3Q9UC

In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
157
Chain Sequence
FGQDLGKKLLEAAAAGQDDEVRILMANGADVNATDDNGLTPLHLAAANGQLEIVEVLLKNGADVNASDSAGITPLHLAAYDGHLEIVEVLLKHGADVNAYDRAGWTPLHLAALSGQLEIVEVLLKHGADVNAQDALGLTAFDISINQGQEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CoA binding protein
publication title A de novo protein binding pair by computational design and directed evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding, de novo protein
total genus 45
structure length 157
sequence length 157
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3q9uC00
2XEHA 3DEOA 4TUMA 3J5QB 5JA4D 1AP7A 4DX7D 4HRNA 4QQIA 4U8VD 5ENOD 3B95A 3UI2A 4OAVB 1WG0A 4K5BA 2VGEA 4O1PA 4LNUD 5EYPF 5CBOA 3ZKJA 2RFAA 3C5RA 4ZHBA 5BXOA 5EIBE 1BLXB 1BI8B 1S70B 4YDWA 3EHQA 2AJAA 5EIDA 5ENQD 1K1BA 1AWCB 5D66A 4CZ2D 4DUIA 3B7BA 1OT8A 2JABA 3Q9UC 4HI8A 5AQ7A 2F8XK 1G3NB 3IXEA 3TWWA 2KXPC 2DZOA 5CECB 3HG0D 3JXJA 4K5AB 5BXUA 5CEAA 4NIKA 5EYLA 1A5EA 4RLYA 4BSZB 1MYOA 3AAAC 2DVWA 1QYMA 1BD8A 3V30A 5KWDA 5ITZF 3TWVA 1UOHA 3TWUA 4F1PA 2V5QC 1BU9A 5KNGA 2Y0BG 3ZUVB 5EN5D 4U8YD 4DX5D 3TWSA 3ZNGA 2XZDG 4BERA 1K3ZD 1YCSB 5EILA 5JMND 1BI7B 4G8KA 1MX4A 1IXVA 2DZNA 4HLLA 4HNAD 4U95D 3EU9A 4U96D 5AN8A 4DX6D 4JB8P 3V2OA 3TWTA 5FIOA 4HQDA 3TWQA 1OY3D 5AQAA 3TWXA 4N5QA 5AAOA 2QYJA 2ETBA 2ETCA 3V31A 3T9KA 4DX1A 1TR4A 3NBNB 3V79K 1MJ0A 1WDYA 5ENPD 4A63B 2XZTG 5KBAA 2F8YA 4GPMA 4K5CA 4C48B 3NOGD 4HRMB 3Q9NC 3ZU7B 2XENA 4QFVA 3D9HA 3UTMA 2HE0A 4O1OA 2ZGDA 5AARA 3J5PA 4J8YA 2PNNA 4YDYA 1N0RA 4O60A 1NFIE 5ENTD 5CBNA 5CERB 4BETA 2Y1LE 2V4HC 4HB5A 1MX2A 5FINA 4DX2A 3TWRA 1YMPA 3EHRA 5AQBA 3UXGA 2QC9A 2BKGA 2ETAA 5HS0A 4B93B 4CYMD 2DWZA 3F6QA 1IHBA 2NYJA 2A5EA 3JUEA 3LJNA 4HRLA 1K1AA 5KNHD 2MYOA 4F6RD 4LSZE 1DC2A 2ZGGA 2RFMA 3AJIA 4Z68A 1N11A 2B0OE 4J7WA 4HI9A 4GMRA 1SVXA 5ENRD 3SO8A 4LG6A 5AQ9A 2KBXA 3NOCD 4ZFHA 1MX6A 4OAUC 4UUCA 1DCQA 4DRXE 4BESA 2P2CP 3DEPA 4BEPA 1YYHA 3V2XA 5HRYA 2F37A 3JXIA 2BKKB 4ATZD 3W9GA 1D9SA 2FO1E 2J8SD 3W9FA 5ENSD 2XEEA 3T8KA 2L6BA 1N0QA 5HKPA 4HBDA 5CEDB 1IKND 3KEAA 4G8LA 1SW6A 3HRAA
chains in the Genus database with same CATH superfamily
4XE0A 3R9AB 1Z6TA 1N54A 2GRRB 3MV3B 3AG1E 1E7UA 1UJKA 2XHEA 3OTNA 1GW6A 3AS4A 4XIFA 2V5FA 3IXEA 2KXPC 3CVWA 2PL2A 5EYLA 5AIJA 3SY2A 3TL5A 3UMVA 5BPPA 3ZGQA 3U66A 2KCKA 3LEWA 3BG1B 1MX4A 1E8XA 4BFRA 2WXPA 4HQDA 2X3MA 4N5QA 3ZYMA 2X6IA 1WDYA 4HOUA 4U63A 2EQXA 4RQIA 2I9CA 2YNQA 3NOGD 4JPSA 2OEVA 4Y6WA 3LXUX 3ESLA 1TNBA 3FY4A 5ENTD 4FLBA 1NFIE 1HX8A 2P9LG 4L2LA 2L6JA 4CCAA 3LVRE 2I1KA 5J08A 2PM7A 3MKRA 4BTAA 3UT8A 2P2CP 1FPPA 2F37A 4GTRA 2AW6A 2PQNA 2MHKA 2VQ2A 2WXLA 4C0MA 4OVVA 3L6AA 4GB9A 3UIPC 1IKND 2VYIA 3HRAA 4WWNA 5JA4D 5ENOD 5DIZA 2WXRA 5EDSA 4APOA 3PDNA 3D9KA 2J08A 2L0TB 5CEAA 1N52A 3AS5A 4PS8A 2QY7A 4KZCA 4OVUA 5LP0A 4XZ4A 4A55A 2ZIRA 4JL0A 2R59A 3ZUVB 4U8YD 4IYPA 4DX5D 2XZDG 1K3ZD 3KSQA 5BW8C 5KJKA 2VTBB 1ELKA 4HS2A 2ZXWE 3UINC 2ETBA 4AXHA 2LXLA 3VLDA 2BF0X 3O4ZA 2UY1A 1S63A 1LD8A 4A3TA 2HE0A 3MV2B 1N9AA 1MX2A 2VSYA 2FULA 3TWRA 3JCKC 3ONKA 2CG3A 3Q73A 2KATA 1ELRA 4UWGA 2WXGA 3ZEFA 4F1SA 1SVXA 3X2QE 3T5XA 1QQEA 4N3AA 1MZCA 3V2XA 4ATZD 2YHEA 3DWLG 3W9FA 2XPIA 2XEEA 4NACA 4GPKA 2AXZA 4HRNA 5H7PA 1BLXB 2Y69E 5EKQD 3EHQA 3CIAA 1KT0A 3GZSA 3QNKA 5D66A 3MKQA 2WQHA 5ENNA 4BSXA 3B13A 3HVEA 4NIKA 4O6FA 4TXPA 2WXNA 5G04J 1LTXA 1N94A 4JW1A 3QJZA 3PZ2A 3WXXA 2GRMA 4WWPA 1E7VA 3UIOC 3ZRHA 2CHZA 4Q96A 5ENPD 5D0QD 1TN8A 2C2LA 2YHCA 3QOUA 4J8FA 4EZLA 1WY6A 2V4HC 4J8DA 4DX2A 1HU3A 5AQBA 1Z3XA 4GAAA 1XGWA 3LJNA 3TGOA 1DC2A 2ZGGA 4GTTA 3LYAA 1Y8MA 3SHFA 4G2VA 1D8EA 4UI9K 3S7FA 4U8HA 4HBDA 5B1BE 1FVFA 4C9BB 5AJDA 3ZIMA 4ACKA 3R9MA 3NZSA 3PEVB 1JCSA 1HG2A 3ZYQA 5CBOA 1NL4A 3PH0C 2HYZA 3FUIA 1S70B 4GTPA 1TEZA 2HO1A 4U7EB 4WAFA 2R17C 4YDEA 3PZDA 3RK6A 3Q9UC 5CCMA 4TXRA 1X5BA 5BXUA 1TN6A 4MKTA 1Z3YA 1SQMA 3FUMA 2ONDA 4AIFA 3CVQA 3ABLE 3DSUA 4UWKA 3CR3A 4N2QA 1MQSA 1HO8A 2XPYA 2XS8A 3EU9A 4KXKB 3LY7A 3CEQA 3TWTA 4XX5A 3NAWA 3K9IA 3L22A 3T9KA 3ZYKA 3V79K 4A63B 2F8YA 4GPMA 3FTWA 4UWFA 3D9MA 1IYGA 4KVOA 4XI0A 4EQFA 3S7JA 3U3WA 5T8IA 1PY1A 3MZLB 1OWPA 2DBAA 4PS3A 2Q7FA 2P9UG 1HH8A 2C0LA 4W9RA 3EIJA 3CHSA 4WNFA 2AXVA 3ENEA 2FO1E 1OWMA 4WUYA 1OWNA 5ENSD 1PC2A 3AG4E 2V4LA 2GRLA 3KSLA 3DSSA 3UKUG 4U0SA 2Y4UA 1K8KG 4GA1A 5AENA 1E90A 4GZ5A 3PUJA 3SF4A 3CVYA 1NA3A 4KBQA 4YDWA 5JJ7A 3IEGA 4EBAA 4UI9J 4B8AA 1TJFA 5DBKA 1O1RA 3RAUA 3B7BA 3PZ4A 5BNWA 4HVBA 1SZ9A 1UJJA 4Q69A 4ABNA 2WXFA 2R05A 3C3OA 3PZ3A 3CHMA 5EN5D 2CFZA 4FHJA 5FZRA 5LOZA 1BI7B 3FU5A 5LCWJ 4CEMA 5HQ8A 1OY3D 2EILE 3KS2A 5A7DB 3APFA 2ETCA 2IFUA 3FHEA 3DSWA 2HM8A 5KBAA 3ML8A 2WMNA 4EZKA 3RRUA 1HXIA 3CVXA 4DLOA 3D9OA 1UG3A 1U2VG 4B94A 3PS6A 3ZXPA 4IN3B 5FINA 3MKQB 3ULQA 3UXGA 2OCCE 4B93B 3JQ1A 3HVEB 3SBSA 5G2NA 3FUEA 2DYRE 5BV0A 4GMRA 4LG6A 3NOCD 1N95A 3IBEA 3CVPA 3APCA 4AM9A 3ZHEA 3CQGB 3FTZA 4H7YA 3C98A 1ZBPA 3ISMC 4AY6A 4U8VD 2JLBA 3PE4A 3ULYA 3MJWA 3D3MA 1DVPA 3UI2A 3C5RA 2HR2A 4U04A 3RU0A 5CCLA 1O1TA 3CVLA 3JQ0A 2E2EA 3TWWA 2IOSA 5CECB 3HYMB 4FU3A 3ABKE 1EPUA 1Q2ZA 2P58C 4LERA 1KLXA 3MEKA 2FBNA 4TXQA 3L16A 3DXMG 5EILA 5JMND 5ANRA 3FTXA 3FTVA 4I9EA 4LCTA 4TV3A 3MX3A 5AQAA 3TWXA 4JHRA 4GA0A 3QWVA 4J8SA 4C48B 4XKBA 4EECA 2UWJG 4HRMB 4GCNA 4PUCA 5CRUA 3J5PA 3SFXA 4P29A 5B3SE 2ETAA 3ZXSA 2A4ZA 2EIKE 5KNHD 4XEIG 3FUKA 3BQOA 3FU3A 4OAUC 2WXOA 4ZFHA 2P9PG 4DRXE 4BESA 2XCCA 3PNLB 4JZYA 3QWPA 4TUUA 2LO6A 1FVHA 4APFA 3ASDA 1N0QA 2XQ0A 4RG6A 3LY9A 4GTMA 5KJNA 3ASNE 3OAWA 2FEZA 1BI8B 3D9LA 1JWFA 1LF8A 3G2WA 4FULA 4JC8A 4UWLA 3Q79A 2E0IA 2WM9A 2DZOA 4NURA 5JJ6A 2WQ7A 2R5SA 1IQRA 3CHOA 4D10C 5ITZF 3TWVA 2WB2A 1WAO1 3D9PA 4GTSA 4Q94A 4G1TA 4YVQC 3Q5MA 3P1UA 4FC8A 2MOWA 4JD2G 3BU8A 4URKA 3MCXA 3RO3A 4CGWA 3BG0B 3ZFWA 1EF1C 3I5PA 3E30A 2RD0A 2X6JA 3CQCB 3FH5A 4HOTA 4K0RA 3I4RB 1KPSB 5AYWD 1EYHA 4YDYA 5CBNA 3PEUB 2GGFA 4UQZA 4JEUA 2KCLA 2XGMA 2J9QA 3CVVA 4I6JA 4GTOA 2BKGA 4V3IA 3U64A 4DI4A 1JPLA 4J7WA 2KZTB 5AQ9A 3RIBA 3FU6A 2NC9A 3FTSA 4GA2A 4ANXA 3DBSA 3SFYA 4PDXA 2XCBA 4N2SA 5HKPA 4CT0A 5CEDB 5HI7A 2IO2C 4KYOB 4MBGA 3UM0A 3VLEA 2CFUA 3EHNA 3R7QA 3Q7FA 2IO3C 2QZAA 3SBTB 3LPZA 4G24A 5EIDA 1B89A 3G2VA 4CDMA 1K1BA 1UN8A 3U9WA 4I6EA 3ZW3A 3E33A 5AQ7A 5FZQA 4RLYA 3AAAC 4FJZA 2VGXB 2BEDA 4YDOA 2H6GA 3CVUA 3KAEA 5LFAA 2OVFA 4JEHA 4B0ZA 2X6FA 4L7TA 5E75A 1U3CA 3WG7E 5FIOA 3PE3A 3V31A 1TNUA 2IOLA 3O48A 3B7SA 3VTXA 4IULA 3S7DA 4I1AA 3UQ3A 2ZGDA 3IHVA 2P9IG 4ACLA 3APDA 4CT4A 4PH4B 1HE8A 3GYZA 2WVIA 4JXTA 1N11A 5ENRD 3HXEA 1NI1A 5G05J 1E8YA 2GROB 5KJLA 2V8SE 3CV0A 3UPVA 3CHPA 2XRYA 2DYSE 2A5UA 3GW4A 3JUIA 1ZB1A 4OYSA 4UQYA 4B8CB 3PNTB 3C3QA 3TG4A 3J5QB 4L23A 2JEKA 3PUKA 1X81A 4OAVB 2XRZA 2BUGA 2VSXE 3DSXA 2CHWA 2P9NG 1HG5A 4F53A 3CVNA 1AWCB 3LVQE 3QWWA 4DUIA 3DPDA 2JABA 3DSTA 3Q47B 3HG0D 4GZ6A 2H6FA 3C72A 4WNDA 3R7RA 5G04C 3G2TA 3LCAA 4ANUA 3I4GA 1BU9A 5KNGA 3L9TA 3TWSA 4AOFA 3FH7A 2WXQA 1IXVA 4HLLA 3L08A 4U96D 1N4PA 3ESKA 1JUQA 3N71A 1RW2A 2YQ8A 4GU5A 3ASOE 1JCRA 4AVXA 2PQRA 3URZA 3NB2A 3UM2A 4J6IA 3I3NA 1TNOA 3CSTA 3TG5A 2WXIA 1N0RA 2RKKA 3HHMA 4LEUA 4AJWA 2QC9A 4HOQA 2DWZA 3F6QA 4F3VA 1FT2A 4I43A 4LSZE 4UQXA 4Z68A 4CDNA 3UKRG 2KBXA 3OXGA 3IHYA 1LD7A 1INZA 3NQPA 4I9CA 3L13A 3Q15A 3AG2E 1TN7A 4LNUD 4G25A 5BXOA 5ANLA 3DPYA 3FUDA 4HI8A 5FWQA 5BT1A 3FEXA 3RKVA 4GMJA 4BSZB 3QAQA 1MYOA 1E8ZA 2UY1B 1JCQA 5FQ7A 5FQ8A 3TWUA 3ZN3A 3PVLA 3ZNGA 4A3VA 5FTPA 3GZ1A 2WQ6A 3HXDA 4JB8P 3V2OA 4ATGA 4K03A 1P5QA 2LXMA 5FQ4A 3D9HA 4A1SA 4O1OA 3TJPA 1FT1A 4L1BA 1YMPA 3EHRA 3FTUA 3UT7A 4JHJA 3SQVA 3RSEG 1A17A 4GYYA 3JUEA 2NYJA 2A5EA 1K1AA 2L9BA 4ANVA 2BTDA 1H2VC 2FI7A 5KCMA 4GTQA 1DCQA 4GCOA 3FTYA 4I6GA 4KMOA 3FP3A 3VTYA 2VGYA 3FEYA 3DEOA 4YVOA 2XGOA 1SA5A 4MRUA 1QNFA 1ZU2A 4O1PA 2FO7A 3CGHA 3HDXA 3CKBA 4UI9C 4ILHB 3D9NA 3JYSA 1V55E 1G3NB 5A23A 4GYWA 1WM5A 3CK9A 4FA6A 1A5EA 2GW1A 5T3RA 2EIME 3ASHA 5ARGA 1NZNA 4C0EA 2LUHA 4I2ZA 2IQCA 1H6PA 3MGBA 4BERA 2GRNB 4BX8A 3Q75A 4WNEA 2OEWA 1N4RA 2LNIA 4DX6D 5LCWC 1ELWA 2J49A 1TNYA 2KCVA 3QDNA 3TXNA 3ULEG 1MJ0A 1RZ4A 4LUNU 2VJ8A 3BUAA 3UT4A 3Q9NC 2P9SG 3CHRA 4H7XA 2PNNA 3G2UA 3AU4A 4HB5A 4BT8A 2J4DA 2QYUA 2LSVA 1O5MA 1DCEA 4Y6CA 2ILRA 2CG2A 2KM4A 3FWVA 2RFMA 4DPRA 3LS8A 2EINE 1MX6A 3VLFA 5CHEE 3U4TA 1H6KA 5EX0A 3FDHA 3W9GA 3AS8A 5D2MC 3AU5A 4WNGA 4XI9A 4DLQA 4RVBA 2LSUA 3L54A 1TNZA 2XEHA 3SGHA 2NSZA 3B95A 1WG0A 4RG9A 5C1DA 2LAIA 3DRAA 3CK7A 4MLPA 2XGSA 1KZPA 4ILGA 2WXMA 4K5AB 3Q7AA 2EIJE 1SZAA 4M7CA 2WPVA 3RRMB 1BD8A 4BY6A 3IV0A 1UOHA 1Y6IA 4F1PA 2V5QC 4U0ZA 5D0OD 3D9JA 2MRIA 2IJGX 3IKOB 2I2OA 4CGVA 3TWQA 5AAOA 2QYJA 4DX1A 1OCCE 4L9PA 3TAXA 2L0IA 3CKCA 3L82A 2H6HA 5BUZA 2XENA 1H2UA 4R7LA 3CHQA 2GRPB 1OXJA 1Z5SC 3UM3A 5JHAA 1OUVA 3FUFA 5KJMA 2MYOA 3FFLA 3KD7A 3S2AA 2PZIA 4AP2A 4FADA 3RJVA 4JA7A 3HXFA 2YINA 2ZU6B 4JA9A 2CHXA 3ASFA 4EHMA 4M3OA 4EZJA 2WXKA 2L6BA 3T8KA 1QZ2A 1FCHA 1NP7A 2X6HA 5C2YA 4BTBA 5B1AE 1PAQA 4DK5A 5EYPF 5EIBE 3SI5A 2IU1A 3DSVA 4A1GA 1HZ4A 3TXMA 3QK0A 1SA4A 2Y3AA 1OT8A 3ABME 3LDZA 4KZ0A 3JXJA 1S0PA 4N39A 2QFCA 4N5CA 4FLHA 3ZPJA 3RO2A 1HF8A 3MYVA 2LAHA 3SNXA 3KEZA 1NA0A 4HORA 5E76A 3OXFA 4KVMA 1YCSB 2DZNA 4HNAD 3QARA 5AN8A 4BWRA 3G2SA 1HFAA 3SFZA 3FUJA 1TR4A 3EJNA 3CK8A 4G11A 4HLEA 2XZTG 1YA0A 4NQ0A 4TRQA 1OWOA 4BT9A 3HIZA 5FJYA 4F7AA 2Y1LE 3ZHEB 4ME2A 2X38A 1OWLA 3CLJA 4GTVA 3EHMA 4JVSA 5FT9A 3CSFA 4CYMD 2AXUA 4HRLA 4MS6A 3S7BA 3LKUA 1EDUA 4BEPA 3C3RA 3HXBA 4I17A 4LRZA 4LNBA 2J8SD 2NXPA 4IRUA 2XS1A 5M72A 1IHGA 3FU0A 3RRNB 2I6HA 2PM6A 3P2BA 4CRWA 4KT6B 1AP7A 4GZCA 3DXKG 1HS6A 2VGEA 4ILIA 3D9IA 4ZHBA 5IY5E 5ENQD 3Q4AB 3B7RL 3NZUA 2F8XK 2OV8A 3E32A 2ZISA 1BPOA 3B7UX 2DVWA 3LJ3A 1QBQA 2KC7A 4I1OB 4G8KA 1E96B 2XPZA 4U95D 4I2WA 3UX4A 2C0MA 2WMOA 4N3BA 3ZYLA 2WXJA 1MHQA 3ASGA 3UUXA 4AEZC 5J90A 3Q78A 5G55A 1UW4B 4QFVA 3UTMA 5CERB 4AY5A 4BETA 4LNGA 1OCOE 5EX3A 3T5VA 2DIWA 5T4YA 4BX9A 4GYOA 3FUHA 5HS0A 1IHBA 3FULA 4F6RD 3AJIA 1V54E 4HI9A 4FHKA 4WWOA 5G05C 4CDRA 3DEPA 1YYHA 5HRYA 3JXIA 2BKKB 5LX8A 3EU5A 3LY8A 3KEAA 4G8LA 3T8MA 4E6HA 4TUMA 1XNFA 4QQIA 2P9KG 4L2YA 3PREA 3E37A 2VSNA 1N4QA 1S64A 4FJYA 4CZ2D 2AVPA 5ARFA 1H0AA 3SD5A 3EUVA 1IQUA 4DJAA 1H19A 1N4SA 2DCPA 4ANWA 2RG8A 5CMYA 1D8DA 4I1MA 2VSOE 3ONLA 5JJTA 3OXLA 4HFGA 1OCZE 2IEJA 3NBNB 3EIQC 2J07A 3ZVVA 4HOSA 2GRQB 2H6IA 5BV1A 1KT1A 1L5JA 5AARA 2I1JA 4GZ3A 3FUNA 2R2LA 3ML9A 2M63A 2IY0C 3QKYA 2OVBA 4G26A 4J0UA 5A6CA 4EPZA 2J4BA 1UN9A 3SO8A 4N3CA 4UUCA 4YNDA 2B6CA 2FF4A 1W3BA 3SZ7A 2VTBA 3NF1A 3L17A 4HXIA 4JHKA 4AV7A 4DX7D 2X6KA 2KZTA 4K5BA 4PS7A 3E34A 3ZKJA 2RFAA 3FH8A 4E85A 3B7TA 2AJAA 2V0PA 4XKCA 2R02A 3BEEA 2IONA 1TYQG 5CMWA 1KZOA 1U3DA 3QB2A 4RSYA 2WXHA 1H2TC 1JWGA 1QYMA 4B89A 1OCRE 3V30A 5KWDA 3E4BA 4U07A 2Y0BG 4J8EA 4X8QA 3QC1A 3HXCA 2AWIA 4GZDA 5JHBA 4DI3A 3MA5A 2Y4TA 1TJCA 2VGXA 4K5CA 4NRHB 4GMLA 3ZU7B 5FZSA 4J8YA 4EBAG 4U0UA 4O60A 1O1SA 3UM1A 2R03A 3PZ1A 4UWHA 3EDTB 5CRVA 1H6OA 4FP7A 2XEVA 3GZ2A 2B0OE 2F0YA 3PRZA 3Q49B 1E8WA 1DNPA 1VDYA 5FQ6A 4G23A 5AJLA 1D9SA 2IF4A 2J09A 3AG3E 2OOEA 1SW6A
chains in the Genus database with same CATH topology
2XEHA 3DEOA 4TUMA 3J5QB 5JA4D 1AP7A 4DX7D 4HRNA 4QQIA 4U8VD 5ENOD 3B95A 3UI2A 4OAVB 1WG0A 4K5BA 2VGEA 4O1PA 4LNUD 5EYPF 5CBOA 3ZKJA 2RFAA 3C5RA 4ZHBA 5BXOA 5EIBE 1BLXB 1BI8B 1S70B 4YDWA 3EHQA 2AJAA 5EIDA 5ENQD 1K1BA 1AWCB 5D66A 4CZ2D 4DUIA 3B7BA 1OT8A 2JABA 3Q9UC 4HI8A 5AQ7A 2F8XK 1G3NB 3IXEA 3TWWA 2KXPC 2DZOA 5CECB 3HG0D 3JXJA 4K5AB 5BXUA 5CEAA 4NIKA 5EYLA 1A5EA 4RLYA 4BSZB 1MYOA 3AAAC 2DVWA 1QYMA 1BD8A 3V30A 5KWDA 5ITZF 3TWVA 1UOHA 3TWUA 4F1PA 2V5QC 1BU9A 5KNGA 2Y0BG 3ZUVB 5EN5D 4U8YD 4DX5D 3TWSA 3ZNGA 2XZDG 4BERA 1K3ZD 1YCSB 5EILA 5JMND 1BI7B 4G8KA 1MX4A 1IXVA 2DZNA 4HLLA 4HNAD 4U95D 3EU9A 4U96D 5AN8A 4DX6D 4JB8P 3V2OA 3TWTA 5FIOA 4HQDA 3TWQA 1OY3D 5AQAA 3TWXA 4N5QA 5AAOA 2QYJA 2ETBA 2ETCA 3V31A 3T9KA 4DX1A 1TR4A 3NBNB 3V79K 1MJ0A 1WDYA 5ENPD 4A63B 2XZTG 5KBAA 2F8YA 4GPMA 4K5CA 4C48B 3NOGD 4HRMB 3Q9NC 3ZU7B 2XENA 4QFVA 3D9HA 3UTMA 2HE0A 4O1OA 2ZGDA 5AARA 3J5PA 4J8YA 2PNNA 4YDYA 1N0RA 4O60A 1NFIE 5ENTD 5CBNA 5CERB 4BETA 2Y1LE 2V4HC 4HB5A 1MX2A 5FINA 4DX2A 3TWRA 1YMPA 3EHRA 5AQBA 3UXGA 2QC9A 2BKGA 2ETAA 5HS0A 4B93B 4CYMD 2DWZA 3F6QA 1IHBA 2NYJA 2A5EA 3JUEA 3LJNA 4HRLA 1K1AA 5KNHD 2MYOA 4F6RD 4LSZE 1DC2A 2ZGGA 2RFMA 3AJIA 4Z68A 1N11A 2B0OE 4J7WA 4HI9A 4GMRA 1SVXA 5ENRD 3SO8A 4LG6A 5AQ9A 2KBXA 3NOCD 4ZFHA 1MX6A 4OAUC 4UUCA 1DCQA 4DRXE 4BESA 2P2CP 3DEPA 4BEPA 1YYHA 3V2XA 5HRYA 2F37A 3JXIA 2BKKB 4ATZD 3W9GA 1D9SA 2FO1E 2J8SD 3W9FA 5ENSD 2XEEA 3T8KA 2L6BA 1N0QA 5HKPA 4HBDA 5CEDB 1IKND 3KEAA 4G8LA 1SW6A 3HRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEH A;  3DEO A;  4TUM A;  3J5Q B;  5JA4 D;  1AP7 A;  4DX7 D;  4HRN A;  4QQI A;  4U8V D;  5ENO D;  3B95 A;  3UI2 A;  4OAV B;  1WG0 A;  4K5B A;  2VGE A;  4O1P A;  4LNU D;  5EYP F;  5CBO A;  3ZKJ A;  2RFA A;  3C5R A;  4ZHB A;  5BXO A;  5EIB E;  1BLX B;  1BI8 B;  1S70 B;  4YDW A;  3EHQ A;  2AJA A;  5EID A;  5ENQ D;  1K1B A;  1AWC B;  5D66 A;  4CZ2 D;  4DUI A;  3B7B A;  1OT8 A;  2JAB A;  3Q9U C;  4HI8 A;  5AQ7 A;  2F8X K;  1G3N B;  3IXE A;  3TWW A;  2KXP C;  2DZO A;  5CEC B;  3HG0 D;  3JXJ A;  4K5A B;  5BXU A;  5CEA A;  4NIK A;  5EYL A;  1A5E A;  4RLY A;  4BSZ B;  1MYO A;  3AAA C;  2DVW A;  1QYM A;  1BD8 A;  3V30 A;  5KWD A;  5ITZ F;  3TWV A;  1UOH A;  3TWU A;  4F1P A;  2V5Q C;  1BU9 A;  5KNG A;  2Y0B G;  3ZUV B;  5EN5 D;  4U8Y D;  4DX5 D;  3TWS A;  3ZNG A;  2XZD G;  4BER A;  1K3Z D;  1YCS B;  5EIL A;  5JMN D;  1BI7 B;  4G8K A;  1MX4 A;  1IXV A;  2DZN A;  4HLL A;  4HNA D;  4U95 D;  3EU9 A;  4U96 D;  5AN8 A;  4DX6 D;  4JB8 P;  3V2O A;  3TWT A;  5FIO A;  4HQD A;  3TWQ A;  1OY3 D;  5AQA A;  3TWX A;  4N5Q A;  5AAO A;  2QYJ A;  2ETB A;  2ETC A;  3V31 A;  3T9K A;  4DX1 A;  1TR4 A;  3NBN B;  3V79 K;  1MJ0 A;  1WDY A;  5ENP D;  4A63 B;  2XZT G;  5KBA A;  2F8Y A;  4GPM A;  4K5C A;  4C48 B;  3NOG D;  4HRM B;  3Q9N C;  3ZU7 B;  2XEN A;  4QFV A;  3D9H A;  3UTM A;  2HE0 A;  4O1O A;  2ZGD A;  5AAR A;  3J5P A;  4J8Y A;  2PNN A;  4YDY A;  1N0R A;  4O60 A;  1NFI E;  5ENT D;  5CBN A;  5CER B;  4BET A;  2Y1L E;  2V4H C;  4HB5 A;  1MX2 A;  5FIN A;  4DX2 A;  3TWR A;  1YMP A;  3EHR A;  5AQB A;  3UXG A;  2QC9 A;  2BKG A;  2ETA A;  5HS0 A;  4B93 B;  4CYM D;  2DWZ A;  3F6Q A;  1IHB A;  2NYJ A;  2A5E A;  3JUE A;  3LJN A;  4HRL A;  1K1A A;  5KNH D;  2MYO A;  4F6R D;  4LSZ E;  1DC2 A;  2ZGG A;  2RFM A;  3AJI A;  4Z68 A;  1N11 A;  2B0O E;  4J7W A;  4HI9 A;  4GMR A;  1SVX A;  5ENR D;  3SO8 A;  4LG6 A;  5AQ9 A;  2KBX A;  3NOC D;  4ZFH A;  1MX6 A;  4OAU C;  4UUC A;  1DCQ A;  4DRX E;  4BES A;  2P2C P;  3DEP A;  4BEP A;  1YYH A;  3V2X A;  5HRY A;  2F37 A;  3JXI A;  2BKK B;  4ATZ D;  3W9G A;  1D9S A;  2FO1 E;  2J8S D;  3W9F A;  5ENS D;  2XEE A;  3T8K A;  2L6B A;  1N0Q A;  5HKP A;  4HBD A;  5CED B;  1IKN D;  3KEA A;  4G8L A;  1SW6 A;  3HRA A; 
#chains in the Genus database with same CATH topology
 4XE0 A;  3R9A B;  1Z6T A;  1N54 A;  2GRR B;  3MV3 B;  3AG1 E;  1E7U A;  1UJK A;  2XHE A;  3OTN A;  1GW6 A;  3AS4 A;  4XIF A;  2V5F A;  3IXE A;  2KXP C;  3CVW A;  2PL2 A;  5EYL A;  5AIJ A;  3SY2 A;  3TL5 A;  3UMV A;  5BPP A;  3ZGQ A;  3U66 A;  2KCK A;  3LEW A;  3BG1 B;  1MX4 A;  1E8X A;  4BFR A;  2WXP A;  4HQD A;  2X3M A;  4N5Q A;  3ZYM A;  2X6I A;  1WDY A;  4HOU A;  4U63 A;  2EQX A;  4RQI A;  2I9C A;  2YNQ A;  3NOG D;  4JPS A;  2OEV A;  4Y6W A;  3LXU X;  3ESL A;  1TNB A;  3FY4 A;  5ENT D;  4FLB A;  1NFI E;  1HX8 A;  2P9L G;  4L2L A;  2L6J A;  4CCA A;  3LVR E;  2I1K A;  5J08 A;  2PM7 A;  3MKR A;  4BTA A;  3UT8 A;  2P2C P;  1FPP A;  2F37 A;  4GTR A;  2AW6 A;  2PQN A;  2MHK A;  2VQ2 A;  2WXL A;  4C0M A;  4OVV A;  3L6A A;  4GB9 A;  3UIP C;  1IKN D;  2VYI A;  3HRA A;  4WWN A;  5JA4 D;  5ENO D;  5DIZ A;  2WXR A;  5EDS A;  4APO A;  3PDN A;  3D9K A;  2J08 A;  2L0T B;  5CEA A;  1N52 A;  3AS5 A;  4PS8 A;  2QY7 A;  4KZC A;  4OVU A;  5LP0 A;  4XZ4 A;  4A55 A;  2ZIR A;  4JL0 A;  2R59 A;  3ZUV B;  4U8Y D;  4IYP A;  4DX5 D;  2XZD G;  1K3Z D;  3KSQ A;  5BW8 C;  5KJK A;  2VTB B;  1ELK A;  4HS2 A;  2ZXW E;  3UIN C;  2ETB A;  4AXH A;  2LXL A;  3VLD A;  2BF0 X;  3O4Z A;  2UY1 A;  1S63 A;  1LD8 A;  4A3T A;  2HE0 A;  3MV2 B;  1N9A A;  1MX2 A;  2VSY A;  2FUL A;  3TWR A;  3JCK C;  3ONK A;  2CG3 A;  3Q73 A;  2KAT A;  1ELR A;  4UWG A;  2WXG A;  3ZEF A;  4F1S A;  1SVX A;  3X2Q E;  3T5X A;  1QQE A;  4N3A A;  1MZC A;  3V2X A;  4ATZ D;  2YHE A;  3DWL G;  3W9F A;  2XPI A;  2XEE A;  4NAC A;  4GPK A;  2AXZ A;  4HRN A;  5H7P A;  1BLX B;  2Y69 E;  5EKQ D;  3EHQ A;  3CIA A;  1KT0 A;  3GZS A;  3QNK A;  5D66 A;  3MKQ A;  2WQH A;  5ENN A;  4BSX A;  3B13 A;  3HVE A;  4NIK A;  4O6F A;  4TXP A;  2WXN A;  5G04 J;  1LTX A;  1N94 A;  4JW1 A;  3QJZ A;  3PZ2 A;  3WXX A;  2GRM A;  4WWP A;  1E7V A;  3UIO C;  3ZRH A;  2CHZ A;  4Q96 A;  5ENP D;  5D0Q D;  1TN8 A;  2C2L A;  2YHC A;  3QOU A;  4J8F A;  4EZL A;  1WY6 A;  2V4H C;  4J8D A;  4DX2 A;  1HU3 A;  5AQB A;  1Z3X A;  4GAA A;  1XGW A;  3LJN A;  3TGO A;  1DC2 A;  2ZGG A;  4GTT A;  3LYA A;  1Y8M A;  3SHF A;  4G2V A;  1D8E A;  4UI9 K;  3S7F A;  4U8H A;  4HBD A;  5B1B E;  1FVF A;  4C9B B;  5AJD A;  3ZIM A;  4ACK A;  3R9M A;  3NZS A;  3PEV B;  1JCS A;  1HG2 A;  3ZYQ A;  5CBO A;  1NL4 A;  3PH0 C;  2HYZ A;  3FUI A;  1S70 B;  4GTP A;  1TEZ A;  2HO1 A;  4U7E B;  4WAF A;  2R17 C;  4YDE A;  3PZD A;  3RK6 A;  3Q9U C;  5CCM A;  4TXR A;  1X5B A;  5BXU A;  1TN6 A;  4MKT A;  1Z3Y A;  1SQM A;  3FUM A;  2OND A;  4AIF A;  3CVQ A;  3ABL E;  3DSU A;  4UWK A;  3CR3 A;  4N2Q A;  1MQS A;  1HO8 A;  2XPY A;  2XS8 A;  3EU9 A;  4KXK B;  3LY7 A;  3CEQ A;  3TWT A;  4XX5 A;  3NAW A;  3K9I A;  3L22 A;  3T9K A;  3ZYK A;  3V79 K;  4A63 B;  2F8Y A;  4GPM A;  3FTW A;  4UWF A;  3D9M A;  1IYG A;  4KVO A;  4XI0 A;  4EQF A;  3S7J A;  3U3W A;  5T8I A;  1PY1 A;  3MZL B;  1OWP A;  2DBA A;  4PS3 A;  2Q7F A;  2P9U G;  1HH8 A;  2C0L A;  4W9R A;  3EIJ A;  3CHS A;  4WNF A;  2AXV A;  3ENE A;  2FO1 E;  1OWM A;  4WUY A;  1OWN A;  5ENS D;  1PC2 A;  3AG4 E;  2V4L A;  2GRL A;  3KSL A;  3DSS A;  3UKU G;  4U0S A;  2Y4U A;  1K8K G;  4GA1 A;  5AEN A;  1E90 A;  4GZ5 A;  3PUJ A;  3SF4 A;  3CVY A;  1NA3 A;  4KBQ A;  4YDW A;  5JJ7 A;  3IEG A;  4EBA A;  4UI9 J;  4B8A A;  1TJF A;  5DBK A;  1O1R A;  3RAU A;  3B7B A;  3PZ4 A;  5BNW A;  4HVB A;  1SZ9 A;  1UJJ A;  4Q69 A;  4ABN A;  2WXF A;  2R05 A;  3C3O A;  3PZ3 A;  3CHM A;  5EN5 D;  2CFZ A;  4FHJ A;  5FZR A;  5LOZ A;  1BI7 B;  3FU5 A;  5LCW J;  4CEM A;  5HQ8 A;  1OY3 D;  2EIL E;  3KS2 A;  5A7D B;  3APF A;  2ETC A;  2IFU A;  3FHE A;  3DSW A;  2HM8 A;  5KBA A;  3ML8 A;  2WMN A;  4EZK A;  3RRU A;  1HXI A;  3CVX A;  4DLO A;  3D9O A;  1UG3 A;  1U2V G;  4B94 A;  3PS6 A;  3ZXP A;  4IN3 B;  5FIN A;  3MKQ B;  3ULQ A;  3UXG A;  2OCC E;  4B93 B;  3JQ1 A;  3HVE B;  3SBS A;  5G2N A;  3FUE A;  2DYR E;  5BV0 A;  4GMR A;  4LG6 A;  3NOC D;  1N95 A;  3IBE A;  3CVP A;  3APC A;  4AM9 A;  3ZHE A;  3CQG B;  3FTZ A;  4H7Y A;  3C98 A;  1ZBP A;  3ISM C;  4AY6 A;  4U8V D;  2JLB A;  3PE4 A;  3ULY A;  3MJW A;  3D3M A;  1DVP A;  3UI2 A;  3C5R A;  2HR2 A;  4U04 A;  3RU0 A;  5CCL A;  1O1T A;  3CVL A;  3JQ0 A;  2E2E A;  3TWW A;  2IOS A;  5CEC B;  3HYM B;  4FU3 A;  3ABK E;  1EPU A;  1Q2Z A;  2P58 C;  4LER A;  1KLX A;  3MEK A;  2FBN A;  4TXQ A;  3L16 A;  3DXM G;  5EIL A;  5JMN D;  5ANR A;  3FTX A;  3FTV A;  4I9E A;  4LCT A;  4TV3 A;  3MX3 A;  5AQA A;  3TWX A;  4JHR A;  4GA0 A;  3QWV A;  4J8S A;  4C48 B;  4XKB A;  4EEC A;  2UWJ G;  4HRM B;  4GCN A;  4PUC A;  5CRU A;  3J5P A;  3SFX A;  4P29 A;  5B3S E;  2ETA A;  3ZXS A;  2A4Z A;  2EIK E;  5KNH D;  4XEI G;  3FUK A;  3BQO A;  3FU3 A;  4OAU C;  2WXO A;  4ZFH A;  2P9P G;  4DRX E;  4BES A;  2XCC A;  3PNL B;  4JZY A;  3QWP A;  4TUU A;  2LO6 A;  1FVH A;  4APF A;  3ASD A;  1N0Q A;  2XQ0 A;  4RG6 A;  3LY9 A;  4GTM A;  5KJN A;  3ASN E;  3OAW A;  2FEZ A;  1BI8 B;  3D9L A;  1JWF A;  1LF8 A;  3G2W A;  4FUL A;  4JC8 A;  4UWL A;  3Q79 A;  2E0I A;  2WM9 A;  2DZO A;  4NUR A;  5JJ6 A;  2WQ7 A;  2R5S A;  1IQR A;  3CHO A;  4D10 C;  5ITZ F;  3TWV A;  2WB2 A;  1WAO 1;  3D9P A;  4GTS A;  4Q94 A;  4G1T A;  4YVQ C;  3Q5M A;  3P1U A;  4FC8 A;  2MOW A;  4JD2 G;  3BU8 A;  4URK A;  3MCX A;  3RO3 A;  4CGW A;  3BG0 B;  3ZFW A;  1EF1 C;  3I5P A;  3E30 A;  2RD0 A;  2X6J A;  3CQC B;  3FH5 A;  4HOT A;  4K0R A;  3I4R B;  1KPS B;  5AYW D;  1EYH A;  4YDY A;  5CBN A;  3PEU B;  2GGF A;  4UQZ A;  4JEU A;  2KCL A;  2XGM A;  2J9Q A;  3CVV A;  4I6J A;  4GTO A;  2BKG A;  4V3I A;  3U64 A;  4DI4 A;  1JPL A;  4J7W A;  2KZT B;  5AQ9 A;  3RIB A;  3FU6 A;  2NC9 A;  3FTS A;  4GA2 A;  4ANX A;  3DBS A;  3SFY A;  4PDX A;  2XCB A;  4N2S A;  5HKP A;  4CT0 A;  5CED B;  5HI7 A;  2IO2 C;  4KYO B;  4MBG A;  3UM0 A;  3VLE A;  2CFU A;  3EHN A;  3R7Q A;  3Q7F A;  2IO3 C;  2QZA A;  3SBT B;  3LPZ A;  4G24 A;  5EID A;  1B89 A;  3G2V A;  4CDM A;  1K1B A;  1UN8 A;  3U9W A;  4I6E A;  3ZW3 A;  3E33 A;  5AQ7 A;  5FZQ A;  4RLY A;  3AAA C;  4FJZ A;  2VGX B;  2BED A;  4YDO A;  2H6G A;  3CVU A;  3KAE A;  5LFA A;  2OVF A;  4JEH A;  4B0Z A;  2X6F A;  4L7T A;  5E75 A;  1U3C A;  3WG7 E;  5FIO A;  3PE3 A;  3V31 A;  1TNU A;  2IOL A;  3O48 A;  3B7S A;  3VTX A;  4IUL A;  3S7D A;  4I1A A;  3UQ3 A;  2ZGD A;  3IHV A;  2P9I G;  4ACL A;  3APD A;  4CT4 A;  4PH4 B;  1HE8 A;  3GYZ A;  2WVI A;  4JXT A;  1N11 A;  5ENR D;  3HXE A;  1NI1 A;  5G05 J;  1E8Y A;  2GRO B;  5KJL A;  2V8S E;  3CV0 A;  3UPV A;  3CHP A;  2XRY A;  2DYS E;  2A5U A;  3GW4 A;  3JUI A;  1ZB1 A;  4OYS A;  4UQY A;  4B8C B;  3PNT B;  3C3Q A;  3TG4 A;  3J5Q B;  4L23 A;  2JEK A;  3PUK A;  1X81 A;  4OAV B;  2XRZ A;  2BUG A;  2VSX E;  3DSX A;  2CHW A;  2P9N G;  1HG5 A;  4F53 A;  3CVN A;  1AWC B;  3LVQ E;  3QWW A;  4DUI A;  3DPD A;  2JAB A;  3DST A;  3Q47 B;  3HG0 D;  4GZ6 A;  2H6F A;  3C72 A;  4WND A;  3R7R A;  5G04 C;  3G2T A;  3LCA A;  4ANU A;  3I4G A;  1BU9 A;  5KNG A;  3L9T A;  3TWS A;  4AOF A;  3FH7 A;  2WXQ A;  1IXV A;  4HLL A;  3L08 A;  4U96 D;  1N4P A;  3ESK A;  1JUQ A;  3N71 A;  1RW2 A;  2YQ8 A;  4GU5 A;  3ASO E;  1JCR A;  4AVX A;  2PQR A;  3URZ A;  3NB2 A;  3UM2 A;  4J6I A;  3I3N A;  1TNO A;  3CST A;  3TG5 A;  2WXI A;  1N0R A;  2RKK A;  3HHM A;  4LEU A;  4AJW A;  2QC9 A;  4HOQ A;  2DWZ A;  3F6Q A;  4F3V A;  1FT2 A;  4I43 A;  4LSZ E;  4UQX A;  4Z68 A;  4CDN A;  3UKR G;  2KBX A;  3OXG A;  3IHY A;  1LD7 A;  1INZ A;  3NQP A;  4I9C A;  3L13 A;  3Q15 A;  3AG2 E;  1TN7 A;  4LNU D;  4G25 A;  5BXO A;  5ANL A;  3DPY A;  3FUD A;  4HI8 A;  5FWQ A;  5BT1 A;  3FEX A;  3RKV A;  4GMJ A;  4BSZ B;  3QAQ A;  1MYO A;  1E8Z A;  2UY1 B;  1JCQ A;  5FQ7 A;  5FQ8 A;  3TWU A;  3ZN3 A;  3PVL A;  3ZNG A;  4A3V A;  5FTP A;  3GZ1 A;  2WQ6 A;  3HXD A;  4JB8 P;  3V2O A;  4ATG A;  4K03 A;  1P5Q A;  2LXM A;  5FQ4 A;  3D9H A;  4A1S A;  4O1O A;  3TJP A;  1FT1 A;  4L1B A;  1YMP A;  3EHR A;  3FTU A;  3UT7 A;  4JHJ A;  3SQV A;  3RSE G;  1A17 A;  4GYY A;  3JUE A;  2NYJ A;  2A5E A;  1K1A A;  2L9B A;  4ANV A;  2BTD A;  1H2V C;  2FI7 A;  5KCM A;  4GTQ A;  1DCQ A;  4GCO A;  3FTY A;  4I6G A;  4KMO A;  3FP3 A;  3VTY A;  2VGY A;  3FEY A;  3DEO A;  4YVO A;  2XGO A;  1SA5 A;  4MRU A;  1QNF A;  1ZU2 A;  4O1P A;  2FO7 A;  3CGH A;  3HDX A;  3CKB A;  4UI9 C;  4ILH B;  3D9N A;  3JYS A;  1V55 E;  1G3N B;  5A23 A;  4GYW A;  1WM5 A;  3CK9 A;  4FA6 A;  1A5E A;  2GW1 A;  5T3R A;  2EIM E;  3ASH A;  5ARG A;  1NZN A;  4C0E A;  2LUH A;  4I2Z A;  2IQC A;  1H6P A;  3MGB A;  4BER A;  2GRN B;  4BX8 A;  3Q75 A;  4WNE A;  2OEW A;  1N4R A;  2LNI A;  4DX6 D;  5LCW C;  1ELW A;  2J49 A;  1TNY A;  2KCV A;  3QDN A;  3TXN A;  3ULE G;  1MJ0 A;  1RZ4 A;  4LUN U;  2VJ8 A;  3BUA A;  3UT4 A;  3Q9N C;  2P9S G;  3CHR A;  4H7X A;  2PNN A;  3G2U A;  3AU4 A;  4HB5 A;  4BT8 A;  2J4D A;  2QYU A;  2LSV A;  1O5M A;  1DCE A;  4Y6C A;  2ILR A;  2CG2 A;  2KM4 A;  3FWV A;  2RFM A;  4DPR A;  3LS8 A;  2EIN E;  1MX6 A;  3VLF A;  5CHE E;  3U4T A;  1H6K A;  5EX0 A;  3FDH A;  3W9G A;  3AS8 A;  5D2M C;  3AU5 A;  4WNG A;  4XI9 A;  4DLQ A;  4RVB A;  2LSU A;  3L54 A;  1TNZ A;  2XEH A;  3SGH A;  2NSZ A;  3B95 A;  1WG0 A;  4RG9 A;  5C1D A;  2LAI A;  3DRA A;  3CK7 A;  4MLP A;  2XGS A;  1KZP A;  4ILG A;  2WXM A;  4K5A B;  3Q7A A;  2EIJ E;  1SZA A;  4M7C A;  2WPV A;  3RRM B;  1BD8 A;  4BY6 A;  3IV0 A;  1UOH A;  1Y6I A;  4F1P A;  2V5Q C;  4U0Z A;  5D0O D;  3D9J A;  2MRI A;  2IJG X;  3IKO B;  2I2O A;  4CGV A;  3TWQ A;  5AAO A;  2QYJ A;  4DX1 A;  1OCC E;  4L9P A;  3TAX A;  2L0I A;  3CKC A;  3L82 A;  2H6H A;  5BUZ A;  2XEN A;  1H2U A;  4R7L A;  3CHQ A;  2GRP B;  1OXJ A;  1Z5S C;  3UM3 A;  5JHA A;  1OUV A;  3FUF A;  5KJM A;  2MYO A;  3FFL A;  3KD7 A;  3S2A A;  2PZI A;  4AP2 A;  4FAD A;  3RJV A;  4JA7 A;  3HXF A;  2YIN A;  2ZU6 B;  4JA9 A;  2CHX A;  3ASF A;  4EHM A;  4M3O A;  4EZJ A;  2WXK A;  2L6B A;  3T8K A;  1QZ2 A;  1FCH A;  1NP7 A;  2X6H A;  5C2Y A;  4BTB A;  5B1A E;  1PAQ A;  4DK5 A;  5EYP F;  5EIB E;  3SI5 A;  2IU1 A;  3DSV A;  4A1G A;  1HZ4 A;  3TXM A;  3QK0 A;  1SA4 A;  2Y3A A;  1OT8 A;  3ABM E;  3LDZ A;  4KZ0 A;  3JXJ A;  1S0P A;  4N39 A;  2QFC A;  4N5C A;  4FLH A;  3ZPJ A;  3RO2 A;  1HF8 A;  3MYV A;  2LAH A;  3SNX A;  3KEZ A;  1NA0 A;  4HOR A;  5E76 A;  3OXF A;  4KVM A;  1YCS B;  2DZN A;  4HNA D;  3QAR A;  5AN8 A;  4BWR A;  3G2S A;  1HFA A;  3SFZ A;  3FUJ A;  1TR4 A;  3EJN A;  3CK8 A;  4G11 A;  4HLE A;  2XZT G;  1YA0 A;  4NQ0 A;  4TRQ A;  1OWO A;  4BT9 A;  3HIZ A;  5FJY A;  4F7A A;  2Y1L E;  3ZHE B;  4ME2 A;  2X38 A;  1OWL A;  3CLJ A;  4GTV A;  3EHM A;  4JVS A;  5FT9 A;  3CSF A;  4CYM D;  2AXU A;  4HRL A;  4MS6 A;  3S7B A;  3LKU A;  1EDU A;  4BEP A;  3C3R A;  3HXB A;  4I17 A;  4LRZ A;  4LNB A;  2J8S D;  2NXP A;  4IRU A;  2XS1 A;  5M72 A;  1IHG A;  3FU0 A;  3RRN B;  2I6H A;  2PM6 A;  3P2B A;  4CRW A;  4KT6 B;  1AP7 A;  4GZC A;  3DXK G;  1HS6 A;  2VGE A;  4ILI A;  3D9I A;  4ZHB A;  5IY5 E;  5ENQ D;  3Q4A B;  3B7R L;  3NZU A;  2F8X K;  2OV8 A;  3E32 A;  2ZIS A;  1BPO A;  3B7U X;  2DVW A;  3LJ3 A;  1QBQ A;  2KC7 A;  4I1O B;  4G8K A;  1E96 B;  2XPZ A;  4U95 D;  4I2W A;  3UX4 A;  2C0M A;  2WMO A;  4N3B A;  3ZYL A;  2WXJ A;  1MHQ A;  3ASG A;  3UUX A;  4AEZ C;  5J90 A;  3Q78 A;  5G55 A;  1UW4 B;  4QFV A;  3UTM A;  5CER B;  4AY5 A;  4BET A;  4LNG A;  1OCO E;  5EX3 A;  3T5V A;  2DIW A;  5T4Y A;  4BX9 A;  4GYO A;  3FUH A;  5HS0 A;  1IHB A;  3FUL A;  4F6R D;  3AJI A;  1V54 E;  4HI9 A;  4FHK A;  4WWO A;  5G05 C;  4CDR A;  3DEP A;  1YYH A;  5HRY A;  3JXI A;  2BKK B;  5LX8 A;  3EU5 A;  3LY8 A;  3KEA A;  4G8L A;  3T8M A;  4E6H A;  4TUM A;  1XNF A;  4QQI A;  2P9K G;  4L2Y A;  3PRE A;  3E37 A;  2VSN A;  1N4Q A;  1S64 A;  4FJY A;  4CZ2 D;  2AVP A;  5ARF A;  1H0A A;  3SD5 A;  3EUV A;  1IQU A;  4DJA A;  1H19 A;  1N4S A;  2DCP A;  4ANW A;  2RG8 A;  5CMY A;  1D8D A;  4I1M A;  2VSO E;  3ONL A;  5JJT A;  3OXL A;  4HFG A;  1OCZ E;  2IEJ A;  3NBN B;  3EIQ C;  2J07 A;  3ZVV A;  4HOS A;  2GRQ B;  2H6I A;  5BV1 A;  1KT1 A;  1L5J A;  5AAR A;  2I1J A;  4GZ3 A;  3FUN A;  2R2L A;  3ML9 A;  2M63 A;  2IY0 C;  3QKY A;  2OVB A;  4G26 A;  4J0U A;  5A6C A;  4EPZ A;  2J4B A;  1UN9 A;  3SO8 A;  4N3C A;  4UUC A;  4YND A;  2B6C A;  2FF4 A;  1W3B A;  3SZ7 A;  2VTB A;  3NF1 A;  3L17 A;  4HXI A;  4JHK A;  4AV7 A;  4DX7 D;  2X6K A;  2KZT A;  4K5B A;  4PS7 A;  3E34 A;  3ZKJ A;  2RFA A;  3FH8 A;  4E85 A;  3B7T A;  2AJA A;  2V0P A;  4XKC A;  2R02 A;  3BEE A;  2ION A;  1TYQ G;  5CMW A;  1KZO A;  1U3D A;  3QB2 A;  4RSY A;  2WXH A;  1H2T C;  1JWG A;  1QYM A;  4B89 A;  1OCR E;  3V30 A;  5KWD A;  3E4B A;  4U07 A;  2Y0B G;  4J8E A;  4X8Q A;  3QC1 A;  3HXC A;  2AWI A;  4GZD A;  5JHB A;  4DI3 A;  3MA5 A;  2Y4T A;  1TJC A;  2VGX A;  4K5C A;  4NRH B;  4GML A;  3ZU7 B;  5FZS A;  4J8Y A;  4EBA G;  4U0U A;  4O60 A;  1O1S A;  3UM1 A;  2R03 A;  3PZ1 A;  4UWH A;  3EDT B;  5CRV A;  1H6O A;  4FP7 A;  2XEV A;  3GZ2 A;  2B0O E;  2F0Y A;  3PRZ A;  3Q49 B;  1E8W A;  1DNP A;  1VDY A;  5FQ6 A;  4G23 A;  5AJL A;  1D9S A;  2IF4 A;  2J09 A;  3AG3 E;  2OOE A;  1SW6 A; 
#chains in the Genus database with same CATH homology
 2XEH A;  3DEO A;  4TUM A;  3J5Q B;  5JA4 D;  1AP7 A;  4DX7 D;  4HRN A;  4QQI A;  4U8V D;  5ENO D;  3B95 A;  3UI2 A;  4OAV B;  1WG0 A;  4K5B A;  2VGE A;  4O1P A;  4LNU D;  5EYP F;  5CBO A;  3ZKJ A;  2RFA A;  3C5R A;  4ZHB A;  5BXO A;  5EIB E;  1BLX B;  1BI8 B;  1S70 B;  4YDW A;  3EHQ A;  2AJA A;  5EID A;  5ENQ D;  1K1B A;  1AWC B;  5D66 A;  4CZ2 D;  4DUI A;  3B7B A;  1OT8 A;  2JAB A;  3Q9U C;  4HI8 A;  5AQ7 A;  2F8X K;  1G3N B;  3IXE A;  3TWW A;  2KXP C;  2DZO A;  5CEC B;  3HG0 D;  3JXJ A;  4K5A B;  5BXU A;  5CEA A;  4NIK A;  5EYL A;  1A5E A;  4RLY A;  4BSZ B;  1MYO A;  3AAA C;  2DVW A;  1QYM A;  1BD8 A;  3V30 A;  5KWD A;  5ITZ F;  3TWV A;  1UOH A;  3TWU A;  4F1P A;  2V5Q C;  1BU9 A;  5KNG A;  2Y0B G;  3ZUV B;  5EN5 D;  4U8Y D;  4DX5 D;  3TWS A;  3ZNG A;  2XZD G;  4BER A;  1K3Z D;  1YCS B;  5EIL A;  5JMN D;  1BI7 B;  4G8K A;  1MX4 A;  1IXV A;  2DZN A;  4HLL A;  4HNA D;  4U95 D;  3EU9 A;  4U96 D;  5AN8 A;  4DX6 D;  4JB8 P;  3V2O A;  3TWT A;  5FIO A;  4HQD A;  3TWQ A;  1OY3 D;  5AQA A;  3TWX A;  4N5Q A;  5AAO A;  2QYJ A;  2ETB A;  2ETC A;  3V31 A;  3T9K A;  4DX1 A;  1TR4 A;  3NBN B;  3V79 K;  1MJ0 A;  1WDY A;  5ENP D;  4A63 B;  2XZT G;  5KBA A;  2F8Y A;  4GPM A;  4K5C A;  4C48 B;  3NOG D;  4HRM B;  3Q9N C;  3ZU7 B;  2XEN A;  4QFV A;  3D9H A;  3UTM A;  2HE0 A;  4O1O A;  2ZGD A;  5AAR A;  3J5P A;  4J8Y A;  2PNN A;  4YDY A;  1N0R A;  4O60 A;  1NFI E;  5ENT D;  5CBN A;  5CER B;  4BET A;  2Y1L E;  2V4H C;  4HB5 A;  1MX2 A;  5FIN A;  4DX2 A;  3TWR A;  1YMP A;  3EHR A;  5AQB A;  3UXG A;  2QC9 A;  2BKG A;  2ETA A;  5HS0 A;  4B93 B;  4CYM D;  2DWZ A;  3F6Q A;  1IHB A;  2NYJ A;  2A5E A;  3JUE A;  3LJN A;  4HRL A;  1K1A A;  5KNH D;  2MYO A;  4F6R D;  4LSZ E;  1DC2 A;  2ZGG A;  2RFM A;  3AJI A;  4Z68 A;  1N11 A;  2B0O E;  4J7W A;  4HI9 A;  4GMR A;  1SVX A;  5ENR D;  3SO8 A;  4LG6 A;  5AQ9 A;  2KBX A;  3NOC D;  4ZFH A;  1MX6 A;  4OAU C;  4UUC A;  1DCQ A;  4DRX E;  4BES A;  2P2C P;  3DEP A;  4BEP A;  1YYH A;  3V2X A;  5HRY A;  2F37 A;  3JXI A;  2BKK B;  4ATZ D;  3W9G A;  1D9S A;  2FO1 E;  2J8S D;  3W9F A;  5ENS D;  2XEE A;  3T8K A;  2L6B A;  1N0Q A;  5HKP A;  4HBD A;  5CED B;  1IKN D;  3KEA A;  4G8L A;  1SW6 A;  3HRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...