82 A;  3LPZ A;  1U3C A;  4CGV A;  4JA9 A;  3PDN A;  1MZC A;  3VLE A;  4ACK A;  4EZK A;  3EUV A;  3FUJ A;  3JUE A;  3MCX A;  3C5R A;  3OTN A;  1NZN A;  4G11 A;  2XZT G;  4EEC A;  3VLF A;  4BX9 A;  2HM8 A;  3MKQ A;  1AP7 A;  2EIL E;  1H2V C;  3CEQ A;  4N3A A;  2R17 C;  1OCZ E;  3FH7 A;  1HG5 A;  4K0R A;  3GW4 A;  2KM4 A;  1D8D A;  2Y4U A;  2DZN A;  4BFR A;  1OCR E;  4EBA G;  2H6F A;  2J09 A;  4I17 A;  2J07 A;  1OWN A;  4JHK A;  3E30 A;  3G2W A;  3EDT B;  3X2Q E;  3SGH A;  4KZ0 A;  1SVX A;  3SHF A;  3CKC A;  3JCK C;  3IBE A;  1PAQ A;  3KEA A;  4UWK A;  3QNK A;  1RW2 A;  1XNF A;  4DX5 D;  3LJN A;  4CCA A;  2IU1 A;  3LYA A;  3MZL B;  4TRQ A;  3U64 A;  4FP7 A;  4YDY A;  4JPS A;  1IXV A;  5BXU A;  1OWM A;  1VDY A;  1UW4 B;  4LG6 A;  2VSX E;  2ZU6 B;  3W9F A;  2AXZ A;  4C0E A;  3P1U A;  4I2Z A;  1OCO E;  1JUQ A;  1UN9 A;  2GW1 A;  3AS5 A;  3QOU A;  5ENQ D;  2IJG X;  1G3N B;  2WXK A;  3EU5 A;  2XS1 A;  4APF A;  5HI7 A;  1SZA A;  5AYW D;  3MV2 B;  4BET A;  4GPM A;  4GA1 A;  5ANR A;  5ENR D;  3ZPJ A;  4N39 A;  5A6C A;  2B0O E;  3MKQ B;  4M3O A;  5G55 A;  5EDS A;  3C98 A;  3UQ3 A;  4MRU A;  4XX5 A;  3FUL A;  2WQ6 A;  2EIJ E;  1AWC B;  4JHR A;  4J8D A;  3RK6 A;  5AN8 A;  1ZU2 A;  5KJK A;  2A5U A;  2J08 A;  4NAC A;  2L9B A;  5JHB A;  5FTP A;  3LXU X;  3PNL B;  4TUM A;  4ILG A;  1KZP A;  3U3W A;  3UIP C;  4Q94 A;  4AOF A;  4DLQ A;  1O5M A;  2P58 C;  3MV3 B;  2ETB A;  3OXF A;  2R02 A;  4I1M A;  4G8L A;  2MHK A;  4B0Z A;  3ONL A;  1TN6 A;  2L0T B;  2WXN A;  4YND A;  2KCK A;  3DEO A;  2OV8 A;  2XPI A;  3U66 A;  3DSV A;  4J8Y A;  2I2O A;  2BKG A;  2YQ8 A;  2ZXW E;  3FEX A;  5EIB E;  4ATZ D;  4LCT A;  1YA0 A;  3DEP A;  5FIO A;  3ML8 A;  3QB2 A;  3IKO B;  2KAT A;  3EHQ A;  3UXG A;  3B7B A;  3D9H A;  2BUG A;  4OYS A;  2GRQ B;  5CED B;  2KBX A;  3TWS A;  4H7Y A;  3D9N A;  4GTP A;  1BLX B;  5JHA A;  1JCS A;  3ZNG A;  2UY1 A;  1MJ0 A;  5HRY A;  1TR4 A;  3FUE A;  3IHV A;  1O1T A;  2OND A;  4NRH B;  4HOS A; 
#chains in the Genus database with same CATH homology
 3V2X A;  3ZUV B;  5CBO A;  4BER A;  5JA4 D;  3HRA A;  4F6R D;  2XEE A;  5CBN A;  5KBA A;  4TUM A;  2L6B A;  5ENO D;  4BEP A;  3B95 A;  4DX7 D;  4DX1 A;  1WDY A;  3ZKJ A;  5EID A;  3W9G A;  2ZGG A;  1N11 A;  1SVX A;  1YCS B;  5JMN D;  2DVW A;  4DRX E;  3V79 K;  1S70 B;  4ZFH A;  2XZD G;  3EHR A;  2ETB A;  3HG0 D;  4HBD A;  5CER B;  3V2O A;  3J5Q B;  3KEA A;  4J7W A;  5ENS D;  2AJA A;  4N5Q A;  5EYL A;  5ENT D;  1SW6 A;  1YMP A;  1YYH A;  4G8L A;  4O1P A;  2DZO A;  4U8V D;  4HB5 A;  4YDW A;  5AAR A;  3F6Q A;  3J5P A;  3V30 A;  4BES A;  4DX5 D;  2Y1L E;  3LJN A;  2RFA A;  2XEN A;  4O1O A;  5CEC B;  1A5E A;  3DEO A;  5AQ9 A;  5ITZ F;  3T9K A;  1QYM A;  4OAV B;  4Z68 A;  4LSZ E;  3TWW A;  1K1A A;  4YDY A;  4CZ2 D;  2F37 A;  3JXI A;  1NFI E;  1IXV A;  3TWR A;  2Y0B G;  5KWD A;  3TWQ A;  5BXU A;  1K3Z D;  4J8Y A;  4QFV A;  2BKG A;  1BU9 A;  2HE0 A;  3UTM A;  2RFM A;  4LG6 A;  1DC2 A;  4G8K A;  3V31 A;  3Q9U C;  2ETA A;  3W9F A;  1K1B A;  4ATZ D;  4A63 B;  2DWZ A;  5EIB E;  3DEP A;  5EYP F;  4K5C A;  2V4H C;  5FIO A;  2QYJ A;  4K5A B;  3AJI A;  5AAO A;  5FIN A;  2PNN A;  4CYM D;  5HKP A;  4HRM B;  3EHQ A;  3JUE A;  4B93 B;  2A5E A;  3UXG A;  3B7B A;  3D9H A;  3C5R A;  4LNU D;  5ENQ D;  2V5Q C;  2BKK B;  1IHB A;  5CED B;  2QC9 A;  2ZGD A;  1G3N B;  4U8Y D;  3T8K A;  3UI2 A;  1OT8 A;  2F8X K;  2ETC A;  4BSZ B;  1N0Q A;  1D9S A;  1WG0 A;  1OY3 D;  2NYJ A;  1DCQ A;  2XZT G;  4DX6 D;  5CEA A;  3TWT A;  4ZHB A;  1MYO A;  4HI9 A;  4F1P A;  4U95 D;  2F8Y A;  5AQB A;  2P2C P;  3ZU7 B;  5KNG A;  1IKN D;  2KBX A;  5D66 A;  3TWS A;  5BXO A;  4BET A;  1MX2 A;  4QQI A;  4GPM A;  2VGE A;  3Q9N C;  3TWX A;  1BLX B;  1AP7 A;  3NOC D;  5ENR D;  2MYO A;  1UOH A;  3ZNG A;  1BD8 A;  4HI8 A;  2B0O E;  5EIL A;  1MJ0 A;  4U96 D;  1TR4 A;  4HQD A;  4O60 A;  1MX4 A;  1N0R A;  5HRY A;  2KXP C;  4GMR A;  3AAA C;  4JB8 P;  2JAB A;  4HRL A;  5ENP D;  4DUI A;  4K5B A;  2FO1 E;  3TWU A;  5EN5 D;  5KNH D;  1AWC B;  4HLL A;  1BI7 B;  3SO8 A;  4DX2 A;  2DZN A;  3JXJ A;  4HNA D;  4HRN A;  4C48 B;  5AQ7 A;  3NBN B;  2XEH A;  4OAU C;  3IXE A;  5AN8 A;  3TWV A;  3NOG D;  5HS0 A;  4NIK A;  1MX6 A;  4UUC A;  4RLY A;  2J8S D;  5AQA A;  1BI8 B;  3EU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...