3QAKA

Agonist bound structure of the human adenosine a2a receptor
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
453
structure length
444
Chain Sequence
IMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYRSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an agonist-bound human A2A adenosine receptor.
pubmed doi rcsb
molecule keywords Adenosine receptor A2a,lysozyme chimera
molecule tags Signaling protein, hydrolase
source organism Homo sapien
total genus 167
structure length 444
sequence length 453
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2011-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 3qakA02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3qakA01
1QT6A 2KS9A 3S3CB 1PY6A 1QSQA 1IW9A 1L32A 229LA 4HYJA 3DMZA 4EA3A 1T8GA 222LA 2O79A 2PEDA 1CU0A 1C6EA 5AHZA 2RB1X 2EI4A 1C6LA 1C6CA 1LGXA 1QUHA 3COCA 1P6YA 4PXFA 234LA 1QT4A 4G71B 4W55A 3ZPQA 1SSWA 1L36A 1L13A 3HU9A 1KGBA 1ZWNA 1L04A 211LA 123LA 4OV0A 3C9LA 3ABWA 3GULA 2I35A 1B6IA 4FPDA 217LA 1L02A 1QTVA 4GRVA 5JJNA 1C6PA 5TGZA 3EH5B 4IAPA 2KSAA 1VJMA 3HTGA 1L14A 1QT5A 3OE6A 256LA 3DDLA 4BWBA 1AP9A 1S8LA 1D3FA 2B74A 1L22A 1L15A 2OE4X 4XTOA 2WJLA 1L21A 3CDQA 3UTVA 2Z55A 3HARA 3CDTA 3CDRA 1L47A 4A4MA 3SBAA 4IARA 4JQ6A 2Y00A 3QBKA 3QAKA 1L40A 4I7MA 5A44A 3G3XA 2B6ZA 1C6KA 138LA 2L78A 1FBBA 1L48A 250LA 1L46A 2OE9X 1L86A 159LA 1OVHA 2RBOA 1L00A 2QPEB 1G0LA 209LA 4W53A 2OTYX 1L0MA 3SN6R 3HTDA 216LA 163LA 4PK0A 1S53A 130LA 4GPOA 1I6SA 3DMXA 3S8FB 1S8JA 1CV0A 2M3GA 1OWZA 129LA 4LZMA 4HYXA 1BRRA 1G0QA 3S8GB 1CU2A 2B73A 2HULA 3PQRA 233LA 3HUAA 1L17A 1OYUA 1L61A 149LA 3C8QA 1JGJA 5B6WA 5ETZA 3UTYA 1SX2A 4BV0A 1AT9A 1L79A 4ARLA 4BEZA 4FA7B 1C66A 3CDOA 195LA 5H2IA 1XMEB 4W52A 1E12A 4G72B 5JJJA 1Q5IA 3QJVB 5H2PA 4EPFA 2RAYX 3REYA 227LA 5A45A 1L82A 1L73A 1XEPA 2F47A 1G1VA 180LA 1L92A 1C60A 1PQIA 5G2CA 3MBVA 1L99A 1JV7A 3DN4A 2NTGA 4YXAC 4EKQA 3AM6A 1CV5A 1L58A 1L56A 5H2OA 3X3BA 1QTCA 244LA 2F93A 104LA 201LA 1LYEA 126LA 114LA 6LZMA 4TL3A 3VHZA 1C6MA 1CV3A 1L91A 3GUKA 1MGYA 1ZURA 178LA 3HAOA 1L49A 1L39A 1UAZA 1G0GA 5H2HA 3DMVA 2OU8A 1BRDA 1L18A 5B35A 1CV4A 2A4TA 1L63A 4ARMB 1O0AA 5BR2A 1QKOA 3DN3A 110LA 1P46A 3QBLA 3DN6A 2YCYA 2J4YA 1L69A 4X31A 172LA 2NTHA 1L01A 4I7SA 3HASA 3DKEX 1ZYTA 3OAXA 1C3WA 2RH1A 4KNFA 1P3NA 242LA 3QDCA 5ITCA 189LA 3VG9A 2F2QA 2RB0X 1L9HA 3S3BB 2ZFEA 2HUKA 1WTHA 3X3CA 1DYCA 3EH3B 103LA 4ARQB 109LA 2B72A 3PBLA 4ARMA 1P64A 2LCBA 3C7YA 5H2MA 1C8SA 3UG9A 1C68A 174LA 3QJUB 2YDOA 1L93A 1DYGA 3G3VA 2I20A 3HUQA 1D2WA 1NHBA 3C7ZA 3F8VA 261LA 1L29A 4XT3A 3OE8A 1CV1A 3DQBA 111LA 1P7SA 4JR8A 4W56A 4W57A 1L74A 259LA 2ANXA 1P8HA 3PXOA 5A8EA 3HAQA 3NS0A 1L33A 1L35A 3DN2A 1SSYA 4I7NA 4I7OA 4ARQA 1OVKA 2WJKA 5H2LA 1BM1A 4IAQA 1L55A 4MQTA 4UG2A 1L20A 199LA 3C7WA 3QJSB 4I7TA 190LA 1CV6A 1P37A 1D3MA 3HT6A 4ARJA 228LA 4QI1A 1UCQA 2I1XA 4EIYA 245LA 1L87A 3AYMA 1L77A 1CVKA 1SWZA 3RZEA 1KG8A 4KLYA 1L30A 187LA 4DJHA 1X0K1 4G7RB 5B6YA 1C6GA 1L28A 1G06A 5LZMA 219LA 1L51A 3V2YA 1H68A 235LA 1C6JA 1G0PA 1QTZA 3ODUA 206LA 1L53A 1LYIA 3GUMA 226LA 1L94A 4GP8B 3ZPRA 1PQKA 120LA 152LA 1C6QA 1OWYA 1QUDA 4NC3A 5G2AA 3T45A 112LA 1L0JA 3QJQB 1P56A 3QBGA 1JFPA 2X72A 5J7AA 107LA 2Y02A 118LA 1L60A 2O7AA 2B6WA 2Y01A 4XT1A 5G36A 168LA 1QS5A 5AHYA 1L0KA 3D4SA 3GUIA 1D9WA 4LDLA 1L81A 3F9LA 1L34A 1L68A 1CU3A 1QUGA 4GP4B 177LA 1PXRA 1L42A 1OVJA 1QM8A 143LA 1LGWA 3DN0A 3HU8A 181LA 4DAJA 1L07A 238LA 1L09A 1PQDA 4FAAB 1SWYA 4AQNA 1D2YA 148LE 2JAGA 2QB0B 3NSBA 170LA 1GUEA 4GP5B 5AX0A 4W51A 175LA 2RBNA 1L96A 3L64A 3LZMA 2R4RA 1LYJA 236LA 1R84A 2ZZLA 145LA 1G0MA 1KW5A 1JTNA 3HTFA 3V2WA 1L75A 239LA 1L05A 1L65A 2OU0X 4W59A 2RBSA 1IW6A 1CUQA 1L26A 3PDSA 1XJIA 1QHJA 4PXKA 2OU9A 1T6HA 3KJ6A 218LA 205LA 2Q9DA 1L84A 3HT7A 1BRXA 5LWEA 157LA 1L95A 1S51A 3GUOA 1C8RA 4MD2A 4I7PA 1G0KA 188LA 1L23A 2YCZA 260LA 1L98A 3HH3A 4PJZA 1L45A 4EJ4A 4EXMA 4XTNA 5H2JA 4MQSA 140LA 1L89A 1CX7A 1L25A 5FJGA 3SB9A 158LA 1T97A 1C6AA 162LA 5G28A 3HUKA 5B0WA 4GYCA 5F8UA 225LA 3EH4B 1L72A 1QS9A 2OEAX 3HAPA 3HT8A 5KKHA 1XIOA 240LA 1DYEA 1L43A 1L24A 1LYGA 2OE7X 2L6XA 3GUNA 4UHRA 137LA 4I7LA 4IB4A 113LA 4EKSA 2R4SA 5EN0A 5DYSA 2LC9A 3OE0A 2LNLA 4BUOA 1KMEA 1CUPA 210LA 4J4QA 166LA 1L38A 251LA 1C67A 3C81A 1L76A 4E97A 1C6FA 131LA 4YXCA 1KY0A 2AT9A 2IGCA 4W58A 3UTXA 3PWHA 1PQJA 1T8FA 243LA 160LA 4MBSA 192LA 3DN1A 1C65A 1L80A 3SB7A 1L97A 221LA 213LA 186LA 156LA 161LA 4X1HA 1L54A 4XTLA 1G07A 3L2XA 248LA 220LA 1QKPA 1L52A 3C83A 4BVNA 1C6TA 1L67A 3CODA 5DHHA 2Y03A 1G0JA 2B6TA 1QSBA 4G7QB 3AYNA 1L08A 3OE9A 3UZAA 1LPYA 4JKVA 1JTMA 197LA 1LWKA 1L64A 3DN8A 3EMLA 2VT4A 1SX7A 1P5CA 5DHGA 150LA 4W54A 2ANVA 1C6NA 1QTDA 1LLHA 1P36A 1L57A 3DNAA 196LA 4LDEA 4X32A 3C82A 2B7XA 2KSYA 4MD1A 1QT8A 128LA 3QJRB 4I7QA 3WQJA 3SB6A 252LA 1QTHA 1KG9A 1C6HA 1L62A 139LA 5I14A 4QIDA 214LA 1LI6A 3HT9A 1QT3A 1TLAA 1C69A 144LA 2RAZX 4WAVA 185LA 2B6XA 4EPIA 3C9MA 3ZEVA 1TN5A 102LA 3FI5A 4I7RA 1U19A 184LA 1L70A 1G1WA 147LA 1CTWA 1XJUA 119LA 1LGUA 3CDVA 3VI0A 4I7JA 1QTBA 1EHKB 1KW7A 1OV5A 1M0KA 1M0LA 3C8RA 198LA 1C61A 5G54A 1OV7A 3NYAA 1P2LA 191LA 2Z6BA 3UTWA 1C6DA 3C8SA 4DKLA 1P2RA 1F50A 1C62A 253LA 3BVDB 4QRYA 108LA 4G70B 1M0MA 1KS3A 3HH5A 5AX1A 183LA 3UZCA 3UONA 3VVKA 2NTWA 1DYFA 4K5YA 212LA 3C80A 3SB8A 2Y04A 4ARPA 1LYFA 2RB2X 3HDEA 3S3DB 2O4WA 2QARC 1PQOA 3HWLA 3A7KA 1LI2A 171LA 258LA 232LA 165LA 241LA 2OTZX 1CWQA 1VGOA 4GBRB 2ZIYA 5H2KA 5H2NA 115LA 257LA 1KNIA 127LA 1XJTA 2B75A 1L11A 2B70A 1E0PA 1F88A 155LA 1LI3A 3FA0A 3NY8A 2G87A 1L88A 4HWLA 2HPYA 141LA 1L83A 1L44A 237LA 5G53A 4L35A 5B6ZA 4EKRA 246LA 1L12A 1P8UA 1LW9A 5B6XA 3VW7A 2BRDA 4EKPA 7LZMA 4GBRA 1JV6A 2RBRA 5AZDA 1C6BA 1S52A 1T8AA 5AWZA 230LA 2B6YA 1LYDA 5BR5A 169LA 1JQUA 142LA 2F32A 4XXJA 5ITEA 1CU6A 1L85A 1S54A 2RBQA 167LA 1R2NA 254LA 231LA 182LA 2YDVA 5JJEA 151LA 3SB5A 3SBBC 4N6HA 1L41A 4N4YB 1DYDA 1P8IA 1PXSA 4L6RA 1L03A 1DZEA 3JR6A 3QJTB 1C64A 1L10A 1CU5A 5G2DA 1L06A 3RUNA 1L27A 4I7KA 146LA 1L31A 1PQMA 2Z73A 3HH6A 1X0I1 3VGAA 3RFMA 1KY1A 3P0GA 1L50A 1K28A 262LA 3GUPA 125LA 247LA 4BEYA 1D3NA 1L59A 3K2RA 176LA 1CX6A 4AMIA 5B2NA 4YX7C 1QUOA 200LA 3HDFA 1GU8A 1DYBA 5B6VA 1L37A 224LA 3NY9A 3HH4A 1L90A 2CUUA 122LA 1Q5JA 3G3WA 1LYHA 1LN6A 1L71A 4ZPUA 4S0WA 4OO9A 4N4WA 3HTBA 1FBKA 5B34A 4G7SB 1L19A 2JAFA 2QPDB 3FADA 1QT7A 2I21A 2KSBA 2YCWA 164LA 5C1MA 2F95A 2YCXA 1EPYA 1L16A 3QAPA 4WW3A 1C6IA 255LA 2NTUA 1L66A 1LWGA 1D3JA 1GZMA 1IXFA 4LDOA 3CAPA 4Y9HA 1X0SA 249LA 2Q9EA 1F4ZA 1C63A 215LA 2LZMA 4FBZA 1TN0A 3GUJA 3HANA 1HZXA 3QBIA 173LA 2RBPA 223LA 1H2SA 4AMJA 1DYAA 2HUMA
chains in the Genus database with same CATH superfamily
1JTOL 5KXOA 1OUIA 4NGZA 5AHZA 4J1BA 1RCMA 2RB1X 5HMVA 2FBDA 1C6LA 1QUHA 3OK0A 1C10A 4W55A 2H9KA 1L13A 2HEEA 3RW8A 2MECA 4OOTA 1KGBA 4OWEA 1YL1X 6LYTA 1B7RA 4FPDA 217LA 4IAPA 1LHKA 1QT5A 3DDLA 1GFKA 2BQFA 1L22A 2CDSA 1B5UA 3IJVA 1L21A 3P68A 1OUGA 3UTVA 1IWWA 1L47A 3TMWA 4IARA 1V7TA 1GB5A 4NFVA 3QBKA 1B7OA 2B5ZA 2B6ZA 2MEFA 3WUMA 2BQIA 1LJIA 1L86A 159LA 1L00A 2QPEB 3SN6R 3HTDA 216LA 1S53A 4KL7A 1UIGA 4DD2A 1I56A 4QGZA 1OWZA 4CHXA 4LZMA 4H94A 1CU2A 1LJJA 233LA 1LJFA 1ZVHL 1JGJA 3UTYA 4FA7B 4ARLA 1HSWA 3CDOA 195LA 3IJUA 3J6KA 5KY1A 5H2IA 4W52A 1E12A 1Q5IA 1VATA 1L82A 2FYDA 3CQLA 1L99A 3DN4A 1ZV5L 2NTGA 3TMUA 1L56A 4B4JA 3X3BA 2H9JA 2F93A 104LA 3A3QA 4HP0A 1VEDA 7LYZA 4NSIA 5LAFA 4TL3A 1QIOA 2LYMA 1L91A 1ZURA 1L49A 1L39A 4HJVA 4X3BA 1O0AA 1UIEA 110LA 3TXFA 2FBBA 2J4YA 4X31A 3OAXA 2RH1A 4NEBA 5ITCA 1XEKA 1L9HA 3S3BB 3EH3B 3PBLA 2B72A 2LCBA 2LHMA 2ZQ4A 5F14A 1QQYA 1XGUC 3HUQA 2BQAA 4XT3A 1D0MA 3A34A 4HPEA 259LA 2ANXA 208LA 3HAQA 1L33A 4I7NA 2WJKA 1OVKA 4IAQA 1GBSA 1AM7A 4RW1A 3AJNA 2MEEA 1UCQA 1LYYA 2I1XA 245LA 1GFJA 1SWZA 1CVKA 4DWXA 3RZEA 1L30A 1HENA 3FI7A 3E3DA 1UUZC 5B6YA 5LZMA 1L51A 4R6CA 1G0PA 3GUMA 1LJHA 152LA 1OWYA 3A96A 5T3FA 1JFPA 168LA 1QS5A 2D6BA 3GUIA 4HJZA 4Z46A 1L81A 2W1LA 3F9LA 4H9FA 4GP4B 1QUGA 143LA 3DN0A 4DAJA 238LA 1VFBC 2PC2A 3A95A 2QB0B 170LA 5AX0A 5L3HA 1LAAA 1IR7A 1L96A 3QY4A 2HU1A 2ZZLA 2OU0X 4NGJA 134LA 4W59A 2RBSA 1L26A 5LA5A 4EMNA 1XJIA 4PXKA 2OU9A 1KIQC 1BRXA 157LA 1S51A 1C8RA 1G0KA 4U3XB 188LA 1L23A 2YCZA 4DC4A 4G9SA 3AZ7A 5I53A 5H2JA 4LYBA 1CX7A 3BKVA 1GFEA 4GN3A 3SB9A 3LZTA 2X0AA 162LA 2LZTA 5G28A 1XIOA 1DYEA 1CKFA 1LYGA 2L6XA 1BB3A 1ZVYB 3ZVQB 2ZIKA 4EKSA 2HECA 5DYSA 1LJ3A 1JISA 4BUOA 4PHIA 4TX7A 4YXCA 2IGCA 4W58A 3UTXA 2D4IA 4ETDA 3PWHA 2Y8PA 3ZVQA 1L80A 2YVBA 213LA 161LA 4XTLA 1G07A 1HFXA 1B7NA 1L52A 4BVNA 1C6TA 4XJHA 5DN4A 2EKSC 1QSBA 1L08A 3OE9A 1LPYA 1IP6A 1NMMA 4IJ4A 1B2KA 1GB2A 5HQ1A 3TXDA 150LA 1WQQA 4W54A 2ANVA 1WTMA 2NWDX 2Q0MX 4J1AA 1FLQA 128LA 4I7QA 5HNLA 3SB6A 1QTHA 1C6HA 1L62A 139LA 2Z2EA 1YKZX 4QIDA 3HT9A 3ATNA 1DI3A 1KXYA 1TLAA 2HUBA 144LA 4LYZA 4ML7A 1TN5A 3FI5A 1IY3A 4I7RA 1U19A 1BGIA 3AZ4A 3VI0A 4I7JA 1OV5A 1D6PA 1OV7A 5KKIA 1LZ8A 4OWAA 3UTWA 5ILCA 3C8SA 1P2RA 1F50A 2EPEA 1IP4A 1HMLA 3HH5A 4WM2A 5AX1A 3UZCA 3VVKA 1LZRA 3WYHA 1DYFA 4K5YA 2ZIJA 1LYFA 3S3DB 1LZ6A 3A7KA 3W6BA 3CB7A 1LI2A 4AXTA 1REXA 165LA 1SLYA 1VGOA 1CWQA 5H2KA 5H2NA 2F4GA 4NGLA 1FKVA 257LA 4ETCA 127LA 3GXKA 5KXPA 2DQAA 1JKDA 3WVYA 1E0PA 4UWVA 1F88A 3FA0A 4HJYA 1JJ1A 5APDA 2ZNXY 5G53A 4L35A 5B6ZA 4EKRA 3VW7A 3WU7A 3A90A 1XSFA 5HNCA 2BQEA 1OQMA 2B6YA 169LA 4PGJB 4WLDA 4H9BA 2RBQA 167LA 254LA 182LA 3N9EA 151LA 3SBBC 4N6HA 1LJ4A 4GLAA 1P8IA 1L03A 2BQGA 4MR1A 1IIZA 4LYMA 1LSFA 4W96A 3JR6A 1L10A 1B7LA 1FLYA 1JITA 3CSQA 2BQOA 3EO5A 1BWJA 1DPXA 3A6CY 3P0GA 2YBJA 5M1YA 4YX7C 1J1OY 1D6QA 1YIKA 224LA 3NY9A 3HH4A 3QNGA 1LYHA 5LVJA 1LJEA 3TXKA 1GPQC 3HTBA 5IDDA 5B34A 1L19A 2F2NA 2JAFA 2QPDB 2RSCA 1DPWA 3FADA 2KSBA 3A8ZA 4I8SA 4DDAA 3F6ZA 1GZMA 3CAPA 249LA 1VDSA 215LA 2LZMA 1IC5Y 2BQHA 3HANA 1HZXA 135LA 3N9AA 1TBYA 1H2SA 4AMJA 2O4WA 1QT6A 2KS9A 3S3CB 1QSQA 1IW9A 229LA 4EA3A 3DMZA 1LMOA 2PEDA 1CU0A 1C6EA 2ZYPA 2EI4A 5DLAA 5F9UA 4H1PA 4WM5A 1GEZA 4PXFA 5APCA 1QT4A 3TMXA 3ZPQA 4WG7A 5FHWA 211LA 1GB7A 4H9EA 4XJFA 5TGZA 1XGPC 4RLNA 2KSAA 1OUEA 2MEGA 1PZYA 1AP9A 1D0KA 1S8LA 5F9XA 2B74A 4HPIA 5B05A 132LA 1DKJA 2WJLA 3CDQA 3CDTA 3CDRA 2CGIA 2Y00A 3QAKA 4DYGA 5A44A 1VAUA 2Z2FA 2HEAA 1C6KA 1AZFA 1L46A 1DXJA 1REZA 4CGEA 209LA 163LA 3AW6A 4G49A 1CKCA 1LZCA 2I25L 129LA 1G0QA 2B73A 2FYCA 194LA 1L17A 1W08A 2BLXA 3C8QA 1GE4A 5ETZA 1SX2A 5JJJA 2CWIA 4EPFA 1HELA 4HSFA 1L73A 2LZ2A 2F47A 1JV7A 2ZQ3A 3P66A 5H2OA 1VDTA 1GBYA 201LA 3A6BY 1B5VA 2MEAA 1TAYA 1LSMA 1HEPA 1GDXA 4GCCA 3VHZA 6LZMA 1JUGA 2MEDA 3GUKA 3W3EA 1G0GA 5H2HA 3DMVA 1BRDA 1L18A 1CV4A 1YAMA 5BR2A 3AZ6A 3DN3A 3DN6A 172LA 5APEA 1LMQA 1EQEA 1P3NA 242LA 189LA 2RB0X 1LSGA 4UWUA 1DYCA 2CJLA 4Z3MA 4WG1A 1FDLY 1GF0A 4ETEA 1CNSA 1C68A 2YDOA 4DDBA 2I20A 1D2WA 1B7MA 261LA 1L29A 3OE8A 1CV1A 4WOAA 3DQBA 1LOZA 1IEEA 4UWNA 3PXOA 1L35A 3DN2A 1SSYA 4H8XA 5H2LA 1BQLY 1BB6A 1L20A 1LYSA 3QJSB 1TEWA 1NDMC 190LA 4I7TA 4DD0A 5AMYA 4QI1A 4EIYA 1L87A 1UIAA 1O23A 4WL7A 3WU8A 1G7MC 4KLYA 187LA 4DJHA 4G7RB 4TUNA 1YAPA 3A67Y 3V2YA 235LA 1AKIA 2BQDA 1HFZA 2YBIA 5I4YA 1L94A 4GP8B 2DQDY 120LA 1C6QA 1LSCA 2W1YA 1P2CC 2ZYCA 2ZWBA 1F6SA 1EL1A 1L0JA 2AUBA 1P56A 3QBGA 1LSZA 5J7AA 1GBZA 1L60A 2Y02A 5FDJA 2B6WA 2Y01A 5G36A 4EOFA 1L0KA 1GBWA 1UIBA 2G4NA 1D9WA 5LXWA 4QEQA 4H9HA 1PS5A 1QM8A 4OWHA 3HU8A 2IHLA 1L07A 4FAAB 1F10A 1SWYA 1LZ1A 4AQNA 1D2YA 3W6AA 1IO5A 2JAGA 3NSBA 1LZTA 4Z98A 1GXXA 3LZMA 2MEBA 1LYJA 1R84A 1LHIA 5KXMA 1CKGA 2HEBA 3PDSA 1AT5A 3WPJA 205LA 3HT7A 5LWEA 1GB0A 1L95A 3GUOA 4N1EI 260LA 1G7HC 4PJZA 4XTNA 1L45A 1C43A 3B0OA 5LVKA 4OW1A 225LA 2BQLA 3EH4B 1L72A 154LA 3HAPA 5KKHA 5LAGA 2N5ZA 2OE7X 4B49A 5LYTA 3GUNA 4UHRA 2XJWA 4A7DA 2R4SA 5EN0A 2LC9A 2LNLA 1KMEA 1IVMA 4TSCA 1QDRA 4KT3A 131LA 1KY0A 3WMKA 1PQJA 1IP2A 1IWYA 192LA 4P2EA 1C65A 3SB7A 156LA 220LA 1QKPA 4WM1A 1GF5A 4G4BA 4JKVA 1LWKA 3MGWA 3DN8A 2VT4A 1T3PA 2C8PA 5F81A 4DQ7A 1IP5A 4E3UA 1CKDA 3HBDA 2ZNWY 1LHHA 1IOCA 1QTDA 1LHJA 1UCOA 2DQGY 1JEFA 4LDEA 4X32A 2B7XA 4NWEA 4NGKA 252LA 1OUAA 4OOOA 4NWHA 1QT3A 1C69A 4RLMA 4WAVA 185LA 2B6XA 4N9RA 4GN5C 4G4HA 102LA 4ZIXA 1LMNA 1CTWA 4TWSA 1LGUA 4XJIA 1HEWA 1KW7A 193LA 1B5YA 1G7LC 1C61A 2Z19A 4BS7A 1KXXA 191LA 2Z6BA 4B1AA 1C62A 5I4XA 1KS3A 3M3UA 183LA 1B7SA 1TCYA 1LHLA 2Y04A 3TXIA 4ARPA 1PQOA 3HWLA 258LA 115LA 4LZTA 4H90A 1KNIA 5KXNA 2A7FA 4LT2A 2B75A 2Z39A 1GFAA 1NBYC 1LI3A 4R0FA 1UICA 4HWLA 2HPYA 5D5FA 1HNLA 4DD7A 237LA 1JKCA 2W1MA 1HERA 1L12A 1P8UA 3D3DA 4EKPA 1JV6A 1LMCA 2DQJY 3B72A 3ULRA 1GFRA 1S54A 231LA 3J4GA 3G3AB 1OUBA 1YAQA 1DYDA 1PXSA 1LSNA 4L6RA 4PRQA 1DZEA 1LPIA 1TDYA 3QJTB 1C64A 1PQMA 1LSDA 3RFMA 4LT3A 1YL0X 1L59A 1VDQA 1QUOA 4H91A 5B6VA 122LA 1HEMA 2XBSA 1LN6A 4ZPUA 4S0WA 3W6CA 4N4WA 1FBKA 2YBMA 3QE8A 1BWHA 1YKXX 164LA 5C1MA 2YCXA 3QAPA 4N0JA 4NGWA 2BQNA 2Q9EA 1C63A 1F4ZA 1DKKA 173LA 2RBPA 1DYAA 1PY6A 1OP9B 4HTQA 5IELA 4HYJA 222LA 2O79A 1F0WA 1YILA 3COCA 1P6YA 2H5ZA 1FBIX 1IX0A 3RT5X 5FSTA 123LA 4OV0A 3C9LA 1HFYA 3ABWA 1IWUA 4GRVA 1QTVA 2EQLA 3HTGA 1LHMA 1RFPA 1YKYX 1L15A 3KAMA 4IASA 4AGAA 1QDTA 1J1PY 2Z55A 3HARA 3AGHA 1IORA 138LA 4M4OA 1L48A 5ILFA 1OVHA 2BQKA 1L0MA 4W53A 2DQFC 4GPOA 5I54A 1REMA 1S8JA 3S8FB 2M3GA 2XQOA 5LYZA 3WVXA 5LVHA 3A3RX 3PQRA 3TXJA 3HUAA 4ZFPA 3N9CA 5B07A 1GHLA 5B6WA 1AT9A 1C66A 4WLXA 1XMEB 4G72B 3QJVB 3REYA 227LA 4H8YA 2DBTA 6LYZA 1C60A 5G2CA 3MBVA 4GCFA 3W6DA 4EKQA 1LJGA 1IC7Y 1CV5A 3RZ4A 4ANRA 1JTTL 1LYEA 4GCDA 5IHGA 2BQJA 1IWVA 114LA 1C6MA 1CV3A 4LYCA 3HAOA 178LA 4RDSA 1GFVA 3AYQA 5B35A 4YEMA 2A4TA 3WUNA 1L63A 4O34A 4ARMB 4NHQA 4TSBA 4HTNA 1QKOA 1P46A 2ZILA 2Z37A 2YCYA 1L69A 3LYMA 2NTHA 1GXV2 3HASA 1ZYTA 1YANA 5C6LA 3LHMA 4KNFA 1GF3A 2F2QA 4NY5A 1MLCE 2HUKA 1WTHA 3X3CA 103LA 4ARQB 4ARMA 1LCNA 1P64A 3OJPA 1QSWA 5H2MA 3LYOA 1C8SA 3UG9A 3TXEA 3QJUB 1NHBA 3C7ZA 3F8VA 4NGVA 3WULA 111LA 1BB4A 1P7SA 4W56A 4W57A 5DL9A 1LKRA 1GE1A 1P8HA 1D9UA 3IWRA 3NS0A 4I7OA 1FLUA 1GAZA 4ARQA 1ALCA 1BM1A 1L55A 4N1CC 4UG2A 1EQ4A 1IWTA 4YENA 1P37A 3WU9A 1D3MA 3AYMA 5KJ9A 1LSYA 3A91A 1X0K1 1L28A 1LSAA 219LA 1C6JA 1B5XA 1JHLA 3P65A 5E4PA 1GF6A 1QTZA 3ODUA 1G7IC 4XADA 2DQHY 1QUDA 2Z38A 3B0KA 112LA 3QJQB 2X72A 2DKVA 107LA 1JKBA 118LA 4XT1A 1QUTA 3D4SA 2LYOA 1HF4A 1CU3A 1DI4A 3CT5A 1WQRA 5EBHA 1LGWA 1WQOA 2YSSC 181LA 1L09A 1BVXA 1B7QA 3AGGG 1LZ9A 4YOPA 4GP5B 1BHZA 2RBNA 3L64A 5KKJA 2R4RA 236LA 3CSZA 1G0MA 1GB9A 3A92A 3V2WA 4GCBA 4LYOA 3WPLA 1GAYA 1J1XY 4DD1A 1QHJA 1T6HA 3KJ6A 1QSAA 4HV1A 1T6VL 1NBZC 1NF5A 1JKAA 1WQNA 4EJ4A 4EXMA 1IP1A 4ET8A 140LA 1L89A 1L25A 133LA 5FJGA 5LA8A 1T97A 1C6AA 1NWGA 5F8UA 3HT8A 1IP7A 5DM9A 1HEQA 4OWCA 4RW2A 1L43A 137LA 4IB4A 113LA 1XEJA 5C6JA 2DQCY 1KIPC 2I6ZA 4DDCA 3EMSA 1WQPA 1CUPA 210LA 4G4CA 4DT3A 1LKSA 251LA 1L76A 1LZBA 1C6FA 4H9CA 5I5QA 1JPOA 243LA 5LVIA 3T6UA 160LA 3DN1A 1LSEA 2G4QA 1L97A 221LA 5KXLA 186LA 1L54A 5APFA 3CODA 5DHHA 2Y03A 1G0JA 8LYZA 3RNXA 3AYNA 4ETAA 5D5CA 3UZAA 197LA 1L64A 1SX7A 1P5CA 5DHGA 4CFPA 4W94A 1KXWA 1C6NA 3DNAA 196LA 5K7OA 1LMAA 3C82A 1QT8A 1LZEA 3A94A 1QUSA 3QJRB 2XTHA 3TMVA 1KG9A 1UBZA 2GV0A 1CJ7A 1CKHA 1WQMA 3C9MA 1NKHA 4OWBA 1L70A 1G1WA 147LA 1B5WA 1XJUA 119LA 3CT1A 3CDVA 1M0KA 4PJ2C 1REYA 1JWRA 4QY9A 1C6DA 5JENB 4DKLA 3BVDB 108LA 4G70B 3UONA 2NTWA 5KXTA 3C80A 3SB8A 2RB2X 5A3ZA 2QARC 1JJ0A 1RI8B 4PPOA 1BB5A 1IOQA 171LA 232LA 2ZIYA 4NHIA 5HMJA 5A3EA 4MSTA 1XJTA 3BKHA 3CSRA 3W6FA 5II3A 1L11A 2B70A 2BLYA 141LA 1GFTA 1LJKA 4HTKA 1GD6A 246LA 1IWXA 1LW9A 3W6EA 2BRDA 4H9AA 7LZMA 5L9JA 5AZDA 1C6BA 4II8A 1T8AA 4MCKA 5AWZA 230LA 2VB1A 1JQUA 2F32A 142LA 1LZNA 2YDVA 5JJEA 4Z41A 4WL6A 4BAFA 1OUJA 1UC0A 1L41A 2G4PA 3P64A 1GE2A 1CU5A 5G2DA 1IOSA 3T36A 1L27A 4NIJA 2Z73A 3HH6A 3HBEX 1L50A 125LA 247LA 3EXDA 1D3NA 4BEYA 3K2RA 176LA 1CX6A 4AMIA 5B2NA 4CFOA 1GU8A 1IY4A 1JSEA 3G3WA 4GCEA 3ZEKA 4OO9A 1GF4A 4G7SB 2YBLA 2I21A 2W1XA 2F95A 5I4WA 1EPYA 1L16A 4WW3A 1C6IA 255LA 2NTUA 4YEOA 3WXTA 1L66A 5LINA 2A7DA 1D3JA 4Y9HA 4BAPA 4ETBA 1GF7A 4FBZA 1TN0A 3GUJA 3LZ2A 3QBIA 223LA 153LA 4HV2A 2HUMA 1WTNA 4NHTA 1L32A 1RE2A 1T8GA 3B6LA 1C45A 1GEVA 1NQIA 1C6CA 1LGXA 1XFPL 234LA 2MEIA 4G71B 1SSWA 4KPMA 1L36A 1LZYA 3HU9A 1ZWNA 1L04A 1QTEA 3WXUA 3GULA 3ATOA 1B6IA 3M18B 4H8ZA 2I35A 1L02A 5JJNA 1C6PA 3EH5B 5B1GA 4DQ5A 5HLLA 1VJMA 4BWBA 1L14A 1LMPA 256LA 3OE6A 1D3FA 3TXBA 1OUFA 2OE4X 4XTOA 3CT0A 1B7PA 1Z55A 1HSXA 4A4MA 3SBAA 4NSJA 4JQ6A 1L40A 4I7MA 3G3XA 2L78A 1FBBA 1IP3A 3EBAB 250LA 4YM8A 5C6IA 2OE9X 1IOTA 4NSHA 1G7JC 2RBOA 4B0DA 1G0LA 2OTYX 3TXHA 4YF2A 4PK0A 1BB7A 130LA 1I6SA 3DMXA 1CV0A 1V7SA 4HYXA 1BRRA 3S8GB 2HULA 1INUA 5KXSA 1OYUA 1L61A 1I20A 149LA 2D4KA 2Z12A 4BV0A 1L79A 4BEZA 1NHEA 4B4IA 5H2PA 3HBHA 2RAYX 5A45A 4FDYA 1XEPA 1G1VA 180LA 4GN4A 1L92A 1PQIA 2DQIY 1BVKC 4YXAC 1YQVY 3AM6A 1L58A 2BQBA 1QTCA 244LA 3AGIA 126LA 1UA6Y 1GB8A 4FJRA 1MGYA 1WVUA 4XENA 1UAZA 3WW6A 2OU8A 1GE3A 5FEKA 1H87A 4QDNA 1YROA 2BQCA 3QBLA 4NHPA 1B9OA 1L01A 4I7SA 3DKEX 1YAOA 9LYZA 1C3WA 1EQ5A 3QDCA 2I26L 3VG9A 1B0DA 1HC0A 2ZFEA 4N5RA 4WM4A 1H6MA 2YDGA 4WO6A 109LA 2F4AA 3C7YA 3LYZA 174LA 207LA 1L93A 1XEIA 1DYGA 1LSPA 3G3VA 5LYMA 1IC4Y 5KXZA 4M6DA 4JR8A 1C08C 1L74A 5A8EA 3A93A 4MQTA 199LA 3C7WA 1CV6A 5B59A 5KXKA 3HT6A 4ARJA 228LA 5LVGA 1L77A 1KG8A 4LGKA 3LN2A 2Z18A 1C6GA 2BPUA 1G06A 1H68A 1LZ4A 5B1FA 3AB6A 1W6ZA 206LA 4PRUA 1L53A 1LYIA 4H9IA 226LA 3ZPRA 2HEFA 1PQKA 4H92A 4NC3A 5G2AA 3T45A 1JSFA 1LMTA 4XJGA 2HEDA 3AZ5A 1MELL 2O7AA 4C5FA 5AHYA 4TTDA 4NGIA 5DN5A 3D9AC 4LDLA 5LIOA 1L34A 1AT6A 1FN5A 1L68A 177LA 1PXRA 1L42A 4NG8A 1OVJA 1A4VA 1PQDA 3HFMY 5J7CA 148LE 1GUEA 4W51A 175LA 1IR9A 5E9RA 145LA 1KW5A 1GFUA 1JTNA 3HTFA 1L75A 239LA 1UIHA 4WMGA 1L05A 1L65A 4WLTA 4DS7E 5B06A 4WLYA 1IW6A 1B5ZA 3GXRA 1CUQA 4LFXA 3WPKA 218LA 4NG1A 2Q9DA 1L84A 1UIFA 1HHLA 4MD2A 4I7PA 1LZ5A 1L98A 3HH3A 1LZAA 5FCPA 2LYZA 4MQSA 158LA 1D0LA 1JIYA 3HUKA 5B0WA 3TXGA 4GYCA 1GFHA 1QS9A 3AW7A 2OEAX 1SQ2L 240LA 1L24A 4NHSA 1CJ8A 4I7LA 1GFGA 1GF9A 1C7PA 5L3IA 3OE0A 3LYTA 1E8LA 4J4QA 4C3WA 2MEHA 166LA 1LSBA 1L38A 4WM6A 3C81A 1C67A 3WW5A 1IR8A 4E97A 2AT9A 3K3TA 3FE0A 5KXWA 1KIRC 1T8FA 4MBSA 4XN6A 1DI5A 1OUHA 4X1HA 3L2XA 248LA 4L41A 2BQMA 3C83A 4XYYA 1L67A 2B6TA 4G7QB 1GBOA 4CJ2A 1JTMA 3EMLA 1LJNA 1GF8A 1LLHA 1P36A 1L57A 4BADA 2KSYA 4MD1A 1N4FA 1WVVA 5KXRA 4NGYA 3WQJA 4WM3A 5I14A 214LA 1LI6A 3B0IA 1I1ZA 1F6RA 2RAZX 2BAAA 4EPIA 3ZEVA 1QTKA 1A2YC 1VDPA 2D4JA 2YBHA 184LA 3WH1A 5F16A 1ZMYL 2IFFY 4DD3A 1EHKB 1QTBA 1RJCB 1M0LA 1FKQA 3C8RA 198LA 3SP3A 5G54A 1XGQC 3NYAA 1P2LA 4I0CA 1JTPL 4B4EA 3WUAA 1OUCA 1LTMA 253LA 4QRYA 1M0MA 5KXYA 3RU5A 4D9ZA 2HTXA 212LA 3HDEA 4IATA 1NDGC 1DQJC 2D91A 4LFPA 5KXXA 4N8ZA 4WO9A 241LA 2OTZX 4GBRB 1XGRC 2HU3A 2DQEY 155LA 3NY8A 2G87A 1L88A 1L83A 1L44A 1C46A 1HEOA 4LT0A 4XJDA 4ET9A 1JJ3A 1LYOA 5B6XA 1GB3A 4GBRA 2RBRA 1DZBX 1S52A 4KXIA 1LYZA 5BR5A 1LYDA 4XXJA 5ITEA 1FLWA 1CU6A 1L85A 1R2NA 2C8OA 2F30A 1GDWA 3SB5A 1HMKA 5FELA 1UIDA 4N4YB 1UACY 4LT1A 1LZSA 1IWZA 1GB6A 4H93A 4LYTA 4DQJA 1L06A 3RUNA 1BWIA 4NGOA 4I7KA 146LA 1L31A 1X0I1 3VGAA 1OUDA 1KY1A 1CJ9A 1K28A 262LA 3WL2A 3GUPA 1GBXA 3G3BB 200LA 3HDFA 1DYBA 1L37A 1L90A 2CUUA 1Q5JA 1L71A 1GE0A 4J7VA 4XJBA 1LZDA 1QT7A 4NSGA 2YCWA 2EIZC 4J0LA 2WARA 2YBNA 1LWGA 1IXFA 3P4ZA 2XBRA 4LDOA 3VWOA 4ZEEA 1X0SA 1CJ6A 1XGTC 1LZGA 1GWDA 4GLVA 4DD9A
chains in the Genus database with same CATH topology
1JTOL 5KXOA 1OUIA 4NGZA 5AHZA 4J1BA 1RCMA 2RB1X 5HMVA 2FBDA 1C6LA 1QUHA 3OK0A 1C10A 4W55A 2H9KA 1L13A 2HEEA 3RW8A 2MECA 4OOTA 1KGBA 4OWEA 1YL1X 6LYTA 1B7RA 4FPDA 217LA 4IAPA 1LHKA 1QT5A 3DDLA 1GFKA 2BQFA 1L22A 2CDSA 1B5UA 3IJVA 1L21A 3P68A 1OUGA 3UTVA 1IWWA 1L47A 3TMWA 4IARA 1V7TA 1GB5A 4NFVA 3QBKA 1B7OA 2B5ZA 2B6ZA 2MEFA 3WUMA 2BQIA 1LJIA 1L86A 159LA 1L00A 2QPEB 3SN6R 3HTDA 216LA 1S53A 4KL7A 1UIGA 4DD2A 1I56A 4QGZA 1OWZA 4CHXA 4LZMA 4H94A 1CU2A 1LJJA 233LA 1LJFA 1ZVHL 1JGJA 3UTYA 4FA7B 4ARLA 1HSWA 3CDOA 195LA 3IJUA 3J6KA 5KY1A 5H2IA 4W52A 1E12A 1Q5IA 1VATA 1L82A 2FYDA 3CQLA 1L99A 3DN4A 1ZV5L 2NTGA 3TMUA 1L56A 4B4JA 3X3BA 2H9JA 2F93A 104LA 3A3QA 4HP0A 1VEDA 7LYZA 4NSIA 5LAFA 4TL3A 1QIOA 2LYMA 1L91A 1ZURA 1L49A 1L39A 4HJVA 4X3BA 1O0AA 1UIEA 110LA 3TXFA 2FBBA 2J4YA 4X31A 3OAXA 2RH1A 4NEBA 5ITCA 1XEKA 1L9HA 3S3BB 3EH3B 3PBLA 2B72A 2LCBA 2LHMA 2ZQ4A 5F14A 1QQYA 1XGUC 3HUQA 2BQAA 4XT3A 1D0MA 3A34A 4HPEA 259LA 2ANXA 208LA 3HAQA 1L33A 4I7NA 2WJKA 1OVKA 4IAQA 1GBSA 1AM7A 4RW1A 3AJNA 2MEEA 1UCQA 1LYYA 2I1XA 245LA 1GFJA 1SWZA 1CVKA 4DWXA 3RZEA 1L30A 1HENA 3FI7A 3E3DA 1UUZC 5B6YA 5LZMA 1L51A 4R6CA 1G0PA 3GUMA 1LJHA 152LA 1OWYA 3A96A 5T3FA 1JFPA 168LA 1QS5A 2D6BA 3GUIA 4HJZA 4Z46A 1L81A 2W1LA 3F9LA 4H9FA 4GP4B 1QUGA 143LA 3DN0A 4DAJA 238LA 1VFBC 2PC2A 3A95A 2QB0B 170LA 5AX0A 5L3HA 1LAAA 1IR7A 1L96A 3QY4A 2HU1A 2ZZLA 2OU0X 4NGJA 134LA 4W59A 2RBSA 1L26A 5LA5A 4EMNA 1XJIA 4PXKA 2OU9A 1KIQC 1BRXA 157LA 1S51A 1C8RA 1G0KA 4U3XB 188LA 1L23A 2YCZA 4DC4A 4G9SA 3AZ7A 5I53A 5H2JA 4LYBA 1CX7A 3BKVA 1GFEA 4GN3A 3SB9A 3LZTA 2X0AA 162LA 2LZTA 5G28A 1XIOA 1DYEA 1CKFA 1LYGA 2L6XA 1BB3A 1ZVYB 3ZVQB 2ZIKA 4EKSA 2HECA 5DYSA 1LJ3A 1JISA 4BUOA 4PHIA 4TX7A 4YXCA 2IGCA 4W58A 3UTXA 2D4IA 4ETDA 3PWHA 2Y8PA 3ZVQA 1L80A 2YVBA 213LA 161LA 4XTLA 1G07A 1HFXA 1B7NA 1L52A 4BVNA 1C6TA 4XJHA 5DN4A 2EKSC 1QSBA 1L08A 3OE9A 1LPYA 1IP6A 1NMMA 4IJ4A 1B2KA 1GB2A 5HQ1A 3TXDA 150LA 1WQQA 4W54A 2ANVA 1WTMA 2NWDX 2Q0MX 4J1AA 1FLQA 128LA 4I7QA 5HNLA 3SB6A 1QTHA 1C6HA 1L62A 139LA 2Z2EA 1YKZX 4QIDA 3HT9A 3ATNA 1DI3A 1KXYA 1TLAA 2HUBA 144LA 4LYZA 4ML7A 1TN5A 3FI5A 1IY3A 4I7RA 1U19A 1BGIA 3AZ4A 3VI0A 4I7JA 1OV5A 1D6PA 1OV7A 5KKIA 1LZ8A 4OWAA 3UTWA 5ILCA 3C8SA 1P2RA 1F50A 2EPEA 1IP4A 1HMLA 3HH5A 4WM2A 5AX1A 3UZCA 3VVKA 1LZRA 3WYHA 1DYFA 4K5YA 2ZIJA 1LYFA 3S3DB 1LZ6A 3A7KA 3W6BA 3CB7A 1LI2A 4AXTA 1REXA 165LA 1SLYA 1VGOA 1CWQA 5H2KA 5H2NA 2F4GA 4NGLA 1FKVA 257LA 4ETCA 127LA 3GXKA 5KXPA 2DQAA 1JKDA 3WVYA 1E0PA 4UWVA 1F88A 3FA0A 4HJYA 1JJ1A 5APDA 2ZNXY 5G53A 4L35A 5B6ZA 4EKRA 3VW7A 3WU7A 3A90A 1XSFA 5HNCA 2BQEA 1OQMA 2B6YA 169LA 4PGJB 4WLDA 4H9BA 2RBQA 167LA 254LA 182LA 3N9EA 151LA 3SBBC 4N6HA 1LJ4A 4GLAA 1P8IA 1L03A 2BQGA 4MR1A 1IIZA 4LYMA 1LSFA 4W96A 3JR6A 1L10A 1B7LA 1FLYA 1JITA 3CSQA 2BQOA 3EO5A 1BWJA 1DPXA 3A6CY 3P0GA 2YBJA 5M1YA 4YX7C 1J1OY 1D6QA 1YIKA 224LA 3NY9A 3HH4A 3QNGA 1LYHA 5LVJA 1LJEA 3TXKA 1GPQC 3HTBA 5IDDA 5B34A 1L19A 2F2NA 2JAFA 2QPDB 2RSCA 1DPWA 3FADA 2KSBA 3A8ZA 4I8SA 4DDAA 3F6ZA 1GZMA 3CAPA 249LA 1VDSA 215LA 2LZMA 1IC5Y 2BQHA 3HANA 1HZXA 135LA 3N9AA 1TBYA 1H2SA 4AMJA 2O4WA 1QT6A 2KS9A 3S3CB 1QSQA 1IW9A 229LA 4EA3A 3DMZA 1LMOA 2PEDA 1CU0A 1C6EA 2ZYPA 2EI4A 5DLAA 5F9UA 4H1PA 4WM5A 1GEZA 4PXFA 5APCA 1QT4A 3TMXA 3ZPQA 4WG7A 5FHWA 211LA 1GB7A 4H9EA 4XJFA 5TGZA 1XGPC 4RLNA 2KSAA 1OUEA 2MEGA 1PZYA 1AP9A 1D0KA 1S8LA 5F9XA 2B74A 4HPIA 5B05A 132LA 1DKJA 2WJLA 3CDQA 3CDTA 3CDRA 2CGIA 2Y00A 3QAKA 4DYGA 5A44A 1VAUA 2Z2FA 2HEAA 1C6KA 1AZFA 1L46A 1DXJA 1REZA 4CGEA 209LA 163LA 3AW6A 4G49A 1CKCA 1LZCA 2I25L 129LA 1G0QA 2B73A 2FYCA 194LA 1L17A 1W08A 2BLXA 3C8QA 1GE4A 5ETZA 1SX2A 5JJJA 2CWIA 4EPFA 1HELA 4HSFA 1L73A 2LZ2A 2F47A 1JV7A 2ZQ3A 3P66A 5H2OA 1VDTA 1GBYA 201LA 3A6BY 1B5VA 2MEAA 1TAYA 1LSMA 1HEPA 1GDXA 4GCCA 3VHZA 6LZMA 1JUGA 2MEDA 3GUKA 3W3EA 1G0GA 5H2HA 3DMVA 1BRDA 1L18A 1CV4A 1YAMA 5BR2A 3AZ6A 3DN3A 3DN6A 172LA 5APEA 1LMQA 1EQEA 1P3NA 242LA 189LA 2RB0X 1LSGA 4UWUA 1DYCA 2CJLA 4Z3MA 4WG1A 1FDLY 1GF0A 4ETEA 1CNSA 1C68A 2YDOA 4DDBA 2I20A 1D2WA 1B7MA 261LA 1L29A 3OE8A 1CV1A 4WOAA 3DQBA 1LOZA 1IEEA 4UWNA 3PXOA 1L35A 3DN2A 1SSYA 4H8XA 5H2LA 1BQLY 1BB6A 1L20A 1LYSA 3QJSB 1TEWA 1NDMC 190LA 4I7TA 4DD0A 5AMYA 4QI1A 4EIYA 1L87A 1UIAA 1O23A 4WL7A 3WU8A 1G7MC 4KLYA 187LA 4DJHA 4G7RB 4TUNA 1YAPA 3A67Y 3V2YA 235LA 1AKIA 2BQDA 1HFZA 2YBIA 5I4YA 1L94A 4GP8B 2DQDY 120LA 1C6QA 1LSCA 2W1YA 1P2CC 2ZYCA 2ZWBA 1F6SA 1EL1A 1L0JA 2AUBA 1P56A 3QBGA 1LSZA 5J7AA 1GBZA 1L60A 2Y02A 5FDJA 2B6WA 2Y01A 5G36A 4EOFA 1L0KA 1GBWA 1UIBA 2G4NA 1D9WA 5LXWA 4QEQA 4H9HA 1PS5A 1QM8A 4OWHA 3HU8A 2IHLA 1L07A 4FAAB 1F10A 1SWYA 1LZ1A 4AQNA 1D2YA 3W6AA 1IO5A 2JAGA 3NSBA 1LZTA 4Z98A 1GXXA 3LZMA 2MEBA 1LYJA 1R84A 1LHIA 5KXMA 1CKGA 2HEBA 3PDSA 1AT5A 3WPJA 205LA 3HT7A 5LWEA 1GB0A 1L95A 3GUOA 4N1EI 260LA 1G7HC 4PJZA 4XTNA 1L45A 1C43A 3B0OA 5LVKA 4OW1A 225LA 2BQLA 3EH4B 1L72A 154LA 3HAPA 5KKHA 5LAGA 2N5ZA 2OE7X 4B49A 5LYTA 3GUNA 4UHRA 2XJWA 4A7DA 2R4SA 5EN0A 2LC9A 2LNLA 1KMEA 1IVMA 4TSCA 1QDRA 4KT3A 131LA 1KY0A 3WMKA 1PQJA 1IP2A 1IWYA 192LA 4P2EA 1C65A 3SB7A 156LA 220LA 1QKPA 4WM1A 1GF5A 4G4BA 4JKVA 1LWKA 3MGWA 3DN8A 2VT4A 1T3PA 2C8PA 5F81A 4DQ7A 1IP5A 4E3UA 1CKDA 3HBDA 2ZNWY 1LHHA 1IOCA 1QTDA 1LHJA 1UCOA 2DQGY 1JEFA 4LDEA 4X32A 2B7XA 4NWEA 4NGKA 252LA 1OUAA 4OOOA 4NWHA 1QT3A 1C69A 4RLMA 4WAVA 185LA 2B6XA 4N9RA 4GN5C 4G4HA 102LA 4ZIXA 1LMNA 1CTWA 4TWSA 1LGUA 4XJIA 1HEWA 1KW7A 193LA 1B5YA 1G7LC 1C61A 2Z19A 4BS7A 1KXXA 191LA 2Z6BA 4B1AA 1C62A 5I4XA 1KS3A 3M3UA 183LA 1B7SA 1TCYA 1LHLA 2Y04A 3TXIA 4ARPA 1PQOA 3HWLA 258LA 115LA 4LZTA 4H90A 1KNIA 5KXNA 2A7FA 4LT2A 2B75A 2Z39A 1GFAA 1NBYC 1LI3A 4R0FA 1UICA 4HWLA 2HPYA 5D5FA 1HNLA 4DD7A 237LA 1JKCA 2W1MA 1HERA 1L12A 1P8UA 3D3DA 4EKPA 1JV6A 1LMCA 2DQJY 3B72A 3ULRA 1GFRA 1S54A 231LA 3J4GA 3G3AB 1OUBA 1YAQA 1DYDA 1PXSA 1LSNA 4L6RA 4PRQA 1DZEA 1LPIA 1TDYA 3QJTB 1C64A 1PQMA 1LSDA 3RFMA 4LT3A 1YL0X 1L59A 1VDQA 1QUOA 4H91A 5B6VA 122LA 1HEMA 2XBSA 1LN6A 4ZPUA 4S0WA 3W6CA 4N4WA 1FBKA 2YBMA 3QE8A 1BWHA 1YKXX 164LA 5C1MA 2YCXA 3QAPA 4N0JA 4NGWA 2BQNA 2Q9EA 1C63A 1F4ZA 1DKKA 173LA 2RBPA 1DYAA 1PY6A 1OP9B 4HTQA 5IELA 4HYJA 222LA 2O79A 1F0WA 1YILA 3COCA 1P6YA 2H5ZA 1FBIX 1IX0A 3RT5X 5FSTA 123LA 4OV0A 3C9LA 1HFYA 3ABWA 1IWUA 4GRVA 1QTVA 2EQLA 3HTGA 1LHMA 1RFPA 1YKYX 1L15A 3KAMA 4IASA 4AGAA 1QDTA 1J1PY 2Z55A 3HARA 3AGHA 1IORA 138LA 4M4OA 1L48A 5ILFA 1OVHA 2BQKA 1L0MA 4W53A 2DQFC 4GPOA 5I54A 1REMA 1S8JA 3S8FB 2M3GA 2XQOA 5LYZA 3WVXA 5LVHA 3A3RX 3PQRA 3TXJA 3HUAA 4ZFPA 3N9CA 5B07A 1GHLA 5B6WA 1AT9A 1C66A 4WLXA 1XMEB 4G72B 3QJVB 3REYA 227LA 4H8YA 2DBTA 6LYZA 1C60A 5G2CA 3MBVA 4GCFA 3W6DA 4EKQA 1LJGA 1IC7Y 1CV5A 3RZ4A 4ANRA 1JTTL 1LYEA 4GCDA 5IHGA 2BQJA 1IWVA 114LA 1C6MA 1CV3A 4LYCA 3HAOA 178LA 4RDSA 1GFVA 3AYQA 5B35A 4YEMA 2A4TA 3WUNA 1L63A 4O34A 4ARMB 4NHQA 4TSBA 4HTNA 1QKOA 1P46A 2ZILA 2Z37A 2YCYA 1L69A 3LYMA 2NTHA 1GXV2 3HASA 1ZYTA 1YANA 5C6LA 3LHMA 4KNFA 1GF3A 2F2QA 4NY5A 1MLCE 2HUKA 1WTHA 3X3CA 103LA 4ARQB 4ARMA 1LCNA 1P64A 3OJPA 1QSWA 5H2MA 3LYOA 1C8SA 3UG9A 3TXEA 3QJUB 1NHBA 3C7ZA 3F8VA 4NGVA 3WULA 111LA 1BB4A 1P7SA 4W56A 4W57A 5DL9A 1LKRA 1GE1A 1P8HA 1D9UA 3IWRA 3NS0A 4I7OA 1FLUA 1GAZA 4ARQA 1ALCA 1BM1A 1L55A 4N1CC 4UG2A 1EQ4A 1IWTA 4YENA 1P37A 3WU9A 1D3MA 3AYMA 5KJ9A 1LSYA 3A91A 1X0K1 1L28A 1LSAA 219LA 1C6JA 1B5XA 1JHLA 3P65A 5E4PA 1GF6A 1QTZA 3ODUA 1G7IC 4XADA 2DQHY 1QUDA 2Z38A 3B0KA 112LA 3QJQB 2X72A 2DKVA 107LA 1JKBA 118LA 4XT1A 1QUTA 3D4SA 2LYOA 1HF4A 1CU3A 1DI4A 3CT5A 1WQRA 5EBHA 1LGWA 1WQOA 2YSSC 181LA 1L09A 1BVXA 1B7QA 3AGGG 1LZ9A 4YOPA 4GP5B 1BHZA 2RBNA 3L64A 5KKJA 2R4RA 236LA 3CSZA 1G0MA 1GB9A 3A92A 3V2WA 4GCBA 4LYOA 3WPLA 1GAYA 1J1XY 4DD1A 1QHJA 1T6HA 3KJ6A 1QSAA 4HV1A 1T6VL 1NBZC 1NF5A 1JKAA 1WQNA 4EJ4A 4EXMA 1IP1A 4ET8A 140LA 1L89A 1L25A 133LA 5FJGA 5LA8A 1T97A 1C6AA 1NWGA 5F8UA 3HT8A 1IP7A 5DM9A 1HEQA 4OWCA 4RW2A 1L43A 137LA 4IB4A 113LA 1XEJA 5C6JA 2DQCY 1KIPC 2I6ZA 4DDCA 3EMSA 1WQPA 1CUPA 210LA 4G4CA 4DT3A 1LKSA 251LA 1L76A 1LZBA 1C6FA 4H9CA 5I5QA 1JPOA 243LA 5LVIA 3T6UA 160LA 3DN1A 1LSEA 2G4QA 1L97A 221LA 5KXLA 186LA 1L54A 5APFA 3CODA 5DHHA 2Y03A 1G0JA 8LYZA 3RNXA 3AYNA 4ETAA 5D5CA 3UZAA 197LA 1L64A 1SX7A 1P5CA 5DHGA 4CFPA 4W94A 1KXWA 1C6NA 3DNAA 196LA 5K7OA 1LMAA 3C82A 1QT8A 1LZEA 3A94A 1QUSA 3QJRB 2XTHA 3TMVA 1KG9A 1UBZA 2GV0A 1CJ7A 1CKHA 1WQMA 3C9MA 1NKHA 4OWBA 1L70A 1G1WA 147LA 1B5WA 1XJUA 119LA 3CT1A 3CDVA 1M0KA 4PJ2C 1REYA 1JWRA 4QY9A 1C6DA 5JENB 4DKLA 3BVDB 108LA 4G70B 3UONA 2NTWA 5KXTA 3C80A 3SB8A 2RB2X 5A3ZA 2QARC 1JJ0A 1RI8B 4PPOA 1BB5A 1IOQA 171LA 232LA 2ZIYA 4NHIA 5HMJA 5A3EA 4MSTA 1XJTA 3BKHA 3CSRA 3W6FA 5II3A 1L11A 2B70A 2BLYA 141LA 1GFTA 1LJKA 4HTKA 1GD6A 246LA 1IWXA 1LW9A 3W6EA 2BRDA 4H9AA 7LZMA 5L9JA 5AZDA 1C6BA 4II8A 1T8AA 4MCKA 5AWZA 230LA 2VB1A 1JQUA 2F32A 142LA 1LZNA 2YDVA 5JJEA 4Z41A 4WL6A 4BAFA 1OUJA 1UC0A 1L41A 2G4PA 3P64A 1GE2A 1CU5A 5G2DA 1IOSA 3T36A 1L27A 4NIJA 2Z73A 3HH6A 3HBEX 1L50A 125LA 247LA 3EXDA 1D3NA 4BEYA 3K2RA 176LA 1CX6A 4AMIA 5B2NA 4CFOA 1GU8A 1IY4A 1JSEA 3G3WA 4GCEA 3ZEKA 4OO9A 1GF4A 4G7SB 2YBLA 2I21A 2W1XA 2F95A 5I4WA 1EPYA 1L16A 4WW3A 1C6IA 255LA 2NTUA 4YEOA 3WXTA 1L66A 5LINA 2A7DA 1D3JA 4Y9HA 4BAPA 4ETBA 1GF7A 4FBZA 1TN0A 3GUJA 3LZ2A 3QBIA 223LA 153LA 4HV2A 2HUMA 1WTNA 4NHTA 1L32A 1RE2A 1T8GA 3B6LA 1C45A 1GEVA 1NQIA 1C6CA 1LGXA 1XFPL 234LA 2MEIA 4G71B 1SSWA 4KPMA 1L36A 1LZYA 3HU9A 1ZWNA 1L04A 1QTEA 3WXUA 3GULA 3ATOA 1B6IA 3M18B 4H8ZA 2I35A 1L02A 5JJNA 1C6PA 3EH5B 5B1GA 4DQ5A 5HLLA 1VJMA 4BWBA 1L14A 1LMPA 256LA 3OE6A 1D3FA 3TXBA 1OUFA 2OE4X 4XTOA 3CT0A 1B7PA 1Z55A 1HSXA 4A4MA 3SBAA 4NSJA 4JQ6A 1L40A 4I7MA 3G3XA 2L78A 1FBBA 1IP3A 3EBAB 250LA 4YM8A 5C6IA 2OE9X 1IOTA 4NSHA 1G7JC 2RBOA 4B0DA 1G0LA 2OTYX 3TXHA 4YF2A 4PK0A 1BB7A 130LA 1I6SA 3DMXA 1CV0A 1V7SA 4HYXA 1BRRA 3S8GB 2HULA 1INUA 5KXSA 1OYUA 1L61A 1I20A 149LA 2D4KA 2Z12A 4BV0A 1L79A 4BEZA 1NHEA 4B4IA 5H2PA 3HBHA 2RAYX 5A45A 4FDYA 1XEPA 1G1VA 180LA 4GN4A 1L92A 1PQIA 2DQIY 1BVKC 4YXAC 1YQVY 3AM6A 1L58A 2BQBA 1QTCA 244LA 3AGIA 126LA 1UA6Y 1GB8A 4FJRA 1MGYA 1WVUA 4XENA 1UAZA 3WW6A 2OU8A 1GE3A 5FEKA 1H87A 4QDNA 1YROA 2BQCA 3QBLA 4NHPA 1B9OA 1L01A 4I7SA 3DKEX 1YAOA 9LYZA 1C3WA 1EQ5A 3QDCA 2I26L 3VG9A 1B0DA 1HC0A 2ZFEA 4N5RA 4WM4A 1H6MA 2YDGA 4WO6A 109LA 2F4AA 3C7YA 3LYZA 174LA 207LA 1L93A 1XEIA 1DYGA 1LSPA 3G3VA 5LYMA 1IC4Y 5KXZA 4M6DA 4JR8A 1C08C 1L74A 5A8EA 3A93A 4MQTA 199LA 3C7WA 1CV6A 5B59A 5KXKA 3HT6A 4ARJA 228LA 5LVGA 1L77A 1KG8A 4LGKA 3LN2A 2Z18A 1C6GA 2BPUA 1G06A 1H68A 1LZ4A 5B1FA 3AB6A 1W6ZA 206LA 4PRUA 1L53A 1LYIA 4H9IA 226LA 3ZPRA 2HEFA 1PQKA 4H92A 4NC3A 5G2AA 3T45A 1JSFA 1LMTA 4XJGA 2HEDA 3AZ5A 1MELL 2O7AA 4C5FA 5AHYA 4TTDA 4NGIA 5DN5A 3D9AC 4LDLA 5LIOA 1L34A 1AT6A 1FN5A 1L68A 177LA 1PXRA 1L42A 4NG8A 1OVJA 1A4VA 1PQDA 3HFMY 5J7CA 148LE 1GUEA 4W51A 175LA 1IR9A 5E9RA 145LA 1KW5A 1GFUA 1JTNA 3HTFA 1L75A 239LA 1UIHA 4WMGA 1L05A 1L65A 4WLTA 4DS7E 5B06A 4WLYA 1IW6A 1B5ZA 3GXRA 1CUQA 4LFXA 3WPKA 218LA 4NG1A 2Q9DA 1L84A 1UIFA 1HHLA 4MD2A 4I7PA 1LZ5A 1L98A 3HH3A 1LZAA 5FCPA 2LYZA 4MQSA 158LA 1D0LA 1JIYA 3HUKA 5B0WA 3TXGA 4GYCA 1GFHA 1QS9A 3AW7A 2OEAX 1SQ2L 240LA 1L24A 4NHSA 1CJ8A 4I7LA 1GFGA 1GF9A 1C7PA 5L3IA 3OE0A 3LYTA 1E8LA 4J4QA 4C3WA 2MEHA 166LA 1LSBA 1L38A 4WM6A 3C81A 1C67A 3WW5A 1IR8A 4E97A 2AT9A 3K3TA 3FE0A 5KXWA 1KIRC 1T8FA 4MBSA 4XN6A 1DI5A 1OUHA 4X1HA 3L2XA 248LA 4L41A 2BQMA 3C83A 4XYYA 1L67A 2B6TA 4G7QB 1GBOA 4CJ2A 1JTMA 3EMLA 1LJNA 1GF8A 1LLHA 1P36A 1L57A 4BADA 2KSYA 4MD1A 1N4FA 1WVVA 5KXRA 4NGYA 3WQJA 4WM3A 5I14A 214LA 1LI6A 3B0IA 1I1ZA 1F6RA 2RAZX 2BAAA 4EPIA 3ZEVA 1QTKA 1A2YC 1VDPA 2D4JA 2YBHA 184LA 3WH1A 5F16A 1ZMYL 2IFFY 4DD3A 1EHKB 1QTBA 1RJCB 1M0LA 1FKQA 3C8RA 198LA 3SP3A 5G54A 1XGQC 3NYAA 1P2LA 4I0CA 1JTPL 4B4EA 3WUAA 1OUCA 1LTMA 253LA 4QRYA 1M0MA 5KXYA 3RU5A 4D9ZA 2HTXA 212LA 3HDEA 4IATA 1NDGC 1DQJC 2D91A 4LFPA 5KXXA 4N8ZA 4WO9A 241LA 2OTZX 4GBRB 1XGRC 2HU3A 2DQEY 155LA 3NY8A 2G87A 1L88A 1L83A 1L44A 1C46A 1HEOA 4LT0A 4XJDA 4ET9A 1JJ3A 1LYOA 5B6XA 1GB3A 4GBRA 2RBRA 1DZBX 1S52A 4KXIA 1LYZA 5BR5A 1LYDA 4XXJA 5ITEA 1FLWA 1CU6A 1L85A 1R2NA 2C8OA 2F30A 1GDWA 3SB5A 1HMKA 5FELA 1UIDA 4N4YB 1UACY 4LT1A 1LZSA 1IWZA 1GB6A 4H93A 4LYTA 4DQJA 1L06A 3RUNA 1BWIA 4NGOA 4I7KA 146LA 1L31A 1X0I1 3VGAA 1OUDA 1KY1A 1CJ9A 1K28A 262LA 3WL2A 3GUPA 1GBXA 3G3BB 200LA 3HDFA 1DYBA 1L37A 1L90A 2CUUA 1Q5JA 1L71A 1GE0A 4J7VA 4XJBA 1LZDA 1QT7A 4NSGA 2YCWA 2EIZC 4J0LA 2WARA 2YBNA 1LWGA 1IXFA 3P4ZA 2XBRA 4LDOA 3VWOA 4ZEEA 1X0SA 1CJ6A 1XGTC 1LZGA 1GWDA 4GLVA 4DD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QT6 A;  2KS9 A;  3S3C B;  1PY6 A;  1QSQ A;  1IW9 A;  1L32 A;  229L A;  4HYJ A;  3DMZ A;  4EA3 A;  1T8G A;  222L A;  2O79 A;  2PED A;  1CU0 A;  1C6E A;  5AHZ A;  2RB1 X;  2EI4 A;  1C6L A;  1C6C A;  1LGX A;  1QUH A;  3COC A;  1P6Y A;  4PXF A;  234L A;  1QT4 A;  4G71 B;  4W55 A;  3ZPQ A;  1SSW A;  1L36 A;  1L13 A;  3HU9 A;  1KGB A;  1ZWN A;  1L04 A;  211L A;  123L A;  4OV0 A;  3C9L A;  3ABW A;  3GUL A;  2I35 A;  1B6I A;  4FPD A;  217L A;  1L02 A;  1QTV A;  4GRV A;  5JJN A;  1C6P A;  5TGZ A;  3EH5 B;  4IAP A;  2KSA A;  1VJM A;  3HTG A;  1L14 A;  1QT5 A;  3OE6 A;  256L A;  3DDL A;  4BWB A;  1AP9 A;  1S8L A;  1D3F A;  2B74 A;  1L22 A;  1L15 A;  2OE4 X;  4XTO A;  2WJL A;  1L21 A;  3CDQ A;  3UTV A;  2Z55 A;  3HAR A;  3CDT A;  3CDR A;  1L47 A;  4A4M A;  3SBA A;  4IAR A;  4JQ6 A;  2Y00 A;  3QBK A;  3QAK A;  1L40 A;  4I7M A;  5A44 A;  3G3X A;  2B6Z A;  1C6K A;  138L A;  2L78 A;  1FBB A;  1L48 A;  250L A;  1L46 A;  2OE9 X;  1L86 A;  159L A;  1OVH A;  2RBO A;  1L00 A;  2QPE B;  1G0L A;  209L A;  4W53 A;  2OTY X;  1L0M A;  3SN6 R;  3HTD A;  216L A;  163L A;  4PK0 A;  1S53 A;  130L A;  4GPO A;  1I6S A;  3DMX A;  3S8F B;  1S8J A;  1CV0 A;  2M3G A;  1OWZ A;  129L A;  4LZM A;  4HYX A;  1BRR A;  1G0Q A;  3S8G B;  1CU2 A;  2B73 A;  2HUL A;  3PQR A;  233L A;  3HUA A;  1L17 A;  1OYU A;  1L61 A;  149L A;  3C8Q A;  1JGJ A;  5B6W A;  5ETZ A;  3UTY A;  1SX2 A;  4BV0 A;  1AT9 A;  1L79 A;  4ARL A;  4BEZ A;  4FA7 B;  1C66 A;  3CDO A;  195L A;  5H2I A;  1XME B;  4W52 A;  1E12 A;  4G72 B;  5JJJ A;  1Q5I A;  3QJV B;  5H2P A;  4EPF A;  2RAY X;  3REY A;  227L A;  5A45 A;  1L82 A;  1L73 A;  1XEP A;  2F47 A;  1G1V A;  180L A;  1L92 A;  1C60 A;  1PQI A;  5G2C A;  3MBV A;  1L99 A;  1JV7 A;  3DN4 A;  2NTG A;  4YXA C;  4EKQ A;  3AM6 A;  1CV5 A;  1L58 A;  1L56 A;  5H2O A;  3X3B A;  1QTC A;  244L A;  2F93 A;  104L A;  201L A;  1LYE A;  126L A;  114L A;  6LZM A;  4TL3 A;  3VHZ A;  1C6M A;  1CV3 A;  1L91 A;  3GUK A;  1MGY A;  1ZUR A;  178L A;  3HAO A;  1L49 A;  1L39 A;  1UAZ A;  1G0G A;  5H2H A;  3DMV A;  2OU8 A;  1BRD A;  1L18 A;  5B35 A;  1CV4 A;  2A4T A;  1L63 A;  4ARM B;  1O0A A;  5BR2 A;  1QKO A;  3DN3 A;  110L A;  1P46 A;  3QBL A;  3DN6 A;  2YCY A;  2J4Y A;  1L69 A;  4X31 A;  172L A;  2NTH A;  1L01 A;  4I7S A;  3HAS A;  3DKE X;  1ZYT A;  3OAX A;  1C3W A;  2RH1 A;  4KNF A;  1P3N A;  242L A;  3QDC A;  5ITC A;  189L A;  3VG9 A;  2F2Q A;  2RB0 X;  1L9H A;  3S3B B;  2ZFE A;  2HUK A;  1WTH A;  3X3C A;  1DYC A;  3EH3 B;  103L A;  4ARQ B;  109L A;  2B72 A;  3PBL A;  4ARM A;  1P64 A;  2LCB A;  3C7Y A;  5H2M A;  1C8S A;  3UG9 A;  1C68 A;  174L A;  3QJU B;  2YDO A;  1L93 A;  1DYG A;  3G3V A;  2I20 A;  3HUQ A;  1D2W A;  1NHB A;  3C7Z A;  3F8V A;  261L A;  1L29 A;  4XT3 A;  3OE8 A;  1CV1 A;  3DQB A;  111L A;  1P7S A;  4JR8 A;  4W56 A;  4W57 A;  1L74 A;  259L A;  2ANX A;  1P8H A;  3PXO A;  5A8E A;  3HAQ A;  3NS0 A;  1L33 A;  1L35 A;  3DN2 A;  1SSY A;  4I7N A;  4I7O A;  4ARQ A;  1OVK A;  2WJK A;  5H2L A;  1BM1 A;  4IAQ A;  1L55 A;  4MQT A;  4UG2 A;  1L20 A;  199L A;  3C7W A;  3QJS B;  4I7T A;  190L A;  1CV6 A;  1P37 A;  1D3M A;  3HT6 A;  4ARJ A;  228L A;  4QI1 A;  1UCQ A;  2I1X A;  4EIY A;  245L A;  1L87 A;  3AYM A;  1L77 A;  1CVK A;  1SWZ A;  3RZE A;  1KG8 A;  4KLY A;  1L30 A;  187L A;  4DJH A;  1X0K 1;  4G7R B;  5B6Y A;  1C6G A;  1L28 A;  1G06 A;  5LZM A;  219L A;  1L51 A;  3V2Y A;  1H68 A;  235L A;  1C6J A;  1G0P A;  1QTZ A;  3ODU A;  206L A;  1L53 A;  1LYI A;  3GUM A;  226L A;  1L94 A;  4GP8 B;  3ZPR A;  1PQK A;  120L A;  152L A;  1C6Q A;  1OWY A;  1QUD A;  4NC3 A;  5G2A A;  3T45 A;  112L A;  1L0J A;  3QJQ B;  1P56 A;  3QBG A;  1JFP A;  2X72 A;  5J7A A;  107L A;  2Y02 A;  118L A;  1L60 A;  2O7A A;  2B6W A;  2Y01 A;  4XT1 A;  5G36 A;  168L A;  1QS5 A;  5AHY A;  1L0K A;  3D4S A;  3GUI A;  1D9W A;  4LDL A;  1L81 A;  3F9L A;  1L34 A;  1L68 A;  1CU3 A;  1QUG A;  4GP4 B;  177L A;  1PXR A;  1L42 A;  1OVJ A;  1QM8 A;  143L A;  1LGW A;  3DN0 A;  3HU8 A;  181L A;  4DAJ A;  1L07 A;  238L A;  1L09 A;  1PQD A;  4FAA B;  1SWY A;  4AQN A;  1D2Y A;  148L E;  2JAG A;  2QB0 B;  3NSB A;  170L A;  1GUE A;  4GP5 B;  5AX0 A;  4W51 A;  175L A;  2RBN A;  1L96 A;  3L64 A;  3LZM A;  2R4R A;  1LYJ A;  236L A;  1R84 A;  2ZZL A;  145L A;  1G0M A;  1KW5 A;  1JTN A;  3HTF A;  3V2W A;  1L75 A;  239L A;  1L05 A;  1L65 A;  2OU0 X;  4W59 A;  2RBS A;  1IW6 A;  1CUQ A;  1L26 A;  3PDS A;  1XJI A;  1QHJ A;  4PXK A;  2OU9 A;  1T6H A;  3KJ6 A;  218L A;  205L A;  2Q9D A;  1L84 A;  3HT7 A;  1BRX A;  5LWE A;  157L A;  1L95 A;  1S51 A;  3GUO A;  1C8R A;  4MD2 A;  4I7P A;  1G0K A;  188L A;  1L23 A;  2YCZ A;  260L A;  1L98 A;  3HH3 A;  4PJZ A;  1L45 A;  4EJ4 A;  4EXM A;  4XTN A;  5H2J A;  4MQS A;  140L A;  1L89 A;  1CX7 A;  1L25 A;  5FJG A;  3SB9 A;  158L A;  1T97 A;  1C6A A;  162L A;  5G28 A;  3HUK A;  5B0W A;  4GYC A;  5F8U A;  225L A;  3EH4 B;  1L72 A;  1QS9 A;  2OEA X;  3HAP A;  3HT8 A;  5KKH A;  1XIO A;  240L A;  1DYE A;  1L43 A;  1L24 A;  1LYG A;  2OE7 X;  2L6X A;  3GUN A;  4UHR A;  137L A;  4I7L A;  4IB4 A;  113L A;  4EKS A;  2R4S A;  5EN0 A;  5DYS A;  2LC9 A;  3OE0 A;  2LNL A;  4BUO A;  1KME A;  1CUP A;  210L A;  4J4Q A;  166L A;  1L38 A;  251L A;  1C67 A;  3C81 A;  1L76 A;  4E97 A;  1C6F A;  131L A;  4YXC A;  1KY0 A;  2AT9 A;  2IGC A;  4W58 A;  3UTX A;  3PWH A;  1PQJ A;  1T8F A;  243L A;  160L A;  4MBS A;  192L A;  3DN1 A;  1C65 A;  1L80 A;  3SB7 A;  1L97 A;  221L A;  213L A;  186L A;  156L A;  161L A;  4X1H A;  1L54 A;  4XTL A;  1G07 A;  3L2X A;  248L A;  220L A;  1QKP A;  1L52 A;  3C83 A;  4BVN A;  1C6T A;  1L67 A;  3COD A;  5DHH A;  2Y03 A;  1G0J A;  2B6T A;  1QSB A;  4G7Q B;  3AYN A;  1L08 A;  3OE9 A;  3UZA A;  1LPY A;  4JKV A;  1JTM A;  197L A;  1LWK A;  1L64 A;  3DN8 A;  3EML A;  2VT4 A;  1SX7 A;  1P5C A;  5DHG A;  150L A;  4W54 A;  2ANV A;  1C6N A;  1QTD A;  1LLH A;  1P36 A;  1L57 A;  3DNA A;  196L A;  4LDE A;  4X32 A;  3C82 A;  2B7X A;  2KSY A;  4MD1 A;  1QT8 A;  128L A;  3QJR B;  4I7Q A;  3WQJ A;  3SB6 A;  252L A;  1QTH A;  1KG9 A;  1C6H A;  1L62 A;  139L A;  5I14 A;  4QID A;  214L A;  1LI6 A;  3HT9 A;  1QT3 A;  1TLA A;  1C69 A;  144L A;  2RAZ X;  4WAV A;  185L A;  2B6X A;  4EPI A;  3C9M A;  3ZEV A;  1TN5 A;  102L A;  3FI5 A;  4I7R A;  1U19 A;  184L A;  1L70 A;  1G1W A;  147L A;  1CTW A;  1XJU A;  119L A;  1LGU A;  3CDV A;  3VI0 A;  4I7J A;  1QTB A;  1EHK B;  1KW7 A;  1OV5 A;  1M0K A;  1M0L A;  3C8R A;  198L A;  1C61 A;  5G54 A;  1OV7 A;  3NYA A;  1P2L A;  191L A;  2Z6B A;  3UTW A;  1C6D A;  3C8S A;  4DKL A;  1P2R A;  1F50 A;  1C62 A;  253L A;  3BVD B;  4QRY A;  108L A;  4G70 B;  1M0M A;  1KS3 A;  3HH5 A;  5AX1 A;  183L A;  3UZC A;  3UON A;  3VVK A;  2NTW A;  1DYF A;  4K5Y A;  212L A;  3C80 A;  3SB8 A;  2Y04 A;  4ARP A;  1LYF A;  2RB2 X;  3HDE A;  3S3D B;  2O4W A;  2QAR C;  1PQO A;  3HWL A;  3A7K A;  1LI2 A;  171L A;  258L A;  232L A;  165L A;  241L A;  2OTZ X;  1CWQ A;  1VGO A;  4GBR B;  2ZIY A;  5H2K A;  5H2N A;  115L A;  257L A;  1KNI A;  127L A;  1XJT A;  2B75 A;  1L11 A;  2B70 A;  1E0P A;  1F88 A;  155L A;  1LI3 A;  3FA0 A;  3NY8 A;  2G87 A;  1L88 A;  4HWL A;  2HPY A;  141L A;  1L83 A;  1L44 A;  237L A;  5G53 A;  4L35 A;  5B6Z A;  4EKR A;  246L A;  1L12 A;  1P8U A;  1LW9 A;  5B6X A;  3VW7 A;  2BRD A;  4EKP A;  7LZM A;  4GBR A;  1JV6 A;  2RBR A;  5AZD A;  1C6B A;  1S52 A;  1T8A A;  5AWZ A;  230L A;  2B6Y A;  1LYD A;  5BR5 A;  169L A;  1JQU A;  142L A;  2F32 A;  4XXJ A;  5ITE A;  1CU6 A;  1L85 A;  1S54 A;  2RBQ A;  167L A;  1R2N A;  254L A;  231L A;  182L A;  2YDV A;  5JJE A;  151L A;  3SB5 A;  3SBB C;  4N6H A;  1L41 A;  4N4Y B;  1DYD A;  1P8I A;  1PXS A;  4L6R A;  1L03 A;  1DZE A;  3JR6 A;  3QJT B;  1C64 A;  1L10 A;  1CU5 A;  5G2D A;  1L06 A;  3RUN A;  1L27 A;  4I7K A;  146L A;  1L31 A;  1PQM A;  2Z73 A;  3HH6 A;  1X0I 1;  3VGA A;  3RFM A;  1KY1 A;  3P0G A;  1L50 A;  1K28 A;  262L A;  3GUP A;  125L A;  247L A;  4BEY A;  1D3N A;  1L59 A;  3K2R A;  176L A;  1CX6 A;  4AMI A;  5B2N A;  4YX7 C;  1QUO A;  200L A;  3HDF A;  1GU8 A;  1DYB A;  5B6V A;  1L37 A;  224L A;  3NY9 A;  3HH4 A;  1L90 A;  2CUU A;  122L A;  1Q5J A;  3G3W A;  1LYH A;  1LN6 A;  1L71 A;  4ZPU A;  4S0W A;  4OO9 A;  4N4W A;  3HTB A;  1FBK A;  5B34 A;  4G7S B;  1L19 A;  2JAF A;  2QPD B;  3FAD A;  1QT7 A;  2I21 A;  2KSB A;  2YCW A;  164L A;  5C1M A;  2F95 A;  2YCX A;  1EPY A;  1L16 A;  3QAP A;  4WW3 A;  1C6I A;  255L A;  2NTU A;  1L66 A;  1LWG A;  1D3J A;  1GZM A;  1IXF A;  4LDO A;  3CAP A;  4Y9H A;  1X0S A;  249L A;  2Q9E A;  1F4Z A;  1C63 A;  215L A;  2LZM A;  4FBZ A;  1TN0 A;  3GUJ A;  3HAN A;  1HZX A;  3QBI A;  173L A;  2RBP A;  223L A;  1H2S A;  4AMJ A;  1DYA A;  2HUM A; 
#chains in the Genus database with same CATH topology
 1JTO L;  5KXO A;  1OUI A;  4NGZ A;  5AHZ A;  4J1B A;  1RCM A;  2RB1 X;  5HMV A;  2FBD A;  1C6L A;  1QUH A;  3OK0 A;  1C10 A;  4W55 A;  2H9K A;  1L13 A;  2HEE A;  3RW8 A;  2MEC A;  4OOT A;  1KGB A;  4OWE A;  1YL1 X;  6LYT A;  1B7R A;  4FPD A;  217L A;  4IAP A;  1LHK A;  1QT5 A;  3DDL A;  1GFK A;  2BQF A;  1L22 A;  2CDS A;  1B5U A;  3IJV A;  1L21 A;  3P68 A;  1OUG A;  3UTV A;  1IWW A;  1L47 A;  3TMW A;  4IAR A;  1V7T A;  1GB5 A;  4NFV A;  3QBK A;  1B7O A;  2B5Z A;  2B6Z A;  2MEF A;  3WUM A;  2BQI A;  1LJI A;  1L86 A;  159L A;  1L00 A;  2QPE B;  3SN6 R;  3HTD A;  216L A;  1S53 A;  4KL7 A;  1UIG A;  4DD2 A;  1I56 A;  4QGZ A;  1OWZ A;  4CHX A;  4LZM A;  4H94 A;  1CU2 A;  1LJJ A;  233L A;  1LJF A;  1ZVH L;  1JGJ A;  3UTY A;  4FA7 B;  4ARL A;  1HSW A;  3CDO A;  195L A;  3IJU A;  3J6K A;  5KY1 A;  5H2I A;  4W52 A;  1E12 A;  1Q5I A;  1VAT A;  1L82 A;  2FYD A;  3CQL A;  1L99 A;  3DN4 A;  1ZV5 L;  2NTG A;  3TMU A;  1L56 A;  4B4J A;  3X3B A;  2H9J A;  2F93 A;  104L A;  3A3Q A;  4HP0 A;  1VED A;  7LYZ A;  4NSI A;  5LAF A;  4TL3 A;  1QIO A;  2LYM A;  1L91 A;  1ZUR A;  1L49 A;  1L39 A;  4HJV A;  4X3B A;  1O0A A;  1UIE A;  110L A;  3TXF A;  2FBB A;  2J4Y A;  4X31 A;  3OAX A;  2RH1 A;  4NEB A;  5ITC A;  1XEK A;  1L9H A;  3S3B B;  3EH3 B;  3PBL A;  2B72 A;  2LCB A;  2LHM A;  2ZQ4 A;  5F14 A;  1QQY A;  1XGU C;  3HUQ A;  2BQA A;  4XT3 A;  1D0M A;  3A34 A;  4HPE A;  259L A;  2ANX A;  208L A;  3HAQ A;  1L33 A;  4I7N A;  2WJK A;  1OVK A;  4IAQ A;  1GBS A;  1AM7 A;  4RW1 A;  3AJN A;  2MEE A;  1UCQ A;  1LYY A;  2I1X A;  245L A;  1GFJ A;  1SWZ A;  1CVK A;  4DWX A;  3RZE A;  1L30 A;  1HEN A;  3FI7 A;  3E3D A;  1UUZ C;  5B6Y A;  5LZM A;  1L51 A;  4R6C A;  1G0P A;  3GUM A;  1LJH A;  152L A;  1OWY A;  3A96 A;  5T3F A;  1JFP A;  168L A;  1QS5 A;  2D6B A;  3GUI A;  4HJZ A;  4Z46 A;  1L81 A;  2W1L A;  3F9L A;  4H9F A;  4GP4 B;  1QUG A;  143L A;  3DN0 A;  4DAJ A;  238L A;  1VFB C;  2PC2 A;  3A95 A;  2QB0 B;  170L A;  5AX0 A;  5L3H A;  1LAA A;  1IR7 A;  1L96 A;  3QY4 A;  2HU1 A;  2ZZL A;  2OU0 X;  4NGJ A;  134L A;  4W59 A;  2RBS A;  1L26 A;  5LA5 A;  4EMN A;  1XJI A;  4PXK A;  2OU9 A;  1KIQ C;  1BRX A;  157L A;  1S51 A;  1C8R A;  1G0K A;  4U3X B;  188L A;  1L23 A;  2YCZ A;  4DC4 A;  4G9S A;  3AZ7 A;  5I53 A;  5H2J A;  4LYB A;  1CX7 A;  3BKV A;  1GFE A;  4GN3 A;  3SB9 A;  3LZT A;  2X0A A;  162L A;  2LZT A;  5G28 A;  1XIO A;  1DYE A;  1CKF A;  1LYG A;  2L6X A;  1BB3 A;  1ZVY B;  3ZVQ B;  2ZIK A;  4EKS A;  2HEC A;  5DYS A;  1LJ3 A;  1JIS A;  4BUO A;  4PHI A;  4TX7 A;  4YXC A;  2IGC A;  4W58 A;  3UTX A;  2D4I A;  4ETD A;  3PWH A;  2Y8P A;  3ZVQ A;  1L80 A;  2YVB A;  213L A;  161L A;  4XTL A;  1G07 A;  1HFX A;  1B7N A;  1L52 A;  4BVN A;  1C6T A;  4XJH A;  5DN4 A;  2EKS C;  1QSB A;  1L08 A;  3OE9 A;  1LPY A;  1IP6 A;  1NMM A;  4IJ4 A;  1B2K A;  1GB2 A;  5HQ1 A;  3TXD A;  150L A;  1WQQ A;  4W54 A;  2ANV A;  1WTM A;  2NWD X;  2Q0M X;  4J1A A;  1FLQ A;  128L A;  4I7Q A;  5HNL A;  3SB6 A;  1QTH A;  1C6H A;  1L62 A;  139L A;  2Z2E A;  1YKZ X;  4QID A;  3HT9 A;  3ATN A;  1DI3 A;  1KXY A;  1TLA A;  2HUB A;  144L A;  4LYZ A;  4ML7 A;  1TN5 A;  3FI5 A;  1IY3 A;  4I7R A;  1U19 A;  1BGI A;  3AZ4 A;  3VI0 A;  4I7J A;  1OV5 A;  1D6P A;  1OV7 A;  5KKI A;  1LZ8 A;  4OWA A;  3UTW A;  5ILC A;  3C8S A;  1P2R A;  1F50 A;  2EPE A;  1IP4 A;  1HML A;  3HH5 A;  4WM2 A;  5AX1 A;  3UZC A;  3VVK A;  1LZR A;  3WYH A;  1DYF A;  4K5Y A;  2ZIJ A;  1LYF A;  3S3D B;  1LZ6 A;  3A7K A;  3W6B A;  3CB7 A;  1LI2 A;  4AXT A;  1REX A;  165L A;  1SLY A;  1VGO A;  1CWQ A;  5H2K A;  5H2N A;  2F4G A;  4NGL A;  1FKV A;  257L A;  4ETC A;  127L A;  3GXK A;  5KXP A;  2DQA A;  1JKD A;  3WVY A;  1E0P A;  4UWV A;  1F88 A;  3FA0 A;  4HJY A;  1JJ1 A;  5APD A;  2ZNX Y;  5G53 A;  4L35 A;  5B6Z A;  4EKR A;  3VW7 A;  3WU7 A;  3A90 A;  1XSF A;  5HNC A;  2BQE A;  1OQM A;  2B6Y A;  169L A;  4PGJ B;  4WLD A;  4H9B A;  2RBQ A;  167L A;  254L A;  182L A;  3N9E A;  151L A;  3SBB C;  4N6H A;  1LJ4 A;  4GLA A;  1P8I A;  1L03 A;  2BQG A;  4MR1 A;  1IIZ A;  4LYM A;  1LSF A;  4W96 A;  3JR6 A;  1L10 A;  1B7L A;  1FLY A;  1JIT A;  3CSQ A;  2BQO A;  3EO5 A;  1BWJ A;  1DPX A;  3A6C Y;  3P0G A;  2YBJ A;  5M1Y A;  4YX7 C;  1J1O Y;  1D6Q A;  1YIK A;  224L A;  3NY9 A;  3HH4 A;  3QNG A;  1LYH A;  5LVJ A;  1LJE A;  3TXK A;  1GPQ C;  3HTB A;  5IDD A;  5B34 A;  1L19 A;  2F2N A;  2JAF A;  2QPD B;  2RSC A;  1DPW A;  3FAD A;  2KSB A;  3A8Z A;  4I8S A;  4DDA A;  3F6Z A;  1GZM A;  3CAP A;  249L A;  1VDS A;  215L A;  2LZM A;  1IC5 Y;  2BQH A;  3HAN A;  1HZX A;  135L A;  3N9A A;  1TBY A;  1H2S A;  4AMJ A;  2O4W A;  1QT6 A;  2KS9 A;  3S3C B;  1QSQ A;  1IW9 A;  229L A;  4EA3 A;  3DMZ A;  1LMO A;  2PED A;  1CU0 A;  1C6E A;  2ZYP A;  2EI4 A;  5DLA A;  5F9U A;  4H1P A;  4WM5 A;  1GEZ A;  4PXF A;  5APC A;  1QT4 A;  3TMX A;  3ZPQ A;  4WG7 A;  5FHW A;  211L A;  1GB7 A;  4H9E A;  4XJF A;  5TGZ A;  1XGP C;  4RLN A;  2KSA A;  1OUE A;  2MEG A;  1PZY A;  1AP9 A;  1D0K A;  1S8L A;  5F9X A;  2B74 A;  4HPI A;  5B05 A;  132L A;  1DKJ A;  2WJL A;  3CDQ A;  3CDT A;  3CDR A;  2CGI A;  2Y00 A;  3QAK A;  4DYG A;  5A44 A;  1VAU A;  2Z2F A;  2HEA A;  1C6K A;  1AZF A;  1L46 A;  1DXJ A;  1REZ A;  4CGE A;  209L A;  163L A;  3AW6 A;  4G49 A;  1CKC A;  1LZC A;  2I25 L;  129L A;  1G0Q A;  2B73 A;  2FYC A;  194L A;  1L17 A;  1W08 A;  2BLX A;  3C8Q A;  1GE4 A;  5ETZ A;  1SX2 A;  5JJJ A;  2CWI A;  4EPF A;  1HEL A;  4HSF A;  1L73 A;  2LZ2 A;  2F47 A;  1JV7 A;  2ZQ3 A;  3P66 A;  5H2O A;  1VDT A;  1GBY A;  201L A;  3A6B Y;  1B5V A;  2MEA A;  1TAY A;  1LSM A;  1HEP A;  1GDX A;  4GCC A;  3VHZ A;  6LZM A;  1JUG A;  2MED A;  3GUK A;  3W3E A;  1G0G A;  5H2H A;  3DMV A;  1BRD A;  1L18 A;  1CV4 A;  1YAM A;  5BR2 A;  3AZ6 A;  3DN3 A;  3DN6 A;  172L A;  5APE A;  1LMQ A;  1EQE A;  1P3N A;  242L A;  189L A;  2RB0 X;  1LSG A;  4UWU A;  1DYC A;  2CJL A;  4Z3M A;  4WG1 A;  1FDL Y;  1GF0 A;  4ETE A;  1CNS A;  1C68 A;  2YDO A;  4DDB A;  2I20 A;  1D2W A;  1B7M A;  261L A;  1L29 A;  3OE8 A;  1CV1 A;  4WOA A;  3DQB A;  1LOZ A;  1IEE A;  4UWN A;  3PXO A;  1L35 A;  3DN2 A;  1SSY A;  4H8X A;  5H2L A;  1BQL Y;  1BB6 A;  1L20 A;  1LYS A;  3QJS B;  1TEW A;  1NDM C;  190L A;  4I7T A;  4DD0 A;  5AMY A;  4QI1 A;  4EIY A;  1L87 A;  1UIA A;  1O23 A;  4WL7 A;  3WU8 A;  1G7M C;  4KLY A;  187L A;  4DJH A;  4G7R B;  4TUN A;  1YAP A;  3A67 Y;  3V2Y A;  235L A;  1AKI A;  2BQD A;  1HFZ A;  2YBI A;  5I4Y A;  1L94 A;  4GP8 B;  2DQD Y;  120L A;  1C6Q A;  1LSC A;  2W1Y A;  1P2C C;  2ZYC A;  2ZWB A;  1F6S A;  1EL1 A;  1L0J A;  2AUB A;  1P56 A;  3QBG A;  1LSZ A;  5J7A A;  1GBZ A;  1L60 A;  2Y02 A;  5FDJ A;  2B6W A;  2Y01 A;  5G36 A;  4EOF A;  1L0K A;  1GBW A;  1UIB A;  2G4N A;  1D9W A;  5LXW A;  4QEQ A;  4H9H A;  1PS5 A;  1QM8 A;  4OWH A;  3HU8 A;  2IHL A;  1L07 A;  4FAA B;  1F10 A;  1SWY A;  1LZ1 A;  4AQN A;  1D2Y A;  3W6A A;  1IO5 A;  2JAG A;  3NSB A;  1LZT A;  4Z98 A;  1GXX A;  3LZM A;  2MEB A;  1LYJ A;  1R84 A;  1LHI A;  5KXM A;  1CKG A;  2HEB A;  3PDS A;  1AT5 A;  3WPJ A;  205L A;  3HT7 A;  5LWE A;  1GB0 A;  1L95 A;  3GUO A;  4N1E I;  260L A;  1G7H C;  4PJZ A;  4XTN A;  1L45 A;  1C43 A;  3B0O A;  5LVK A;  4OW1 A;  225L A;  2BQL A;  3EH4 B;  1L72 A;  154L A;  3HAP A;  5KKH A;  5LAG A;  2N5Z A;  2OE7 X;  4B49 A;  5LYT A;  3GUN A;  4UHR A;  2XJW A;  4A7D A;  2R4S A;  5EN0 A;  2LC9 A;  2LNL A;  1KME A;  1IVM A;  4TSC A;  1QDR A;  4KT3 A;  131L A;  1KY0 A;  3WMK A;  1PQJ A;  1IP2 A;  1IWY A;  192L A;  4P2E A;  1C65 A;  3SB7 A;  156L A;  220L A;  1QKP A;  4WM1 A;  1GF5 A;  4G4B A;  4JKV A;  1LWK A;  3MGW A;  3DN8 A;  2VT4 A;  1T3P A;  2C8P A;  5F81 A;  4DQ7 A;  1IP5 A;  4E3U A;  1CKD A;  3HBD A;  2ZNW Y;  1LHH A;  1IOC A;  1QTD A;  1LHJ A;  1UCO A;  2DQG Y;  1JEF A;  4LDE A;  4X32 A;  2B7X A;  4NWE A;  4NGK A;  252L A;  1OUA A;  4OOO A;  4NWH A;  1QT3 A;  1C69 A;  4RLM A;  4WAV A;  185L A;  2B6X A;  4N9R A;  4GN5 C;  4G4H A;  102L A;  4ZIX A;  1LMN A;  1CTW A;  4TWS A;  1LGU A;  4XJI A;  1HEW A;  1KW7 A;  193L A;  1B5Y A;  1G7L C;  1C61 A;  2Z19 A;  4BS7 A;  1KXX A;  191L A;  2Z6B A;  4B1A A;  1C62 A;  5I4X A;  1KS3 A;  3M3U A;  183L A;  1B7S A;  1TCY A;  1LHL A;  2Y04 A;  3TXI A;  4ARP A;  1PQO A;  3HWL A;  258L A;  115L A;  4LZT A;  4H90 A;  1KNI A;  5KXN A;  2A7F A;  4LT2 A;  2B75 A;  2Z39 A;  1GFA A;  1NBY C;  1LI3 A;  4R0F A;  1UIC A;  4HWL A;  2HPY A;  5D5F A;  1HNL A;  4DD7 A;  237L A;  1JKC A;  2W1M A;  1HER A;  1L12 A;  1P8U A;  3D3D A;  4EKP A;  1JV6 A;  1LMC A;  2DQJ Y;  3B72 A;  3ULR A;  1GFR A;  1S54 A;  231L A;  3J4G A;  3G3A B;  1OUB A;  1YAQ A;  1DYD A;  1PXS A;  1LSN A;  4L6R A;  4PRQ A;  1DZE A;  1LPI A;  1TDY A;  3QJT B;  1C64 A;  1PQM A;  1LSD A;  3RFM A;  4LT3 A;  1YL0 X;  1L59 A;  1VDQ A;  1QUO A;  4H91 A;  5B6V A;  122L A;  1HEM A;  2XBS A;  1LN6 A;  4ZPU A;  4S0W A;  3W6C A;  4N4W A;  1FBK A;  2YBM A;  3QE8 A;  1BWH A;  1YKX X;  164L A;  5C1M A;  2YCX A;  3QAP A;  4N0J A;  4NGW A;  2BQN A;  2Q9E A;  1C63 A;  1F4Z A;  1DKK A;  173L A;  2RBP A;  1DYA A;  1PY6 A;  1OP9 B;  4HTQ A;  5IEL A;  4HYJ A;  222L A;  2O79 A;  1F0W A;  1YIL A;  3COC A;  1P6Y A;  2H5Z A;  1FBI X;  1IX0 A;  3RT5 X;  5FST A;  123L A;  4OV0 A;  3C9L A;  1HFY A;  3ABW A;  1IWU A;  4GRV A;  1QTV A;  2EQL A;  3HTG A;  1LHM A;  1RFP A;  1YKY X;  1L15 A;  3KAM A;  4IAS A;  4AGA A;  1QDT A;  1J1P Y;  2Z55 A;  3HAR A;  3AGH A;  1IOR A;  138L A;  4M4O A;  1L48 A;  5ILF A;  1OVH A;  2BQK A;  1L0M A;  4W53 A;  2DQF C;  4GPO A;  5I54 A;  1REM A;  1S8J A;  3S8F B;  2M3G A;  2XQO A;  5LYZ A;  3WVX A;  5LVH A;  3A3R X;  3PQR A;  3TXJ A;  3HUA A;  4ZFP A;  3N9C A;  5B07 A;  1GHL A;  5B6W A;  1AT9 A;  1C66 A;  4WLX A;  1XME B;  4G72 B;  3QJV B;  3REY A;  227L A;  4H8Y A;  2DBT A;  6LYZ A;  1C60 A;  5G2C A;  3MBV A;  4GCF A;  3W6D A;  4EKQ A;  1LJG A;  1IC7 Y;  1CV5 A;  3RZ4 A;  4ANR A;  1JTT L;  1LYE A;  4GCD A;  5IHG A;  2BQJ A;  1IWV A;  114L A;  1C6M A;  1CV3 A;  4LYC A;  3HAO A;  178L A;  4RDS A;  1GFV A;  3AYQ A;  5B35 A;  4YEM A;  2A4T A;  3WUN A;  1L63 A;  4O34 A;  4ARM B;  4NHQ A;  4TSB A;  4HTN A;  1QKO A;  1P46 A;  2ZIL A;  2Z37 A;  2YCY A;  1L69 A;  3LYM A;  2NTH A;  1GXV 2;  3HAS A;  1ZYT A;  1YAN A;  5C6L A;  3LHM A;  4KNF A;  1GF3 A;  2F2Q A;  4NY5 A;  1MLC E;  2HUK A;  1WTH A;  3X3C A;  103L A;  4ARQ B;  4ARM A;  1LCN A;  1P64 A;  3OJP A;  1QSW A;  5H2M A;  3LYO A;  1C8S A;  3UG9 A;  3TXE A;  3QJU B;  1NHB A;  3C7Z A;  3F8V A;  4NGV A;  3WUL A;  111L A;  1BB4 A;  1P7S A;  4W56 A;  4W57 A;  5DL9 A;  1LKR A;  1GE1 A;  1P8H A;  1D9U A;  3IWR A;  3NS0 A;  4I7O A;  1FLU A;  1GAZ A;  4ARQ A;  1ALC A;  1BM1 A;  1L55 A;  4N1C C;  4UG2 A;  1EQ4 A;  1IWT A;  4YEN A;  1P37 A;  3WU9 A;  1D3M A;  3AYM A;  5KJ9 A;  1LSY A;  3A91 A;  1X0K 1;  1L28 A;  1LSA A;  219L A;  1C6J A;  1B5X A;  1JHL A;  3P65 A;  5E4P A;  1GF6 A;  1QTZ A;  3ODU A;  1G7I C;  4XAD A;  2DQH Y;  1QUD A;  2Z38 A;  3B0K A;  112L A;  3QJQ B;  2X72 A;  2DKV A;  107L A;  1JKB A;  118L A;  4XT1 A;  1QUT A;  3D4S A;  2LYO A;  1HF4 A;  1CU3 A;  1DI4 A;  3CT5 A;  1WQR A;  5EBH A;  1LGW A;  1WQO A;  2YSS C;  181L A;  1L09 A;  1BVX A;  1B7Q A;  3AGG G;  1LZ9 A;  4YOP A;  4GP5 B;  1BHZ A;  2RBN A;  3L64 A;  5KKJ A;  2R4R A;  236L A;  3CSZ A;  1G0M A;  1GB9 A;  3A92 A;  3V2W A;  4GCB A;  4LYO A;  3WPL A;  1GAY A;  1J1X Y;  4DD1 A;  1QHJ A;  1T6H A;  3KJ6 A;  1QSA A;  4HV1 A;  1T6V L;  1NBZ C;  1NF5 A;  1JKA A;  1WQN A;  4EJ4 A;  4EXM A;  1IP1 A;  4ET8 A;  140L A;  1L89 A;  1L25 A;  133L A;  5FJG A;  5LA8 A;  1T97 A;  1C6A A;  1NWG A;  5F8U A;  3HT8 A;  1IP7 A;  5DM9 A;  1HEQ A;  4OWC A;  4RW2 A;  1L43 A;  137L A;  4IB4 A;  113L A;  1XEJ A;  5C6J A;  2DQC Y;  1KIP C;  2I6Z A;  4DDC A;  3EMS A;  1WQP A;  1CUP A;  210L A;  4G4C A;  4DT3 A;  1LKS A;  251L A;  1L76 A;  1LZB A;  1C6F A;  4H9C A;  5I5Q A;  1JPO A;  243L A;  5LVI A;  3T6U A;  160L A;  3DN1 A;  1LSE A;  2G4Q A;  1L97 A;  221L A;  5KXL A;  186L A;  1L54 A;  5APF A;  3COD A;  5DHH A;  2Y03 A;  1G0J A;  8LYZ A;  3RNX A;  3AYN A;  4ETA A;  5D5C A;  3UZA A;  197L A;  1L64 A;  1SX7 A;  1P5C A;  5DHG A;  4CFP A;  4W94 A;  1KXW A;  1C6N A;  3DNA A;  196L A;  5K7O A;  1LMA A;  3C82 A;  1QT8 A;  1LZE A;  3A94 A;  1QUS A;  3QJR B;  2XTH A;  3TMV A;  1KG9 A;  1UBZ A;  2GV0 A;  1CJ7 A;  1CKH A;  1WQM A;  3C9M A;  1NKH A;  4OWB A;  1L70 A;  1G1W A;  147L A;  1B5W A;  1XJU A;  119L A;  3CT1 A;  3CDV A;  1M0K A;  4PJ2 C;  1REY A;  1JWR A;  4QY9 A;  1C6D A;  5JEN B;  4DKL A;  3BVD B;  108L A;  4G70 B;  3UON A;  2NTW A;  5KXT A;  3C80 A;  3SB8 A;  2RB2 X;  5A3Z A;  2QAR C;  1JJ0 A;  1RI8 B;  4PPO A;  1BB5 A;  1IOQ A;  171L A;  232L A;  2ZIY A;  4NHI A;  5HMJ A;  5A3E A;  4MST A;  1XJT A;  3BKH A;  3CSR A;  3W6F A;  5II3 A;  1L11 A;  2B70 A;  2BLY A;  141L A;  1GFT A;  1LJK A;  4HTK A;  1GD6 A;  246L A;  1IWX A;  1LW9 A;  3W6E A;  2BRD A;  4H9A A;  7LZM A;  5L9J A;  5AZD A;  1C6B A;  4II8 A;  1T8A A;  4MCK A;  5AWZ A;  230L A;  2VB1 A;  1JQU A;  2F32 A;  142L A;  1LZN A;  2YDV A;  5JJE A;  4Z41 A;  4WL6 A;  4BAF A;  1OUJ A;  1UC0 A;  1L41 A;  2G4P A;  3P64 A;  1GE2 A;  1CU5 A;  5G2D A;  1IOS A;  3T36 A;  1L27 A;  4NIJ A;  2Z73 A;  3HH6 A;  3HBE X;  1L50 A;  125L A;  247L A;  3EXD A;  1D3N A;  4BEY A;  3K2R A;  176L A;  1CX6 A;  4AMI A;  5B2N A;  4CFO A;  1GU8 A;  1IY4 A;  1JSE A;  3G3W A;  4GCE A;  3ZEK A;  4OO9 A;  1GF4 A;  4G7S B;  2YBL A;  2I21 A;  2W1X A;  2F95 A;  5I4W A;  1EPY A;  1L16 A;  4WW3 A;  1C6I A;  255L A;  2NTU A;  4YEO A;  3WXT A;  1L66 A;  5LIN A;  2A7D A;  1D3J A;  4Y9H A;  4BAP A;  4ETB A;  1GF7 A;  4FBZ A;  1TN0 A;  3GUJ A;  3LZ2 A;  3QBI A;  223L A;  153L A;  4HV2 A;  2HUM A;  1WTN A;  4NHT A;  1L32 A;  1RE2 A;  1T8G A;  3B6L A;  1C45 A;  1GEV A;  1NQI A;  1C6C A;  1LGX A;  1XFP L;  234L A;  2MEI A;  4G71 B;  1SSW A;  4KPM A;  1L36 A;  1LZY A;  3HU9 A;  1ZWN A;  1L04 A;  1QTE A;  3WXU A;  3GUL A;  3ATO A;  1B6I A;  3M18 B;  4H8Z A;  2I35 A;  1L02 A;  5JJN A;  1C6P A;  3EH5 B;  5B1G A;  4DQ5 A;  5HLL A;  1VJM A;  4BWB A;  1L14 A;  1LMP A;  256L A;  3OE6 A;  1D3F A;  3TXB A;  1OUF A;  2OE4 X;  4XTO A;  3CT0 A;  1B7P A;  1Z55 A;  1HSX A;  4A4M A;  3SBA A;  4NSJ A;  4JQ6 A;  1L40 A;  4I7M A;  3G3X A;  2L78 A;  1FBB A;  1IP3 A;  3EBA B;  250L A;  4YM8 A;  5C6I A;  2OE9 X;  1IOT A;  4NSH A;  1G7J C;  2RBO A;  4B0D A;  1G0L A;  2OTY X;  3TXH A;  4YF2 A;  4PK0 A;  1BB7 A;  130L A;  1I6S A;  3DMX A;  1CV0 A;  1V7S A;  4HYX A;  1BRR A;  3S8G B;  2HUL A;  1INU A;  5KXS A;  1OYU A;  1L61 A;  1I20 A;  149L A;  2D4K A;  2Z12 A;  4BV0 A;  1L79 A;  4BEZ A;  1NHE A;  4B4I A;  5H2P A;  3HBH A;  2RAY X;  5A45 A;  4FDY A;  1XEP A;  1G1V A;  180L A;  4GN4 A;  1L92 A;  1PQI A;  2DQI Y;  1BVK C;  4YXA C;  1YQV Y;  3AM6 A;  1L58 A;  2BQB A;  1QTC A;  244L A;  3AGI A;  126L A;  1UA6 Y;  1GB8 A;  4FJR A;  1MGY A;  1WVU A;  4XEN A;  1UAZ A;  3WW6 A;  2OU8 A;  1GE3 A;  5FEK A;  1H87 A;  4QDN A;  1YRO A;  2BQC A;  3QBL A;  4NHP A;  1B9O A;  1L01 A;  4I7S A;  3DKE X;  1YAO A;  9LYZ A;  1C3W A;  1EQ5 A;  3QDC A;  2I26 L;  3VG9 A;  1B0D A;  1HC0 A;  2ZFE A;  4N5R A;  4WM4 A;  1H6M A;  2YDG A;  4WO6 A;  109L A;  2F4A A;  3C7Y A;  3LYZ A;  174L A;  207L A;  1L93 A;  1XEI A;  1DYG A;  1LSP A;  3G3V A;  5LYM A;  1IC4 Y;  5KXZ A;  4M6D A;  4JR8 A;  1C08 C;  1L74 A;  5A8E A;  3A93 A;  4MQT A;  199L A;  3C7W A;  1CV6 A;  5B59 A;  5KXK A;  3HT6 A;  4ARJ A;  228L A;  5LVG A;  1L77 A;  1KG8 A;  4LGK A;  3LN2 A;  2Z18 A;  1C6G A;  2BPU A;  1G06 A;  1H68 A;  1LZ4 A;  5B1F A;  3AB6 A;  1W6Z A;  206L A;  4PRU A;  1L53 A;  1LYI A;  4H9I A;  226L A;  3ZPR A;  2HEF A;  1PQK A;  4H92 A;  4NC3 A;  5G2A A;  3T45 A;  1JSF A;  1LMT A;  4XJG A;  2HED A;  3AZ5 A;  1MEL L;  2O7A A;  4C5F A;  5AHY A;  4TTD A;  4NGI A;  5DN5 A;  3D9A C;  4LDL A;  5LIO A;  1L34 A;  1AT6 A;  1FN5 A;  1L68 A;  177L A;  1PXR A;  1L42 A;  4NG8 A;  1OVJ A;  1A4V A;  1PQD A;  3HFM Y;  5J7C A;  148L E;  1GUE A;  4W51 A;  175L A;  1IR9 A;  5E9R A;  145L A;  1KW5 A;  1GFU A;  1JTN A;  3HTF A;  1L75 A;  239L A;  1UIH A;  4WMG A;  1L05 A;  1L65 A;  4WLT A;  4DS7 E;  5B06 A;  4WLY A;  1IW6 A;  1B5Z A;  3GXR A;  1CUQ A;  4LFX A;  3WPK A;  218L A;  4NG1 A;  2Q9D A;  1L84 A;  1UIF A;  1HHL A;  4MD2 A;  4I7P A;  1LZ5 A;  1L98 A;  3HH3 A;  1LZA A;  5FCP A;  2LYZ A;  4MQS A;  158L A;  1D0L A;  1JIY A;  3HUK A;  5B0W A;  3TXG A;  4GYC A;  1GFH A;  1QS9 A;  3AW7 A;  2OEA X;  1SQ2 L;  240L A;  1L24 A;  4NHS A;  1CJ8 A;  4I7L A;  1GFG A;  1GF9 A;  1C7P A;  5L3I A;  3OE0 A;  3LYT A;  1E8L A;  4J4Q A;  4C3W A;  2MEH A;  166L A;  1LSB A;  1L38 A;  4WM6 A;  3C81 A;  1C67 A;  3WW5 A;  1IR8 A;  4E97 A;  2AT9 A;  3K3T A;  3FE0 A;  5KXW A;  1KIR C;  1T8F A;  4MBS A;  4XN6 A;  1DI5 A;  1OUH A;  4X1H A;  3L2X A;  248L A;  4L41 A;  2BQM A;  3C83 A;  4XYY A;  1L67 A;  2B6T A;  4G7Q B;  1GBO A;  4CJ2 A;  1JTM A;  3EML A;  1LJN A;  1GF8 A;  1LLH A;  1P36 A;  1L57 A;  4BAD A;  2KSY A;  4MD1 A;  1N4F A;  1WVV A;  5KXR A;  4NGY A;  3WQJ A;  4WM3 A;  5I14 A;  214L A;  1LI6 A;  3B0I A;  1I1Z A;  1F6R A;  2RAZ X;  2BAA A;  4EPI A;  3ZEV A;  1QTK A;  1A2Y C;  1VDP A;  2D4J A;  2YBH A;  184L A;  3WH1 A;  5F16 A;  1ZMY L;  2IFF Y;  4DD3 A;  1EHK B;  1QTB A;  1RJC B;  1M0L A;  1FKQ A;  3C8R A;  198L A;  3SP3 A;  5G54 A;  1XGQ C;  3NYA A;  1P2L A;  4I0C A;  1JTP L;  4B4E A;  3WUA A;  1OUC A;  1LTM A;  253L A;  4QRY A;  1M0M A;  5KXY A;  3RU5 A;  4D9Z A;  2HTX A;  212L A;  3HDE A;  4IAT A;  1NDG C;  1DQJ C;  2D91 A;  4LFP A;  5KXX A;  4N8Z A;  4WO9 A;  241L A;  2OTZ X;  4GBR B;  1XGR C;  2HU3 A;  2DQE Y;  155L A;  3NY8 A;  2G87 A;  1L88 A;  1L83 A;  1L44 A;  1C46 A;  1HEO A;  4LT0 A;  4XJD A;  4ET9 A;  1JJ3 A;  1LYO A;  5B6X A;  1GB3 A;  4GBR A;  2RBR A;  1DZB X;  1S52 A;  4KXI A;  1LYZ A;  5BR5 A;  1LYD A;  4XXJ A;  5ITE A;  1FLW A;  1CU6 A;  1L85 A;  1R2N A;  2C8O A;  2F30 A;  1GDW A;  3SB5 A;  1HMK A;  5FEL A;  1UID A;  4N4Y B;  1UAC Y;  4LT1 A;  1LZS A;  1IWZ A;  1GB6 A;  4H93 A;  4LYT A;  4DQJ A;  1L06 A;  3RUN A;  1BWI A;  4NGO A;  4I7K A;  146L A;  1L31 A;  1X0I 1;  3VGA A;  1OUD A;  1KY1 A;  1CJ9 A;  1K28 A;  262L A;  3WL2 A;  3GUP A;  1GBX A;  3G3B B;  200L A;  3HDF A;  1DYB A;  1L37 A;  1L90 A;  2CUU A;  1Q5J A;  1L71 A;  1GE0 A;  4J7V A;  4XJB A;  1LZD A;  1QT7 A;  4NSG A;  2YCW A;  2EIZ C;  4J0L A;  2WAR A;  2YBN A;  1LWG A;  1IXF A;  3P4Z A;  2XBR A;  4LDO A;  3VWO A;  4ZEE A;  1X0S A;  1CJ6 A;  1XGT C;  1LZG A;  1GWD A;  4GLV A;  4DD9 A; 
#chains in the Genus database with same CATH homology
 1JTO L;  5KXO A;  1OUI A;  4NGZ A;  5AHZ A;  4J1B A;  1RCM A;  2RB1 X;  5HMV A;  2FBD A;  1C6L A;  1QUH A;  3OK0 A;  1C10 A;  4W55 A;  2H9K A;  1L13 A;  2HEE A;  3RW8 A;  2MEC A;  4OOT A;  1KGB A;  4OWE A;  1YL1 X;  6LYT A;  1B7R A;  4FPD A;  217L A;  4IAP A;  1LHK A;  1QT5 A;  3DDL A;  1GFK A;  2BQF A;  1L22 A;  2CDS A;  1B5U A;  3IJV A;  1L21 A;  3P68 A;  1OUG A;  3UTV A;  1IWW A;  1L47 A;  3TMW A;  4IAR A;  1V7T A;  1GB5 A;  4NFV A;  3QBK A;  1B7O A;  2B5Z A;  2B6Z A;  2MEF A;  3WUM A;  2BQI A;  1LJI A;  1L86 A;  159L A;  1L00 A;  2QPE B;  3SN6 R;  3HTD A;  216L A;  1S53 A;  4KL7 A;  1UIG A;  4DD2 A;  1I56 A;  4QGZ A;  1OWZ A;  4CHX A;  4LZM A;  4H94 A;  1CU2 A;  1LJJ A;  233L A;  1LJF A;  1ZVH L;  1JGJ A;  3UTY A;  4FA7 B;  4ARL A;  1HSW A;  3CDO A;  195L A;  3IJU A;  3J6K A;  5KY1 A;  5H2I A;  4W52 A;  1E12 A;  1Q5I A;  1VAT A;  1L82 A;  2FYD A;  3CQL A;  1L99 A;  3DN4 A;  1ZV5 L;  2NTG A;  3TMU A;  1L56 A;  4B4J A;  3X3B A;  2H9J A;  2F93 A;  104L A;  3A3Q A;  4HP0 A;  1VED A;  7LYZ A;  4NSI A;  5LAF A;  4TL3 A;  1QIO A;  2LYM A;  1L91 A;  1ZUR A;  1L49 A;  1L39 A;  4HJV A;  4X3B A;  1O0A A;  1UIE A;  110L A;  3TXF A;  2FBB A;  2J4Y A;  4X31 A;  3OAX A;  2RH1 A;  4NEB A;  5ITC A;  1XEK A;  1L9H A;  3S3B B;  3EH3 B;  3PBL A;  2B72 A;  2LCB A;  2LHM A;  2ZQ4 A;  5F14 A;  1QQY A;  1XGU C;  3HUQ A;  2BQA A;  4XT3 A;  1D0M A;  3A34 A;  4HPE A;  259L A;  2ANX A;  208L A;  3HAQ A;  1L33 A;  4I7N A;  2WJK A;  1OVK A;  4IAQ A;  1GBS A;  1AM7 A;  4RW1 A;  3AJN A;  2MEE A;  1UCQ A;  1LYY A;  2I1X A;  245L A;  1GFJ A;  1SWZ A;  1CVK A;  4DWX A;  3RZE A;  1L30 A;  1HEN A;  3FI7 A;  3E3D A;  1UUZ C;  5B6Y A;  5LZM A;  1L51 A;  4R6C A;  1G0P A;  3GUM A;  1LJH A;  152L A;  1OWY A;  3A96 A;  5T3F A;  1JFP A;  168L A;  1QS5 A;  2D6B A;  3GUI A;  4HJZ A;  4Z46 A;  1L81 A;  2W1L A;  3F9L A;  4H9F A;  4GP4 B;  1QUG A;  143L A;  3DN0 A;  4DAJ A;  238L A;  1VFB C;  2PC2 A;  3A95 A;  2QB0 B;  170L A;  5AX0 A;  5L3H A;  1LAA A;  1IR7 A;  1L96 A;  3QY4 A;  2HU1 A;  2ZZL A;  2OU0 X;  4NGJ A;  134L A;  4W59 A;  2RBS A;  1L26 A;  5LA5 A;  4EMN A;  1XJI A;  4PXK A;  2OU9 A;  1KIQ C;  1BRX A;  157L A;  1S51 A;  1C8R A;  1G0K A;  4U3X B;  188L A;  1L23 A;  2YCZ A;  4DC4 A;  4G9S A;  3AZ7 A;  5I53 A;  5H2J A;  4LYB A;  1CX7 A;  3BKV A;  1GFE A;  4GN3 A;  3SB9 A;  3LZT A;  2X0A A;  162L A;  2LZT A;  5G28 A;  1XIO A;  1DYE A;  1CKF A;  1LYG A;  2L6X A;  1BB3 A;  1ZVY B;  3ZVQ B;  2ZIK A;  4EKS A;  2HEC A;  5DYS A;  1LJ3 A;  1JIS A;  4BUO A;  4PHI A;  4TX7 A;  4YXC A;  2IGC A;  4W58 A;  3UTX A;  2D4I A;  4ETD A;  3PWH A;  2Y8P A;  3ZVQ A;  1L80 A;  2YVB A;  213L A;  161L A;  4XTL A;  1G07 A;  1HFX A;  1B7N A;  1L52 A;  4BVN A;  1C6T A;  4XJH A;  5DN4 A;  2EKS C;  1QSB A;  1L08 A;  3OE9 A;  1LPY A;  1IP6 A;  1NMM A;  4IJ4 A;  1B2K A;  1GB2 A;  5HQ1 A;  3TXD A;  150L A;  1WQQ A;  4W54 A;  2ANV A;  1WTM A;  2NWD X;  2Q0M X;  4J1A A;  1FLQ A;  128L A;  4I7Q A;  5HNL A;  3SB6 A;  1QTH A;  1C6H A;  1L62 A;  139L A;  2Z2E A;  1YKZ X;  4QID A;  3HT9 A;  3ATN A;  1DI3 A;  1KXY A;  1TLA A;  2HUB A;  144L A;  4LYZ A;  4ML7 A;  1TN5 A;  3FI5 A;  1IY3 A;  4I7R A;  1U19 A;  1BGI A;  3AZ4 A;  3VI0 A;  4I7J A;  1OV5 A;  1D6P A;  1OV7 A;  5KKI A;  1LZ8 A;  4OWA A;  3UTW A;  5ILC A;  3C8S A;  1P2R A;  1F50 A;  2EPE A;  1IP4 A;  1HML A;  3HH5 A;  4WM2 A;  5AX1 A;  3UZC A;  3VVK A;  1LZR A;  3WYH A;  1DYF A;  4K5Y A;  2ZIJ A;  1LYF A;  3S3D B;  1LZ6 A;  3A7K A;  3W6B A;  3CB7 A;  1LI2 A;  4AXT A;  1REX A;  165L A;  1SLY A;  1VGO A;  1CWQ A;  5H2K A;  5H2N A;  2F4G A;  4NGL A;  1FKV A;  257L A;  4ETC A;  127L A;  3GXK A;  5KXP A;  2DQA A;  1JKD A;  3WVY A;  1E0P A;  4UWV A;  1F88 A;  3FA0 A;  4HJY A;  1JJ1 A;  5APD A;  2ZNX Y;  5G53 A;  4L35 A;  5B6Z A;  4EKR A;  3VW7 A;  3WU7 A;  3A90 A;  1XSF A;  5HNC A;  2BQE A;  1OQM A;  2B6Y A;  169L A;  4PGJ B;  4WLD A;  4H9B A;  2RBQ A;  167L A;  254L A;  182L A;  3N9E A;  151L A;  3SBB C;  4N6H A;  1LJ4 A;  4GLA A;  1P8I A;  1L03 A;  2BQG A;  4MR1 A;  1IIZ A;  4LYM A;  1LSF A;  4W96 A;  3JR6 A;  1L10 A;  1B7L A;  1FLY A;  1JIT A;  3CSQ A;  2BQO A;  3EO5 A;  1BWJ A;  1DPX A;  3A6C Y;  3P0G A;  2YBJ A;  5M1Y A;  4YX7 C;  1J1O Y;  1D6Q A;  1YIK A;  224L A;  3NY9 A;  3HH4 A;  3QNG A;  1LYH A;  5LVJ A;  1LJE A;  3TXK A;  1GPQ C;  3HTB A;  5IDD A;  5B34 A;  1L19 A;  2F2N A;  2JAF A;  2QPD B;  2RSC A;  1DPW A;  3FAD A;  2KSB A;  3A8Z A;  4I8S A;  4DDA A;  3F6Z A;  1GZM A;  3CAP A;  249L A;  1VDS A;  215L A;  2LZM A;  1IC5 Y;  2BQH A;  3HAN A;  1HZX A;  135L A;  3N9A A;  1TBY A;  1H2S A;  4AMJ A;  2O4W A;  1QT6 A;  2KS9 A;  3S3C B;  1QSQ A;  1IW9 A;  229L A;  4EA3 A;  3DMZ A;  1LMO A;  2PED A;  1CU0 A;  1C6E A;  2ZYP A;  2EI4 A;  5DLA A;  5F9U A;  4H1P A;  4WM5 A;  1GEZ A;  4PXF A;  5APC A;  1QT4 A;  3TMX A;  3ZPQ A;  4WG7 A;  5FHW A;  211L A;  1GB7 A;  4H9E A;  4XJF A;  5TGZ A;  1XGP C;  4RLN A;  2KSA A;  1OUE A;  2MEG A;  1PZY A;  1AP9 A;  1D0K A;  1S8L A;  5F9X A;  2B74 A;  4HPI A;  5B05 A;  132L A;  1DKJ A;  2WJL A;  3CDQ A;  3CDT A;  3CDR A;  2CGI A;  2Y00 A;  3QAK A;  4DYG A;  5A44 A;  1VAU A;  2Z2F A;  2HEA A;  1C6K A;  1AZF A;  1L46 A;  1DXJ A;  1REZ A;  4CGE A;  209L A;  163L A;  3AW6 A;  4G49 A;  1CKC A;  1LZC A;  2I25 L;  129L A;  1G0Q A;  2B73 A;  2FYC A;  194L A;  1L17 A;  1W08 A;  2BLX A;  3C8Q A;  1GE4 A;  5ETZ A;  1SX2 A;  5JJJ A;  2CWI A;  4EPF A;  1HEL A;  4HSF A;  1L73 A;  2LZ2 A;  2F47 A;  1JV7 A;  2ZQ3 A;  3P66 A;  5H2O A;  1VDT A;  1GBY A;  201L A;  3A6B Y;  1B5V A;  2MEA A;  1TAY A;  1LSM A;  1HEP A;  1GDX A;  4GCC A;  3VHZ A;  6LZM A;  1JUG A;  2MED A;  3GUK A;  3W3E A;  1G0G A;  5H2H A;  3DMV A;  1BRD A;  1L18 A;  1CV4 A;  1YAM A;  5BR2 A;  3AZ6 A;  3DN3 A;  3DN6 A;  172L A;  5APE A;  1LMQ A;  1EQE A;  1P3N A;  242L A;  189L A;  2RB0 X;  1LSG A;  4UWU A;  1DYC A;  2CJL A;  4Z3M A;  4WG1 A;  1FDL Y;  1GF0 A;  4ETE A;  1CNS A;  1C68 A;  2YDO A;  4DDB A;  2I20 A;  1D2W A;  1B7M A;  261L A;  1L29 A;  3OE8 A;  1CV1 A;  4WOA A;  3DQB A;  1LOZ A;  1IEE A;  4UWN A;  3PXO A;  1L35 A;  3DN2 A;  1SSY A;  4H8X A;  5H2L A;  1BQL Y;  1BB6 A;  1L20 A;  1LYS A;  3QJS B;  1TEW A;  1NDM C;  190L A;  4I7T A;  4DD0 A;  5AMY A;  4QI1 A;  4EIY A;  1L87 A;  1UIA A;  1O23 A;  4WL7 A;  3WU8 A;  1G7M C;  4KLY A;  187L A;  4DJH A;  4G7R B;  4TUN A;  1YAP A;  3A67 Y;  3V2Y A;  235L A;  1AKI A;  2BQD A;  1HFZ A;  2YBI A;  5I4Y A;  1L94 A;  4GP8 B;  2DQD Y;  120L A;  1C6Q A;  1LSC A;  2W1Y A;  1P2C C;  2ZYC A;  2ZWB A;  1F6S A;  1EL1 A;  1L0J A;  2AUB A;  1P56 A;  3QBG A;  1LSZ A;  5J7A A;  1GBZ A;  1L60 A;  2Y02 A;  5FDJ A;  2B6W A;  2Y01 A;  5G36 A;  4EOF A;  1L0K A;  1GBW A;  1UIB A;  2G4N A;  1D9W A;  5LXW A;  4QEQ A;  4H9H A;  1PS5 A;  1QM8 A;  4OWH A;  3HU8 A;  2IHL A;  1L07 A;  4FAA B;  1F10 A;  1SWY A;  1LZ1 A;  4AQN A;  1D2Y A;  3W6A A;  1IO5 A;  2JAG A;  3NSB A;  1LZT A;  4Z98 A;  1GXX A;  3LZM A;  2MEB A;  1LYJ A;  1R84 A;  1LHI A;  5KXM A;  1CKG A;  2HEB A;  3PDS A;  1AT5 A;  3WPJ A;  205L A;  3HT7 A;  5LWE A;  1GB0 A;  1L95 A;  3GUO A;  4N1E I;  260L A;  1G7H C;  4PJZ A;  4XTN A;  1L45 A;  1C43 A;  3B0O A;  5LVK A;  4OW1 A;  225L A;  2BQL A;  3EH4 B;  1L72 A;  154L A;  3HAP A;  5KKH A;  5LAG A;  2N5Z A;  2OE7 X;  4B49 A;  5LYT A;  3GUN A;  4UHR A;  2XJW A;  4A7D A;  2R4S A;  5EN0 A;  2LC9 A;  2LNL A;  1KME A;  1IVM A;  4TSC A;  1QDR A;  4KT3 A;  131L A;  1KY0 A;  3WMK A;  1PQJ A;  1IP2 A;  1IWY A;  192L A;  4P2E A;  1C65 A;  3SB7 A;  156L A;  220L A;  1QKP A;  4WM1 A;  1GF5 A;  4G4B A;  4JKV A;  1LWK A;  3MGW A;  3DN8 A;  2VT4 A;  1T3P A;  2C8P A;  5F81 A;  4DQ7 A;  1IP5 A;  4E3U A;  1CKD A;  3HBD A;  2ZNW Y;  1LHH A;  1IOC A;  1QTD A;  1LHJ A;  1UCO A;  2DQG Y;  1JEF A;  4LDE A;  4X32 A;  2B7X A;  4NWE A;  4NGK A;  252L A;  1OUA A;  4OOO A;  4NWH A;  1QT3 A;  1C69 A;  4RLM A;  4WAV A;  185L A;  2B6X A;  4N9R A;  4GN5 C;  4G4H A;  102L A;  4ZIX A;  1LMN A;  1CTW A;  4TWS A;  1LGU A;  4XJI A;  1HEW A;  1KW7 A;  193L A;  1B5Y A;  1G7L C;  1C61 A;  2Z19 A;  4BS7 A;  1KXX A;  191L A;  2Z6B A;  4B1A A;  1C62 A;  5I4X A;  1KS3 A;  3M3U A;  183L A;  1B7S A;  1TCY A;  1LHL A;  2Y04 A;  3TXI A;  4ARP A;  1PQO A;  3HWL A;  258L A;  115L A;  4LZT A;  4H90 A;  1KNI A;  5KXN A;  2A7F A;  4LT2 A;  2B75 A;  2Z39 A;  1GFA A;  1NBY C;  1LI3 A;  4R0F A;  1UIC A;  4HWL A;  2HPY A;  5D5F A;  1HNL A;  4DD7 A;  237L A;  1JKC A;  2W1M A;  1HER A;  1L12 A;  1P8U A;  3D3D A;  4EKP A;  1JV6 A;  1LMC A;  2DQJ Y;  3B72 A;  3ULR A;  1GFR A;  1S54 A;  231L A;  3J4G A;  3G3A B;  1OUB A;  1YAQ A;  1DYD A;  1PXS A;  1LSN A;  4L6R A;  4PRQ A;  1DZE A;  1LPI A;  1TDY A;  3QJT B;  1C64 A;  1PQM A;  1LSD A;  3RFM A;  4LT3 A;  1YL0 X;  1L59 A;  1VDQ A;  1QUO A;  4H91 A;  5B6V A;  122L A;  1HEM A;  2XBS A;  1LN6 A;  4ZPU A;  4S0W A;  3W6C A;  4N4W A;  1FBK A;  2YBM A;  3QE8 A;  1BWH A;  1YKX X;  164L A;  5C1M A;  2YCX A;  3QAP A;  4N0J A;  4NGW A;  2BQN A;  2Q9E A;  1C63 A;  1F4Z A;  1DKK A;  173L A;  2RBP A;  1DYA A;  1PY6 A;  1OP9 B;  4HTQ A;  5IEL A;  4HYJ A;  222L A;  2O79 A;  1F0W A;  1YIL A;  3COC A;  1P6Y A;  2H5Z A;  1FBI X;  1IX0 A;  3RT5 X;  5FST A;  123L A;  4OV0 A;  3C9L A;  1HFY A;  3ABW A;  1IWU A;  4GRV A;  1QTV A;  2EQL A;  3HTG A;  1LHM A;  1RFP A;  1YKY X;  1L15 A;  3KAM A;  4IAS A;  4AGA A;  1QDT A;  1J1P Y;  2Z55 A;  3HAR A;  3AGH A;  1IOR A;  138L A;  4M4O A;  1L48 A;  5ILF A;  1OVH A;  2BQK A;  1L0M A;  4W53 A;  2DQF C;  4GPO A;  5I54 A;  1REM A;  1S8J A;  3S8F B;  2M3G A;  2XQO A;  5LYZ A;  3WVX A;  5LVH A;  3A3R X;  3PQR A;  3TXJ A;  3HUA A;  4ZFP A;  3N9C A;  5B07 A;  1GHL A;  5B6W A;  1AT9 A;  1C66 A;  4WLX A;  1XME B;  4G72 B;  3QJV B;  3REY A;  227L A;  4H8Y A;  2DBT A;  6LYZ A;  1C60 A;  5G2C A;  3MBV A;  4GCF A;  3W6D A;  4EKQ A;  1LJG A;  1IC7 Y;  1CV5 A;  3RZ4 A;  4ANR A;  1JTT L;  1LYE A;  4GCD A;  5IHG A;  2BQJ A;  1IWV A;  114L A;  1C6M A;  1CV3 A;  4LYC A;  3HAO A;  178L A;  4RDS A;  1GFV A;  3AYQ A;  5B35 A;  4YEM A;  2A4T A;  3WUN A;  1L63 A;  4O34 A;  4ARM B;  4NHQ A;  4TSB A;  4HTN A;  1QKO A;  1P46 A;  2ZIL A;  2Z37 A;  2YCY A;  1L69 A;  3LYM A;  2NTH A;  1GXV 2;  3HAS A;  1ZYT A;  1YAN A;  5C6L A;  3LHM A;  4KNF A;  1GF3 A;  2F2Q A;  4NY5 A;  1MLC E;  2HUK A;  1WTH A;  3X3C A;  103L A;  4ARQ B;  4ARM A;  1LCN A;  1P64 A;  3OJP A;  1QSW A;  5H2M A;  3LYO A;  1C8S A;  3UG9 A;  3TXE A;  3QJU B;  1NHB A;  3C7Z A;  3F8V A;  4NGV A;  3WUL A;  111L A;  1BB4 A;  1P7S A;  4W56 A;  4W57 A;  5DL9 A;  1LKR A;  1GE1 A;  1P8H A;  1D9U A;  3IWR A;  3NS0 A;  4I7O A;  1FLU A;  1GAZ A;  4ARQ A;  1ALC A;  1BM1 A;  1L55 A;  4N1C C;  4UG2 A;  1EQ4 A;  1IWT A;  4YEN A;  1P37 A;  3WU9 A;  1D3M A;  3AYM A;  5KJ9 A;  1LSY A;  3A91 A;  1X0K 1;  1L28 A;  1LSA A;  219L A;  1C6J A;  1B5X A;  1JHL A;  3P65 A;  5E4P A;  1GF6 A;  1QTZ A;  3ODU A;  1G7I C;  4XAD A;  2DQH Y;  1QUD A;  2Z38 A;  3B0K A;  112L A;  3QJQ B;  2X72 A;  2DKV A;  107L A;  1JKB A;  118L A;  4XT1 A;  1QUT A;  3D4S A;  2LYO A;  1HF4 A;  1CU3 A;  1DI4 A;  3CT5 A;  1WQR A;  5EBH A;  1LGW A;  1WQO A;  2YSS C;  181L A;  1L09 A;  1BVX A;  1B7Q A;  3AGG G;  1LZ9 A;  4YOP A;  4GP5 B;  1BHZ A;  2RBN A;  3L64 A;  5KKJ A;  2R4R A;  236L A;  3CSZ A;  1G0M A;  1GB9 A;  3A92 A;  3V2W A;  4GCB A;  4LYO A;  3WPL A;  1GAY A;  1J1X Y;  4DD1 A;  1QHJ A;  1T6H A;  3KJ6 A;  1QSA A;  4HV1 A;  1T6V L;  1NBZ C;  1NF5 A;  1JKA A;  1WQN A;  4EJ4 A;  4EXM A;  1IP1 A;  4ET8 A;  140L A;  1L89 A;  1L25 A;  133L A;  5FJG A;  5LA8 A;  1T97 A;  1C6A A;  1NWG A;  5F8U A;  3HT8 A;  1IP7 A;  5DM9 A;  1HEQ A;  4OWC A;  4RW2 A;  1L43 A;  137L A;  4IB4 A;  113L A;  1XEJ A;  5C6J A;  2DQC Y;  1KIP C;  2I6Z A;  4DDC A;  3EMS A;  1WQP A;  1CUP A;  210L A;  4G4C A;  4DT3 A;  1LKS A;  251L A;  1L76 A;  1LZB A;  1C6F A;  4H9C A;  5I5Q A;  1JPO A;  243L A;  5LVI A;  3T6U A;  160L A;  3DN1 A;  1LSE A;  2G4Q A;  1L97 A;  221L A;  5KXL A;  186L A;  1L54 A;  5APF A;  3COD A;  5DHH A;  2Y03 A;  1G0J A;  8LYZ A;  3RNX A;  3AYN A;  4ETA A;  5D5C A;  3UZA A;  197L A;  1L64 A;  1SX7 A;  1P5C A;  5DHG A;  4CFP A;  4W94 A;  1KXW A;  1C6N A;  3DNA A;  196L A;  5K7O A;  1LMA A;  3C82 A;  1QT8 A;  1LZE A;  3A94 A;  1QUS A;  3QJR B;  2XTH A;  3TMV A;  1KG9 A;  1UBZ A;  2GV0 A;  1CJ7 A;  1CKH A;  1WQM A;  3C9M A;  1NKH A;  4OWB A;  1L70 A;  1G1W A;  147L A;  1B5W A;  1XJU A;  119L A;  3CT1 A;  3CDV A;  1M0K A;  4PJ2 C;  1REY A;  1JWR A;  4QY9 A;  1C6D A;  5JEN B;  4DKL A;  3BVD B;  108L A;  4G70 B;  3UON A;  2NTW A;  5KXT A;  3C80 A;  3SB8 A;  2RB2 X;  5A3Z A;  2QAR C;  1JJ0 A;  1RI8 B;  4PPO A;  1BB5 A;  1IOQ A;  171L A;  232L A;  2ZIY A;  4NHI A;  5HMJ A;  5A3E A;  4MST A;  1XJT A;  3BKH A;  3CSR A;  3W6F A;  5II3 A;  1L11 A;  2B70 A;  2BLY A;  141L A;  1GFT A;  1LJK A;  4HTK A;  1GD6 A;  246L A;  1IWX A;  1LW9 A;  3W6E A;  2BRD A;  4H9A A;  7LZM A;  5L9J A;  5AZD A;  1C6B A;  4II8 A;  1T8A A;  4MCK A;  5AWZ A;  230L A;  2VB1 A;  1JQU A;  2F32 A;  142L A;  1LZN A;  2YDV A;  5JJE A;  4Z41 A;  4WL6 A;  4BAF A;  1OUJ A;  1UC0 A;  1L41 A;  2G4P A;  3P64 A;  1GE2 A;  1CU5 A;  5G2D A;  1IOS A;  3T36 A;  1L27 A;  4NIJ A;  2Z73 A;  3HH6 A;  3HBE X;  1L50 A;  125L A;  247L A;  3EXD A;  1D3N A;  4BEY A;  3K2R A;  176L A;  1CX6 A;  4AMI A;  5B2N A;  4CFO A;  1GU8 A;  1IY4 A;  1JSE A;  3G3W A;  4GCE A;  3ZEK A;  4OO9 A;  1GF4 A;  4G7S B;  2YBL A;  2I21 A;  2W1X A;  2F95 A;  5I4W A;  1EPY A;  1L16 A;  4WW3 A;  1C6I A;  255L A;  2NTU A;  4YEO A;  3WXT A;  1L66 A;  5LIN A;  2A7D A;  1D3J A;  4Y9H A;  4BAP A;  4ETB A;  1GF7 A;  4FBZ A;  1TN0 A;  3GUJ A;  3LZ2 A;  3QBI A;  223L A;  153L A;  4HV2 A;  2HUM A;  1WTN A;  4NHT A;  1L32 A;  1RE2 A;  1T8G A;  3B6L A;  1C45 A;  1GEV A;  1NQI A;  1C6C A;  1LGX A;  1XFP L;  234L A;  2MEI A;  4G71 B;  1SSW A;  4KPM A;  1L36 A;  1LZY A;  3HU9 A;  1ZWN A;  1L04 A;  1QTE A;  3WXU A;  3GUL A;  3ATO A;  1B6I A;  3M18 B;  4H8Z A;  2I35 A;  1L02 A;  5JJN A;  1C6P A;  3EH5 B;  5B1G A;  4DQ5 A;  5HLL A;  1VJM A;  4BWB A;  1L14 A;  1LMP A;  256L A;  3OE6 A;  1D3F A;  3TXB A;  1OUF A;  2OE4 X;  4XTO A;  3CT0 A;  1B7P A;  1Z55 A;  1HSX A;  4A4M A;  3SBA A;  4NSJ A;  4JQ6 A;  1L40 A;  4I7M A;  3G3X A;  2L78 A;  1FBB A;  1IP3 A;  3EBA B;  250L A;  4YM8 A;  5C6I A;  2OE9 X;  1IOT A;  4NSH A;  1G7J C;  2RBO A;  4B0D A;  1G0L A;  2OTY X;  3TXH A;  4YF2 A;  4PK0 A;  1BB7 A;  130L A;  1I6S A;  3DMX A;  1CV0 A;  1V7S A;  4HYX A;  1BRR A;  3S8G B;  2HUL A;  1INU A;  5KXS A;  1OYU A;  1L61 A;  1I20 A;  149L A;  2D4K A;  2Z12 A;  4BV0 A;  1L79 A;  4BEZ A;  1NHE A;  4B4I A;  5H2P A;  3HBH A;  2RAY X;  5A45 A;  4FDY A;  1XEP A;  1G1V A;  180L A;  4GN4 A;  1L92 A;  1PQI A;  2DQI Y;  1BVK C;  4YXA C;  1YQV Y;  3AM6 A;  1L58 A;  2BQB A;  1QTC A;  244L A;  3AGI A;  126L A;  1UA6 Y;  1GB8 A;  4FJR A;  1MGY A;  1WVU A;  4XEN A;  1UAZ A;  3WW6 A;  2OU8 A;  1GE3 A;  5FEK A;  1H87 A;  4QDN A;  1YRO A;  2BQC A;  3QBL A;  4NHP A;  1B9O A;  1L01 A;  4I7S A;  3DKE X;  1YAO A;  9LYZ A;  1C3W A;  1EQ5 A;  3QDC A;  2I26 L;  3VG9 A;  1B0D A;  1HC0 A;  2ZFE A;  4N5R A;  4WM4 A;  1H6M A;  2YDG A;  4WO6 A;  109L A;  2F4A A;  3C7Y A;  3LYZ A;  174L A;  207L A;  1L93 A;  1XEI A;  1DYG A;  1LSP A;  3G3V A;  5LYM A;  1IC4 Y;  5KXZ A;  4M6D A;  4JR8 A;  1C08 C;  1L74 A;  5A8E A;  3A93 A;  4MQT A;  199L A;  3C7W A;  1CV6 A;  5B59 A;  5KXK A;  3HT6 A;  4ARJ A;  228L A;  5LVG A;  1L77 A;  1KG8 A;  4LGK A;  3LN2 A;  2Z18 A;  1C6G A;  2BPU A;  1G06 A;  1H68 A;  1LZ4 A;  5B1F A;  3AB6 A;  1W6Z A;  206L A;  4PRU A;  1L53 A;  1LYI A;  4H9I A;  226L A;  3ZPR A;  2HEF A;  1PQK A;  4H92 A;  4NC3 A;  5G2A A;  3T45 A;  1JSF A;  1LMT A;  4XJG A;  2HED A;  3AZ5 A;  1MEL L;  2O7A A;  4C5F A;  5AHY A;  4TTD A;  4NGI A;  5DN5 A;  3D9A C;  4LDL A;  5LIO A;  1L34 A;  1AT6 A;  1FN5 A;  1L68 A;  177L A;  1PXR A;  1L42 A;  4NG8 A;  1OVJ A;  1A4V A;  1PQD A;  3HFM Y;  5J7C A;  148L E;  1GUE A;  4W51 A;  175L A;  1IR9 A;  5E9R A;  145L A;  1KW5 A;  1GFU A;  1JTN A;  3HTF A;  1L75 A;  239L A;  1UIH A;  4WMG A;  1L05 A;  1L65 A;  4WLT A;  4DS7 E;  5B06 A;  4WLY A;  1IW6 A;  1B5Z A;  3GXR A;  1CUQ A;  4LFX A;  3WPK A;  218L A;  4NG1 A;  2Q9D A;  1L84 A;  1UIF A;  1HHL A;  4MD2 A;  4I7P A;  1LZ5 A;  1L98 A;  3HH3 A;  1LZA A;  5FCP A;  2LYZ A;  4MQS A;  158L A;  1D0L A;  1JIY A;  3HUK A;  5B0W A;  3TXG A;  4GYC A;  1GFH A;  1QS9 A;  3AW7 A;  2OEA X;  1SQ2 L;  240L A;  1L24 A;  4NHS A;  1CJ8 A;  4I7L A;  1GFG A;  1GF9 A;  1C7P A;  5L3I A;  3OE0 A;  3LYT A;  1E8L A;  4J4Q A;  4C3W A;  2MEH A;  166L A;  1LSB A;  1L38 A;  4WM6 A;  3C81 A;  1C67 A;  3WW5 A;  1IR8 A;  4E97 A;  2AT9 A;  3K3T A;  3FE0 A;  5KXW A;  1KIR C;  1T8F A;  4MBS A;  4XN6 A;  1DI5 A;  1OUH A;  4X1H A;  3L2X A;  248L A;  4L41 A;  2BQM A;  3C83 A;  4XYY A;  1L67 A;  2B6T A;  4G7Q B;  1GBO A;  4CJ2 A;  1JTM A;  3EML A;  1LJN A;  1GF8 A;  1LLH A;  1P36 A;  1L57 A;  4BAD A;  2KSY A;  4MD1 A;  1N4F A;  1WVV A;  5KXR A;  4NGY A;  3WQJ A;  4WM3 A;  5I14 A;  214L A;  1LI6 A;  3B0I A;  1I1Z A;  1F6R A;  2RAZ X;  2BAA A;  4EPI A;  3ZEV A;  1QTK A;  1A2Y C;  1VDP A;  2D4J A;  2YBH A;  184L A;  3WH1 A;  5F16 A;  1ZMY L;  2IFF Y;  4DD3 A;  1EHK B;  1QTB A;  1RJC B;  1M0L A;  1FKQ A;  3C8R A;  198L A;  3SP3 A;  5G54 A;  1XGQ C;  3NYA A;  1P2L A;  4I0C A;  1JTP L;  4B4E A;  3WUA A;  1OUC A;  1LTM A;  253L A;  4QRY A;  1M0M A;  5KXY A;  3RU5 A;  4D9Z A;  2HTX A;  212L A;  3HDE A;  4IAT A;  1NDG C;  1DQJ C;  2D91 A;  4LFP A;  5KXX A;  4N8Z A;  4WO9 A;  241L A;  2OTZ X;  4GBR B;  1XGR C;  2HU3 A;  2DQE Y;  155L A;  3NY8 A;  2G87 A;  1L88 A;  1L83 A;  1L44 A;  1C46 A;  1HEO A;  4LT0 A;  4XJD A;  4ET9 A;  1JJ3 A;  1LYO A;  5B6X A;  1GB3 A;  4GBR A;  2RBR A;  1DZB X;  1S52 A;  4KXI A;  1LYZ A;  5BR5 A;  1LYD A;  4XXJ A;  5ITE A;  1FLW A;  1CU6 A;  1L85 A;  1R2N A;  2C8O A;  2F30 A;  1GDW A;  3SB5 A;  1HMK A;  5FEL A;  1UID A;  4N4Y B;  1UAC Y;  4LT1 A;  1LZS A;  1IWZ A;  1GB6 A;  4H93 A;  4LYT A;  4DQJ A;  1L06 A;  3RUN A;  1BWI A;  4NGO A;  4I7K A;  146L A;  1L31 A;  1X0I 1;  3VGA A;  1OUD A;  1KY1 A;  1CJ9 A;  1K28 A;  262L A;  3WL2 A;  3GUP A;  1GBX A;  3G3B B;  200L A;  3HDF A;  1DYB A;  1L37 A;  1L90 A;  2CUU A;  1Q5J A;  1L71 A;  1GE0 A;  4J7V A;  4XJB A;  1LZD A;  1QT7 A;  4NSG A;  2YCW A;  2EIZ C;  4J0L A;  2WAR A;  2YBN A;  1LWG A;  1IXF A;  3P4Z A;  2XBR A;  4LDO A;  3VWO A;  4ZEE A;  1X0S A;  1CJ6 A;  1XGT C;  1LZG A;  1GWD A;  4GLV A;  4DD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...